3URCA

T181g mutant of alpha-lytic protease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLGQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urcA01
2BY8X 1J16A 1HGTH 1SGCA 1TALA 4BAMB 5SGAE 2FZZA 1YPHC 3S69A 1DY8A 3F9HA 4FUBA 4B73A 1XUHA 2FS9A 2RA3A 3I29A 1ESTA 1LHGH 1ZTKA 2AGGX 2PW8H 5GCHF 1OPHB 3A81A 1V2TT 1MBMA 4WMDA 3T27A 1EZXC 5BRRE 2BOKA 1QL8A 5T6GA 4HTCH 2HPPH 1T8MA 5C67A 4ABFA 2FYRA 4AFUA 1TB6H 3UQVA 7GCHF 3SU2A 2BLQA 1SR5C 1BUIA 1ORFA 3A7TA 1UVPA 2W3IA 2Z3CA 4ZKSU 1TNLA 1ZZZA 2O8WA 1LKAA 1GGDC 5FCRA 3RLYH 1WCZA 1N1LA 2ZEBA 3M7TA 1HIAA 1NU7B 1O3JA 4X6PA 1F2SE 2Z7FE 1C2IA 1P09A 1GCTC 1ZJKA 3Q3XA 5F6MA 2ZCHP 3U1IB 3ELAH 3SU4A 1CT4E 1EKBB 3M3TA 3RMOH 1O31A 3NWUA 2H6MA 1TX7A 1AQ7A 1QIXB 1OX1A 2W26A 1MMJN 5ETXA 1EPTA 2CJIA 1TONA 2C4FH 5FHTA 1EPTC 5C3NA 1O2XA 4AG2A 1T8OA 1O3BA 4MPUA 1RIWB 1ABJH 1PQAA 4GPGA 1GWAA 1BDAA 1BMLA 2GX4A 1CSOE 3ZYEA 2UUYA 5F03A 2GCTB 5G4BA 2SGEE 4ZHMU 4MTBA 2XXLA 3E8LA 3UR6A 1W0ZU 1ZSKA 1QB1A 1TMTH 1A3EH 3BTDE 3DA9B 3IG6B 4A7IB 3MYWA 3BG4C 4ZHAA 1EP6A 1D6RA 2NWNA 1QQUA 1JWTA 1NROH 4JMYA 1P12E 4X8SH 1GBHA 4BANB 3BTWE 2CV3A 1CHOF 2OC8A 2QYIA 2BQ6B 4UFGH 1C5PA 2BDHA 4ZAEA 2B9LA 3SNEA 3ZZDA 1FPCH 1H9HE 1WAYB 3BTFE 1SHYA 3SNBA 4YZUA 3MH7A 2K1QA 3MHWU 3QX5H 2ZQ2A 4UFEH 1P2IA 1SPJA 1Y3XA 1IQLA 2J2UA 5EU8A 5DP7A 3GY5A 2TGAA 1SGFG 3UWIA 3OSYA 1MCVA 3TU7H 4NIYA 4UONA 2HWLB 2BD5A 3PTBA 1DLKB 1HCGA 4OS2A 3F9FA 2AFQB 5GJ4B 5CHAB 2KAIA 5EPNA 1M9UA 1BMNH 3GYMA 2GV7A 1O3GA 1D3TB 1Z8IB 2FP7B 1BJUA 1C2LA 2RA0A 1TNKA 1VITF 2ZGHA 3B9FH 1H4WA 3PMBB 1EX3A 2BVRH 4X0WU 1ELVA 4MNYA 5J4QA 5GWZA 1QQ4A 2ODYB 1HPGA 2JH5D 4NA8A 3GDUA 1QRWA 2R0LA 3ZZAA 2HOBA 1LPZB 1PQ5A 1Z1IA 1EOJA 1WU1A 1TIOA 2XCNA 3SJOA 3RXAA 1GHBG 4OS7A 5H4IB 3MO6A 1O3CA 1TOMH 1Y3UA 1SGNE 1O3FA 1J8AA 1FV9A 1BZXE 1GDUA 4KELA 1AE8H 2AH4X 4A1TA 2BM2A 3OX7U 2BD8A 3KCGH 1FY3A 3A80A 1W2KH 1AUTC 1ZPBA 1CHGA 3W94A 2FOMB 2R9PA 2LPRA 4A1XA 1GHZA 4WWYA 1D3DB 1DDJA 3JZ1B 4JK6A 5A09A 1HAZB 2VWLA 4AN7A 1ELGA 1L1JA 1TMUH 2A2XH 2CMYA 4O03A 1W7GH 1PPGE 4B74A 5E8EH 1GJ7B 1G3CA 3SQHE 2Q6FA 2OP9A 8GCHG 3HGPA 1MZAA 2ZU2A 2FEQH 5DP6A 2V3OH 2H5CA 1O2QA 1TRMA 4AZ2B 3RXIA 1A4WH 1O3OA 1T8LA 1HV7A 2PR3A 3TJVA 5JBTA 1D3PB 1C2KA 4F49A 1MKWK 3PM3A 1O3MA 3P17H 3QDZB 1P02A 1LHEH 2XBWA 1GHWH 3RXMA 1V2WT 1SQAA 1ANDA 1GJ8B 2FS8A 2PTNA 1C9PA 2V35A 3STJA 4FUHA 5C20A 4K1SA 1F92A 4FU8A 1Z8RA 5EQQA 1FPHH 1QB9A 3W95A 3RMMH 4XBDA 3Q76A 1QA0A 1CO7E 2EI7A 5EG4A 1Z6EA 4CRAA 4TYDA 1YPJH 3ZZ6A 4AOQA 1EJNA 1TNJA 1QRXA 2B7DH 2QXGA 4DURA 3T2NA 1O5AB 5GPIB 3SV9A 1JMOH 5HM2A 4CH8B 4OS5A 1L4ZA 2BYAX 1CA0B 1EZQA 1OS8A 4CHAB 5JB8S 2QXJA 1GHAG 3E3TA 3MWIU 3PTNA 4Y79A 4FU7A 2BMGB 4YOIA 3E90B 1C5XB 2GD4B 4NG9H 4U2WA 1LQDB 4IS5A 3V13A 4IN1A 1RGQA 5TJXA 4JZIA 2PLXA 2A4RA 4K1EA 1AY6H 1KXFA 4ISHH 1P11E 1DVAH 1X7AC 2ZDKA 3KL6A 1GMCF 3UQOA 3F9EA 1Q31A 1WTGH 2FODA 3LT3A 4MLFB 4Q80A 1SVPA 2B5TB 4CRGA 1O5FH 4CHAC 3SBKA 4MQAA 1GMDF 1O2TA 4X2VA 2A7HA 4YLQH 5DJ7A 1BTXA 4AYYB 1GBLA 5HXFA 2A0QB 1O2IA 3OY6U 1RTLA 1BITA 1O2GH 4YO9A 1O37A 2YNAA 2A45B 1KYNA 1C5LH 3T26A 1H9IE 1FNIA 1V2VT 2W7SA 1GBEA 5B6OA 3RXQA 3UNQA 1BRUP 1Z1JA 1C5VA 4CRFA 1ZOMA 1NRQH 1SGRE 1P3EA 3VB3A 4ESTE 3OYPA 4JCNA 3TGJE 3SU3A 3NZIA 4NGAH 1YPHE 6GCHG 3BG8A 4QT8C 3A87A 3QTOH 4Y11E 5A0BA 2A4OA 1TAWA 3LONA 3GCHB 2Q6DA 1YP9A 1UVUH 3MMGA 3IITA 1SGTA 2PKAA 3ZZ5A 1UTLM 3MNBA 1WBGB 4ISNA 1C2FA 3HGNA 3ESTA 1TLDA 1A0HB 4WVPE 2VU8E 4J2YB 3AASA 1O5CB 1TNHA 3P6ZB 2VWOA 3SI4H 4MPWA 3U8RH 4TPIZ 1V2RT 1FI8A 2P3UB 1PPHE 3M35A 1F5RA 2CF8H 1AZ8A 3E0NB 4KKDA 3WY8A 3KIDU 1C5QA 2CF9H 3QGNB 4XBCA 5DP5A 1K22H 2J4IA 1IQJA 5ESTE 4AFSA 5AVDA 1O2LA 3R0FA 4NZQA 3ATMA 3GCHC 4A1VA 4ZXYH 3RXRA 3M37A 2ZHQH 4KP0A 5FCKA 2OXSA 4B2BA 1P10A 3DUXH 2OTVA 4K8YA 3T29A 2A32A 2WINI 4CRCA 4A6LA 2AS9A 1MZDA 2FX6A 3RXLA 1BT7A 1P3CA 4GVUA 4INKA 1LO6A 4I8HA 2VNTA 1OWEA 4Z6AH 1G32B 1AFEH 1CBWB 1FY8E 1LVBA 1BQYA 2ZU3A 2P16A 1VCWA 3VB7A 3PWCA 4JZFH 4DY7B 2DUCA 2R2MB 2ZDAH 1NT1A 3S9AA 1XX9A 4JZDH 1LHDH 1NZQH 2BDAA 1TGTA 4IGDA 2EI6A 1DUEA 1MAYA 1G3DA 4FXGH 2OUAA 1AZZA 1TA6A 4JYTA 3LGUA 5EOKA 3NKKA 1A5HA 3RXBA 1QB6A 2V6NA 4X1NU 4TWYA 1NY22 2XTTB 1AD8H 5FPYA 2BLVA 1MTSA 2ZDVH 4B76A 3RXVA 1CBWC 2VIDA 1THSH 2ZQ1A 1G9IE 1J15A 2BZAA 4NSYA 1A5GH 2AMQA 3KQEA 3G01A 1UCYH 1C5OH 5L30H 4NIVA 3RXOA 1Z8JB 2ZA5A 3RMNH 1L1NA 1VITH 3V7TA 3A82A 1W3CA 3BTEE 2C90B 1RFNA 1A3BH 4I8KA 1O3DA 1H1BA 1SGIB 2A7JA 4VGCB 2WPJS 4ABBA 4Y7AA 1AVGH 1AU8A 4KGAA 1HNEE 1PPFE 1BA8B 1ZSLA 1C1OA 2ZGBH 2Y81A 2SGAA 3GCOA 2I6QA 4K3JA 5DP8A 3VB5A 3Q77A 3PO1C 2QAAA 5EPYA 1MQ6A 1QL7A 1GBKA 2ZU5A 4NWKA 1OOKB 1DFPA 3P95A 3ZZBA 1C1VH 1GDNA 4K5ZA 2PTCE 2EI8A 1G3EA 1FAKH 5F8ZA 3PMJA 1DS2E 3O8RA 1O38A 1MH0A 1GL0E 1L1GA 5BPEA 3ZZCA 2VGCC 3DHKH 1OWKA 3JZ2B 3BIUH 1H8DH 1D4PB 2STAE 1ZRBA 4VGCC 2ZTXA 1FUJA 1O3HA 4Q2KA 1HXEH 5L6NH 1PPZA 4WY3A 2BY7X 3URDA 4H42U 2AYWA 1GI4A 1KXDA 2R2WU 4OGYA 1SGEE 1AB9B 2BB4A 2PUQH 1K1PA 3ZZ3A 4X8TH 1O3LA 1BBRH 1JOUB 4DIIH 3M5OA 3E6PH 1NO9H 1HJAC 3UPEA 2BZ6H 2TPIZ 3O8BA 4MNWA 4I8LA 2STBE 1AVXA 1G36A 5FBIA 1ARCA 3C27B 2BXTH 2FI3E 2IPHA 1THPB 1SHHB 1XUGA 2ODQA 4Y76A 1ZSJA 4ZKNU 3RXSA 1MCTA 1V2PT 2P3TB 1ZJDA 3Q3KA 1O30A 5J4SA 2Y7ZA 4GCHG 1FMGA 3AAUA 2WYJA 3CP7A 4NCYA 1AB9C 4RN6A 1DPOA 3SNAA 1E38B 2NU2E 2A5KA 1DWCH 3BEFB 8KME2 3TITA 3K2UA 3SW2B 3QLPH 3DFLA 1NFUA 9ESTA 2ZFQH 1Y5UT 2IN2A 2GDEH 3UY9A 5HYOA 1C5MD 1HIAB 4F4OC 4WMEA 1C2JA 2G8TA 2J34A 1TPSA 2FOGA 1O3NA 1YPKH 1O35A 1W11U 4AX9H 3P92A 1AFQB 4U30A 1C1RA 2FOCA 1KSNA 2CHAB 3KNXA 1G2LA 1NN6A 5AHGH 5E2PA 1HAXB 3ITIA 1OXGA 1BTWA 1QCPA 1FQ3A 1EQ9A 1O5BB 2BD3A 3ATIA 3MNCA 3PLPA 3EDXB 2H9HA 4IW4E 1H9LB 2GZ8A 1YPLH 2P94A 2Z9GA 1UCYE 1T7CA 1QBNA 3S9BA 1W7XH 2GP9B 3E16B 4GHQA 1QFKH 1HB0B 3FFGA 4OS4A 2Y7XA 1O5DH 1VCPA 1HUTH 4ZHLU 7LPRA 1KLIH 1FN6A 1NFYA 1IAUA 3M5NA 1VZQH 3BTTE 4ABAA 3OY5U 2VWMA 1J14A 1TRYA 4OGXA 4LXBH 1SQTA 1JRSA 1DUAA 6CHAB 2CHAC 5DP4A 1ZMLA 1W8BH 3EA7A 2AMPA 3FP8E 2F9PA 4BAOB 4H6TA 1SB1H 1SFQB 1FDPA 1GHBF 5FXLA 5ABWA 1AN1E 1A1RA 1KDQB 5L2ZH 1WQVH 4GUXA 1GL1A 5LGOA 5F8TA 2P95A 2QY0B 1K1MA 1Y3YA 4ISLA 1C9TA 2J94A 3CS0A 1C5UA 2ZO3H 3M3VA 2WPKS 3NK8A 2R3YA 3ZVBA 2FOHA 1GI5A 1JRTA 3VXEH 1GJ5H 2G51A 2XW9A 3A8AA 3TGKE 2A5AA 1TBRH 1RIWC 3BIVH 2GCHG 4RKJB 4X1SU 4YLUA 1MKXH 3URCA 4GSOA 3K6ZA 1ELDE 5A0CA 1J9CH 3GCNA 2C93B 2KAIB 8GCHF 2GCTC 3SNDA 1GBAA 2PV9B 4YOGA 1BTPA 1AE5A 1V2NT 2VIWA 1NPMA 2WPLS 3LDXH 2C8WB 3RM0H 3ZVGA 5E0JA 5IDKA 1P2QA 1PYTC 3A88A 1BBRE 4ZROA 1K1NA 5DKMA 1EAIA 2ZCLP 1TGBA 1V2LT 5LPRA 1NRNH 2R3UA 2Y6TA 4MPVA 1UTQA 2SGQE 1ARBA 2VJ1A 2ANMH 1Y59T 1G2MA 3SV8A 1O5EH 2A5IA 3FP6E 1TPOA 1BTZA 2P59A 4FUEA 4BXSA 1GJ4H 1IQIA 1HAVA 1RXPA 2AIQA 3QN7A 2ASUB 1KIGH 3M3SA 1SLXB 1GBCA 1V2JT 2GZ9A 2YNBA 3M7QA 4X2XA 2TRMA 2QCYA 3AVZA 1BHXF 2NU3E 8LPRA 2FIRH 3D65E 4INHA 4ZXXH 2ZFRH 1ID5H 2ODPA 1O3IA 1O2VA 1QURH 1S85A 1OWHA 2ZNKH 1SLUB 4X8VH 1TMBH 2WPIS 6LPRA 2VWNA 8ESTE 4YM9A 1LKBA 4E05H 1JBUH 3GISB 3A8CA 4UE7H 1LPGB 5CHAC 4NFEA 4JYVH 2ZTYA 1C1SA 1GHXH 3A7WA 3U98H 3SO3A 3HK3B 4Q7ZA 1ZLRA 1IOEA 5GIBA 4AFQA 2FTLE 1DITH 1FXYA 1GHAF 2H1UA 5GDSH 1BMMH 3KGPA 1OWDA 4X1QU 3TIUA 3ZVDA 1DM4B 3RXJA 3S0NA 1C1WH 3RMLH 1WSSH 1C2EA 4UFDH 3TNTA 3P8GA 5FPSA 2ZFTA 1DWDH 2FLBH 1N6YA 3A83A 4GLYA 1ELTA 5EGMA 4CR9A 3H5CB 1KY9A 1RJXB 1C2GA 2VIVA 2ZZUH 1DXPA 1PJPA 1O2ZA 2QXIA 1JXPA 4IC6A 1FONA 2OBQA 1C4Y2 3LC3A 3V0XA 2ZFSA 2WUCA 5JB9S 1O39A 1ELBA 3RU4E 1GI3A 3UIRA 1C5NH 2IJOB 4PROA 1UTMA 2F9UA 5E2OA 1AUJA 5AFZH 1ANCA 2F83A 1FJSA 1TE0A 3BSQA 2ZP0H 3DFJA 3GCTG 2FOEA 2ZC9H 1TOCB 2ZHDA 4X2WA 1PPCE 1S0QA 1IQNA 1AWFH 1DE7H 2VH0A 4NZLA 1UK2A 3SUGA 5DP3A 1TPPA 1XVMA 1BMAA 3MH4A 1KTSB 5C1YA 1ZPZA 1K9OE 3SJIA 1UCYK 1D9IA 2ZGJA 1AHTH 1BHXB 1CT2E 2PKSB 4CR5A 5JBBS 3Q3YA 1O2UA 1FN8A 1O2PA 2BXUH 2UWLA 6GCHF 2G00A 4Y7BA 1HAHH 2HLCA 1F0UA 1TYNA 2FI5E 2JH0D 1MU8B 5K7RA 2B0FA 1YGCH 4ISOA 1Y5BT 2BTCE 1SC8U 1CU1A 2GDDA 2QGRA 2VIQA 4MVNA 3ZZ7A 2GTBA 3ZVAA 1GCDA 2FI4E 1XM1A 3TK6A 4FUFA 3ZV9A 1K28D 1O5GH 4LZ4B 1EZUC 4RKOB 4MNVA 3UOPA 1QA7A 3KQDA 1GG6B 1VCQA 2CN0H 3FAOA 1LPKB 3LIWA 4IMQA 2P8OB 2RDLA 2Y5GA 5L2YH 1EJAA 3QGJA 5TCCA 1RS0A 2BQWB 2WYGA 3F6UH 3BN9A 3BTKE 4CREA 1SL3A 1XVOA 2PGQB 1FLEE 1IQMA 2SNWA 4ABDA 2PSYA 3T28A 4KTUA 1DT2A 3SGAE 1SGPE 3I78A 1CA0C 4CRBA 2XRCA 3R3GB 1YF4A 1FAXA 3TVJB 5C1XA 3KF2A 1EAXA 3TH4H 1YC0A 1CT0E 1ZGIA 1Z71A 2FM2A 3LC5A 1FIWA 2ZHWH 1T4UH 5AFYH 1QTFA 2H9TH 3GICB 2FOFA 5DPAA 4DOQA 3O8CA 3BTME 2SFAA 1VJ9U 3L3TA 4JYUH 1XKBC 2Q6GA 4I31A 1BBRK 2P8OC 1A0LA 3SI3H 3PMAB 3MU8A 4FVDA 3RC5A 1EUFA 3B8JA 1GI9B 3SJ8A 4DW2U 2H5DA 5EXMA 3RXGA 4ASHA 2ZCKP 3SU5A 3TH3H 3PYHA 3LGIA 2VH6A 3LGWA 3V3MA 4Y8YA 1MBQA 1GBTA 2UUJB 3SQEE 1AI8H 2HVXA 1EZSC 2D8WA 4CH2B 3U1JB 1EAUA 1PPEE 1DSTA 1K1LA 2FXRA 1T31A 5ESBA 4DJZB 2XC0A 3SZNA 3TK9A 3UREA 2Z9JA 1UVSH 1K2I1 1ZHRA 3RXFA 2BDBA 1S6HA 2BY5X 4LOYH 1GHVH 1O33A 2HNTF 2ZGXH 3L6PA 3SUDA 1V2OT 2ZFPH 5K0HA 2P93A 1C1TA 3GDSA 1C5ZB 2ZECA 2O8MA 1GMHG 3A7ZA 3EQ0H 2ZDMA 3TNSA 5T3HA 2BVXH 1IHSH 3SJKA 4Q7YA 1AGJA 2C8XB 1NS3A 1V2ST 3GY7A 3A8BA 1T8NA 1J17T 4DCDA 5LPFA 4TPYA 1QBVH 4X6OA 1L2EA 2XC5A 1D6WA 1GBFA 1E36B 2AIPA 1P0SH 1NTPA 3LPRA 2D2DA 4Y0YE 1ZYOA 1OKXA 1O2MA 2A31A 2P3FH 3NCLA 2TGDA 1KXAA 2TIOA 1UJ1A 2BOHB 1OSSA 4E7NA 3QZRA 3QZQA 1SFIA 2FYQA 4E7RG 3NXPA 2WPHS 2F9NA 3T25A 5TCAA 3BEUA 4K1TA 1DOJA 2BD9A 3NUMA 1D3QB 3T62A 4ABEA 5EODA 1GBDA 3UR9A 1W13U 1QR3E 1RD3B 4ABJA 1DICA 3MU4A 4KTCA 3SU6A 1P06A 2XYAA 4ISIH 1XMNB 4XDEA 3LKWA 1P9UA 3MO3A 3RXDA 1OWJA 4B2CA 4AG1A 1GI2A 3SU0A 1O3AA 3L33A 2JH6D 3OU0A 5EQSA 3LH3A 4UFFH 2M5TA 2Y82A 3RUOA 3H7TA 1NFXA 1EAWA 1TBQH 4WXIA 2TGPZ 3ZVEA 1GVLA 1BRAA 2W5EA 1O2SA 1HLTH 4AGJA 2BLWA 2BLOA 4CBOA 1Q3XA 2FO9A 1MKXK 4BXWA 1GI8B 2DE8A 1UTKA 3IWMA 1HXFH 2HGTH 2BX3A 1UHBA 3T5FH 1V2MT 1MTVA 2ZWLH 1TNIA 1FZZA 1WUNH 3TK5A 2ZPQA 1Y3WA 2SNVA 2EC9H 1XKAC 4GCHF 3SUFA 4BTUB 3BEIB 1FY4A 1O3KA 2OBOA 2THFB 4JZEH 4ZH8A 1P2KA 4B71A 3HPTB 1HAGE 1B0EA 3ENSB 4UDWH 2HNTC 1IQFA 3NPSA 2BVSH 2O8UA 2A1DB 1DX5M 1IQEA 1SGYE 2VVUA 1AWHB 1GJDB 3Q00A 1T32A 1VJAU 3M36A 5DGJA 1Y3VA 3PMHB 4WMFA 5F8XA 2G81E 2OQ5A 1DANH 3EA8A 3AW1A 1MUEB 1EP5A 3BTHE 1HJ9A 1XUIA 4WH6A 1MTUA 2BDYA 3TJUA 2OC1A 2Z9IA 3RU4D 4IC5A 1Y5AT 2R0KA 2SGFE 3SNCA 3BTQE 3SOSA 1SSXA 1FY1A 1MTNB 1CQQA 1S84A 1PQ7A 1QBOA 1G3BA 4BAQB 4XBBA 3C1KA 3M7UA 4BTIB 1C5WB 3RP2A 3SHAH 2A7CA 3GYLB 3SUEA 3A7XA 1AVWA 1HDTH 1YLDA 2FLRH 2XBVA 4AFZA 1B5GH 1SGQE 3TGIE 3AAVA 3TPIZ 4I33A 4AGKA 1AKSA 1K21H 1RTFB 4M7GA 1IQHA 3GY3A 2O8LA 3MH6A 1WTHD 4IMZA 4Y10E 2F9VA 2ALVA 2ZPRA 3TH2H 1QGFA 1UMAH 1BTHH 1O3PB 1EATA 3QTVH 1DY9A 3GDVA 4DG4A 3HK6B 1P05A 1EB2A 4DGJA 1LDTT 1TFXA 2QF3A 7ESTE 3PLKA 1XXDA 1GBJA 4KTSA 1E0FD 1DSUA 4XSKU 2GCHF 1GCTB 1BJVA 1QL9A 2VVCA 3E91A 3LGYA 1C4V2 2QIQA 3MU1A 3SHCH 1GJCB 2OC0A 1BCUH 3RXTA 5LH8A 1W0YH 1WOFA 5DG6A 1EPTB 1HBTH 4Y6DA 3ZZ4A 5GXPA 1F0RA 1SLVB 2OD3B 3M5MA 1OYTH 3SU1A 1EXFA 1B0FA 2AGEX 5T6DA 1YPMH 4TWWA 1S83A 4UEHH 1EJMA 1UK4A 2GMTB 3LGVA 1Z6JH 2FWWA 4TY7A 3S7HB 3A86A 1SLWB 1SGDE 3KEEA 3VB4A 1SQOA 3BG4B 4K69A 3MI4A 1AFQC 4INLA 1SOZA 5FBEA 3UTUH 4XFQA 4BTTB 5E0HA 2G55A 4O97A 2TBSA 1YPGH 4FUIA 1ETTH 4DIHH 3EA9A 4XE4A 1LVOA 1P03A 1TABE 1P9SA 1CGHA 5JBAS 2FMJA 2ZG0H 4U32A 1ZTJA 4E06H 4SGAE 3AW0A 4WF8A 1ELFA 4WH8A 2ZDLA 1ANBA 1QJ1B 1P8VC 1QJ7B 2ZPSA 1YCPH 2PGBB 2A4GA 2ZFFH 1T4VH 3D49H 3QWCH 1C1NA 1OP2A 2GMTC 3KN2A 3ATKA 4HZHA 2BHGA 2Z94A 4YESB 4BOHA 1Q2WA 2SGPE 3D62A 1A2CH 2ZU4A 2ZGCA 3B23B 1O2JA 2GV6A 2ZTZA 5IYTA 4D9RA 1GI6A 1UVOA 1N6XA 3KQBA 4HFPB 4IBLH 4D8NA 1WV7H 6CHAC 5GCHG 1O2YA 3U9AH 3SN8A 2FESH 1O34A 4NA7A 4OS1A 1KDQA 3FZZA 1O36A 4YT7H 4ABHA 2G4TA 3BV9B 1HAVB 3EAJA 2F3CE 2XC4A 7GCHG 4B2AA 1XUKA 1C2DA 1SBWA 1QY6A 1KLTA 5C1UA 1YPEH 1DWBH 1EASA 1QNJA 4FU9A 1LHCH 1P04A 2RG3A 1TQ7B 4H4FA 1TPAE 2G5NA 4DVAU 1TGNA 3GCTF 5JPMH 2G5VA 3RXCA 3QUMP 5A8XA 4ZMAH 4ZKRU 4K60A 2Z3EA 4HI3A 1LVMA 3SORA 4UD9H 1TGCA 1VGCB 3LOXA 3KHVA 3A85A 1N8OB 2VINA 1TX8A 1ESBA 3GY4A 1FY5A 2CXVA 3H7OA 1SGFA 4YOJA 1WYKA 2XWAA 2QA9E 2VIPA 1UTPA 3A89A 4X2YA 5FPTA 3UUZA 1V6DA 1AMHA 1INCA 1GHYH 2Q1JA 4NSVA 1KXEA 1GVZA 1YBWA 4FUDA 3RC6A 1LTOA 1ACBE 4CBNA 1FIZA 3E0PB 2OLGA 1G37A 1WQSA 1BB0B 2J92A 3D23A 3S9CA 1A46H 1C4U2 4BNRA 2WV4A 2FPZA 1C1QA 1VGCC 3S7KB 2QC2A 2GGVB 1GDQA 3PB1E 3UNSA 2UWPA 3MTYA 3A8DA 4WXVA 1N8OC 2BDIA 4Y0ZE 2C8ZB 1CHOG 2DE9A 2ZU1A 1L4DA 2PFEA 1BOQA 1YLCA 3FP7E 4R8TB 2XCFA 3FZDA 2J9NA 3LU9B 4FVBA 3SJ9A 2QV1A 3RXPA 3MNSA 1ESAA 2PUXB 2NU4E 1PYTD 2QF0A 4AYVB 1P57B 5FAHA 4B1TA 4CRDA 3ZV8A 1MD8A 3F9GA 1C1MA 1HAPH 4RSPA 1SI5H 1KLJH 5DP9A 3QO6A 2UUFB 3RXKA 2H9EH 3F1SB 2Z3DA 5JYIA 1TWXB 2ZI2H 2XBYA 5C5NA 2NU0E 1YYY1 2FOAA 3CS7A 2ZKSA 1YKTA 4Y71A 4ZUHA 2PWXA 3I77A 2EA3A 1TX6A 2AEIH 1VITG 1K1JA 2I6SA 3MO9A 1KXCA 3A7YA 3RLWH 3RU4T 2ZHEH 1Y8TA 4I32A 3K65B 1NFWA 2XWBI 1Z8GA 2V0BA 2D26C 2C8YB 1HFDA 3BF6H 3HKIB 2IOTA 4ABIA 2FX4A 1SOTA 5HGGA 2HALA 3EYDA 3P8OA 5JDUB 4B75A 4AORA 3HATH 5HMAA 1V2QT 2HNTE 3PWBA 5EXNA 1O0DH 1OP8A 3U8OH 2FTMA 1GBBA 4O3UA 2VVVA 4H6SB 1BIOA 7KMEH 2PKSC 2TGTA 2WV5A 2FOBA 2ZHFH 3RC4A 1GMHF 1C5TA 3A84A 2JKHA 2VB0A 5T6FA 2ILNA 4OS6A 1E35B 1C5RA 1B7XB 5CMXH 5A0AE 1MQ5A 3QK1A 5C5OA 2J95A 1V2KT 3MU0A 2YOLA 5I46H 2LNCA 3K9XB 4THNH 4U01A 3KQCA 2ANWA 3ATLA 1CA8B 1GJ6A 1UK3A 5A8ZA 2ANYA 3P8NA 3VGCB 2W3KA 2OCVB 4MG3A 4O3TA 1CGJE 3VB6A 3ODDA 1ETSH 1GG6C 2J38A 1TRNA 4JK5A 2O9QA 1OP0A 1PPBH 3RXEA 2Z6BD 1W12U 3MU5A 4BAKB 1UVTH 1V3XA 3ZYDA 3PROA 2JETB 4O9VA 2AMDA 1A7SA 1E34B 1L0ZA 6ESTA 1AIXH 5FX6A 1OYQA 5E0GA 4A92A 2PKAB 4MDSA 1C1UH 5PTPA 3M61U 1G30B 1XUJA 3SV2H 5DK1A 3VFEA 1O2RA 1O2KA 2ZF0H 1ZGVA 3VGCC 1CVWH 3M5LA 4FUGA 2ESTE 1EOLA 4X6NA 1MTWA 5EXLA 4Q7XA 5I25A 4NIWA 1VR1H 2AGIX 2XNIA 1CGIE 2WPMS 3MOCA 3ODFA 4I8JA 4K2YA 2CGAA 4D7FA 1NRPH 1S81A 1LVYA 4NWLA 3TJOA 3F68H 2JETC 1ZHMA 2H2ZA 3RXHA 1DLEA 3ZZ9A 2BY6X 3N7OA 3VEQB 3ZVCA 3HKJB 1P2NA 1ZMJA 4IN2A 3UWJH 1IQGA 3P70B 3VXFH 1W14U 1HAOH 4D7GA 1GI1A 3U8TH 4LZ1H 2XBXA 4BAHB 1BTUA 4HGCA 1W10U 1E37B 3TJNA 2RCEA 3BTGE 3RDZA 2GVFA 3U69H 1LHFH 4SGBE 1GJBB 1QRZA 4I8GA 4X6MA 2NU1E 1Z7KA 1NRRH 1HAIH 1GMCG 1PFXC 3P8FA 2GT8A 2ALPA 4NA9H 2Y5HA 1NU9A 1THRH 1ELEE 2A4QA 3O8DA 1SMFE 1SG8B 4LK4A 1RRKA 2GKVE 1GMDG 1XXFA 4D9QA 5EW1H 1UTOA 1O2WA 1P01A 1NESE 3GY8A 2OC7A 2UUKB 1GJ9B 1QHRB 1ZHPA 2C3SA 3TLOA 5HM9A 1HRTH 3FANA 2Y80A 5JBCS 1NRSH 3SV6A 1U6QA 2B8OH 1CE5A 4GHTA 1C1PA 1O2OA 1TA2A 3OTJE 3STIA 1KTTB 1RTKA 1QJ6B 4I7YH 2G52A 3CENA 4YT6H 3FVFB 1K1OA 2Z9LA 1KXBA 5AF9H 1IHTH 1F5LA 4J1YA 1A5IA 4DT7B 1JIMA 1BRBE 1ZTLA 1GBMA 2BY9X 1MKWH 1YCPK 4A5TS 2BDGA 2WUBA 2GT7A 2BD7A 2D1JA 4NIXA 1MD7A 1A61H 1UHBB 1UO6A 3DT0H 1NC6A 4K8BA 3PLBA 3EE0B 1ZRKA 2F9OA 3RXUA 4Y8XA 1OWIA 3SGBE 1AO5A 1ETRH 1YM0A 2BQ7B 2GZ7A 1ABIH 1A0JA 2PHBA 2Z9KA 3PO1B 4FUCA 5DO4H 1F5KU 1TNGA 2QXHA 1C5YB 2G4UA 1YCPM 5LPEA 1ELCA 3SGQE 1F0SA 3ZVFA 1NM6A 1O32A 4GAWA 2VGCB 5EW2H 1GBIA 2VIOA 3UFAA 1BTYA 1S6FA 3UOUA 1P2JA 4MPXA 1IQKA 1TQ0B 3GOVB 2BX4A 1O3EA 1V2UT 4AB9A 1ZPCA 4MNXA 2OINA 2F91A 1GI0A 2UWOA 3LJOA 1C2MA 2EEKA 2FDAA 2SGDE 1MAXA 1LCYA 5A8YA 1S0RA 2ZDNA 3VPKA 4D76A 3UNRA 2HRVA 3DD2H 5CE1A 3GY6A 3EGKH 3K6YA 1GPZA 2HPQH 3MNXA 4X1RU 1PQ8A 1C5SA 1MU6B 1HJAB 5C2ZA 1S82A 1BRCE 1LMWB 4R0IA 2AERH 1JIRA 3RM2H 1EB1H 4FUJA 4TY6A 1O2NA 4XOJA 3MH5A 2PSXA 1AKSB 1LQEA 1ZMNA 3ZZ8A 1UTJA 2OQUA 1H8IH 5FX5A 1P2OA 2BD2A 3PV4A 1DXWA 2BD4A 3MFJA 2BDCA 3LH1A 4JZ1A 4X8UH 1ELAA 2Y5FA 9LPRA 1HAYB 2O8TA 1ANEA 2QN5T 2ULLA 4AB8A 1HJ8A 1K1IA 4NFFA 3SV7A 1S5SA 1GI7B 4Y8ZA 4YTAA 4WJG2 4X1PU 1DWEH 5A2MH 3LJJA 2A2QH 1F7ZA 3E1XB 4ABGA 1TBZH 2V3HH 3A7VA 1UTNA 1P2MA 1ZR0A 1HYLA 1GJAB 1GVKB 3GY2A 4Z0KA 1TGSZ 1C2HA 1XUFA 3V12A 2W7UA 3ATWA 3LGTA 2ZIQH 2F9BH 1O2HA 2ANKH 5EQRA 4ZKOU 1MTNC 1F0TA 1GGDB
chains in the Genus database with same CATH superfamily
2BY8X 4F48B 1J16A 1HGTH 1SGCA 1TALA 4BAMB 5SGAE 2FZZA 1S6LA 1YPHC 3S69A 1DY8A 3F9HA 4FUBA 4B73A 1XUHA 2FS9A 2RA3A 3I29A 1ESTA 1LHGH 1ZTKA 2AGGX 2PW8H 5GCHF 1OPHB 3UAIC 3A81A 1V2TT 1MBMA 4WMDA 3T27A 1EZXC 5BRRE 2BOKA 1QL8A 5T6GA 4HTCH 2HPPH 1T8MA 5C67A 4ABFA 2FYRA 4AFUA 1TB6H 3UQVA 7GCHF 3SU2A 2BLQA 1SR5C 1BUIA 1ORFA 1WXRA 3A7TA 1UVPA 2W3IA 2Z3CA 4ZKSU 1TNLA 1ZZZA 2J97A 2O8WA 1LKAA 1GGDC 5FCRA 3DSPA 3RLYH 1WCZA 2RDEA 1COWD 1N1LA 2ZEBA 3M7TA 1HIAA 1NU7B 1O3JA 4X6PA 1F2SE 2Z7FE 1C2IA 1P09A 1GCTC 1ZJKA 3Q3XA 5F6MA 2ZCHP 3U1IB 3ELAH 3SU4A 1CT4E 1EKBB 3M3TA 3RMOH 1O31A 3F2FA 3NWUA 2H6MA 1TX7A 1AQ7A 1QIXB 1OX1A 2W26A 1MMJN 5ETXA 1EPTA 2CJIA 1TONA 2C4FH 5FHTA 1EPTC 5C3NA 1YLNA 1O2XA 4AG2A 1T8OA 1O3BA 2EQNA 4MPUA 1RIWB 1ABJH 1PQAA 4GPGA 1GWAA 1BDAA 1BMLA 2GX4A 1CSOE 3ZYEA 2KCOA 2UUYA 5F03A 2GCTB 5G4BA 2SGEE 4ZHMU 3F2HA 4MTBA 3KQ5A 2XXLA 3E8LA 3UR6A 1W0ZU 1ZSKA 1QB1A 1TMTH 1A3EH 3BTDE 3DA9B 3IG6B 4A7IB 3MYWA 3BG4C 4ZHAA 1EP6A 1D6RA 4I86A 2NWNA 1QQUA 1JWTA 1NROH 4JMYA 1P12E 4X8SH 1GBHA 4BANB 3BTWE 1MABB 2CV3A 1CHOF 2OC8A 2QYIA 2BQ6B 4UFGH 1C5PA 2BDHA 3GS9A 4ZAEA 2B9LA 3SNEA 3ZZDA 1FPCH 1H9HE 1WAYB 3BTFE 1SHYA 3SNBA 4YZUA 3MH7A 2K1QA 3MHWU 3QX5H 2ZQ2A 4UFEH 1P2IA 1SPJA 1H8HD 1Y3XA 1IQLA 2J2UA 5EU8A 5DP7A 3GY5A 2TGAA 1SGFG 3UWIA 3OSYA 1MCVA 3TU7H 4NIYA 4UONA 2HWLB 2KCAA 2BD5A 3PTBA 1DLKB 1HCGA 4OS2A 3F9FA 2AFQB 5GJ4B 5CHAB 2KAIA 5EPNA 1M9UA 1BMNH 3GYMA 2GV7A 1O3GA 1D3TB 1Z8IB 2FP7B 1BJUA 1C2LA 2RA0A 1TNKA 1VITF 2ZGHA 3B9FH 1H4WA 3PMBB 1EX3A 2BVRH 4X0WU 1ELVA 4MNYA 3MQKC 5J4QA 5GWZA 1QQ4A 2ODYB 1HPGA 2JH5D 4NA8A 3GDUA 1QRWA 2R0LA 3ZZAA 2HOBA 1LPZB 1PQ5A 1Z1IA 1EOJA 1WU1A 1TIOA 2XCNA 3SJOA 3RXAA 1GHBG 4OS7A 5H4IB 3MO6A 1O3CA 1TOMH 1Y3UA 1SGNE 1O3FA 1J8AA 1FV9A 1BZXE 1GDUA 4KELA 1AE8H 2AH4X 4A1TA 2BM2A 3F2GA 3OX7U 2BD8A 3KCGH 1FY3A 3A80A 1W2KH 1AUTC 1ZPBA 1CHGA 3W94A 2FOMB 2R9PA 2LPRA 2WZQA 4A1XA 1GHZA 4WWYA 1D3DB 1DDJA 3JZ1B 4JK6A 5A09A 1HAZB 2VWLA 3OE7D 4AN7A 1ELGA 1L1JA 1TMUH 2A2XH 2CMYA 3OFND 4O03A 1W7GH 1PPGE 4B74A 5E8EH 1GJ7B 3DSGA 1G3CA 3SQHE 2Q6FA 2OP9A 8GCHG 3HGPA 1MZAA 2ZU2A 2FEQH 5DP6A 2V3OH 2H5CA 1O2QA 1TRMA 4AZ2B 3RXIA 1A4WH 4XD7D 1O3OA 1T8LA 1HV7A 2PR3A 3TJVA 5JBTA 1D3PB 1W0JD 1C2KA 4F49A 1MKWK 3PM3A 1O3MA 3P17H 3QDZB 1P02A 1LHEH 2XBWA 1GHWH 2J98A 3RXMA 1V2WT 1SQAA 1ANDA 1GJ8B 2FS8A 2PTNA 1C9PA 5IK2D 2V35A 3STJA 2HLDD 4FUHA 5C20A 4K1SA 1F92A 3U28C 4FU8A 1Z8RA 5EQQA 1FPHH 1QB9A 3W95A 3RMMH 4XBDA 2V3MA 1QA0A 3Q76A 1CO7E 2EI7A 5EG4A 1Z6EA 4CRAA 4TYDA 1YPJH 3ZZ6A 4AOQA 1EJNA 1TNJA 1QRXA 2B7DH 2QXGA 4Q4LA 4DURA 3T2NA 1O5AB 5GPIB 3SV9A 3DCLA 5C0UA 1JMOH 5HM2A 4CH8B 4OS5A 1L4ZA 3SYJA 2BYAX 1CA0B 1EZQA 1OS8A 4OM9A 4CHAB 5JB8S 2QXJA 3F0OA 1GHAG 3E3TA 3MWIU 3PTNA 4Y79A 4FU7A 2BMGB 4YOIA 3E90B 1C5XB 2GD4B 4NG9H 4U2WA 1LQDB 4IS5A 3V13A 4IN1A 1RGQA 5TJXA 4JZIA 2JJ2D 2PLXA 2A4RA 4K1EA 3WWBA 1AY6H 1KXFA 4ISHH 1P11E 1DVAH 1X7AC 2ZDKA 2LELA 3KL6A 1GMCF 3UQOA 3F9EA 1Q31A 1WTGH 2FODA 3LT3A 4MLFB 4Q80A 1SVPA 2B5TB 4CRGA 1O5FH 4CHAC 3SBKA 4MQAA 1GMDF 1O2TA 4X2VA 2A7HA 4YLQH 5DJ7A 4TT3D 1BTXA 4AYYB 1GBLA 2YMSC 5HXFA 2A0QB 1O2IA 3OY6U 1RTLA 1BITA 1O2GH 4YO9A 1O37A 2YNAA 2A45B 1KYNA 1C5LH 3T26A 1H9IE 1FNIA 1V2VT 2W7SA 1GBEA 5B6OA 2QF5A 3RXQA 3UNQA 1BRUP 1Z1JA 1C5VA 4CRFA 1ZOMA 1NRQH 1SGRE 1P3EA 3VB3A 4ESTE 3OYPA 4JCNA 3TGJE 3SU3A 3NZIA 4NGAH 1YPHE 6GCHG 3BG8A 4QT8C 3A87A 3QTOH 2VBCA 4Y11E 5A0BA 2A4OA 1TAWA 3LONA 3GCHB 2Q6DA 1YP9A 3PRBA 1UVUH 3MMGA 3IITA 1SGTA 2PKAA 3ZZ5A 1UTLM 3MNBA 1WBGB 4ISNA 1C2FA 3HGNA 3ESTA 1TLDA 1A0HB 4WVPE 2VU8E 4J2YB 3AASA 1O5CB 1TNHA 3P6ZB 2VWOA 3SI4H 4MPWA 3U8RH 4TPIZ 1V2RT 1FI8A 2P3UB 1PPHE 3M35A 1F5RA 2CF8H 1AZ8A 3E0NB 4KKDA 3WY8A 3CNRA 3KIDU 1C5QA 2CF9H 3QGNB 4XBCA 5DP5A 1K22H 2J4IA 1IQJA 5ESTE 4AFSA 5AVDA 1O2LA 3R0FA 4NZQA 3FN8A 3ATMA 3GCHC 4A1VA 4ZXYH 3RXRA 1W0KD 3AK5A 3M37A 2ZHQH 4KP0A 5FCKA 2OXSA 4B2BA 1P10A 3DUXH 2OTVA 4K8YA 3T29A 2A32A 2WINI 4CRCA 4A6LA 2AS9A 1MZDA 2FX6A 3RXLA 1BT7A 3FKSD 1P3CA 4GVUA 4INKA 1LO6A 4I8HA 2VNTA 1OWEA 4Z6AH 1G32B 1AFEH 1CBWB 1FY8E 1LVBA 1BQYA 2ZU3A 2AHME 1VCWA 2P16A 3VB7A 3PWCA 4JZFH 4DY7B 2DUCA 2R2MB 2ZDAH 5DN6D 1NT1A 3S9AA 1XX9A 4JZDH 1LHDH 1NZQH 2BDAA 1TGTA 4IGDA 2EI6A 1DUEA 1MAYA 1G3DA 4FXGH 2OUAA 1AZZA 1TA6A 4JYTA 3LGUA 5EOKA 3NKKA 1A5HA 3RXBA 1QB6A 2V6NA 4X1NU 4TWYA 1NY22 2XTTB 1AD8H 5FPYA 2BLVA 1MTSA 4AC9A 2ZDVH 4B76A 3RXVA 1CBWC 2VIDA 1THSH 2ZQ1A 1G9IE 1J15A 2BZAA 4NSYA 1A5GH 2AMQA 3KQEA 3G01A 1UCYH 1C5OH 5L30H 4NIVA 3RXOA 1Z8JB 2ZA5A 2IPQX 3RMNH 1L1NA 1VITH 5C17A 1WDIA 2KM0A 3V7TA 3A82A 1W3CA 3BTEE 2C90B 1RFNA 1A3BH 4I8KA 1O3DA 1H1BA 1SGIB 2A7JA 4VGCB 2WPJS 5T1VA 4ABBA 4Y7AA 1AVGH 1AU8A 4KGAA 5HIZA 1HNEE 1PPFE 2KX4A 1BA8B 1ZSLA 1C1OA 2ZGBH 2Y81A 2SGAA 3GCOA 2I6QA 4K3JA 5DP8A 3VB5A 3Q77A 3PO1C 2QAAA 5EPYA 1MQ6A 1QL7A 1GBKA 2ZU5A 4NWKA 1OOKB 3OEED 1DFPA 3P95A 3ZZBA 1C1VH 1GDNA 4K5ZA 2PTCE 2EI8A 1G3EA 1FAKH 5F8ZA 2V7QD 1DS2E 3PMJA 3O8RA 1O38A 1MH0A 1GL0E 1L1GA 5BPEA 3ZZCA 2VGCC 3DHKH 1OWKA 3JZ2B 3BIUH 1H8DH 1D4PB 2STAE 1ZRBA 4VGCC 2ZTXA 1FUJA 1O3HA 4Q2KA 1HXEH 5L6NH 1PPZA 4WY3A 2BY7X 1FX0B 3URDA 4H42U 2AYWA 1GI4A 1KXDA 2R2WU 4OGYA 1SGEE 1AB9B 2BB4A 2PUQH 1K1PA 3ZZ3A 4X8TH 1O3LA 1BBRH 5EIYA 1JOUB 4DIIH 3M5OA 3E6PH 1NO9H 1HJAC 3UPEA 2BZ6H 2TPIZ 3O8BA 4MNWA 4I8LA 2STBE 1AVXA 1G36A 5FBIA 1ARCA 3C27B 2BXTH 2FI3E 2IPHA 1THPB 1SHHB 1XUGA 2ODQA 4Y76A 1ZSJA 4ZKNU 3RXSA 1MCTA 1V2PT 2P3TB 1ZJDA 4P02A 3Q3KA 1O30A 5J4SA 2Y7ZA 4GCHG 1FMGA 1SKYE 3AAUA 2WYJA 3CP7A 4NCYA 1AB9C 4RN6A 1DPOA 3SNAA 1E38B 2NU2E 2A5KA 1DWCH 3BEFB 8KME2 3TITA 3K2UA 3SW2B 3QLPH 3DFLA 1NFUA 9ESTA 2ZFQH 1Y5UT 1OHHD 2IN2A 2GDEH 3UY9A 5HYOA 1C5MD 1HIAB 4F4OC 4WMEA 4ASUD 1C2JA 2G8TA 2J34A 1TPSA 2HVYB 2FOGA 1O3NA 1YPKH 1O35A 1W11U 4AX9H 3P92A 1AFQB 3N7EA 4U30A 1C1RA 2FOCA 1KSNA 2CHAB 3KNXA 1G2LA 1NN6A 5AHGH 5E2PA 1HAXB 3ITIA 1OXGA 1BTWA 1QCPA 1FQ3A 1EQ9A 1O5BB 2BD3A 3ATIA 3MNCA 3PLPA 3EDXB 2H9HA 4IW4E 1H9LB 2GZ8A 1YPLH 2P94A 2Z9GA 1UCYE 1T7CA 1QBNA 3S9BA 1W7XH 2GP9B 3E16B 4GHQA 3KYFA 1QFKH 1HB0B 3FFGA 4OS4A 2Y7XA 1O5DH 1VCPA 2F4LA 1HUTH 4ZHLU 7LPRA 1KLIH 1FN6A 1NFYA 1IAUA 3M5NA 1VZQH 3BTTE 4ABAA 3OY5U 3WWFA 2VWMA 1J14A 1TRYA 4OGXA 4LXBH 1SQTA 1JRSA 1DUAA 6CHAB 2CHAC 5DP4A 1ZMLA 1W8BH 3EA7A 2AMPA 3FP8E 2F9PA 4BAOB 4H6TA 1SB1H 1SFQB 1FDPA 1GHBF 5FXLA 5ABWA 1YY3A 1AN1E 1A1RA 1KDQB 5L2ZH 1WQVH 4GUXA 1GL1A 5LGOA 5F8TA 2P95A 2QY0B 1K1MA 1Y3YA 4ISLA 1C9TA 2J94A 3CS0A 1C5UA 2ZO3H 2KZ4A 3M3VA 2WPKS 3NK8A 2R3YA 3ZVBA 2FOHA 1GI5A 1JRTA 3VXEH 1GJ5H 2G51A 2XW9A 3A8AA 3TGKE 2A5AA 1TBRH 1RIWC 3BIVH 2GCHG 4RKJB 4X1SU 4YLUA 1MKXH 3URCA 4GSOA 3K6ZA 1ELDE 5A0CA 1J9CH 3GCNA 2C93B 2KAIB 8GCHF 2GCTC 3SNDA 1KMHB 1GBAA 2PV9B 4YOGA 1BTPA 1AE5A 1V2NT 2VIWA 1NPMA 2WPLS 3LDXH 2C8WB 3RM0H 3ZVGA 5E0JA 5IDKA 1P2QA 1PYTC 3A88A 1BBRE 4ZROA 1K1NA 5DKMA 1EAIA 2ZCLP 1TGBA 1V2LT 5LPRA 1NRNH 2R3UA 2Y6TA 4MPVA 1UTQA 2SGQE 1ARBA 2VJ1A 2ANMH 1Y59T 1G2MA 3SV8A 4F55A 1O5EH 2A5IA 3FP6E 1TPOA 1BTZA 2P59A 4FUEA 4BXSA 1GJ4H 1IQIA 1HAVA 1RXPA 2AIQA 3QN7A 2ASUB 1KIGH 3M3SA 1SLXB 1GBCA 1V2JT 2GZ9A 2YNBA 3M7QA 4X2XA 2TRMA 2QCYA 3AVZA 1BHXF 2NU3E 8LPRA 2FIRH 3D65E 4INHA 4ZXXH 2ZFRH 1ID5H 2ODPA 1O3IA 1O2VA 1QURH 1S85A 1OWHA 5HKKD 2ZNKH 1SLUB 4X8VH 3VG8A 1TMBH 2WPIS 6LPRA 2VWNA 8ESTE 4YM9A 1LKBA 4E05H 1JBUH 4B6EA 3GISB 4ACBA 3A8CA 4UE7H 1LPGB 5CHAC 4NFEA 4JYVH 2ZTYA 1C1SA 1GHXH 3A7WA 3U98H 3SO3A 3HK3B 4Q7ZA 1ZLRA 2KCPA 1IOEA 5GIBA 4AFQA 2FTLE 1DITH 1FXYA 2H1UA 1GHAF 5GDSH 1BMMH 3KGPA 1OWDA 4X1QU 3TIUA 3ZVDA 1DM4B 3RXJA 3S0NA 1C1WH 3RMLH 1WSSH 1C2EA 4UFDH 3TNTA 3P8GA 5FPSA 2ZFTA 5C94A 1DWDH 2FLBH 1N6YA 3A83A 2QF4A 1ELTA 4GLYA 5EGMA 4CR9A 3N7DA 3H5CB 1KY9A 1RJXB 4FOUC 1C2GA 2VIVA 2ZZUH 1DXPA 1PJPA 1O2ZA 5DSFA 2QXIA 1JXPA 4IC6A 2W6JD 1FONA 2OBQA 1C4Y2 3LC3A 3V0XA 2ZFSA 2WUCA 5JB9S 1O39A 4RT0A 1ELBA 3RU4E 1GI3A 3UIRA 3F3BA 1C5NH 2IJOB 4PROA 1UTMA 2F9UA 5E2OA 1AUJA 5AFZH 1ANCA 2F83A 1FJSA 1TE0A 3BSQA 2ZP0H 3DFJA 3PV2A 3GCTG 2FOEA 5EJLA 2ZC9H 1TOCB 2ZHDA 4X2WA 1PPCE 3W1EA 1S0QA 1IQNA 1AWFH 1DE7H 2KR7A 2VH0A 4NZLA 5EJ1A 1UK2A 3SUGA 5DP3A 1TPPA 1XVMA 1BMAA 3MH4A 1KTSB 5C1YA 1ZPZA 1K9OE 3SJIA 1UCYK 1D9IA 2ZGJA 1AHTH 1BHXB 1CT2E 2PKSB 4CR5A 5JBBS 3Q3YA 1O2UA 1FN8A 1O2PA 2BXUH 2UWLA 6GCHF 2G00A 4Y7BA 1HAHH 2HLCA 1F0UA 1TYNA 2FI5E 2JH0D 1MU8B 5K7RA 2B0FA 2JIZD 1YGCH 4ISOA 1Y5BT 2BTCE 1SC8U 1CU1A 2GDDA 2QGRA 2VIQA 3FOAA 4MVNA 3ZZ7A 2GTBA 3ZVAA 1GCDA 2FI4E 1XM1A 3TK6A 4FUFA 3ZV9A 1K28D 1O5GH 4LZ4B 1EZUC 1QZ8A 4RKOB 4MNVA 3UOPA 1QA7A 3KQDA 1GG6B 1VCQA 2CN0H 3FAOA 1LPKB 3LIWA 4IMQA 2K0QA 2P8OB 2RDLA 2Y5GA 1EJAA 3QGJA 5TCCA 1RS0A 2BQWB 2WYGA 5L2YH 3F6UH 3BN9A 3BTKE 4CREA 1SL3A 1XVOA 2PGQB 1FLEE 1IQMA 2SNWA 4ABDA 2PSYA 3T28A 4KTUA 1DT2A 3SGAE 1SGPE 3I78A 1CA0C 4CRBA 2XRCA 3R3GB 1YF4A 1FAXA 3TVJB 5C1XA 3KF2A 1EAXA 2J5UA 3TH4H 1YC0A 1CT0E 1ZGIA 1Z71A 2FM2A 3LC5A 1FIWA 2ZHWH 1E1QD 1T4UH 4RI0A 5AFYH 4YXWD 1QTFA 2H9TH 2WSSD 3GICB 2FOFA 5DPAA 4DOQA 3O8CA 2KCYA 2SFAA 3BTME 1VJ9U 3L3TA 4JYUH 1XKBC 2Q6GA 2L74A 4I31A 1BBRK 2P8OC 1A0LA 2K8IA 3SI3H 3PMAB 3MU8A 4FVDA 3RC5A 1EUFA 3B8JA 1GI9B 3SJ8A 4DW2U 2H5DA 5EXMA 3RXGA 4ASHA 2ZCKP 3SU5A 3TH3H 3PYHA 3LGIA 2VH6A 3LGWA 3V3MA 4Y8YA 1MBQA 1GBTA 2UUJB 3SQEE 1AI8H 2HVXA 1EZSC 2D8WA 4CH2B 3U1JB 1EAUA 1PPEE 1DSTA 1K1LA 2FXRA 1T31A 5ESBA 4DJZB 2XC0A 3SZNA 3TK9A 2L6OA 3UREA 2Z9JA 1UVSH 1K2I1 1ZHRA 3RXFA 2BDBA 1S6HA 2BY5X 4LOYH 1GHVH 1O33A 2HNTF 2ZGXH 3L6PA 2EY4C 3SUDA 1V2OT 2ZFPH 5K0HA 2P93A 1C1TA 3GDSA 3WW7A 1C5ZB 2ZECA 2O8MA 1GMHG 3A7ZA 3EQ0H 2ZDMA 3TNSA 5T3HA 2BVXH 1IHSH 3SJKA 4Q7YA 1AGJA 2C8XB 1NS3A 1V2ST 3GY7A 3A8BA 1T8NA 1J17T 4DCDA 5LPFA 4TPYA 1QBVH 4X6OA 1L2EA 2XC5A 1D6WA 1GBFA 1E36B 2AIPA 1P0SH 1NTPA 2YMSD 2D2DA 3LPRA 4Y0YE 1ZYOA 1OKXA 1O2MA 4P00A 2A31A 2P3FH 3NCLA 2TGDA 1KXAA 2TIOA 1UJ1A 2BOHB 1OSSA 4E7NA 3QZRA 3QZQA 1SFIA 2FYQA 4E7RG 3NXPA 2WPHS 2F9NA 3T25A 5TCAA 3BEUA 4K1TA 1DOJA 2BD9A 3NUMA 1D3QB 3T62A 4ABEA 5EODA 1GBDA 3UR9A 1W13U 1QR3E 1RD3B 4ABJA 1DICA 3MU4A 4KTCA 3SU6A 1P06A 2XYAA 1UW7A 4ISIH 1XMNB 4XDEA 3LKWA 1P9UA 3MO3A 3RXDA 1OWJA 4B2CA 4AG1A 1GI2A 3SU0A 1O3AA 3L33A 2JH6D 3OU0A 5EQSA 3OEHD 3LH3A 4UFFH 2M5TA 2Y82A 3RUOA 3H7TA 1NFXA 1EAWA 1TBQH 4WXIA 2TGPZ 3ZVEA 1GVLA 1BRAA 2W5EA 1O2SA 1HLTH 4AGJA 2BLWA 2BLOA 4CBOA 1Q3XA 2FO9A 1MKXK 4BXWA 1GI8B 2DE8A 1UTKA 3IWMA 1HXFH 2RFKC 2HGTH 2BX3A 1UHBA 3T5FH 1V2MT 1MTVA 2ZWLH 1TNIA 1FZZA 1WUNH 4M9FA 3TK5A 2ZPQA 1Y3WA 2SNVA 2EC9H 1XKAC 4GCHF 3SUFA 4BTUB 3BEIB 1FY4A 1O3KA 2OBOA 2F43B 2JDID 2THFB 4JZEH 4ZH8A 1P2KA 4B71A 3HPTB 1HAGE 1B0EA 3ENSB 4UDWH 2HNTC 1IQFA 3NPSA 2BVSH 2O8UA 2A1DB 1DX5M 1IQEA 1SGYE 2VVUA 1AWHB 1GJDB 3Q00A 1T32A 1VJAU 5CHBA 3M36A 5DGJA 1Y3VA 3PMHB 4WMFA 5F8XA 2G81E 2OQ5A 1DANH 3EA8A 3AW1A 1MUEB 1EP5A 3BTHE 3OAAD 1HJ9A 1XUIA 4WH6A 1MTUA 2BDYA 3TJUA 2OC1A 2Z9IA 3RU4D 4IC5A 1Y5AT 2R0KA 2SGFE 3SNCA 3BTQE 3SOSA 1SSXA 1FY1A 1MTNB 1CQQA 1S84A 1PQ7A 1QBOA 1G3BA 4BAQB 4XBBA 3C1KA 3M7UA 4BTIB 1C5WB 3RP2A 3SHAH 2A7CA 3GYLB 1EFRD 3SUEA 3A7XA 1AVWA 1HDTH 1YLDA 2FLRH 2KFWA 2XBVA 4AFZA 3N99A 1B5GH 1SGQE 3TGIE 3AAVA 3TPIZ 4I33A 4AGKA 1AKSA 1K21H 1RTFB 4M7GA 1IQHA 3GY3A 2O8LA 3MH6A 1WTHD 4IMZA 4Y10E 2F9VA 2ALVA 2ZPRA 3TH2H 1QGFA 1UMAH 1BTHH 1O3PB 1EATA 3QTVH 1DY9A 3GDVA 4DG4A 3HK6B 1P05A 3EE7A 1EB2A 4DGJA 1LDTT 1TFXA 2QF3A 7ESTE 3PLKA 1XXDA 1GBJA 4KTSA 1E0FD 1DSUA 4HG6A 4XSKU 2GCHF 1GCTB 1VKYA 1BJVA 1QL9A 2VVCA 3E91A 3LGYA 2IJD1 1C4V2 4DT4A 2QIQA 3MU1A 3SHCH 1GJCB 2OC0A 1BCUH 3RXTA 5LH8A 1W0YH 1WOFA 5DG6A 1EPTB 1HBTH 4Y6DA 3ZZ4A 5GXPA 1F0RA 1SLVB 2OD3B 4XRNA 3M5MA 1OYTH 3SU1A 1EXFA 1B0FA 2AGEX 5T6DA 1YPMH 4TWWA 1S83A 4RT1A 4UEHH 1EJMA 1UK4A 2GMTB 1YWUA 3LGVA 1Z6JH 2FWWA 4TY7A 3S7HB 3A86A 1SLWB 1SGDE 3KEEA 3VB4A 1SQOA 3BG4B 4K69A 3MI4A 1AFQC 4INLA 1SOZA 5FBEA 3UTUH 4XFQA 4BTTB 5E0HA 2G55A 4O97A 2TBSA 1YPGH 4FUIA 1ETTH 4DIHH 3EA9A 4XE4A 1LVOA 1P03A 1TABE 1P9SA 1CGHA 5JBAS 2FMJA 2ZG0H 4U32A 1ZTJA 4E06H 4SGAE 3AW0A 4WF8A 1ELFA 4WH8A 2ZDLA 1ANBA 1QJ1B 1P8VC 1QJ7B 2ZPSA 1YCPH 2PGBB 2A4GA 2ZFFH 1T4VH 3D49H 3QWCH 4FETA 1C1NA 1OP2A 2GMTC 3KN2A 3ATKA 4HZHA 2BHGA 2Z94A 4YESB 4BOHA 1Q2WA 2SGPE 3D62A 1A2CH 2ZU4A 2ZGCA 3B23B 4B6FA 1O2JA 2GV6A 2ZTZA 5IYTA 1SQRA 4D9RA 1GI6A 1UVOA 1N6XA 3KQBA 4HFPB 4IBLH 4D8NA 1WV7H 6CHAC 5GCHG 1O2YA 3U9AH 3SN8A 1E1RD 2FESH 1O34A 4NA7A 4OS1A 1KDQA 3FZZA 1O36A 2PP6A 4YT7H 4ABHA 2G4TA 3BV9B 1HAVB 3EAJA 2F3CE 2XC4A 7GCHG 4B2AA 1XUKA 1C2DA 1SBWA 5KGOA 1QY6A 1H8ED 1KLTA 5C1UA 1YPEH 3ZIAD 1DWBH 1EASA 1QNJA 4FU9A 1LHCH 1P04A 2RG3A 1TQ7B 4H4FA 1TPAE 2G5NA 4DVAU 1TGNA 3GCTF 5JPMH 2G5VA 3RXCA 3QUMP 5A8XA 4ZMAH 4ZKRU 4K60A 2Z3EA 4HI3A 1LVMA 3SORA 4UD9H 1TGCA 1VGCB 3LOXA 2XOKD 3KHVA 3A85A 4TSFD 1BMFD 1N8OB 2WPDD 2VINA 1NBME 1TX8A 1ESBA 3GY4A 1FY5A 2CXVA 3H7OA 1SGFA 4YOJA 1WYKA 2XWAA 2QA9E 2VIPA 1UTPA 3A89A 4X2YA 5FPTA 3UUZA 1V6DA 1AMHA 1INCA 1GHYH 2Q1JA 4NSVA 1KXEA 1GVZA 1YBWA 4FUDA 3RC6A 1LTOA 1ACBE 4CBNA 1FIZA 3E0PB 2OLGA 1G37A 1WQSA 1BB0B 1E79D 2J92A 3D23A 3S9CA 1A46H 1C4U2 4BNRA 2WV4A 2FPZA 1C1QA 1VGCC 3S7KB 2QC2A 2GGVB 1GDQA 3PB1E 3UNSA 2UWPA 3MTYA 3A8DA 4WXVA 1N8OC 2BDIA 4Y0ZE 2C8ZB 1CHOG 2DE9A 2ZU1A 1L4DA 2PFEA 1BOQA 1YLCA 3FP7E 2JJ1D 2J98B 4R8TB 2XCFA 3FZDA 2J9NA 3LU9B 4FVBA 3SJ9A 2QV1A 3RXPA 3MNSA 1ESAA 2PUXB 2NU4E 1PYTD 2QF0A 4AYVB 1P57B 5FAHA 4B1TA 4CRDA 3ZV8A 1MD8A 3F9GA 1C1MA 1HAPH 2WHXA 4RSPA 1SI5H 1KLJH 5DP9A 3QO6A 2UUFB 3RXKA 2H9EH 3F1SB 2Z3DA 5JYIA 1TWXB 2ZI2H 5FL7D 2XBYA 5C5NA 2NU0E 1YYY1 2FOAA 3CS7A 2ZKSA 1YKTA 4Y71A 4ZUHA 2PWXA 3I77A 2EA3A 1TX6A 2AEIH 1VITG 1K1JA 2I6SA 3MO9A 1KXCA 3A7YA 3RLWH 3RU4T 2ZHEH 1Y8TA 2W6ID 2M2AA 4I32A 3K65B 1NFWA 2XWBI 1Z8GA 2V0BA 2D26C 2C8YB 1HFDA 3BF6H 3UB0A 3HKIB 2IOTA 4ABIA 2FX4A 1SOTA 5HGGA 2HALA 3EYDA 3P8OA 5JDUB 4B75A 4AORA 3HATH 5HMAA 1V2QT 2HNTE 3PWBA 5EXNA 5CDFE 1O0DH 1OP8A 3U8OH 2FTMA 1GBBA 4O3UA 2VVVA 4H6SB 1BIOA 7KMEH 2PKSC 2LP6A 2TGTA 2WV5A 2FOBA 2ZHFH 3RC4A 1GMHF 1C5TA 2YMSB 3A84A 2JKHA 2VB0A 5T6FA 2ILNA 4OS6A 1E35B 1C5RA 1B7XB 5CMXH 5A0AE 1MQ5A 3QK1A 5C5OA 2J95A 1V2KT 3MU0A 2YOLA 5I46H 2LNCA 3K9XB 4THNH 4U01A 3KQCA 2ANWA 3ATLA 1CA8B 1GJ6A 1UK3A 5A8ZA 2ANYA 3P8NA 3VGCB 2W3KA 2OCVB 4MG3A 4O3TA 1CGJE 3VB6A 3ODDA 1ETSH 1GG6C 2J38A 1TRNA 4JK5A 2O9QA 1OP0A 1PPBH 3RXEA 2Z6BD 1W12U 3MU5A 4BAKB 1UVTH 1V3XA 3ZYDA 3PROA 3DSOA 3SZEA 2JETB 4O9VA 2AMDA 1A7SA 1E34B 1L0ZA 6ESTA 1AIXH 5FX6A 1OYQA 5E0GA 4A92A 2PKAB 4MDSA 1C1UH 5PTPA 3M61U 1G30B 1XUJA 3SV2H 5DK1A 3VFEA 1O2RA 1O2KA 2ZF0H 1ZGVA 3VGCC 1CVWH 3M5LA 4FUGA 2ESTE 1EOLA 4X6NA 1MTWA 5EXLA 4Q7XA 1K0HA 5I25A 4NIWA 1VR1H 2AGIX 2XNIA 1CGIE 2WPMS 3MOCA 3ODFA 4I8JA 4K2YA 2CGAA 4D7FA 1NRPH 1S81A 1LVYA 4NWLA 3TJOA 3F68H 2JETC 1ZHMA 2H2ZA 3RXHA 1DLEA 2XNDD 5EJZA 3ZZ9A 2BY6X 3N7OA 3VEQB 3ZVCA 3HKJB 1P2NA 2GJGA 1ZMJA 4IN2A 3UWJH 1IQGA 3P70B 3VXFH 1W14U 1HAOH 4D7GA 1GI1A 3U8TH 4LZ1H 2XBXA 3OTPA 4BAHB 1BTUA 4HGCA 1W10U 3PRDA 1E37B 3TJNA 2RCEA 3BTGE 3RDZA 2GVFA 3U69H 1LHFH 4SGBE 1GJBB 1QRZA 4I8GA 4X6MA 2NU1E 1Z7KA 1NRRH 1HAIH 1GMCG 1PFXC 3P8FA 2GT8A 2ALPA 4NA9H 2Y5HA 1NU9A 1THRH 1ELEE 2A4QA 3O8DA 1SMFE 1SG8B 4LK4A 1RRKA 2GKVE 1GMDG 1XXFA 4D9QA 5C0TA 5KECA 1UTOA 5EW1H 1O2WA 1P01A 1NESE 3GY8A 2OC7A 2UUKB 1GJ9B 2OK5A 1QHRB 1ZHPA 2C3SA 3TLOA 5HM9A 1HRTH 3FANA 2Y80A 5JBCS 1NRSH 3SV6A 1U6QA 2B8OH 1CE5A 4GHTA 5F53A 1C1PA 4Q63A 1O2OA 1TA2A 4ZCNA 3OTJE 3FO8D 3STIA 1KTTB 1RTKA 1QJ6B 4I7YH 2G52A 3CENA 4YT6H 3FVFB 1K1OA 2Z9LA 2WV9A 1KXBA 5AF9H 1IHTH 1F5LA 4J1YA 1A5IA 4DT7B 1JIMA 1BRBE 1ZTLA 1GBMA 2BY9X 1MKWH 1YCPK 4A5TS 2BDGA 2WUBA 2GT7A 2BD7A 2D1JA 4NIXA 1MD7A 1A61H 1UHBB 1UO6A 3PV5A 3DT0H 1NC6A 4K8BA 3PLBA 3EE0B 1ZRKA 2F9OA 3RXUA 4Y8XA 1OWIA 3SGBE 1AO5A 1ETRH 1YM0A 2BQ7B 2GZ7A 1ABIH 1A0JA 2PHBA 2Z9KA 3PO1B 4FUCA 5DO4H 1F5KU 1NBMD 1TNGA 2CK3D 2QXHA 1C5YB 2G4UA 1YCPM 5LPEA 1ELCA 3SGQE 5B6LA 3KYGA 1F0SA 3ZVFA 1NM6A 1O32A 4GAWA 2QE7D 2VGCB 5EW2H 1GBIA 2VIOA 3UFAA 1BTYA 1S6FA 3UOUA 1P2JA 4MPXA 1IQKA 1TQ0B 5KEDA 3GOVB 2BX4A 1O3EA 1V2UT 4AB9A 1ZPCA 4MNXA 2OINA 2F91A 1GI0A 2UWOA 3LJOA 1C2MA 2EEKA 2FDAA 2SGDE 1MAXA 1LCYA 5A8YA 1S0RA 2ZDNA 3VPKA 4D76A 3UNRA 2HRVA 5HIYA 3DD2H 5CE1A 3GY6A 3EGKH 3K6YA 1GPZA 2HPQH 3MNXA 4X1RU 1PQ8A 1C5SA 1MU6B 1HJAB 5C2ZA 1S82A 1BRCE 1LMWB 4R0IA 2AERH 1JIRA 3RM2H 1EB1H 4FUJA 4TY6A 4ACAA 1O2NA 4XOJA 3MH5A 2PSXA 1AKSB 1LQEA 1ZMNA 3ZZ8A 1UTJA 2OQUA 1H8IH 5FX5A 1P2OA 2BD2A 3NRLA 3PV4A 1DXWA 2BD4A 3MFJA 2BDCA 3LH1A 4JZ1A 4X8UH 1ELAA 2Y5FA 9LPRA 4Z1MD 1HAYB 2O8TA 1ANEA 2QN5T 2ULLA 4AB8A 1HJ8A 1K1IA 4NFFA 3SV7A 1S5SA 1GI7B 5GNDA 4Y8ZA 4YTAA 4WJG2 4X1PU 1DWEH 5A2MH 3LJJA 2A2QH 1F7ZA 3E1XB 4ABGA 1TBZH 2V3HH 3A7VA 1UTNA 1P2MA 1ZR0A 1HYLA 1GJAB 1GVKB 3GY2A 4Z0KA 1TGSZ 1C2HA 1XUFA 3F0PA 3H09A 3V12A 2W7UA 3ATWA 3LGTA 2ZIQH 2F9BH 1O2HA 2ANKH 5EQRA 4ZKOU 1MTNC 1F0TA 1GGDB
chains in the Genus database with same CATH topology
2BY8X 1J16A 1HGTH 1SGCA 1TALA 4BAMB 5SGAE 2FZZA 1YPHC 3S69A 1DY8A 3F9HA 4FUBA 4B73A 1XUHA 2FS9A 2RA3A 3I29A 1ESTA 1LHGH 1ZTKA 2AGGX 2PW8H 5GCHF 1OPHB 3A81A 1V2TT 1MBMA 4WMDA 3T27A 1EZXC 5BRRE 2BOKA 1QL8A 5T6GA 4HTCH 2HPPH 1T8MA 5C67A 4ABFA 2FYRA 4AFUA 1TB6H 3UQVA 7GCHF 3SU2A 2BLQA 1SR5C 1BUIA 1ORFA 3A7TA 1UVPA 2W3IA 2Z3CA 4ZKSU 1TNLA 1ZZZA 2O8WA 1LKAA 1GGDC 5FCRA 3RLYH 1WCZA 1N1LA 2ZEBA 3M7TA 1HIAA 1NU7B 1O3JA 4X6PA 1F2SE 2Z7FE 1C2IA 1P09A 1GCTC 1ZJKA 3Q3XA 5F6MA 2ZCHP 3U1IB 3ELAH 3SU4A 1CT4E 1EKBB 3M3TA 3RMOH 1O31A 3NWUA 2H6MA 1TX7A 1AQ7A 1QIXB 1OX1A 2W26A 1MMJN 5ETXA 1EPTA 2CJIA 1TONA 2C4FH 5FHTA 1EPTC 5C3NA 1O2XA 4AG2A 1T8OA 1O3BA 4MPUA 1RIWB 1ABJH 1PQAA 4GPGA 1GWAA 1BDAA 1BMLA 2GX4A 1CSOE 3ZYEA 2UUYA 5F03A 2GCTB 5G4BA 2SGEE 4ZHMU 4MTBA 2XXLA 3E8LA 3UR6A 1W0ZU 1ZSKA 1QB1A 1TMTH 1A3EH 3BTDE 3DA9B 3IG6B 4A7IB 3MYWA 3BG4C 4ZHAA 1EP6A 1D6RA 2NWNA 1QQUA 1JWTA 1NROH 4JMYA 1P12E 4X8SH 1GBHA 4BANB 3BTWE 2CV3A 1CHOF 2OC8A 2QYIA 2BQ6B 4UFGH 1C5PA 2BDHA 4ZAEA 2B9LA 3SNEA 3ZZDA 1FPCH 1H9HE 1WAYB 3BTFE 1SHYA 3SNBA 4YZUA 3MH7A 2K1QA 3MHWU 3QX5H 2ZQ2A 4UFEH 1P2IA 1SPJA 1Y3XA 1IQLA 2J2UA 5EU8A 5DP7A 3GY5A 2TGAA 1SGFG 3UWIA 3OSYA 1MCVA 3TU7H 4NIYA 4UONA 2HWLB 2BD5A 3PTBA 1DLKB 1HCGA 4OS2A 3F9FA 2AFQB 5GJ4B 5CHAB 2KAIA 5EPNA 1M9UA 1BMNH 3GYMA 2GV7A 1O3GA 1D3TB 1Z8IB 2FP7B 1BJUA 1C2LA 2RA0A 1TNKA 1VITF 2ZGHA 3B9FH 1H4WA 3PMBB 1EX3A 2BVRH 4X0WU 1ELVA 4MNYA 5J4QA 5GWZA 1QQ4A 2ODYB 1HPGA 2JH5D 4NA8A 3GDUA 1QRWA 2R0LA 3ZZAA 2HOBA 1LPZB 1PQ5A 1Z1IA 1EOJA 1WU1A 1TIOA 2XCNA 3SJOA 3RXAA 1GHBG 4OS7A 5H4IB 3MO6A 1O3CA 1TOMH 1Y3UA 1SGNE 1O3FA 1J8AA 1FV9A 1BZXE 1GDUA 4KELA 1AE8H 2AH4X 4A1TA 2BM2A 3OX7U 2BD8A 3KCGH 1FY3A 3A80A 1W2KH 1AUTC 1ZPBA 1CHGA 3W94A 2FOMB 2R9PA 2LPRA 4A1XA 1GHZA 4WWYA 1D3DB 1DDJA 3JZ1B 4JK6A 5A09A 1HAZB 2VWLA 4AN7A 1ELGA 1L1JA 1TMUH 2A2XH 2CMYA 4O03A 1W7GH 1PPGE 4B74A 5E8EH 1GJ7B 1G3CA 3SQHE 2Q6FA 2OP9A 8GCHG 3HGPA 1MZAA 2ZU2A 2FEQH 5DP6A 2V3OH 2H5CA 1O2QA 1TRMA 4AZ2B 3RXIA 1A4WH 1O3OA 1T8LA 1HV7A 2PR3A 3TJVA 5JBTA 1D3PB 1C2KA 4F49A 1MKWK 3PM3A 1O3MA 3P17H 3QDZB 1P02A 1LHEH 2XBWA 1GHWH 3RXMA 1V2WT 1SQAA 1ANDA 1GJ8B 2FS8A 2PTNA 1C9PA 2V35A 3STJA 4FUHA 5C20A 4K1SA 1F92A 4FU8A 1Z8RA 5EQQA 1FPHH 1QB9A 3W95A 3RMMH 4XBDA 3Q76A 1QA0A 1CO7E 2EI7A 5EG4A 1Z6EA 4CRAA 4TYDA 1YPJH 3ZZ6A 4AOQA 1EJNA 1TNJA 1QRXA 2B7DH 2QXGA 4DURA 3T2NA 1O5AB 5GPIB 3SV9A 1JMOH 5HM2A 4CH8B 4OS5A 1L4ZA 2BYAX 1CA0B 1EZQA 1OS8A 4CHAB 5JB8S 2QXJA 1GHAG 3E3TA 3MWIU 3PTNA 4Y79A 4FU7A 2BMGB 4YOIA 3E90B 1C5XB 2GD4B 4NG9H 4U2WA 1LQDB 4IS5A 3V13A 4IN1A 1RGQA 5TJXA 4JZIA 2PLXA 2A4RA 4K1EA 1AY6H 1KXFA 4ISHH 1P11E 1DVAH 1X7AC 2ZDKA 3KL6A 1GMCF 3UQOA 3F9EA 1Q31A 1WTGH 2FODA 3LT3A 4MLFB 4Q80A 1SVPA 2B5TB 4CRGA 1O5FH 4CHAC 3SBKA 4MQAA 1GMDF 1O2TA 4X2VA 2A7HA 4YLQH 5DJ7A 1BTXA 4AYYB 1GBLA 5HXFA 2A0QB 1O2IA 3OY6U 1RTLA 1BITA 1O2GH 4YO9A 1O37A 2YNAA 2A45B 1KYNA 1C5LH 3T26A 1H9IE 1FNIA 1V2VT 2W7SA 1GBEA 5B6OA 3RXQA 3UNQA 1BRUP 1Z1JA 1C5VA 4CRFA 1ZOMA 1NRQH 1SGRE 1P3EA 3VB3A 4ESTE 3OYPA 4JCNA 3TGJE 3SU3A 3NZIA 4NGAH 1YPHE 6GCHG 3BG8A 4QT8C 3A87A 3QTOH 4Y11E 5A0BA 2A4OA 1TAWA 3LONA 3GCHB 2Q6DA 1YP9A 1UVUH 3MMGA 3IITA 1SGTA 2PKAA 3ZZ5A 1UTLM 3MNBA 1WBGB 4ISNA 1C2FA 3HGNA 3ESTA 1TLDA 1A0HB 4WVPE 2VU8E 4J2YB 3AASA 1O5CB 1TNHA 3P6ZB 2VWOA 3SI4H 4MPWA 3U8RH 4TPIZ 1V2RT 1FI8A 2P3UB 1PPHE 3M35A 1F5RA 2CF8H 1AZ8A 3E0NB 4KKDA 3WY8A 3KIDU 1C5QA 2CF9H 3QGNB 4XBCA 5DP5A 1K22H 2J4IA 1IQJA 5ESTE 4AFSA 5AVDA 1O2LA 3R0FA 4NZQA 3ATMA 3GCHC 4A1VA 4ZXYH 3RXRA 3M37A 2ZHQH 4KP0A 5FCKA 2OXSA 4B2BA 1P10A 3DUXH 2OTVA 4K8YA 3T29A 2A32A 2WINI 4CRCA 4A6LA 2AS9A 1MZDA 2FX6A 3RXLA 1BT7A 1P3CA 4GVUA 4INKA 1LO6A 4I8HA 2VNTA 1OWEA 4Z6AH 1G32B 1AFEH 1CBWB 1FY8E 1LVBA 1BQYA 2ZU3A 2P16A 1VCWA 3VB7A 3PWCA 4JZFH 4DY7B 2DUCA 2R2MB 2ZDAH 1NT1A 3S9AA 1XX9A 4JZDH 1LHDH 1NZQH 2BDAA 1TGTA 4IGDA 2EI6A 1DUEA 1MAYA 1G3DA 4FXGH 2OUAA 1AZZA 1TA6A 4JYTA 3LGUA 5EOKA 3NKKA 1A5HA 3RXBA 1QB6A 2V6NA 4X1NU 4TWYA 1NY22 2XTTB 1AD8H 5FPYA 2BLVA 1MTSA 2ZDVH 4B76A 3RXVA 1CBWC 2VIDA 1THSH 2ZQ1A 1G9IE 1J15A 2BZAA 4NSYA 1A5GH 2AMQA 3KQEA 3G01A 1UCYH 1C5OH 5L30H 4NIVA 3RXOA 1Z8JB 2ZA5A 3RMNH 1L1NA 1VITH 3V7TA 3A82A 1W3CA 3BTEE 2C90B 1RFNA 1A3BH 4I8KA 1O3DA 1H1BA 1SGIB 2A7JA 4VGCB 2WPJS 4ABBA 4Y7AA 1AVGH 1AU8A 4KGAA 1HNEE 1PPFE 1BA8B 1ZSLA 1C1OA 2ZGBH 2Y81A 2SGAA 3GCOA 2I6QA 4K3JA 5DP8A 3VB5A 3Q77A 3PO1C 2QAAA 5EPYA 1MQ6A 1QL7A 1GBKA 2ZU5A 4NWKA 1OOKB 1DFPA 3P95A 3ZZBA 1C1VH 1GDNA 4K5ZA 2PTCE 2EI8A 1G3EA 1FAKH 5F8ZA 3PMJA 1DS2E 3O8RA 1O38A 1MH0A 1GL0E 1L1GA 5BPEA 3ZZCA 2VGCC 3DHKH 1OWKA 3JZ2B 3BIUH 1H8DH 1D4PB 2STAE 1ZRBA 4VGCC 2ZTXA 1FUJA 1O3HA 4Q2KA 1HXEH 5L6NH 1PPZA 4WY3A 2BY7X 3URDA 4H42U 2AYWA 1GI4A 1KXDA 2R2WU 4OGYA 1SGEE 1AB9B 2BB4A 2PUQH 1K1PA 3ZZ3A 4X8TH 1O3LA 1BBRH 1JOUB 4DIIH 3M5OA 3E6PH 1NO9H 1HJAC 3UPEA 2BZ6H 2TPIZ 3O8BA 4MNWA 4I8LA 2STBE 1AVXA 1G36A 5FBIA 1ARCA 3C27B 2BXTH 2FI3E 2IPHA 1THPB 1SHHB 1XUGA 2ODQA 4Y76A 1ZSJA 4ZKNU 3RXSA 1MCTA 1V2PT 2P3TB 1ZJDA 3Q3KA 1O30A 5J4SA 2Y7ZA 4GCHG 1FMGA 3AAUA 2WYJA 3CP7A 4NCYA 1AB9C 4RN6A 1DPOA 3SNAA 1E38B 2NU2E 2A5KA 1DWCH 3BEFB 8KME2 3TITA 3K2UA 3SW2B 3QLPH 3DFLA 1NFUA 9ESTA 2ZFQH 1Y5UT 2IN2A 2GDEH 3UY9A 5HYOA 1C5MD 1HIAB 4F4OC 4WMEA 1C2JA 2G8TA 2J34A 1TPSA 2FOGA 1O3NA 1YPKH 1O35A 1W11U 4AX9H 3P92A 1AFQB 4U30A 1C1RA 2FOCA 1KSNA 2CHAB 3KNXA 1G2LA 1NN6A 5AHGH 5E2PA 1HAXB 3ITIA 1OXGA 1BTWA 1QCPA 1FQ3A 1EQ9A 1O5BB 2BD3A 3ATIA 3MNCA 3PLPA 3EDXB 2H9HA 4IW4E 1H9LB 2GZ8A 1YPLH 2P94A 2Z9GA 1UCYE 1T7CA 1QBNA 3S9BA 1W7XH 2GP9B 3E16B 4GHQA 1QFKH 1HB0B 3FFGA 4OS4A 2Y7XA 1O5DH 1VCPA 1HUTH 4ZHLU 7LPRA 1KLIH 1FN6A 1NFYA 1IAUA 3M5NA 1VZQH 3BTTE 4ABAA 3OY5U 2VWMA 1J14A 1TRYA 4OGXA 4LXBH 1SQTA 1JRSA 1DUAA 6CHAB 2CHAC 5DP4A 1ZMLA 1W8BH 3EA7A 2AMPA 3FP8E 2F9PA 4BAOB 4H6TA 1SB1H 1SFQB 1FDPA 1GHBF 5FXLA 5ABWA 1AN1E 1A1RA 1KDQB 5L2ZH 1WQVH 4GUXA 1GL1A 5LGOA 5F8TA 2P95A 2QY0B 1K1MA 1Y3YA 4ISLA 1C9TA 2J94A 3CS0A 1C5UA 2ZO3H 3M3VA 2WPKS 3NK8A 2R3YA 3ZVBA 2FOHA 1GI5A 1JRTA 3VXEH 1GJ5H 2G51A 2XW9A 3A8AA 3TGKE 2A5AA 1TBRH 1RIWC 3BIVH 2GCHG 4RKJB 4X1SU 4YLUA 1MKXH 3URCA 4GSOA 3K6ZA 1ELDE 5A0CA 1J9CH 3GCNA 2C93B 2KAIB 8GCHF 2GCTC 3SNDA 1GBAA 2PV9B 4YOGA 1BTPA 1AE5A 1V2NT 2VIWA 1NPMA 2WPLS 3LDXH 2C8WB 3RM0H 3ZVGA 5E0JA 5IDKA 1P2QA 1PYTC 3A88A 1BBRE 4ZROA 1K1NA 5DKMA 1EAIA 2ZCLP 1TGBA 1V2LT 5LPRA 1NRNH 2R3UA 2Y6TA 4MPVA 1UTQA 2SGQE 1ARBA 2VJ1A 2ANMH 1Y59T 1G2MA 3SV8A 1O5EH 2A5IA 3FP6E 1TPOA 1BTZA 2P59A 4FUEA 4BXSA 1GJ4H 1IQIA 1HAVA 1RXPA 2AIQA 3QN7A 2ASUB 1KIGH 3M3SA 1SLXB 1GBCA 1V2JT 2GZ9A 2YNBA 3M7QA 4X2XA 2TRMA 2QCYA 3AVZA 1BHXF 2NU3E 8LPRA 2FIRH 3D65E 4INHA 4ZXXH 2ZFRH 1ID5H 2ODPA 1O3IA 1O2VA 1QURH 1S85A 1OWHA 2ZNKH 1SLUB 4X8VH 1TMBH 2WPIS 6LPRA 2VWNA 8ESTE 4YM9A 1LKBA 4E05H 1JBUH 3GISB 3A8CA 4UE7H 1LPGB 5CHAC 4NFEA 4JYVH 2ZTYA 1C1SA 1GHXH 3A7WA 3U98H 3SO3A 3HK3B 4Q7ZA 1ZLRA 1IOEA 5GIBA 4AFQA 2FTLE 1DITH 1FXYA 1GHAF 2H1UA 5GDSH 1BMMH 3KGPA 1OWDA 4X1QU 3TIUA 3ZVDA 1DM4B 3RXJA 3S0NA 1C1WH 3RMLH 1WSSH 1C2EA 4UFDH 3TNTA 3P8GA 5FPSA 2ZFTA 1DWDH 2FLBH 1N6YA 3A83A 4GLYA 1ELTA 5EGMA 4CR9A 3H5CB 1KY9A 1RJXB 1C2GA 2VIVA 2ZZUH 1DXPA 1PJPA 1O2ZA 2QXIA 1JXPA 4IC6A 1FONA 2OBQA 1C4Y2 3LC3A 3V0XA 2ZFSA 2WUCA 5JB9S 1O39A 1ELBA 3RU4E 1GI3A 3UIRA 1C5NH 2IJOB 4PROA 1UTMA 2F9UA 5E2OA 1AUJA 5AFZH 1ANCA 2F83A 1FJSA 1TE0A 3BSQA 2ZP0H 3DFJA 3GCTG 2FOEA 2ZC9H 1TOCB 2ZHDA 4X2WA 1PPCE 1S0QA 1IQNA 1AWFH 1DE7H 2VH0A 4NZLA 1UK2A 3SUGA 5DP3A 1TPPA 1XVMA 1BMAA 3MH4A 1KTSB 5C1YA 1ZPZA 1K9OE 3SJIA 1UCYK 1D9IA 2ZGJA 1AHTH 1BHXB 1CT2E 2PKSB 4CR5A 5JBBS 3Q3YA 1O2UA 1FN8A 1O2PA 2BXUH 2UWLA 6GCHF 2G00A 4Y7BA 1HAHH 2HLCA 1F0UA 1TYNA 2FI5E 2JH0D 1MU8B 5K7RA 2B0FA 1YGCH 4ISOA 1Y5BT 2BTCE 1SC8U 1CU1A 2GDDA 2QGRA 2VIQA 4MVNA 3ZZ7A 2GTBA 3ZVAA 1GCDA 2FI4E 1XM1A 3TK6A 4FUFA 3ZV9A 1K28D 1O5GH 4LZ4B 1EZUC 4RKOB 4MNVA 3UOPA 1QA7A 3KQDA 1GG6B 1VCQA 2CN0H 3FAOA 1LPKB 3LIWA 4IMQA 2P8OB 2RDLA 2Y5GA 5L2YH