3UQEA

Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
307
Chain Sequence
MVRIYTLTLAPSLDSATITPQIDPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFPAGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQLEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGNIELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQVVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQRLCSHDDTQKIYAYLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of E. coli PFK2 mutant Y23D
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-phosphofructokinase isozyme 2
total genus 95
structure length 307
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.11: 6-phosphofructokinase.
pdb deposition date 2011-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00294 PfkB pfkB family carbohydrate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 3uqeA00
5TQIA 3IQ0A 2FV7A 3DRWA 1GC5A 2V78A 3RY7A 3VAQA 1U2XA 3JULA 3UMOA 4S1MA 5CGAA 2NWHA 1KYHA 4E69A 3RQQA 3B1OA 3RQXA 3RRJA 4O1LA 3UMPA 5EYNA 2PKNA 2HLZA 3RS8A 5COJA 3RQ6A 4C5KA 3RTDA 3OTXA 2PKFA 2C49A 1LHPA 4EOHA 1V19A 3NCAA 1VM7A 3KTNA 2QHPA 3RQ5A 2F02A 1RFVA 5C41A 3ZS7A 3K5WA 1V1SA 4C5LA 3UBOA 3HPDA 3RTBA 2AX3A 3NL3A 2AWDA 1ESQA 4LC4A 1ESJA 1YGJA 3RTEA 1JXHA 1YGKA 3Q92A 4C5JA 4K8PA 4KAHA 4E8WA 1TZ3A 3NC2A 4C5NA 3RQ2A 2R3BA 4N09A 4E84A 3RSSA 2ABQA 1JXIA 3RPZA 4KANA 3UQ6A 3EWMA 1VI9A 3LKIA 3RREA 3RSGA 3UQ9A 2RBCA 3NBWA 2HQQA 2Q5RA 3B1PA 2XTBA 2AFBA 3RTAA 3NBVA 5BYDA 4B8SA 1V1BA 3NM1A 4XDAA 1C3QA 3HYOA 3N1CA 3Q1YA 1LIKA 1RFUA 4XCKA 2YXTA 3IN1A 4U7XA 1LIJA 4K9CA 3BGKA 3PZSA 5BYFA 3QA2A 3QAIA 3MBHA 4E8YA 2PKKA 3UQEA 3LOOA 4X8FA 4S1IB 4KALA 3RSQA 3KD6A 4DU5A 1RK2A 1TYYA 2YXUA 3NC9A 4KADA 4LBGA 2R3EA 1TD2A 1BX4A 4S1HA 1YHJA 3IE7A 2A9YA 1RKSA 1UA4A 4EN4A 1LHRA 1EKQA 4E3AA 3RTCA 4K8KA 1L2LA 3NL6A 1RKAA 2I6BA 3GO7A 2AA0A 5B6AA 1EKKA 3KZHA 5F0ZA 3B1NA 4JKUA 3FHXA 3H74A 3IBQA 3K9EA 2JG1A 2DDWA 3B1RA 5C3ZA 5CGEA 3RQHA 4XF6A 3RU2A 3RO4A 2F7KA 3I3YA 3NM3A 3RRBA 3H49A 4JKSA 4EUMA 3HICA 3W4SA 2I5BA 2PKMA 1GQTA 3GBUA 2DDMA 1DGMA 2HW1A 3CQDA 4YL5A 2JGVA 5BYEA 1VK4A 2C4EA 2VARA 4B8RA 4JJPA 5CM5A 1V1AA 3RSFA 4K8CA 3UQDA 3B3LA 3RRFA 1LIOA 1WYEA 4O1GA 3NL5A 4LCAA 4DC3A 2AJRA 4E8ZA 3PL2A 3RPHA 1RFTA 4UBEA 3RU3A 4PVVA 3FHYA 1TZ6A 3RT7A 5C3YA 1LIIA 3IKHA 4K8TA 5TRWA 3RS9A 1UB0A 3VASA 4YWRA 4GM6A 4KBEA 4C5MA 5C40A 3RT9A 5F11A 4K93A 3RM5A 3B1QA 3RTGA 3GO6A 3IH0A 2AB8A 4N08A 3RQ8A 2DDOA 3BF5A 3KEUA 2QCVA 4EBUA 2AJPA 3LHXA 4S1IA 4WJMA 2I6AA 1RKDA 4K9IA 2ABSA 3DZVA 4LBXA 3NL2A 2DCNA 5EY7A 3LJSA 4XF7A 5BYCA 2A9ZA 2JG5A 3MBJA
chains in the Genus database with same CATH superfamily
5TQIA 3IQ0A 2F00A 2FV7A 3DRWA 1GC5A 2XJAA 2V78A 4QDIA 3RY7A 1U2XA 3JULA 3UMOA 3VAQA 4HV4A 4S1MA 5CGAA 2NWHA 1KYHA 4E69A 2UUPA 3RQQA 3B1OA 3RQXA 3RRJA 2VOSA 1FGSA 4O1LA 3UMPA 5EYNA 2PKNA 2Y68A 3NRSA 2HLZA 3RS8A 1GQYA 2GC6A 3ZM5A 5COJA 3RQ6A 4C5KA 2WTZA 1P31A 1EEHA 3RTDA 3OTXA 2PKFA 2C49A 1LHPA 4EOHA 1V19A 3NCAA 1VM7A 3KTNA 2QHPA 3RQ5A 2F02A 1RFVA 3UAGA 3ZS7A 3K5WA 1V1SA 5C41A 4C5LA 3UBOA 3HPDA 3RTBA 2AX3A 3NL3A 2AWDA 1ESQA 4LC4A 1ESJA 1YGJA 3RTEA 1JXHA 1YGKA 3PYZA 3Q92A 2JFGA 4K8PA 4KAHA 4E8WA 1TZ3A 3NC2A 4C5NA 1W78A 3EAGA 2R3BA 3RQ2A 4N09A 4E84A 2Y67A 3RSSA 2ABQA 1JXIA 2VTDA 4KANA 3RPZA 3UQ6A 3EWMA 1VI9A 3LKIA 3RREA 3RSGA 3UQ9A 2VORA 2RBCA 3NBWA 2HQQA 2Q5RA 3B1PA 2XTBA 2AFBA 3LK7A 3RTAA 3NBVA 2UAGA 5BYDA 4B8SA 1V1BA 3NM1A 4XDAA 1C3QA 3HYOA 3N1CA 3Q1YA 1LIKA 1RFUA 4QF5A 2YXTA 3IN1A 1O5ZA 4U7XA 1LIJA 4K9CA 3BGKA 3PZSA 5BYFA 3QA2A 3QAIA 3MBHA 4C12A 2PKKA 4E8YA 3UQEA 1P3DA 3LOOA 3N2AA 3HJ6A 4S1IB 4X8FA 4KALA 2AM2A 3KD6A 3RSQA 1RK2A 4DU5A 1TYYA 2YXUA 3NC9A 4KADA 4LBGA 2AM1A 1TD2A 1BX4A 2R3EA 4S1HA 1YHJA 3IE7A 4C13A 2A9YA 1E0DA 1E8CA 1RKSA 1UA4A 4EN4A 1LHRA 1EKQA 4XCKA 3RTCA 4E3AA 4K8KA 1L2LA 3NL6A 1RKAA 2I6BA 3GO7A 2AA0A 1GG4A 5B6AA 1EKKA 3KZHA 2JFHA 5F0ZA 3B1NA 2Y1OA 4JKUA 3FHXA 3H74A 3IBQA 3K9EA 2JG1A 2DDWA 2GC5A 3B1RA 3ZL8A 5C3ZA 2UUOA 3RQHA 4XF6A 2GCAA 3RU2A 1JBVA 3RO4A 2F7KA 3I3YA 3NM3A 3RRBA 3H49A 4JKSA 4EUMA 3HICA 2JFFA 3W4SA 3ZM6A 2I5BA 2PKMA 4ZIYA 4BUBA 1GQTA 3GBUA 2DDMA 1DGMA 2HW1A 3CQDA 4YL5A 2JGVA 5BYEA 1VK4A 1W7KA 2WJPA 2C4EA 2Y66A 4UAGA 2VARA 4B8RA 4JJPA 5CM5A 1V1AA 3RSFA 4K8CA 4CVKA 1J6UA 3B3LA 3RRFA 1LIOA 1WYEA 5CGEA 3HN7A 4O1GA 3NL5A 4LCAA 4CVMA 2AJRA 4DC3A 4E8ZA 1UAGA 3PL2A 3RPHA 1RFTA 4UBEA 3RU3A 4PVVA 3FHYA 1TZ6A 3RT7A 5C3YA 1LIIA 3IKHA 4K8TA 5TRWA 3RS9A 1UB0A 3VASA 4YWRA 4GM6A 4KBEA 4C5MA 5C40A 3RT9A 5F11A 4K93A 3RM5A 3B1QA 3RTGA 1GQQA 3GO6A 5A5EA 3IH0A 2AB8A 4N08A 3QCZA 5A5FA 3UQDA 3RQ8A 2DDOA 3BF5A 3KEUA 2QCVA 4EBUA 4CVLA 2AJPA 3LHXA 4S1IA 2VTEA 2I6AA 1RKDA 4K9IA 4WJMA 4BUCA 2ABSA 2X5OA 3DZVA 2XPCA 4LBXA 2GCBA 3NL2A 2DCNA 5EY7A 3LJSA 4XF7A 4C5JA 5BYCA 1JBWA 2A9ZA 2JG5A 3MBJA
chains in the Genus database with same CATH topology
5TQIA 3IQ0A 2FV7A 3DRWA 1GC5A 2V78A 3RY7A 3VAQA 1U2XA 3JULA 3UMOA 4S1MA 5CGAA 2NWHA 1KYHA 4E69A 3RQQA 3B1OA 3RQXA 3RRJA 4O1LA 3UMPA 5EYNA 2PKNA 2HLZA 3RS8A 5COJA 3RQ6A 4C5KA 3RTDA 3OTXA 2PKFA 2C49A 1LHPA 4EOHA 1V19A 3NCAA 1VM7A 3KTNA 2QHPA 3RQ5A 2F02A 1RFVA 5C41A 3ZS7A 3K5WA 1V1SA 4C5LA 3UBOA 3HPDA 3RTBA 2AX3A 3NL3A 2AWDA 1ESQA 4LC4A 1ESJA 1YGJA 3RTEA 1JXHA 1YGKA 3Q92A 4C5JA 4K8PA 4KAHA 4E8WA 1TZ3A 3NC2A 4C5NA 3RQ2A 2R3BA 4N09A 4E84A 3RSSA 2ABQA 1JXIA 3RPZA 4KANA 3UQ6A 3EWMA 1VI9A 3LKIA 3RREA 3RSGA 3UQ9A 2RBCA 3NBWA 2HQQA 2Q5RA 3B1PA 2XTBA 2AFBA 3RTAA 3NBVA 5BYDA 4B8SA 1V1BA 3NM1A 4XDAA 1C3QA 3HYOA 3N1CA 3Q1YA 1LIKA 1RFUA 4XCKA 2YXTA 3IN1A 4U7XA 1LIJA 4K9CA 3BGKA 3PZSA 5BYFA 3QA2A 3QAIA 3MBHA 4E8YA 2PKKA 3UQEA 3LOOA 3HJ6A 4S1IB 4X8FA 4KALA 3RSQA 3KD6A 4DU5A 1RK2A 1TYYA 2YXUA 3NC9A 4KADA 4LBGA 2R3EA 1TD2A 1BX4A 4S1HA 1YHJA 3IE7A 2A9YA 1RKSA 1UA4A 4EN4A 1LHRA 1EKQA 4E3AA 3RTCA 4K8KA 1L2LA 3NL6A 1RKAA 2I6BA 3GO7A 2AA0A 5B6AA 1EKKA 3KZHA 5F0ZA 3B1NA 4JKUA 3FHXA 3H74A 3IBQA 3K9EA 2JG1A 2DDWA 3B1RA 5C3ZA 5CGEA 3RQHA 4XF6A 3RU2A 3RO4A 2F7KA 3I3YA 3NM3A 3RRBA 3H49A 4JKSA 4EUMA 3HICA 3W4SA 2I5BA 2PKMA 1GQTA 3GBUA 2DDMA 1DGMA 2HW1A 3CQDA 4YL5A 2JGVA 5BYEA 1VK4A 2C4EA 2VARA 4B8RA 4JJPA 5CM5A 1V1AA 3RSFA 4K8CA 3UQDA 3B3LA 3RRFA 1LIOA 1WYEA 4O1GA 3NL5A 4LCAA 4DC3A 2AJRA 4E8ZA 3PL2A 3RPHA 1RFTA 4UBEA 3RU3A 4PVVA 3FHYA 1TZ6A 3RT7A 5C3YA 1LIIA 3IKHA 4K8TA 5TRWA 3RS9A 1UB0A 3VASA 4YWRA 4GM6A 4KBEA 4C5MA 5C40A 3RT9A 5F11A 4K93A 3RM5A 3B1QA 3RTGA 3GO6A 3IH0A 2AB8A 4N08A 3RQ8A 2DDOA 3BF5A 3KEUA 2QCVA 4EBUA 2AJPA 3LHXA 4S1IA 4WJMA 2I6AA 1RKDA 4K9IA 2ABSA 3DZVA 4LBXA 3NL2A 2DCNA 5EY7A 3LJSA 4XF7A 5BYCA 2A9ZA 2JG5A 3MBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TQI A;  3IQ0 A;  2FV7 A;  3DRW A;  1GC5 A;  2V78 A;  3RY7 A;  3VAQ A;  1U2X A;  3JUL A;  3UMO A;  4S1M A;  5CGA A;  2NWH A;  1KYH A;  4E69 A;  3RQQ A;  3B1O A;  3RQX A;  3RRJ A;  4O1L A;  3UMP A;  5EYN A;  2PKN A;  2HLZ A;  3RS8 A;  5COJ A;  3RQ6 A;  4C5K A;  3RTD A;  3OTX A;  2PKF A;  2C49 A;  1LHP A;  4EOH A;  1V19 A;  3NCA A;  1VM7 A;  3KTN A;  2QHP A;  3RQ5 A;  2F02 A;  1RFV A;  5C41 A;  3ZS7 A;  3K5W A;  1V1S A;  4C5L A;  3UBO A;  3HPD A;  3RTB A;  2AX3 A;  3NL3 A;  2AWD A;  1ESQ A;  4LC4 A;  1ESJ A;  1YGJ A;  3RTE A;  1JXH A;  1YGK A;  3Q92 A;  4C5J A;  4K8P A;  4KAH A;  4E8W A;  1TZ3 A;  3NC2 A;  4C5N A;  3RQ2 A;  2R3B A;  4N09 A;  4E84 A;  3RSS A;  2ABQ A;  1JXI A;  3RPZ A;  4KAN A;  3UQ6 A;  3EWM A;  1VI9 A;  3LKI A;  3RRE A;  3RSG A;  3UQ9 A;  2RBC A;  3NBW A;  2HQQ A;  2Q5R A;  3B1P A;  2XTB A;  2AFB A;  3RTA A;  3NBV A;  5BYD A;  4B8S A;  1V1B A;  3NM1 A;  4XDA A;  1C3Q A;  3HYO A;  3N1C A;  3Q1Y A;  1LIK A;  1RFU A;  4XCK A;  2YXT A;  3IN1 A;  4U7X A;  1LIJ A;  4K9C A;  3BGK A;  3PZS A;  5BYF A;  3QA2 A;  3QAI A;  3MBH A;  4E8Y A;  2PKK A;  3UQE A;  3LOO A;  4X8F A;  4S1I B;  4KAL A;  3RSQ A;  3KD6 A;  4DU5 A;  1RK2 A;  1TYY A;  2YXU A;  3NC9 A;  4KAD A;  4LBG A;  2R3E A;  1TD2 A;  1BX4 A;  4S1H A;  1YHJ A;  3IE7 A;  2A9Y A;  1RKS A;  1UA4 A;  4EN4 A;  1LHR A;  1EKQ A;  4E3A A;  3RTC A;  4K8K A;  1L2L A;  3NL6 A;  1RKA A;  2I6B A;  3GO7 A;  2AA0 A;  5B6A A;  1EKK A;  3KZH A;  5F0Z A;  3B1N A;  4JKU A;  3FHX A;  3H74 A;  3IBQ A;  3K9E A;  2JG1 A;  2DDW A;  3B1R A;  5C3Z A;  5CGE A;  3RQH A;  4XF6 A;  3RU2 A;  3RO4 A;  2F7K A;  3I3Y A;  3NM3 A;  3RRB A;  3H49 A;  4JKS A;  4EUM A;  3HIC A;  3W4S A;  2I5B A;  2PKM A;  1GQT A;  3GBU A;  2DDM A;  1DGM A;  2HW1 A;  3CQD A;  4YL5 A;  2JGV A;  5BYE A;  1VK4 A;  2C4E A;  2VAR A;  4B8R A;  4JJP A;  5CM5 A;  1V1A A;  3RSF A;  4K8C A;  3UQD A;  3B3L A;  3RRF A;  1LIO A;  1WYE A;  4O1G A;  3NL5 A;  4LCA A;  4DC3 A;  2AJR A;  4E8Z A;  3PL2 A;  3RPH A;  1RFT A;  4UBE A;  3RU3 A;  4PVV A;  3FHY A;  1TZ6 A;  3RT7 A;  5C3Y A;  1LII A;  3IKH A;  4K8T A;  5TRW A;  3RS9 A;  1UB0 A;  3VAS A;  4YWR A;  4GM6 A;  4KBE A;  4C5M A;  5C40 A;  3RT9 A;  5F11 A;  4K93 A;  3RM5 A;  3B1Q A;  3RTG A;  3GO6 A;  3IH0 A;  2AB8 A;  4N08 A;  3RQ8 A;  2DDO A;  3BF5 A;  3KEU A;  2QCV A;  4EBU A;  2AJP A;  3LHX A;  4S1I A;  4WJM A;  2I6A A;  1RKD A;  4K9I A;  2ABS A;  3DZV A;  4LBX A;  3NL2 A;  2DCN A;  5EY7 A;  3LJS A;  4XF7 A;  5BYC A;  2A9Z A;  2JG5 A;  3MBJ A; 
#chains in the Genus database with same CATH topology
 5TQI A;  3IQ0 A;  2F00 A;  2FV7 A;  3DRW A;  1GC5 A;  2XJA A;  2V78 A;  4QDI A;  3RY7 A;  1U2X A;  3JUL A;  3UMO A;  3VAQ A;  4HV4 A;  4S1M A;  5CGA A;  2NWH A;  1KYH A;  4E69 A;  2UUP A;  3RQQ A;  3B1O A;  3RQX A;  3RRJ A;  2VOS A;  1FGS A;  4O1L A;  3UMP A;  5EYN A;  2PKN A;  2Y68 A;  3NRS A;  2HLZ A;  3RS8 A;  1GQY A;  2GC6 A;  3ZM5 A;  5COJ A;  3RQ6 A;  4C5K A;  2WTZ A;  1P31 A;  1EEH A;  3RTD A;  3OTX A;  2PKF A;  2C49 A;  1LHP A;  4EOH A;  1V19 A;  3NCA A;  1VM7 A;  3KTN A;  2QHP A;  3RQ5 A;  2F02 A;  1RFV A;  3UAG A;  3ZS7 A;  3K5W A;  1V1S A;  5C41 A;  4C5L A;  3UBO A;  3HPD A;  3RTB A;  2AX3 A;  3NL3 A;  2AWD A;  1ESQ A;  4LC4 A;  1ESJ A;  1YGJ A;  3RTE A;  1JXH A;  1YGK A;  3PYZ A;  3Q92 A;  2JFG A;  4K8P A;  4KAH A;  4E8W A;  1TZ3 A;  3NC2 A;  4C5N A;  1W78 A;  3EAG A;  2R3B A;  3RQ2 A;  4N09 A;  4E84 A;  2Y67 A;  3RSS A;  2ABQ A;  1JXI A;  2VTD A;  4KAN A;  3RPZ A;  3UQ6 A;  3EWM A;  1VI9 A;  3LKI A;  3RRE A;  3RSG A;  3UQ9 A;  2VOR A;  2RBC A;  3NBW A;  2HQQ A;  2Q5R A;  3B1P A;  2XTB A;  2AFB A;  3LK7 A;  3RTA A;  3NBV A;  2UAG A;  5BYD A;  4B8S A;  1V1B A;  3NM1 A;  4XDA A;  1C3Q A;  3HYO A;  3N1C A;  3Q1Y A;  1LIK A;  1RFU A;  4QF5 A;  2YXT A;  3IN1 A;  1O5Z A;  4U7X A;  1LIJ A;  4K9C A;  3BGK A;  3PZS A;  5BYF A;  3QA2 A;  3QAI A;  3MBH A;  4C12 A;  2PKK A;  4E8Y A;  3UQE A;  1P3D A;  3LOO A;  3N2A A;  3HJ6 A;  4S1I B;  4X8F A;  4KAL A;  2AM2 A;  3KD6 A;  3RSQ A;  1RK2 A;  4DU5 A;  1TYY A;  2YXU A;  3NC9 A;  4KAD A;  4LBG A;  2AM1 A;  1TD2 A;  1BX4 A;  2R3E A;  4S1H A;  1YHJ A;  3IE7 A;  4C13 A;  2A9Y A;  1E0D A;  1E8C A;  1RKS A;  1UA4 A;  4EN4 A;  1LHR A;  1EKQ A;  4XCK A;  3RTC A;  4E3A A;  4K8K A;  1L2L A;  3NL6 A;  1RKA A;  2I6B A;  3GO7 A;  2AA0 A;  1GG4 A;  5B6A A;  1EKK A;  3KZH A;  2JFH A;  5F0Z A;  3B1N A;  2Y1O A;  4JKU A;  3FHX A;  3H74 A;  3IBQ A;  3K9E A;  2JG1 A;  2DDW A;  2GC5 A;  3B1R A;  3ZL8 A;  5C3Z A;  2UUO A;  3RQH A;  4XF6 A;  2GCA A;  3RU2 A;  1JBV A;  3RO4 A;  2F7K A;  3I3Y A;  3NM3 A;  3RRB A;  3H49 A;  4JKS A;  4EUM A;  3HIC A;  2JFF A;  3W4S A;  3ZM6 A;  2I5B A;  2PKM A;  4ZIY A;  4BUB A;  1GQT A;  3GBU A;  2DDM A;  1DGM A;  2HW1 A;  3CQD A;  4YL5 A;  2JGV A;  5BYE A;  1VK4 A;  1W7K A;  2WJP A;  2C4E A;  2Y66 A;  4UAG A;  2VAR A;  4B8R A;  4JJP A;  5CM5 A;  1V1A A;  3RSF A;  4K8C A;  4CVK A;  1J6U A;  3B3L A;  3RRF A;  1LIO A;  1WYE A;  5CGE A;  3HN7 A;  4O1G A;  3NL5 A;  4LCA A;  4CVM A;  2AJR A;  4DC3 A;  4E8Z A;  1UAG A;  3PL2 A;  3RPH A;  1RFT A;  4UBE A;  3RU3 A;  4PVV A;  3FHY A;  1TZ6 A;  3RT7 A;  5C3Y A;  1LII A;  3IKH A;  4K8T A;  5TRW A;  3RS9 A;  1UB0 A;  3VAS A;  4YWR A;  4GM6 A;  4KBE A;  4C5M A;  5C40 A;  3RT9 A;  5F11 A;  4K93 A;  3RM5 A;  3B1Q A;  3RTG A;  1GQQ A;  3GO6 A;  5A5E A;  3IH0 A;  2AB8 A;  4N08 A;  3QCZ A;  5A5F A;  3UQD A;  3RQ8 A;  2DDO A;  3BF5 A;  3KEU A;  2QCV A;  4EBU A;  4CVL A;  2AJP A;  3LHX A;  4S1I A;  2VTE A;  2I6A A;  1RKD A;  4K9I A;  4WJM A;  4BUC A;  2ABS A;  2X5O A;  3DZV A;  2XPC A;  4LBX A;  2GCB A;  3NL2 A;  2DCN A;  5EY7 A;  3LJS A;  4XF7 A;  4C5J A;  5BYC A;  1JBW A;  2A9Z A;  2JG5 A;  3MBJ A; 
#chains in the Genus database with same CATH homology
 5TQI A;  3IQ0 A;  2FV7 A;  3DRW A;  1GC5 A;  2V78 A;  3RY7 A;  3VAQ A;  1U2X A;  3JUL A;  3UMO A;  4S1M A;  5CGA A;  2NWH A;  1KYH A;  4E69 A;  3RQQ A;  3B1O A;  3RQX A;  3RRJ A;  4O1L A;  3UMP A;  5EYN A;  2PKN A;  2HLZ A;  3RS8 A;  5COJ A;  3RQ6 A;  4C5K A;  3RTD A;  3OTX A;  2PKF A;  2C49 A;  1LHP A;  4EOH A;  1V19 A;  3NCA A;  1VM7 A;  3KTN A;  2QHP A;  3RQ5 A;  2F02 A;  1RFV A;  5C41 A;  3ZS7 A;  3K5W A;  1V1S A;  4C5L A;  3UBO A;  3HPD A;  3RTB A;  2AX3 A;  3NL3 A;  2AWD A;  1ESQ A;  4LC4 A;  1ESJ A;  1YGJ A;  3RTE A;  1JXH A;  1YGK A;  3Q92 A;  4C5J A;  4K8P A;  4KAH A;  4E8W A;  1TZ3 A;  3NC2 A;  4C5N A;  3RQ2 A;  2R3B A;  4N09 A;  4E84 A;  3RSS A;  2ABQ A;  1JXI A;  3RPZ A;  4KAN A;  3UQ6 A;  3EWM A;  1VI9 A;  3LKI A;  3RRE A;  3RSG A;  3UQ9 A;  2RBC A;  3NBW A;  2HQQ A;  2Q5R A;  3B1P A;  2XTB A;  2AFB A;  3RTA A;  3NBV A;  5BYD A;  4B8S A;  1V1B A;  3NM1 A;  4XDA A;  1C3Q A;  3HYO A;  3N1C A;  3Q1Y A;  1LIK A;  1RFU A;  4XCK A;  2YXT A;  3IN1 A;  4U7X A;  1LIJ A;  4K9C A;  3BGK A;  3PZS A;  5BYF A;  3QA2 A;  3QAI A;  3MBH A;  4E8Y A;  2PKK A;  3UQE A;  3LOO A;  3HJ6 A;  4S1I B;  4X8F A;  4KAL A;  3RSQ A;  3KD6 A;  4DU5 A;  1RK2 A;  1TYY A;  2YXU A;  3NC9 A;  4KAD A;  4LBG A;  2R3E A;  1TD2 A;  1BX4 A;  4S1H A;  1YHJ A;  3IE7 A;  2A9Y A;  1RKS A;  1UA4 A;  4EN4 A;  1LHR A;  1EKQ A;  4E3A A;  3RTC A;  4K8K A;  1L2L A;  3NL6 A;  1RKA A;  2I6B A;  3GO7 A;  2AA0 A;  5B6A A;  1EKK A;  3KZH A;  5F0Z A;  3B1N A;  4JKU A;  3FHX A;  3H74 A;  3IBQ A;  3K9E A;  2JG1 A;  2DDW A;  3B1R A;  5C3Z A;  5CGE A;  3RQH A;  4XF6 A;  3RU2 A;  3RO4 A;  2F7K A;  3I3Y A;  3NM3 A;  3RRB A;  3H49 A;  4JKS A;  4EUM A;  3HIC A;  3W4S A;  2I5B A;  2PKM A;  1GQT A;  3GBU A;  2DDM A;  1DGM A;  2HW1 A;  3CQD A;  4YL5 A;  2JGV A;  5BYE A;  1VK4 A;  2C4E A;  2VAR A;  4B8R A;  4JJP A;  5CM5 A;  1V1A A;  3RSF A;  4K8C A;  3UQD A;  3B3L A;  3RRF A;  1LIO A;  1WYE A;  4O1G A;  3NL5 A;  4LCA A;  4DC3 A;  2AJR A;  4E8Z A;  3PL2 A;  3RPH A;  1RFT A;  4UBE A;  3RU3 A;  4PVV A;  3FHY A;  1TZ6 A;  3RT7 A;  5C3Y A;  1LII A;  3IKH A;  4K8T A;  5TRW A;  3RS9 A;  1UB0 A;  3VAS A;  4YWR A;  4GM6 A;  4KBE A;  4C5M A;  5C40 A;  3RT9 A;  5F11 A;  4K93 A;  3RM5 A;  3B1Q A;  3RTG A;  3GO6 A;  3IH0 A;  2AB8 A;  4N08 A;  3RQ8 A;  2DDO A;  3BF5 A;  3KEU A;  2QCV A;  4EBU A;  2AJP A;  3LHX A;  4S1I A;  4WJM A;  2I6A A;  1RKD A;  4K9I A;  2ABS A;  3DZV A;  4LBX A;  3NL2 A;  2DCN A;  5EY7 A;  3LJS A;  4XF7 A;  5BYC A;  2A9Z A;  2JG5 A;  3MBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...