3UQEA

Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
307
Chain Sequence
MVRIYTLTLAPSLDSATITPQIDPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQRLCSHDDTQKIYAYLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E. coli PFK2 mutant Y23D
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-phosphofructokinase isozyme 2
total genus 95
structure length 307
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3uqeA00
3Q1YA 3UMOA 2I6AA 3LHXA 1TD2A 5TQIA 4EUMA 4E3AA 1V1SA 1UA4A 3N1CA 3NBWA 1LIKA 1LHPA 3NM1A 2XTBA 3VASA 2HQQA 4B8RA 5CGAA 1RFTA 4XF6A 3RQHA 4KAHA 2DCNA 4K8KA 3RM5A 3NL5A 4DU5A 5C41A 3RU2A 2JG1A 4S1MA 2DDWA 1C3QA 2AX3A 4YWRA 2C4EA 3UBOA 3H49A 3EWMA 3NCAA 3JULA 4LBGA 3W4SA 4K93A 1RKAA 2I6BA 5C40A 3GO6A 1TZ3A 3UQ9A 1GQTA 5EYNA 3HPDA 2VARA 3RSGA 2JGVA 3RRBA 3B1NA 2R3EA 1BX4A 3KZHA 3QA2A 4K9IA 2Q5RA 4WJMA 3RPHA 3RRFA 4YL5A 3RTAA 4K9CA 4B8SA 3IE7A 3RQ5A 4DC3A 4KALA 5CM5A 2AB8A 3LKIA 1L2LA 4KANA 3CQDA 4K8CA 3RQ6A 3RTBA 2PKFA 3LJSA 3ZS7A 3RREA 1LIJA 1UB0A 1EKQA 2JG5A 2NWHA 1U2XA 2QHPA 1VM7A 2YXUA 3IBQA 4LC4A 3RO4A 3RQXA 1TZ6A 3LOOA 5C3ZA 4C5JA 3MBHA 3RQ8A 2PKKA 3RS8A 5BYDA 2AFBA 1JXHA 1VK4A 2AJPA 2F7KA 2HLZA 3B1PA 4C5LA 2RBCA 4EOHA 5B6AA 5CGEA 2V78A 5F11A 1RKSA 2R3BA 3RQQA 1KYHA 1ESQA 3GBUA 5BYFA 4O1LA 1LIOA 4X8FA 1LIIA 3RPZA 4EN4A 4UBEA 3FHYA 3NL6A 3I3YA 2F02A 3BF5A 2A9ZA 3VAQA 1DGMA 3RRJA 3RY7A 5C3YA 2YXTA 1ESJA 2PKMA 3UQDA 3KTNA 3NC9A 1V19A 4C5NA 3NC2A 3K9EA 4XCKA 3RSFA 4S1HA 5COJA 5F0ZA 4E84A 4C5KA 2AJRA 4LCAA 3KEUA 3B1OA 3KD6A 1V1BA 5TRWA 4E8ZA 2DDOA 3RT9A 4E8YA 3IH0A 4S1IB 3K5WA 4N09A 3HICA 3DRWA 4LBXA 3UMPA 3GO7A 4O1GA 3RQ2A 5BYCA 5BYEA 2ABSA 2A9YA 3UQ6A 4PVVA 1YGKA 1RFUA 3OTXA 3UQEA 3RTEA 3NBVA 1YHJA 3IKHA 3Q92A 3MBJA 2AWDA 4JKUA 4K8TA 4JJPA 1VI9A 2PKNA 3NL2A 4KADA 5EY7A 3QAIA 3DZVA 3HYOA 3H74A 4K8PA 1TYYA 3PZSA 1RKDA 1YGJA 2ABQA 3RTDA 2FV7A 3FHXA 4E69A 4C5MA 4JKSA 2I5BA 1RFVA 3B1QA 3B1RA 3NL3A 4N08A 3RSSA 2HW1A 4XF7A 3PL2A 2DDMA 4U7XA 3RT7A 1V1AA 4KBEA 4S1IA 3BGKA 3IN1A 1EKKA 3B3LA 1LHRA 3NM3A 1WYEA 2C49A 1GC5A 3IQ0A 1RK2A 3RTGA 4E8WA 3RS9A 4XDAA 1JXIA 3RSQA 2QCVA 3RTCA 3RU3A 4EBUA 2AA0A 4GM6A
chains in the Genus database with same CATH superfamily
3Q1YA 3UMOA 2I6AA 4K8TA 3LHXA 1TD2A 4JKUA 2F00A 5TQIA 4EUMA 3N2AA 4E3AA 1V1SA 1UA4A 3N1CA 1E0DA 1EEHA 1LIKA 1LHPA 2XTBA 3NBWA 3NM1A 2HQQA 3VASA 4B8RA 5CGAA 1RFTA 4XF6A 3PYZA 3RQHA 4KAHA 2DCNA 4K8KA 3RM5A 3NL5A 4CVKA 4DU5A 3RU2A 2JG1A 4S1MA 5C41A 2DDWA 1C3QA 2AX3A 4YWRA 2C4EA 3UBOA 2GC6A 3H49A 3EWMA 3NCAA 3JULA 4LBGA 3W4SA 4K93A 1RKAA 2I6BA 3LK7A 3GO6A 5C40A 1TZ3A 3UQ9A 1GQTA 5EYNA 3HPDA 3ZM6A 2VARA 3RSGA 2JGVA 3RRFA 3RRBA 3B1NA 2R3EA 1BX4A 3KZHA 3QA2A 4K9IA 2Q5RA 2AM2A 2UAGA 4WJMA 1O5ZA 4YL5A 4K9CA 3RPHA 3IE7A 3RQ5A 4DC3A 2GCBA 2JFGA 4KALA 3QCZA 2AB8A 3EAGA 5CM5A 2VOSA 3LKIA 4C13A 1L2LA 4KANA 3CQDA 1P31A 4K8CA 4HV4A 4ZIYA 3RQ6A 3RTBA 4B8SA 2PKFA 2Y66A 3LJSA 3ZS7A 3RREA 1LIJA 1UB0A 1EKQA 2JG5A 2NWHA 1U2XA 2QHPA 1GG4A 1VM7A 1JBWA 1W7KA 2YXUA 3IBQA 1TZ6A 3LOOA 3RQXA 4C5JA 5BYFA 3MBHA 3RQ8A 2PKKA 3RS8A 5BYDA 2AFBA 1JXHA 1VK4A 2AJPA 2F7KA 2HLZA 3B1PA 4C5LA 2RBCA 4EOHA 5B6AA 5CGEA 2V78A 5F11A 1RKSA 2JFFA 2R3BA 3RQQA 1KYHA 1JBVA 1ESQA 3GBUA 4O1LA 1LIOA 2X5OA 4QF5A 1LIIA 4X8FA 3RPZA 4UBEA 4CVMA 1W78A 4EN4A 3FHYA 3NL6A 3RO4A 3I3YA 2XJAA 2F02A 3BF5A 2A9ZA 3VAQA 1UAGA 1DGMA 1FGSA 4UAGA 3RRJA 3RTAA 3RY7A 5C3YA 2WTZA 1ESJA 2PKMA 2YXTA 3KTNA 4CVLA 3NC9A 1V19A 4C5NA 3UQDA 3NC2A 3K9EA 4XCKA 3RSFA 4S1HA 5COJA 3HJ6A 5F0ZA 4E84A 4C5KA 2AJRA 2VORA 4LCAA 3KEUA 2VTDA 3B1OA 3KD6A 1V1BA 5TRWA 4E8ZA 5A5EA 2DDOA 1GQQA 3RT9A 4E8YA 3IH0A 4S1IB 4C12A 3K5WA 4N09A 4LC4A 3HICA 3DRWA 4LBXA 3UMPA 3GO7A 4O1GA 3RQ2A 5BYCA 5BYEA 2ABSA 2A9YA 3UQ6A 4PVVA 1YGKA 1RFUA 3OTXA 1GQYA 3HN7A 3UQEA 3RTEA 4BUBA 3NBVA 1YHJA 3IKHA 3Q92A 2AM1A 2AWDA 3MBJA 3NRSA 4JJPA 1VI9A 2PKNA 2Y1OA 3NL2A 4KADA 5EY7A 5A5FA 3UAGA 3QAIA 3ZL8A 3DZVA 3HYOA 3H74A 4K8PA 1TYYA 3PZSA 1RKDA 1YGJA 2ABQA 3RTDA 4E8WA 2FV7A 3FHXA 4E69A 4C5MA 4JKSA 2UUPA 2UUOA 2GCAA 2I5BA 1RFVA 1P3DA 2WJPA 3B1QA 3B1RA 3NL3A 4N08A 2GC5A 4BUCA 3RSSA 2HW1A 4XF7A 3PL2A 2DDMA 2XPCA 4U7XA 2Y67A 3RT7A 2JFHA 4QDIA 5C3ZA 1V1AA 4KBEA 4S1IA 3BGKA 2VTEA 3IN1A 1EKKA 3B3LA 1LHRA 3NM3A 1E8CA 1WYEA 3ZM5A 2C49A 1GC5A 3IQ0A 1RK2A 3RTGA 2Y68A 3RS9A 4XDAA 1JXIA 3RSQA 2QCVA 1J6UA 3RTCA 3RU3A 2AA0A 4EBUA 4GM6A
chains in the Genus database with same CATH topology
3Q1YA 3UMOA 2I6AA 3LHXA 1TD2A 5TQIA 4EUMA 4E3AA 1V1SA 1UA4A 3N1CA 3NBWA 1LIKA 1LHPA 3NM1A 2XTBA 3VASA 2HQQA 4B8RA 5CGAA 1RFTA 4XF6A 3RQHA 4KAHA 2DCNA 4K8KA 3RM5A 3NL5A 4DU5A 5C41A 3RU2A 2JG1A 4S1MA 2DDWA 1C3QA 2AX3A 4YWRA 2C4EA 3UBOA 3H49A 3EWMA 3NCAA 3JULA 4LBGA 3W4SA 4K93A 1RKAA 2I6BA 5C40A 3GO6A 1TZ3A 3UQ9A 1GQTA 5EYNA 3HPDA 2VARA 3RSGA 2JGVA 3RRBA 3B1NA 2R3EA 1BX4A 3KZHA 3QA2A 4K9IA 2Q5RA 4WJMA 3RPHA 3RRFA 4YL5A 3RTAA 4K9CA 4B8SA 3IE7A 3RQ5A 4DC3A 4KALA 5CM5A 2AB8A 3LKIA 1L2LA 4KANA 3CQDA 4K8CA 3RQ6A 3RTBA 2PKFA 3LJSA 3ZS7A 3RREA 1LIJA 1UB0A 1EKQA 2JG5A 2NWHA 1U2XA 2QHPA 1VM7A 2YXUA 3IBQA 4LC4A 3RO4A 3RQXA 1TZ6A 3LOOA 5C3ZA 4C5JA 3MBHA 3RQ8A 2PKKA 3RS8A 5BYDA 2AFBA 1JXHA 1VK4A 2AJPA 2F7KA 2HLZA 3B1PA 4C5LA 2RBCA 4EOHA 5B6AA 5CGEA 2V78A 5F11A 1RKSA 2R3BA 3RQQA 1KYHA 1ESQA 3GBUA 5BYFA 4O1LA 1LIOA 4X8FA 1LIIA 3RPZA 4EN4A 4UBEA 3FHYA 3NL6A 3I3YA 2F02A 3BF5A 2A9ZA 3VAQA 1DGMA 3RRJA 3RY7A 5C3YA 2YXTA 1ESJA 2PKMA 3UQDA 3KTNA 3NC9A 1V19A 4C5NA 3NC2A 3K9EA 4XCKA 3RSFA 4S1HA 5COJA 3HJ6A 5F0ZA 4E84A 4C5KA 2AJRA 4LCAA 3KEUA 3B1OA 3KD6A 1V1BA 5TRWA 4E8ZA 2DDOA 3RT9A 4E8YA 3IH0A 4S1IB 3K5WA 4N09A 3HICA 3DRWA 4LBXA 3UMPA 3GO7A 4O1GA 3RQ2A 5BYCA 5BYEA 2ABSA 2A9YA 3UQ6A 4PVVA 1YGKA 1RFUA 3OTXA 3UQEA 3RTEA 3NBVA 1YHJA 3IKHA 3Q92A 3MBJA 2AWDA 4JKUA 4K8TA 4JJPA 1VI9A 2PKNA 3NL2A 4KADA 5EY7A 3QAIA 3DZVA 3HYOA 3H74A 4K8PA 1TYYA 3PZSA 1RKDA 1YGJA 2ABQA 3RTDA 2FV7A 3FHXA 4E69A 4C5MA 4JKSA 2I5BA 1RFVA 3B1QA 3B1RA 3NL3A 4N08A 3RSSA 2HW1A 4XF7A 3PL2A 2DDMA 4U7XA 3RT7A 1V1AA 4KBEA 4S1IA 3BGKA 3IN1A 1EKKA 3B3LA 1LHRA 3NM3A 1WYEA 2C49A 1GC5A 3IQ0A 1RK2A 3RTGA 4E8WA 3RS9A 4XDAA 1JXIA 3RSQA 2QCVA 3RTCA 3RU3A 4EBUA 2AA0A 4GM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q1Y A;  3UMO A;  2I6A A;  3LHX A;  1TD2 A;  5TQI A;  4EUM A;  4E3A A;  1V1S A;  1UA4 A;  3N1C A;  3NBW A;  1LIK A;  1LHP A;  3NM1 A;  2XTB A;  3VAS A;  2HQQ A;  4B8R A;  5CGA A;  1RFT A;  4XF6 A;  3RQH A;  4KAH A;  2DCN A;  4K8K A;  3RM5 A;  3NL5 A;  4DU5 A;  5C41 A;  3RU2 A;  2JG1 A;  4S1M A;  2DDW A;  1C3Q A;  2AX3 A;  4YWR A;  2C4E A;  3UBO A;  3H49 A;  3EWM A;  3NCA A;  3JUL A;  4LBG A;  3W4S A;  4K93 A;  1RKA A;  2I6B A;  5C40 A;  3GO6 A;  1TZ3 A;  3UQ9 A;  1GQT A;  5EYN A;  3HPD A;  2VAR A;  3RSG A;  2JGV A;  3RRB A;  3B1N A;  2R3E A;  1BX4 A;  3KZH A;  3QA2 A;  4K9I A;  2Q5R A;  4WJM A;  3RPH A;  3RRF A;  4YL5 A;  3RTA A;  4K9C A;  4B8S A;  3IE7 A;  3RQ5 A;  4DC3 A;  4KAL A;  5CM5 A;  2AB8 A;  3LKI A;  1L2L A;  4KAN A;  3CQD A;  4K8C A;  3RQ6 A;  3RTB A;  2PKF A;  3LJS A;  3ZS7 A;  3RRE A;  1LIJ A;  1UB0 A;  1EKQ A;  2JG5 A;  2NWH A;  1U2X A;  2QHP A;  1VM7 A;  2YXU A;  3IBQ A;  4LC4 A;  3RO4 A;  3RQX A;  1TZ6 A;  3LOO A;  5C3Z A;  4C5J A;  3MBH A;  3RQ8 A;  2PKK A;  3RS8 A;  5BYD A;  2AFB A;  1JXH A;  1VK4 A;  2AJP A;  2F7K A;  2HLZ A;  3B1P A;  4C5L A;  2RBC A;  4EOH A;  5B6A A;  5CGE A;  2V78 A;  5F11 A;  1RKS A;  2R3B A;  3RQQ A;  1KYH A;  1ESQ A;  3GBU A;  5BYF A;  4O1L A;  1LIO A;  4X8F A;  1LII A;  3RPZ A;  4EN4 A;  4UBE A;  3FHY A;  3NL6 A;  3I3Y A;  2F02 A;  3BF5 A;  2A9Z A;  3VAQ A;  1DGM A;  3RRJ A;  3RY7 A;  5C3Y A;  2YXT A;  1ESJ A;  2PKM A;  3UQD A;  3KTN A;  3NC9 A;  1V19 A;  4C5N A;  3NC2 A;  3K9E A;  4XCK A;  3RSF A;  4S1H A;  5COJ A;  5F0Z A;  4E84 A;  4C5K A;  2AJR A;  4LCA A;  3KEU A;  3B1O A;  3KD6 A;  1V1B A;  5TRW A;  4E8Z A;  2DDO A;  3RT9 A;  4E8Y A;  3IH0 A;  4S1I B;  3K5W A;  4N09 A;  3HIC A;  3DRW A;  4LBX A;  3UMP A;  3GO7 A;  4O1G A;  3RQ2 A;  5BYC A;  5BYE A;  2ABS A;  2A9Y A;  3UQ6 A;  4PVV A;  1YGK A;  1RFU A;  3OTX A;  3UQE A;  3RTE A;  3NBV A;  1YHJ A;  3IKH A;  3Q92 A;  3MBJ A;  2AWD A;  4JKU A;  4K8T A;  4JJP A;  1VI9 A;  2PKN A;  3NL2 A;  4KAD A;  5EY7 A;  3QAI A;  3DZV A;  3HYO A;  3H74 A;  4K8P A;  1TYY A;  3PZS A;  1RKD A;  1YGJ A;  2ABQ A;  3RTD A;  2FV7 A;  3FHX A;  4E69 A;  4C5M A;  4JKS A;  2I5B A;  1RFV A;  3B1Q A;  3B1R A;  3NL3 A;  4N08 A;  3RSS A;  2HW1 A;  4XF7 A;  3PL2 A;  2DDM A;  4U7X A;  3RT7 A;  1V1A A;  4KBE A;  4S1I A;  3BGK A;  3IN1 A;  1EKK A;  3B3L A;  1LHR A;  3NM3 A;  1WYE A;  2C49 A;  1GC5 A;  3IQ0 A;  1RK2 A;  3RTG A;  4E8W A;  3RS9 A;  4XDA A;  1JXI A;  3RSQ A;  2QCV A;  3RTC A;  3RU3 A;  4EBU A;  2AA0 A;  4GM6 A; 
#chains in the Genus database with same CATH topology
 3Q1Y A;  3UMO A;  2I6A A;  4K8T A;  3LHX A;  1TD2 A;  4JKU A;  2F00 A;  5TQI A;  4EUM A;  3N2A A;  4E3A A;  1V1S A;  1UA4 A;  3N1C A;  1E0D A;  1EEH A;  1LIK A;  1LHP A;  2XTB A;  3NBW A;  3NM1 A;  2HQQ A;  3VAS A;  4B8R A;  5CGA A;  1RFT A;  4XF6 A;  3PYZ A;  3RQH A;  4KAH A;  2DCN A;  4K8K A;  3RM5 A;  3NL5 A;  4CVK A;  4DU5 A;  3RU2 A;  2JG1 A;  4S1M A;  5C41 A;  2DDW A;  1C3Q A;  2AX3 A;  4YWR A;  2C4E A;  3UBO A;  2GC6 A;  3H49 A;  3EWM A;  3NCA A;  3JUL A;  4LBG A;  3W4S A;  4K93 A;  1RKA A;  2I6B A;  3LK7 A;  3GO6 A;  5C40 A;  1TZ3 A;  3UQ9 A;  1GQT A;  5EYN A;  3HPD A;  3ZM6 A;  2VAR A;  3RSG A;  2JGV A;  3RRF A;  3RRB A;  3B1N A;  2R3E A;  1BX4 A;  3KZH A;  3QA2 A;  4K9I A;  2Q5R A;  2AM2 A;  2UAG A;  4WJM A;  1O5Z A;  4YL5 A;  4K9C A;  3RPH A;  3IE7 A;  3RQ5 A;  4DC3 A;  2GCB A;  2JFG A;  4KAL A;  3QCZ A;  2AB8 A;  3EAG A;  5CM5 A;  2VOS A;  3LKI A;  4C13 A;  1L2L A;  4KAN A;  3CQD A;  1P31 A;  4K8C A;  4HV4 A;  4ZIY A;  3RQ6 A;  3RTB A;  4B8S A;  2PKF A;  2Y66 A;  3LJS A;  3ZS7 A;  3RRE A;  1LIJ A;  1UB0 A;  1EKQ A;  2JG5 A;  2NWH A;  1U2X A;  2QHP A;  1GG4 A;  1VM7 A;  1JBW A;  1W7K A;  2YXU A;  3IBQ A;  1TZ6 A;  3LOO A;  3RQX A;  4C5J A;  5BYF A;  3MBH A;  3RQ8 A;  2PKK A;  3RS8 A;  5BYD A;  2AFB A;  1JXH A;  1VK4 A;  2AJP A;  2F7K A;  2HLZ A;  3B1P A;  4C5L A;  2RBC A;  4EOH A;  5B6A A;  5CGE A;  2V78 A;  5F11 A;  1RKS A;  2JFF A;  2R3B A;  3RQQ A;  1KYH A;  1JBV A;  1ESQ A;  3GBU A;  4O1L A;  1LIO A;  2X5O A;  4QF5 A;  1LII A;  4X8F A;  3RPZ A;  4UBE A;  4CVM A;  1W78 A;  4EN4 A;  3FHY A;  3NL6 A;  3RO4 A;  3I3Y A;  2XJA A;  2F02 A;  3BF5 A;  2A9Z A;  3VAQ A;  1UAG A;  1DGM A;  1FGS A;  4UAG A;  3RRJ A;  3RTA A;  3RY7 A;  5C3Y A;  2WTZ A;  1ESJ A;  2PKM A;  2YXT A;  3KTN A;  4CVL A;  3NC9 A;  1V19 A;  4C5N A;  3UQD A;  3NC2 A;  3K9E A;  4XCK A;  3RSF A;  4S1H A;  5COJ A;  3HJ6 A;  5F0Z A;  4E84 A;  4C5K A;  2AJR A;  2VOR A;  4LCA A;  3KEU A;  2VTD A;  3B1O A;  3KD6 A;  1V1B A;  5TRW A;  4E8Z A;  5A5E A;  2DDO A;  1GQQ A;  3RT9 A;  4E8Y A;  3IH0 A;  4S1I B;  4C12 A;  3K5W A;  4N09 A;  4LC4 A;  3HIC A;  3DRW A;  4LBX A;  3UMP A;  3GO7 A;  4O1G A;  3RQ2 A;  5BYC A;  5BYE A;  2ABS A;  2A9Y A;  3UQ6 A;  4PVV A;  1YGK A;  1RFU A;  3OTX A;  1GQY A;  3HN7 A;  3UQE A;  3RTE A;  4BUB A;  3NBV A;  1YHJ A;  3IKH A;  3Q92 A;  2AM1 A;  2AWD A;  3MBJ A;  3NRS A;  4JJP A;  1VI9 A;  2PKN A;  2Y1O A;  3NL2 A;  4KAD A;  5EY7 A;  5A5F A;  3UAG A;  3QAI A;  3ZL8 A;  3DZV A;  3HYO A;  3H74 A;  4K8P A;  1TYY A;  3PZS A;  1RKD A;  1YGJ A;  2ABQ A;  3RTD A;  4E8W A;  2FV7 A;  3FHX A;  4E69 A;  4C5M A;  4JKS A;  2UUP A;  2UUO A;  2GCA A;  2I5B A;  1RFV A;  1P3D A;  2WJP A;  3B1Q A;  3B1R A;  3NL3 A;  4N08 A;  2GC5 A;  4BUC A;  3RSS A;  2HW1 A;  4XF7 A;  3PL2 A;  2DDM A;  2XPC A;  4U7X A;  2Y67 A;  3RT7 A;  2JFH A;  4QDI A;  5C3Z A;  1V1A A;  4KBE A;  4S1I A;  3BGK A;  2VTE A;  3IN1 A;  1EKK A;  3B3L A;  1LHR A;  3NM3 A;  1E8C A;  1WYE A;  3ZM5 A;  2C49 A;  1GC5 A;  3IQ0 A;  1RK2 A;  3RTG A;  2Y68 A;  3RS9 A;  4XDA A;  1JXI A;  3RSQ A;  2QCV A;  1J6U A;  3RTC A;  3RU3 A;  2AA0 A;  4EBU A;  4GM6 A; 
#chains in the Genus database with same CATH homology
 3Q1Y A;  3UMO A;  2I6A A;  3LHX A;  1TD2 A;  5TQI A;  4EUM A;  4E3A A;  1V1S A;  1UA4 A;  3N1C A;  3NBW A;  1LIK A;  1LHP A;  3NM1 A;  2XTB A;  3VAS A;  2HQQ A;  4B8R A;  5CGA A;  1RFT A;  4XF6 A;  3RQH A;  4KAH A;  2DCN A;  4K8K A;  3RM5 A;  3NL5 A;  4DU5 A;  5C41 A;  3RU2 A;  2JG1 A;  4S1M A;  2DDW A;  1C3Q A;  2AX3 A;  4YWR A;  2C4E A;  3UBO A;  3H49 A;  3EWM A;  3NCA A;  3JUL A;  4LBG A;  3W4S A;  4K93 A;  1RKA A;  2I6B A;  5C40 A;  3GO6 A;  1TZ3 A;  3UQ9 A;  1GQT A;  5EYN A;  3HPD A;  2VAR A;  3RSG A;  2JGV A;  3RRB A;  3B1N A;  2R3E A;  1BX4 A;  3KZH A;  3QA2 A;  4K9I A;  2Q5R A;  4WJM A;  3RPH A;  3RRF A;  4YL5 A;  3RTA A;  4K9C A;  4B8S A;  3IE7 A;  3RQ5 A;  4DC3 A;  4KAL A;  5CM5 A;  2AB8 A;  3LKI A;  1L2L A;  4KAN A;  3CQD A;  4K8C A;  3RQ6 A;  3RTB A;  2PKF A;  3LJS A;  3ZS7 A;  3RRE A;  1LIJ A;  1UB0 A;  1EKQ A;  2JG5 A;  2NWH A;  1U2X A;  2QHP A;  1VM7 A;  2YXU A;  3IBQ A;  4LC4 A;  3RO4 A;  3RQX A;  1TZ6 A;  3LOO A;  5C3Z A;  4C5J A;  3MBH A;  3RQ8 A;  2PKK A;  3RS8 A;  5BYD A;  2AFB A;  1JXH A;  1VK4 A;  2AJP A;  2F7K A;  2HLZ A;  3B1P A;  4C5L A;  2RBC A;  4EOH A;  5B6A A;  5CGE A;  2V78 A;  5F11 A;  1RKS A;  2R3B A;  3RQQ A;  1KYH A;  1ESQ A;  3GBU A;  5BYF A;  4O1L A;  1LIO A;  4X8F A;  1LII A;  3RPZ A;  4EN4 A;  4UBE A;  3FHY A;  3NL6 A;  3I3Y A;  2F02 A;  3BF5 A;  2A9Z A;  3VAQ A;  1DGM A;  3RRJ A;  3RY7 A;  5C3Y A;  2YXT A;  1ESJ A;  2PKM A;  3UQD A;  3KTN A;  3NC9 A;  1V19 A;  4C5N A;  3NC2 A;  3K9E A;  4XCK A;  3RSF A;  4S1H A;  5COJ A;  3HJ6 A;  5F0Z A;  4E84 A;  4C5K A;  2AJR A;  4LCA A;  3KEU A;  3B1O A;  3KD6 A;  1V1B A;  5TRW A;  4E8Z A;  2DDO A;  3RT9 A;  4E8Y A;  3IH0 A;  4S1I B;  3K5W A;  4N09 A;  3HIC A;  3DRW A;  4LBX A;  3UMP A;  3GO7 A;  4O1G A;  3RQ2 A;  5BYC A;  5BYE A;  2ABS A;  2A9Y A;  3UQ6 A;  4PVV A;  1YGK A;  1RFU A;  3OTX A;  3UQE A;  3RTE A;  3NBV A;  1YHJ A;  3IKH A;  3Q92 A;  3MBJ A;  2AWD A;  4JKU A;  4K8T A;  4JJP A;  1VI9 A;  2PKN A;  3NL2 A;  4KAD A;  5EY7 A;  3QAI A;  3DZV A;  3HYO A;  3H74 A;  4K8P A;  1TYY A;  3PZS A;  1RKD A;  1YGJ A;  2ABQ A;  3RTD A;  2FV7 A;  3FHX A;  4E69 A;  4C5M A;  4JKS A;  2I5B A;  1RFV A;  3B1Q A;  3B1R A;  3NL3 A;  4N08 A;  3RSS A;  2HW1 A;  4XF7 A;  3PL2 A;  2DDM A;  4U7X A;  3RT7 A;  1V1A A;  4KBE A;  4S1I A;  3BGK A;  3IN1 A;  1EKK A;  3B3L A;  1LHR A;  3NM3 A;  1WYE A;  2C49 A;  1GC5 A;  3IQ0 A;  1RK2 A;  3RTG A;  4E8W A;  3RS9 A;  4XDA A;  1JXI A;  3RSQ A;  2QCV A;  3RTC A;  3RU3 A;  4EBU A;  2AA0 A;  4GM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...