3URCA

T181g mutant of alpha-lytic protease
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLGQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urcA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urcA01
2BDGA 1DSUA 4YLQH 1KXDA 1O38A 1QL7A 3RMMH 1TRNA 1NFXA 4NSVA 5F8ZA 3LKWA 2AMDA 2DE8A 3SI4H 1DUAA 1G32B 2Z3EA 1C5XB 5L2YH 1FLEE 2ZDAH 1GBBA 3SUFA 3M3TA 1KXEA 2AH4X 1ETTH 1DWEH 1QR3E 4X0WU 1OWJA 3MU1A 2ZU4A 4BAOB 2FDAA 2PGBB 3BTFE 5DK1A 1YPMH 5EW1H 2C8YB 2P8OC 1TX6A 4RKOB 1ZRBA 3ATLA 1ID5H 2K1QA 1J14A 2P59A 3IWMA 4YT6H 2GGVB 2P93A 1L1NA 4KP0A 1HXFH 3RXVA 2IJOB 1BTWA 3P6ZB 4B73A 1FPHH 1FPCH 1GJ8B 1CT0E 3K2UA 5AF9H 1CA0C 1GG6B 3UR6A 2ZFQH 4THNH 7ESTE 4AYYB 4IMZA 3ZVDA 3OU0A 3U98H 1TMUH 1Z8RA 3QUMP 1AUTC 1H8IH 3A87A 4UD9H 5DP3A 1EPTC 3ZZBA 4H6TA 3SU0A 3U8TH 1C5ZB 1S82A 1EJMA 5E2OA 4D9RA 1GBDA 5JBTA 3UIRA 3UFAA 2FYRA 1TGCA 1BBRK 1O2SA 3RXKA 4KTSA 1N8OC 1RIWC 1V2RT 5PTPA 1UMAH 1HV7A 2JETB 3SZNA 1BTYA 2QXGA 4AB8A 4AG1A 1OP2A 1GBIA 1XVOA 1V2LT 4NSYA 1IQFA 2WPJS 1HBTH 4X6OA 3RU4E 2VVVA 1J15A 4X2WA 3QX5H 2ILNA 3ZVEA 1K22H 1XMNB 2ZHWH 2NWNA 2PUQH 4ISIH 3OSYA 4QT8C 2CF8H 4WY3A 5C5OA 3FANA 5CHAC 2H5CA 4ZKOU 2BD3A 2FOFA 2QIQA 2BOHB 1NZQH 1PQAA 1WQSA 2P3FH 1YPEH 2FTMA 2I6QA 2D8WA 1QL8A 3Q3KA 1AVWA 1MCVA 2FM2A 1BTPA 1HB0B 4ABAA 1Y5BT 1S0QA 1WAYB 3OY5U 3C1KA 1ELDE 1UTJA 1ESTA 1Y59T 4FUEA 1QB9A 1EAUA 3ZVBA 3KQDA 1GMCF 1AZZA 4WMDA 3LT3A 3GCTG 3SUDA 1VR1H 5J4QA 3PLPA 1S85A 2XCNA 3BTGE 2ZO3H 3UOPA 1TA2A 1TGTA 1YCPM 1GBEA 1FIWA 1MTWA 1TGBA 2J34A 1C1SA 3FAOA 1GBTA 4GPGA 2BY9X 4UFFH 2IPHA 1V2ST 5F6MA 4F49A 3TGJE 3A8BA 1GCDA 1N6YA 3GDUA 4IBLH 1N1LA 1V2JT 3K65B 2OCVB 2CHAB 1O2LA 2CJIA 4D7GA 2A7HA 2ZI2H 3PLBA 2P3UB 2TRMA 1XUGA 2WYGA 2SGQE 1TPAE 2PHBA 2ZECA 3R0FA 1QY6A 2DE9A 3BIUH 4O3UA 1TNJA 1AN1E 1KTSB 1E36B 1PYTC 3MNBA 1UVOA 3BTME 4B75A 2R2MB 3FZDA 1O2HA 4CRGA 3LGYA 1AVGH 3FP6E 1ELGA 4B76A 4Y76A 4J1YA 1F92A 2D2DA 5DGJA 1IQHA 3ZZ3A 3NWUA 1MZAA 4U32A 3DHKH 1O2UA 2WPHS 3CENA 5HXFA 3M61U 1C5MD 1GHVH 4DIIH 1XUKA 1F7ZA 2BD4A 4LXBH 5A0CA 1SQAA 1P02A 2FOEA 4AGKA 2XBVA 1SHYA 1BTUA 3Q00A 5JBBS 1HIAA 1SI5H 2J38A 2PKAA 1MTNC 1DLEA 1CQQA 5E8EH 2KAIB 1P0SH 2C8XB 3VPKA 1S81A 1BHXB 4X1NU 2SNVA 3M5OA 2V3OH 5J4SA 4FUHA 1SLWB 6GCHG 2WPMS 1FY1A 3VXFH 1NRNH 2TGTA 1W10U 1VCQA 1K1NA 1WOFA 1CHOF 4CRDA 1RTFB 4JZIA 1P2QA 2J2UA 3GY3A 1MD7A 4D8NA 1GMDF 2PKSB 1TGSZ 1EATA 3U8RH 3LOXA 4A6LA 4CRBA 3LGIA 2ULLA 4ZHAA 2Z6BD 4B1TA 1Y3UA 4DCDA 5HYOA 2XBXA 4E06H 4ISNA 1EKBB 1LHDH 1DY8A 3F6UH 2EI6A 1MQ6A 5EXLA 1FNIA 3EYDA 1QL9A 1HAYB 3ZZ6A 1C5NH 1LDTT 4Y8XA 5C5NA 2Z7FE 5H4IB 1UTOA 3UR9A 1BHXF 2A7CA 2ANYA 2F9VA 3RXHA 2Z9LA 3FFGA 1O39A 1NESE 2FPZA 3B8JA 4DIHH 1VZQH 1XM1A 3QTOH 4MNVA 1TNGA 4X8TH 3ZV8A 1PJPA 2ZIQH 5GCHG 1O5FH 1E34B 1MTVA 1FY5A 4A1VA 3SNCA 3LC3A 1TALA 2A4OA 1GDNA 7LPRA 2Z9GA 1EP6A 3BEIB 3K9XB 3RXRA 1P2KA 3S7HB 4ZHMU 1TOCB 1P12E 1HJ8A 2BXTH 1SGYE 2QF0A 2Z9JA 3RXUA 5L6NH 1D3TB 1CBWC 1ZYOA 3KEEA 4AFUA 2ZDMA 1GI1A 1BMNH 1F5LA 3BEUA 4Q7XA 1Y8TA 2V35A 4UFGH 1O5BB 4ABDA 3MU8A 1TNKA 1ELEE 3SGBE 1VITG 2VWLA 1WBGB 1KTTB 3E0NB 4ZXYH 3GCHB 1QRZA 2AFQB 2ZNKH 3RC6A 1Q3XA 1SLXB 1W0ZU 1DT2A 3GDVA 2ZGCA 5EOKA 4E7RG 2FXRA 1DSTA 1HYLA 1Z8GA 4GCHG 5A8XA 3QGNB 1OP8A 1C2HA 1X7AC 4I8GA 1M9UA 2XYAA 2Q6DA 4TWWA 1ZHPA 4I7YH 4GVUA 1GHWH 1O2QA 3A81A 3QTVH 3E0PB 2HALA 3SJ9A 3A7WA 2WV5A 1AVXA 2HLCA 3GY4A 1SBWA 4KTCA 1PPEE 4K1SA 2OUAA 1QFKH 3AVZA 2GP9B 1CA8B 5C1UA 3LONA 3BTQE 2HNTE 2FI4E 4I8JA 1YCPK 4XBCA 1RRKA 3A7ZA 1TFXA 1D3QB 2Y81A 1JIMA 1ETSH 5FX6A 2AERH 1A0HB 3RM0H 4OS2A 1GJ7B 4OS6A 4NCYA 4NIXA 3STJA 1G30B 3H7OA 2NU3E 1BUIA 3A84A 3V0XA 2VB0A 3RXPA 3SU1A 2ZGBH 1NC6A 2G5NA 3BTWE 2TIOA 2AS9A 1YLCA 3IITA 4Z6AH 5A8YA 2PLXA 1O3BA 1GHAF 2JH6D 4A92A 4WWYA 1T7CA 2PSYA 1W7GH 1C1QA 3T27A 1A0LA 2R2WU 3GOVB 3M7QA 1BB0B 4E7NA 3VEQB 1NTPA 2ZHQH 3ZZ4A 5GIBA 3UNRA 1GG6C 1P2NA 2FODA 3BTKE 1TBQH 2ZGHA 5DP6A 3GDSA 4FU8A 1PYTD 2STAE 4CH8B 1C1VH 1LHGH 1Z6JH 1UTLM 3TJVA 3TJNA 2BLOA 1ZSKA 4K8YA 1GI3A 2GMTB 3RC4A 2Y80A 3HATH 4DW2U 1NPMA 1C4U2 2ZC9H 4O97A 2ZHFH 2ESTE 1IQIA 1OS8A 1AE5A 3FVFB 3KN2A 2BLVA 3RXLA 1L1GA 4XFQA 2ZDVH 3A83A 4R8TB 4ABBA 1XUIA 4K5ZA 4MG3A 3MU0A 4PROA 1GBKA 3HPTB 2JETC 2BY7X 3PMBB 5F8TA 1UVSH 5C3NA 5AFZH 4X1PU 2O8WA 3NKKA 4AORA 1K1IA 2C8WB 1V2PT 2SGPE 3MH6A 5EPNA 4ZXXH 4YT7H 1ZGIA 1G3BA 1THPB 1NS3A 3PROA 5JB9S 1ZR0A 2BQWB 4AG2A 2ZU5A 1V2KT 3G01A 1V2VT 2BD7A 5L2ZH 1EP5A 1OWHA 1QBVH 2VVCA 1GHBF 1ZPCA 1CE5A 4ASHA 4GHQA 4Y0YE 5DKMA 3SU3A 1GBJA 3B9FH 1QTFA 2OD3B 1SFIA 3QZQA 1GMHF 1S84A 2HGTH 2XC5A 3PMAB 3LU9B 3V3MA 1T8MA 2OXSA 2CMYA 3P8NA 1O2IA 1C5QA 4NA9H 4NG9H 3RXIA 4U30A 3TH2H 2FOMB 5CMXH 1EB2A 4D9QA 3OX7U 2B5TB 4FUJA 2HVXA 1P2IA 4YM9A 3AW1A 1LO6A 1A7SA 1SG8B 5FAHA 1SGEE 2O8LA 3EA7A 2FOBA 2BDHA 1JWTA 1T32A 2ZU2A 1OYQA 2W3KA 4NA7A 3TGIE 1HAGE 1C2DA 4X2VA 4DT7B 1BMMH 1HCGA 5GWZA 3H5CB 1XXDA 1QQUA 1A3EH 1Z1IA 4CREA 3PWCA 1VJAU 3BN9A 4JZFH 2BZAA 3KHVA 1Z6EA 3VB4A 1EUFA 3QDZB 1QA0A 5FBEA 1WCZA 1RD3B 2YNAA 1UTKA 1KLIH 1LKBA 2CHAC 3SU5A 3VXEH 4XDEA 3S69A 4KELA 2D1JA 1SLUB 1AO5A 4I33A 1W12U 1LKAA 4LOYH 1GMCG 1JIRA 2ZQ2A 1BCUH 3RM2H 1C2GA 1SGNE 3ITIA 3RXEA 1P2OA 1TPSA 2VWMA 1O3OA 3D23A 1O2XA 1AIXH 5EGMA 1O30A 1DY9A 2A4QA 5FCKA 4MLFB 2GZ9A 2GV7A 1MKXH 2ZDKA 4BOHA 3VB7A 2Z3DA 4X1QU 1OYTH 4O3TA 2AIPA 1O2KA 2XW9A 1W8BH 2ZPSA 3BG8A 1IQLA 4CRCA 3RMOH 5FXLA 1IHSH 5JBCS 1KXAA 4HI3A 2BX4A 3KNXA 1YGCH 1J16A 3NUMA 2QV1A 1YPGH 3MHWU 5C67A 1AB9C 1G2MA 3LJOA 3T26A 4IN2A 2VWNA 1ZJDA 1W0YH 4X6MA 1SGPE 1G3CA 1GVZA 3CP7A 3F9GA 1EJNA 1GI9B 2PTNA 5HM2A 4DOQA 1GHYH 1DWCH 4FUFA 1DM4B 3S7KB 3VFEA 2QGRA 1RTKA 1YBWA 2H6MA 1BBRE 1GDUA 1GI7B 1O3MA 4YO9A 4D7FA 2H9TH 1BTHH 1HAOH 4Q2KA 1K1PA 2BZ6H 2PKSC 4ZKNU 1LVYA 3NPSA 1B0FA 5EQRA 4H6SB 4Y10E 5JB8S 4ABEA 2G5VA 3A7YA 1D6WA 1YPJH 1TAWA 2UWLA 1FONA 3B23B 1ZOMA 1TABE 4UEHH 3RP2A 3EDXB 3LGVA 2KAIA 1PQ7A 3E90B 1FV9A 2HNTF 3M37A 3PM3A 1B7XB 1KXFA 1P2JA 2JH0D 4AFSA 3O8CA 1OWKA 1VJ9U 2PTCE 3LIWA 3SGQE 4NWKA 2ANMH 1GWAA 1T31A 3JZ2B 3DFJA 2LPRA 1CHOG 2M5TA 1FAXA 1O3HA 1BTXA 2GV6A 5C1YA 5G4BA 1FUJA 1ELFA 5DJ7A 1SVPA 1ORFA 1O3PB 3SQEE 3F9EA 2TGPZ 1CGJE 1GMDG 3TITA 3TH3H 1GI8B 2GVFA 3F9HA 1K1JA 1V2QT 4FXGH 5I46H 5JYIA 1V2WT 1ZPZA 2GZ8A 1P9SA 1ESAA 1KIGH 1BRBE 2SGAA 3TK6A 1BBRH 3SORA 2FX4A 3U69H 3E3TA 2OP9A 3LC5A 2AEIH 1QNJA 5JBAS 1XUJA 3KL6A 1AKSA 2FI3E 4ABJA 4B2CA 4YOGA 1E38B 1EPTA 1O32A 1AUJA 1GI2A 4Q80A 3T5FH 3SV7A 2ZF0H 1SPJA 2BX3A 2GT7A 1BOQA 2BB4A 3IG6B 1NU7B 2VINA 2TGAA 1T8OA 2VWOA 2VU8E 2GCTB 1CHGA 3C27B 3GCHC 2WUBA 3ESTA 1EJAA 1UVTH 1IQKA 1ELVA 4ZHLU 3ATWA 3SQHE 5HMAA 1F0UA 1NRQH 1C4V2 2V3HH 3D65E 4IGDA 4CR9A 1S6HA 2BD5A 1C5RA 1GBCA 5CE1A 2W7SA 2ZTZA 1CT2E 1KDQA 3S0NA 1FXYA 4D76A 1O2YA 3K6ZA 3W95A 3EGKH 3T28A 4OS4A 3SV9A 3ODFA 3SI3H 1SQTA 1SGFA 1MU6B 3SU6A 2F9UA 3F9FA 4DG4A 1IQNA 4YZUA 3UQOA 4ABFA 1EZXC 1HXEH 1QCPA 2ZGXH 1LVOA 4X1RU 4WF8A 3ZV9A 5T3HA 1GHXH 1KXCA 1V3XA 4INKA 1JMOH 1GVKB 2P95A 2RA0A 4IC5A 1O3IA 3RXDA 3A8CA 5EPYA 1GBLA 4A7IB 2GCHF 4Y11E 1HFDA 2BM2A 3ZZCA 1C1OA 1WU1A 4K8BA 1IQGA 2A31A 2ZG0H 3ZYDA 1W14U 1KLTA 2F9NA 4WH6A 1CVWH 1TNLA 1BRCE 3OTJE 1TQ0B 5FHTA 4X8UH 1F5RA 3MNCA 1SGFG 5FPTA 1BMLA 1C5UA 3EA8A 2ZFPH 2SFAA 2GDEH 3ENSB 1HLTH 1AB9B 2ZEBA 3E91A 1SGDE 1TNIA 1C2IA 2R0LA 2RDLA 2Q6GA 2F83A 2W5EA 4I8HA 1OP0A 4CBNA 1SLVB 2VIWA 2BQ7B 3GY7A 1AHTH 2FIRH 4X6NA 4VGCB 4ESTE 2NU1E 2HPQH 2SGDE 4NFEA 2GMTC 2NU4E 5F03A 1PFXC 2OC1A 4WXVA 2P94A 1GHAG 1OSSA 1HAPH 2BOKA 2QYIA 1AU8A 3P8OA 1ANCA 3ATIA 1RTLA 1C5LH 4ISLA 2OINA 4MNWA 3M7UA 2HRVA 2ZZUH 1F5KU 3ZZ5A 3BTEE 5EQQA 1S5SA 3OYPA 3SHCH 1DDJA 5E2PA 3ELAH 7KMEH 5FBIA 2HWLB 1AE8H 1UCYE 3GICB 1QJ7B 1MQ5A 4ZUHA 1DUEA 1G36A 4GHTA 2JKHA 3BTHE 1O3CA 4FU9A 4ZKRU 3SUEA 1NRPH 4MPXA 1UVPA 5DP7A 3UTUH 1UHBA 4ZH8A 3SNDA 3TVJB 2BDBA 1OWEA 2Y5FA 1TMTH 3O8BA 5IYTA 1MH0A 1LHEH 4INLA 1Y3YA 3SU4A 2O8MA 1C5WB 4FVDA 2QXJA 1DXPA 3UOUA 2CGAA 8GCHF 2B0FA 4JYTA 3U9AH 3TLOA 3L3TA 2GDDA 1W7XH 2Y5HA 3F68H 3SO3A 4AYVB 1PPCE 3DFLA 1GGDB 3A86A 4MPUA 1C1UH 2WYJA 1UCYK 5HM9A 2A2QH 3RMLH 1ARBA 1C1TA 1GHBG 1THRH 3RXJA 5DO4H 3P17H 1O3DA 2OBOA 4XBBA 2PR3A 3A89A 4K1EA 1C1PA 5F8XA 1SHHB 2VNTA 3KQBA 1MBQA 1Y3VA 3PTNA 4X2YA 1U6QA 4NIYA 3DA9B 1C2LA 4OGYA 3GISB 1Z8JB 1UCYH 2FP7B 4JYVH 1C5PA 1HJ9A 2J4IA 1P3CA 2BD2A 1TMBH 1FQ3A 1C5VA 1DANH 2ODPA 5LH8A 1TE0A 1O2GH 1GJBB 1OOKB 1ZLRA 2VIVA 4OS7A 1ZSJA 3RU4D 5K7RA 1O3JA 3M3SA 3ZZ7A 1O2OA 1QURH 3SU2A 1NFUA 1V6DA 1S83A 6LPRA 2JH5D 2Q6FA 3DUXH 1PPFE 1EZUC 1JRSA 1CO7E 1QB6A 2H9EH 1F2SE 1W2KH 1V2OT 4XSKU 2ZHDA 3LDXH 1XUFA 2Y7XA 1QB1A 4JK6A 4TY7A 5A2MH 1GL1A 3T62A 1AY6H 4IC6A 2PW8H 3SUGA 1H4WA 1O3EA 2C4FH 2A45B 3BIVH 5C20A 4AFZA 2OC0A 1NRSH 1C1RA 2ZPRA 1H8DH 2HNTC 4BAHB 5GPIB 1K1OA 4KTUA 5LPRA 2G8TA 1THSH 1O37A 3BTTE 1BT7A 1BRAA 4UFEH 1QBOA 2Q1JA 1KXBA 2W26A 1YCPH 2PKAB 1O3AA 2YNBA 2C3SA 9LPRA 5FPSA 3PLKA 2ZTYA 1EASA 2FMJA 4DGJA 1C1WH 3QK1A 1C5TA 3LGWA 8ESTE 3RXTA 2ANWA 3RXCA 4CR5A 1ZTLA 3A82A 4HZHA 2BQ6B 4UE7H 4YLUA 4Y6DA 5A09A 1DITH 1AZ8A 3UWJH 3A85A 1Z7KA 1O3FA 3I78A 1HRTH 1RXPA 3S9BA 3V13A 4BAMB 5SGAE 3EE0B 1MBMA 2ZCKP 3DT0H 2THFB 4WXIA 1WTHD 2W3IA 3KQEA 1MUEB 1YPLH 1AWHB 4K3JA 2R3YA 1OXGA 4MQAA 1O2JA 2AMPA 1K28D 3QN7A 3HKJB 1SGTA 1QIXB 2BLQA 3I29A 1EAWA 3E16B 1WSSH 1TBRH 1HJAB 3M35A 3BV9B 2VIDA 1TYNA 3NCLA 4Y8ZA 1EX3A 2YOLA 2HOBA 3ATKA 2UUJB 2WPLS 2BTCE 4IN1A 3ZZDA 1YYY1 2GTBA 1WYKA 2DUCA 1XUHA 1LHCH 1O33A 2ZCLP 2XTTB 1V2MT 4WVPE 3NZIA 1LVMA 2TPIZ 1AMHA 2FO9A 2G00A 1K9OE 1AD8H 1ABIH 2Y6TA 3VGCC 1D4PB 3TGKE 3PMHB 5TCCA 3RDZA 2BVSH 3D62A 5IDKA 1Y5AT 4JMYA 1IQJA 2QF3A 3TJUA 5AVDA 1ANDA 1EOJA 2AIQA 3AW0A 3URCA 3T2NA 1YC0A 4IMQA 1A1RA 3ZYEA 1NO9H 1F0SA 4JZ1A 4ABGA 3RXMA 3UWIA 3ZVCA 1VGCB 3RLYH 1P03A 1KYNA 1UTQA 1YKTA 2GCTC 5AFYH 2GT8A 1GI5A 2Z9KA 1ELAA 1ELCA 4SGBE 4JCNA 1P09A 4JZDH 2WUCA 3FP8E 4YESB 3MO6A 2A4RA 3ZVAA 1UTPA 4TYDA 1ZGVA 1G2LA 5DG6A 4O9VA 2ASUB 3GY8A 1O2RA 1ABJH 1W13U 1FY4A 1A46H 3H7TA 1L0ZA 1SC8U 2Y82A 4MPWA 1INCA 2IN2A 4K60A 2ZGJA 2XNIA 1B5GH 4DVAU 2ZU3A 5EG4A 3GY6A 2A2XH 1G3EA 1JRTA 3O8RA 1VCWA 3TJOA 3QZRA 3MMGA 2Z9IA 3TK5A 1Q31A 2GD4B 3P92A 4X2XA 1NROH 1O2ZA 2F9BH 4OS1A 1TB6H 3SGAE 1B0EA 1GBHA 1E0FD 1EQ9A 1NY22 3UREA 2QY0B 1L2EA 1FAKH 1RS0A 3KIDU 4IW4E 4OS5A 3OY6U 1LQDB 3VB5A 3QLPH 1BTZA 2BVXH 1YPHE 4TWYA 4B74A 2XCFA 1P04A 6CHAB 2B9LA 3SNEA 5DP4A 2FLBH 4WMFA 1HDTH 1MD8A 4B71A 1ELBA 1UTMA 2XC0A 3VB6A 1UK2A 5DP9A 1A5HA 1UTNA 3GCNA 1GI0A 5BPEA 1C2JA 4BTIB 4CBOA 1TRMA 1A5IA 1FY8E 1TQ7B 3LGTA 2I6SA 4UONA 5GXPA 3T29A 2R3UA 1MAXA 1XXFA 5TJXA 3TU7H 4MDSA 5B6OA 1A61H 1UJ1A 3I77A 3ODDA 2OTVA 1Z71A 2QXHA 5C1XA 3M7TA 4AFQA 2GCHG 1O5AB 3ZZ8A 2BDCA 1LPGB 3U1IB 2STBE 1H1BA 2VH0A 3SJKA 1FJSA 2EEKA 4BAQB 2EI7A 4VGCC 4SGAE 2A1DB 3Q76A 5GJ4B 5ESBA 4ZROA 4MTBA 4UFDH 2ZFRH 4RKJB 5EW2H 3BEFB 3N7OA 2FOGA 1L1JA 1HUTH 2J95A 1AFQB 1HAVB 3ZZAA 4Y7BA 3MOCA 2QAAA 3A8AA 3E6PH 1HAIH 3SJ8A 1GBMA 5AHGH 1QJ6B 2ZCHP 2C90B 3UPEA 2WPIS 2ANKH 2XWBI 4NA8A 2XRCA 2B8OH 2P16A 1FIZA 3GY5A 3SJIA 3MYWA 1ZZZA 3ZVFA 3PO1B 2RA3A 1ANEA 1C9TA 2ZA5A 2D26C 3AASA 1C2FA 1MAYA 3TK9A 4J2YB 1SFQB 1TPOA 1H9HE 1MU8B 3Q77A 2QN5T 4M7GA 3RC5A 2VGCB 1W3CA 4RSPA 4LZ1H 4TPYA 3V7TA 2G51A 1DE7H 3BTDE 1G3DA 8KME2 5ESTE 1ZSLA 4JYUH 1BMAA 3SV2H 4BNRA 4GLYA 3SV8A 1T4UH 2BDYA 1GPZA 6ESTA 2G81E 3GY2A 1DICA 8LPRA 3MFJA 1QQ4A 1UK3A 3VGCB 2AGEX 1GGDC 2VIQA 3MNXA 1ELTA 2BYAX 1GHZA 5BRRE 1E37B 1D3DB 3NK8A 2A5AA 2H1UA 2WPKS 4MNXA 1GBAA 2ZDLA 3KGPA 1JXPA 3SN8A 3DD2H 1NU9A 1UK4A 3MO9A 4FUIA 3QO6A 4NWLA 5ETXA 2ZU1A 1TGNA 3RXOA 5I25A 2PSXA 5DP5A 1DVAH 1IHTH 7GCHF 1NM6A 3QGJA 1ACBE 1O2NA 4DY7B 1RJXB 2BXUH 3Q3XA 4WJG2 8GCHG 1LTOA 5E0GA 1C2EA 4YOJA 1YPKH 2AGIX 3M3VA 4XOJA 5T6GA 1OKXA 1BRUP 4MNYA 2WINI 3PTBA 1TOMH 1DS2E 1V2UT 1P01A 2BD8A 4NZQA 2NU0E 1N6XA 4AOQA 3BG4B 4HGCA 4JK5A 1A0JA 4TPIZ 3SNBA 1P06A 2FLRH 4AN7A 3ZVGA 3A80A 3LJJA 2W7UA 4CRFA 1LMWB 1RFNA 4CHAB 1P11E 1Y3WA 1TRYA 4I32A 3ZZ9A 1TONA 4FUDA 3SHAH 4DURA 1ESBA 4UDWH 1CGIE 1EOLA 5T6FA 2F91A 1TX8A 3SJOA 1O3KA 3MU5A 2FX6A 1O2PA 5A8ZA 1AI8H 1OWIA 4CH2B 4MVNA 3LH3A 2VH6A 4NIWA 2A5IA 1ZHMA 1ETRH 1ZTJA 3CS0A 3KQCA 1IQMA 2A32A 1P2MA 2VJ1A 4GUXA 1P10A 3KF2A 2G4TA 5DP8A 1T4VH 1Y5UT 3A7XA 5EXNA 1A3BH 2LNCA 1ZTKA 3R3GB 4Q7YA 4X6PA 2A7JA 2ALPA 3U8OH 2Z94A 2XBYA 1J17T 2HPPH 5K0HA 1GCTB 2FI5E 3GCOA 3MNSA 2BY8X 4BAKB 1BA8B 1P8VC 1IOEA 1S0RA 1HPGA 1PQ8A 4INHA 3RXFA 5L30H 2O8UA 1TWXB 1D3PB 2GX4A 2UUKB 4ZKSU 1V2NT 1O5EH 2SNWA 1HJAC 1OPHB 5LPFA 1D6RA 1O35A 1QRWA 3JZ1B 3P95A 1DX5M 2GZ7A 1BJVA 1AFEH 5LPEA 1WUNH 5ABWA 3SBKA 1K2I1 2A0QB 4B2AA 2ZQ1A 1HAXB 1C2MA 4NFFA 2FWWA 2C93B 3U1JB 4Q7ZA 3MTYA 2V6NA 3NXPA 1F0RA 4U2WA 3RXGA 3D49H 2SGEE 2P8OB 1LHFH 2J9NA 1DWDH 1OWDA 3ATMA 2QXIA 2QCYA 1DWBH 4RN6A 2SGFE 1BDAA 9ESTA 2F9OA 4Y0ZE 5A0BA 3HGPA 2FS9A 1GJ4H 1MKWK 5FX5A 5C2ZA 4Y7AA 1YP9A 1W11U 1CA0B 2XC4A 2GKVE 2NU2E 4YOIA 1K21H 1FDPA 4A1TA 1AKSB 1SGRE 4LK4A 1Y3XA 1QA7A 1VGCC 1IQEA 2FOHA 1EPTB 1IAUA 1SSXA 4BXSA 2UWPA 4KGAA 1MKWH 4WH8A 3UNQA 1O5DH 1PPBH 1LPZB 3PWBA 1DXWA 1KY9A 1MCTA 1HNEE 1EAXA 3E8LA 2TGDA 1J8AA 1N8OB 1RIWB 1T8LA 1K1LA 1QGFA 2BMGB 2UWOA 3MU4A 4FUGA 2UUYA 5E0HA 1VITH 4TY6A 4H42U 1P3EA 1FMGA 4H4FA 3RXBA 1GJAB 1LPKB 5FCRA 2CF9H 2RG3A 1GMHG 3P8FA 4FU7A 3HKIB 1HAHH 1GJ5H 1JBUH 3GCTF 5GDSH 1ZPBA 1SGIB 5E0JA 1O31A 1OX1A 1G37A 3A88A 1KDQB 1MMJN 2ODQA 3FZZA 2A5KA 3PB1E 2R9PA 3TH4H 1ZMLA 4XBDA 4BTUB 1MTUA 2ODYB 3LPRA 3MH5A 5CHAB 1AWFH 1T8NA 1UVUH 4ZMAH 2OQUA 2RCEA 1O5CB 3M5MA 2IOTA 1WV7H 1ZJKA 3URDA 4Y8YA 1A2CH 2PFEA 3RLWH 4X1SU 2OC7A 1CU1A 3SW2B 6CHAC 3MH4A 2F9PA 1YF4A 1SR5C 4Y79A 2Y7ZA 1O5GH 5JDUB 3UUZA 1HAZB 4GAWA 2J94A 4NGAH 1LCYA 2CV3A 4IS5A 1TIOA 1LVBA 1ZMJA 3RU4T 3A8DA 3M5LA 1SL3A 2FOAA 1GI4A 2OC8A 1NFWA 1ZMNA 1C5OH 1F0TA 3BSQA 2OQ5A 2ZDNA 3RXSA 2PGQB 1DOJA 4AZ2B 1SOTA 1L4DA 1SMFE 2XBWA 1GI6A 3AAUA 1BZXE 1L4ZA 2R0KA 4KKDA 2BY6X 4R0IA 1O2WA 4Y71A 1WQVH 5FPYA 1DPOA 2P3TB 1GJDB 4BANB 1GVLA 3T25A 1TLDA 1BQYA 2XXLA 2PWXA 1EZSC 3O8DA 1HIAB 3A7TA 2CN0H 1NN6A 1QBNA 1EXFA 1EZQA 1BIOA 1ZHRA 4CRAA 3M36A 1FI8A 1ZRKA 1PPHE 2H5DA 2AGGX 3BF6H 3P8GA 3A7VA 1VCPA 1JOUB 2OLGA 1GJ6A 1FN8A 2H9HA 2ZHEH 4MPVA 3MH7A 6GCHF 1FY3A 3EQ0H 5TCAA 1AFQC 2G55A 1O2MA 4FUCA 1PPGE 1O2TA 1Q2WA 3FP7E 2ZFSA 4E05H 3LH1A 1S6FA 4O03A 4AGJA 1Z1JA 3MI4A 4I31A 3RMNH 3LGUA 1P57B 3RUOA 1GJCB 1Z8IB 1YLDA 4X8SH 2Z3CA 3PO1C 1MZDA 1QRXA 3SNAA 1DFPA 2G52A 1MTNB 1J9CH 1NFYA 2FTLE 3PMJA 5T6DA 3RXAA 2FEQH 2FYQA 4ABIA 1TNHA 3S9AA 1XKAC 1H9IE 4ABHA 1P05A 2VGCC 3P70B 3K6YA 2ALVA 1LQEA 1GJ9B 1YM0A 3UNSA 5DPAA 2ZTXA 3L6PA 1HAVA 1DLKB 1QJ1B 2Y5GA 1PPZA 1UHBB 2AYWA 1CGHA 4K2YA 3VB3A 3EAJA 3TNTA 2OBQA 3F1SB 5EODA 1CSOE 3AAVA 1P9UA 1SGQE 5GCHF 1SQOA 4FVBA 3HGNA 1MTSA 4WMEA 1AQ7A 1SOZA 2ZFTA 2BHGA 2FS8A 1FZZA 1GBFA 3UQVA 2ZKSA 4U01A 1C1MA 1O3NA 4Z0KA 1FN6A 3WY8A 1O3GA 4ISHH 2QC2A 2QA9E 3E1XB 1V2TT 4I8KA 4K69A 1E35B 4DJZB 3MWIU 2J92A 1NT1A 4GSOA 3L33A 2A4GA 3GYMA 2ZPQA 1D9IA 1H9LB 1WTGH 5A0AE 1G9IE 4BTTB 1O36A 2CXVA 4AX9H 3UY9A 1SGCA 1VITF 2O9QA 3V12A 3TNSA 2FOCA 4ISOA 2UUFB 4ZAEA 1EB1H 4AB9A 1XX9A 3EA9A 3BG4C 5EXMA 4HFPB 2WV4A 4A5TS 4GCHF 3RXQA 4LZ4B 4FUBA 2VVUA 1C4Y2 1EAIA 4CHAC 3PYHA 4HTCH 1CBWB 4XE4A 3HK3B 1AGJA 1GDQA 7GCHG 2H2ZA 1C1NA 1C2KA 4F4OC 1XVMA 4A1XA 2BLWA 3KCGH 4OGXA 1O3LA 2ZFFH 1ANBA 3MO3A 3S9CA 1YPHC 1TBZH 1TA6A 1K1MA 1TPPA 3SOSA 2PUXB 5LGOA 2V0BA 1KSNA 3W94A 1HGTH 1QHRB 2G4UA 2EC9H 2FZZA 3Q3YA 1TX7A 4JZEH 1O0DH 1C5SA 2BDAA 2TBSA 2EI8A 4K1TA 1MKXK 1A4WH 1CT4E 1C5YB 4X8VH 2BVRH 1ARCA 3GYLB 2ZWLH 5HGGA 3CS7A 3HK6B 1XKBC 4NIVA 1NRRH 2BD9A 5EQSA 4BXWA 2F3CE 3TPIZ 2VIOA 1A5GH 1GCTC 2FESH 1KLJH 2ZP0H 4NZLA 2BY5X 1SB1H 2C8ZB 3STIA 4B2BA 1O34A 2EA3A 1BJUA 2PV9B 2XWAA 4I8LA 2O8TA 1PQ5A 1UO6A 1C9PA 3TIUA 1RGQA 5JPMH 2AMQA 3M5NA 5EU8A 2B7DH 1BITA 3QWCH 4YTAA 3SV6A 1O2VA 2BDIA 2VIPA 1GL0E 3PV4A
chains in the Genus database with same CATH superfamily
2BDGA 1DSUA 4YLQH 1KXDA 1O38A 1QL7A 3RMMH 1TRNA 1NFXA 4NSVA 5F8ZA 3LKWA 2AMDA 2DE8A 3SI4H 1DUAA 1G32B 2Z3EA 1C5XB 5L2YH 1FLEE 2ZDAH 1GBBA 3SUFA 3M3TA 1KXEA 2AH4X 1ETTH 1DWEH 1QR3E 4X0WU 1OWJA 3MU1A 2ZU4A 4BAOB 2FDAA 2PGBB 3BTFE 5DK1A 1YPMH 5EW1H 2C8YB 2P8OC 1TX6A 4RKOB 1ZRBA 3ATLA 1ID5H 2K1QA 1J14A 2P59A 3IWMA 4YT6H 2GGVB 2P93A 1L1NA 4KP0A 1HXFH 3RXVA 2IJOB 1BTWA 2RFKC 3P6ZB 4B73A 1FPHH 1FPCH 1GJ8B 1CT0E 3K2UA 5AF9H 1CA0C 1GG6B 3UR6A 2ZFQH 4THNH 7ESTE 4AYYB 4IMZA 3ZVDA 3OU0A 3U98H 1TMUH 1Z8RA 3QUMP 1AUTC 1H8IH 3A87A 4UD9H 5DP3A 1EPTC 3ZZBA 4H6TA 3SU0A 3U8TH 1C5ZB 1S82A 1EJMA 5E2OA 4D9RA 1GBDA 5JBTA 3UIRA 3UFAA 2FYRA 1TGCA 1BBRK 1O2SA 3RXKA 4KTSA 1N8OC 1RIWC 1V2RT 5PTPA 1UMAH 1HV7A 3NRLA 2JETB 3SZNA 1BTYA 2QXGA 4AB8A 4AG1A 2JJ2D 1OP2A 4F55A 1GBIA 1XVOA 1V2LT 4NSYA 1IQFA 2WPJS 1HBTH 4X6OA 3RU4E 2VVVA 1J15A 4X2WA 3QX5H 2ILNA 3ZVEA 1K22H 1XMNB 2ZHWH 2NWNA 2PUQH 4ISIH 3OSYA 4QT8C 5DN6D 2CF8H 4WY3A 5C5OA 3FANA 5CHAC 2H5CA 4ZKOU 2BD3A 2FOFA 2QIQA 3H09A 2BOHB 1NZQH 1PQAA 1WQSA 2P3FH 1YPEH 2FTMA 2I6QA 2D8WA 1QL8A 3Q3KA 1AVWA 1MCVA 2FM2A 1BTPA 1HB0B 4ABAA 2V3MA 1Y5BT 1S0QA 1WAYB 3OY5U 3C1KA 1ELDE 1UTJA 1ESTA 1Y59T 4FUEA 1QB9A 1EAUA 3ZVBA 3KQDA 1GMCF 1AZZA 4WMDA 3LT3A 3GCTG 3SUDA 1VR1H 5KEDA 5J4QA 3PLPA 1S85A 2XCNA 3BTGE 2ZO3H 3UOPA 1TA2A 1TGTA 1YCPM 1GBEA 1FIWA 1MTWA 1TGBA 2J34A 1C1SA 3FAOA 1GBTA 4GPGA 2KR7A 2BY9X 4UFFH 2IPHA 1V2ST 5F6MA 4F49A 3TGJE 3A8BA 1GCDA 1N6YA 3GDUA 4IBLH 1N1LA 1V2JT 3K65B 2OCVB 2CHAB 1O2LA 2CJIA 4D7GA 2A7HA 2ZI2H 3PLBA 2KCAA 2P3UB 2TRMA 1YWUA 1XUGA 2WYGA 2SGQE 1TPAE 2PHBA 2ZECA 3R0FA 5HKKD 1QY6A 2DE9A 3BIUH 4O3UA 1TNJA 1AN1E 1KTSB 1E36B 1PYTC 3MNBA 1UVOA 3BTME 4B75A 2R2MB 3FZDA 1O2HA 4CRGA 3LGYA 1AVGH 3FP6E 1ELGA 4B76A 4Y76A 4J1YA 1F92A 2D2DA 5DGJA 1IQHA 3ZZ3A 3NWUA 1MZAA 4U32A 2W6JD 1O2UA 2WPHS 3DHKH 3CENA 5HXFA 2YMSD 3M61U 1C5MD 1GHVH 4DIIH 1XUKA 1F7ZA 2BD4A 4LXBH 5A0CA 1SQAA 1P02A 2FOEA 4AGKA 2XBVA 1SHYA 1BTUA 3Q00A 5JBBS 1HIAA 1SI5H 2J38A 2PKAA 1MTNC 1DLEA 1CQQA 5E8EH 2JDID 2KAIB 1P0SH 2C8XB 3VPKA 1S81A 1BHXB 4X1NU 2SNVA 3M5OA 2V3OH 5J4SA 4FUHA 1SLWB 6GCHG 5EIYA 2WPMS 1FY1A 3VXFH 1NRNH 2TGTA 1W10U 1VCQA 2LELA 1K1NA 1WOFA 1CHOF 4CRDA 1RTFB 4JZIA 3F3BA 1P2QA 2J2UA 3GY3A 4ACBA 1MD7A 4D8NA 1GMDF 1FX0B 2PKSB 1TGSZ 1EATA 2KM0A 3U8RH 3LOXA 4A6LA 4CRBA 3LGIA 2ULLA 4ZHAA 2Z6BD 4B1TA 1Y3UA 4DCDA 5HYOA 2XBXA 4E06H 4ISNA 1EKBB 4HG6A 1LHDH 1DY8A 3F6UH 4Z1MD 2EI6A 1MQ6A 5EXLA 1FNIA 3EYDA 1QL9A 1HAYB 3ZZ6A 1C5NH 1LDTT 4Y8XA 5C5NA 2Z7FE 5H4IB 1UTOA 3UR9A 1BHXF 2A7CA 2ANYA 2F9VA 3RXHA 2Z9LA 3FFGA 1O39A 3N99A 1NESE 2FPZA 3B8JA 4DIHH 1VZQH 1XM1A 3QTOH 4MNVA 1TNGA 4X8TH 3ZV8A 1PJPA 2ZIQH 5GCHG 1O5FH 1E34B 3N7EA 1MTVA 1FY5A 4A1VA 3SNCA 3LC3A 1TALA 2IPQX 2A4OA 1GDNA 7LPRA 2KCYA 2Z9GA 1EP6A 3BEIB 3K9XB 3RXRA 1P2KA 3S7HB 4ZHMU 1TOCB 1E1RD 1P12E 1HJ8A 2BXTH 1SGYE 2QF0A 2Z9JA 3RXUA 5L6NH 1D3TB 3OE7D 1CBWC 1ZYOA 3KEEA 4AFUA 2ZDMA 1GI1A 1BMNH 1F5LA 3BEUA 4Q7XA 1Y8TA 2V35A 4UFGH 1O5BB 4ABDA 3MU8A 1TNKA 1ELEE 3OEHD 3SGBE 1VITG 2VWLA 1WBGB 1KTTB 3E0NB 4ZXYH 3GCHB 1QRZA 2AFQB 2ZNKH 3RC6A 3MQKC 1Q3XA 1SLXB 1W0ZU 1DT2A 3GDVA 2ZGCA 5EOKA 4E7RG 2FXRA 1DSTA 1HYLA 1Z8GA 4GCHG 5A8XA 3QGNB 1OP8A 1C2HA 1X7AC 4I8GA 1M9UA 2XYAA 2Q6DA 3KYGA 4TWWA 1ZHPA 4I7YH 4GVUA 1GHWH 1O2QA 3A81A 3QTVH 3E0PB 2HALA 3F0PA 3SJ9A 3A7WA 2WV5A 1AVXA 2KCPA 2HLCA 3GY4A 1SBWA 4KTCA 5B6LA 1PPEE 2KCOA 3W1EA 4K1SA 2OUAA 1QFKH 3AVZA 2GP9B 2EY4C 1CA8B 5C1UA 3LONA 3BTQE 2HNTE 2FI4E 4I8JA 1YCPK 4XBCA 1RRKA 3A7ZA 1TFXA 1D3QB 2Y81A 1JIMA 1ETSH 5FX6A 2AERH 1A0HB 3RM0H 4OS2A 1GJ7B 4OS6A 4NCYA 4NIXA 3STJA 1G30B 3H7OA 2IJD1 2NU3E 1BUIA 1OHHD 3A84A 3V0XA 2VB0A 3RXPA 3SU1A 2ZGBH 1NC6A 2G5NA 3BTWE 2TIOA 2AS9A 1YLCA 3IITA 4Z6AH 5A8YA 2PLXA 1O3BA 1GHAF 2M2AA 3N7DA 2JH6D 4A92A 4WWYA 1T7CA 2PSYA 1W7GH 1C1QA 3T27A 1A0LA 2R2WU 3GOVB 3M7QA 1BB0B 4E7NA 3VEQB 1NTPA 2ZHQH 3ZZ4A 1H8ED 5GIBA 3UNRA 1GG6C 1MABB 1P2NA 2FODA 3BTKE 1TBQH 2ZGHA 5DP6A 3GDSA 4FU8A 1PYTD 2STAE 4CH8B 1C1VH 1LHGH 1Z6JH 2J98A 1UTLM 3TJVA 3TJNA 2BLOA 1ZSKA 4K8YA 1GI3A 2GMTB 3RC4A 2Y80A 3HATH 4DW2U 1NPMA 2LP6A 1C4U2 2ZC9H 4O97A 2ZHFH 2ESTE 1IQIA 1OS8A 1AE5A 3FVFB 3KN2A 2BLVA 3RXLA 1L1GA 4XFQA 2ZDVH 3A83A 4R8TB 4ABBA 1XUIA 4K5ZA 4MG3A 3MU0A 4PROA 1GBKA 3EE7A 3HPTB 2JETC 2BY7X 3PMBB 5F8TA 1UVSH 5C3NA 5AFZH 4X1PU 2O8WA 3NKKA 4AORA 1K1IA 2C8WB 1V2PT 2SGPE 3MH6A 5EPNA 4ZXXH 4YT7H 1ZGIA 1G3BA 1THPB 1NS3A 3PROA 5JB9S 1ZR0A 2BQWB 4AG2A 2ZU5A 1V2KT 3G01A 1V2VT 2BD7A 5L2ZH 1EP5A 1OWHA 1QBVH 2VVCA 1GHBF 3PV2A 1ZPCA 1CE5A 4ASHA 4GHQA 4Y0YE 5DKMA 3SU3A 1GBJA 2EQNA 3B9FH 1QTFA 2OD3B 1SFIA 3QZQA 1GMHF 1S84A 2HGTH 2XC5A 3PMAB 1K0HA 3LU9B 2VBCA 1T8MA 3V3MA 2OXSA 2CMYA 3P8NA 1O2IA 1C5QA 4NA9H 4NG9H 3RXIA 4U30A 3TH2H 2FOMB 5CMXH 3SZEA 1EB2A 4D9QA 3OX7U 2B5TB 4FUJA 2HVXA 1P2IA 4YM9A 3AW1A 1LO6A 1BMFD 1A7SA 1SG8B 5FAHA 1SGEE 2O8LA 3EA7A 5C0UA 2FOBA 2BDHA 1JWTA 1T32A 2ZU2A 1OYQA 2W3KA 4NA7A 3TGIE 1HAGE 1C2DA 4X2VA 4DT7B 1BMMH 1HCGA 5GWZA 4TT3D 3H5CB 1XXDA 1QQUA 1A3EH 1Z1IA 4CREA 3PWCA 1VJAU 3BN9A 4JZFH 2BZAA 3KHVA 1Z6EA 3VB4A 1EUFA 3QDZB 2KFWA 1QA0A 2J5UA 5FBEA 1WCZA 1RD3B 2YNAA 1UTKA 1KLIH 1LKBA 2CHAC 3SU5A 3VXEH 4XDEA 3S69A 4KELA 2D1JA 1SLUB 1AO5A 4I33A 1W12U 1LKAA 4LOYH 1GMCG 1JIRA 2ZQ2A 1BCUH 3RM2H 1C2GA 2KZ4A 1SGNE 3ITIA 3RXEA 1P2OA 1TPSA 2VWMA 1O3OA 3D23A 1O2XA 5F53A 1AIXH 5EGMA 1O30A 1DY9A 2A4QA 5FCKA 4MLFB 2GZ9A 2GV7A 1MKXH 2ZDKA 4BOHA 3VB7A 2Z3DA 4X1QU 1OYTH 4O3TA 2AIPA 1O2KA 2XW9A 1W8BH 3DSOA 2ZPSA 3BG8A 3OAAD 1IQLA 4CRCA 3RMOH 5FXLA 1IHSH 5JBCS 1KXAA 3WWBA 4HI3A 2BX4A 3KNXA 1YGCH 1J16A 3NUMA 2QV1A 1YPGH 3MHWU 5C67A 1AB9C 1G2MA 3LJOA 3T26A 4IN2A 3FOAA 2VWNA 1ZJDA 1W0YH 4X6MA 1SGPE 1G3CA 5EJ1A 1GVZA 3CP7A 3F9GA 1EJNA 1GI9B 1KMHB 2PTNA 5HM2A 4DOQA 1GHYH 1DWCH 4FUFA 4ACAA 1DM4B 3S7KB 3VFEA 2QGRA 1RTKA 1YBWA 2H6MA 1BBRE 1GDUA 1GI7B 1O3MA 4YO9A 4D7FA 2H9TH 1BTHH 1HAOH 4Q2KA 1K1PA 2BZ6H 2PKSC 4ZKNU 1LVYA 3NPSA 1B0FA 5EQRA 4H6SB 2V7QD 4Y10E 5JB8S 4ABEA 2G5VA 3A7YA 1D6WA 1YPJH 1TAWA 2UWLA 1FONA 2QF5A 1ZOMA 1TABE 3B23B 4UEHH 3RP2A 3EDXB 3LGVA 2KAIA 1PQ7A 3E90B 1FV9A 2HNTF 3M37A 3PM3A 1B7XB 1KXFA 1P2JA 2JH0D 4AFSA 3O8CA 1OWKA 1VJ9U 2PTCE 3LIWA 3SGQE 4NWKA 2ANMH 1GWAA 1T31A 3JZ2B 1SQRA 3DFJA 2LPRA 1CHOG 2M5TA 1FAXA 1O3HA 1BTXA 2GV6A 5C1YA 3AK5A 5G4BA 1FUJA 1ELFA 5DJ7A 1SVPA 1ORFA 1O3PB 3SQEE 3F9EA 2TGPZ 1CGJE 1GMDG 3TITA 3TH3H 1GI8B 2GVFA 3F9HA 1K1JA 1V2QT 4FXGH 5I46H 5JYIA 1V2WT 1ZPZA 2GZ8A 1P9SA 1ESAA 1KIGH 1BRBE 2SGAA 3TK6A 1BBRH 3SORA 2FX4A 2KX4A 3E3TA 3U69H 2OP9A 3LC5A 2AEIH 1QNJA 5JBAS 1XUJA 3KL6A 4ASUD 3UB0A 1AKSA 2FI3E 4ABJA 4B2CA 4YOGA 1E38B 1EPTA 1O32A 1AUJA 1GI2A 4Q80A 3T5FH 3SV7A 2ZF0H 1SPJA 2BX3A 2GT7A 1BOQA 2BB4A 2WHXA 3IG6B 1NU7B 2VINA 2TGAA 1T8OA 2VWOA 2VU8E 2GCTB 1CHGA 3C27B 3GCHC 2WUBA 3ESTA 1EJAA 1UVTH 1W0KD 1IQKA 1ELVA 4ZHLU 3ATWA 3SQHE 4P00A 5HMAA 1F0UA 1NRQH 1C4V2 2V3HH 3D65E 4IGDA 4CR9A 1S6HA 2BD5A 1C5RA 1GBCA 5CE1A 2W7SA 2ZTZA 1CT2E 1KDQA 3S0NA 1FXYA 4FOUC 4D76A 1O2YA 3K6ZA 3W95A 3EGKH 3T28A 4OS4A 3SV9A 3ODFA 3SI3H 1SQTA 1SGFA 1MU6B 3SU6A 2F9UA 3F9FA 4DG4A 1IQNA 4YZUA 3UQOA 4ABFA 1EZXC 1HXEH 1QCPA 2ZGXH 1LVOA 4X1RU 4WF8A 3ZV9A 5T3HA 1GHXH 1KXCA 1V3XA 4INKA 1JMOH 1GVKB 2P95A 5FL7D 2RA0A 4IC5A 1O3IA 3RXDA 3A8CA 5EPYA 1GBLA 4A7IB 3FKSD 2GCHF 4Y11E 1HFDA 2BM2A 3ZZCA 1C1OA 1WU1A 4K8BA 1IQGA 2A31A 2ZG0H 3ZYDA 1W14U 1KLTA 2F9NA 4WH6A 1CVWH 1TNLA 1BRCE 3OTJE 1TQ0B 5FHTA 4X8UH 1F5RA 3MNCA 1SGFG 5FPTA 1BMLA 1C5UA 3EA8A 2ZFPH 3F2FA 2SFAA 2GDEH 3ENSB 2HVYB 1HLTH 1AB9B 2ZEBA 1E1QD 3E91A 1SGDE 1TNIA 1C2IA 2R0LA 2RDLA 2Q6GA 2F83A 2W5EA 2K8IA 4I8HA 2XNDD 1OP0A 4CBNA 1SLVB 2VIWA 2BQ7B 3GY7A 1AHTH 2FIRH 4X6NA 4VGCB 4ESTE 2NU1E 2HPQH 2SGDE 4NFEA 2L6OA 2GMTC 2NU4E 5F03A 1PFXC 2OC1A 4WXVA 4RT1A 2P94A 1GHAG 1OSSA 1HAPH 2BOKA 2QYIA 1AU8A 3P8OA 1ANCA 3ATIA 1RTLA 1C5LH 3KQ5A 2OINA 4ISLA 3OTPA 4MNWA 3M7UA 2HRVA 2ZZUH 1F5KU 3ZZ5A 3BTEE 5EQQA 1S5SA 3OYPA 3SHCH 1DDJA 5E2PA 3ELAH 7KMEH 5FBIA 2HWLB 1AE8H 1UCYE 3GICB 1QJ7B 1MQ5A 4ZUHA 1DUEA 1G36A 4GHTA 2JKHA 3BTHE 1O3CA 4FU9A 4ZKRU 3SUEA 1NRPH 4MPXA 1UVPA 1VKYA 5DP7A 3UTUH 1UHBA 4ZH8A 3SNDA 3ZIAD 3TVJB 2BDBA 1OWEA 2Y5FA 1TMTH 3O8BA 5IYTA 1MH0A 1LHEH 4INLA 1Y3YA 3SU4A 4F48B 2O8MA 1C5WB 4FVDA 2QXJA 1DXPA 3UOUA 2CGAA 8GCHF 2B0FA 4JYTA 3U9AH 3TLOA 3L3TA 2GDDA 1W7XH 2Y5HA 3F68H 3SO3A 1EFRD 4AYVB 1PPCE 3DFLA 1GGDB 3A86A 4MPUA 1C1UH 2WYJA 1UCYK 5HIYA 2A2QH 5HM9A 3RMLH 1ARBA 1C1TA 1GHBG 1THRH 3RXJA 5IK2D 5DO4H 3P17H 1O3DA 2OBOA 4XBBA 2PR3A 3A89A 4K1EA 1C1PA 5F8XA 1SHHB 2VNTA 3VG8A 3KQBA 1MBQA 1Y3VA 3PTNA 4X2YA 1U6QA 4NIYA 3DA9B 1C2LA 4OGYA 1H8HD 3GISB 1Z8JB 1UCYH 2FP7B 4JYVH 1C5PA 1HJ9A 2W6ID 2J4IA 1P3CA 2BD2A 1TMBH 1FQ3A 1C5VA 1DANH 2ODPA 5LH8A 1TE0A 1O2GH 1GJBB 1OOKB 1ZLRA 2VIVA 4OS7A 1NBME 1ZSJA 3RU4D 3OEED 5K7RA 1O3JA 3M3SA 3ZZ7A 2JIZD 1O2OA 1QURH 3SU2A 1NFUA 1V6DA 1S83A 6LPRA 2JH5D 2Q6FA 3DUXH 1PPFE 1EZUC 1JRSA 1CO7E 1QB6A 2H9EH 1F2SE 1W2KH 1V2OT 4XSKU 2ZHDA 3LDXH 1XUFA 2Y7XA 1QB1A 4JK6A 4TY7A 5A2MH 1GL1A 3T62A 1AY6H 4IC6A 2PW8H 3SUGA 1H4WA 1O3EA 2C4FH 2A45B 3BIVH 5C20A 4AFZA 2OC0A 1NRSH 1C1RA 2ZPRA 1H8DH 2HNTC 4BAHB 5GPIB 1K1OA 4KTUA 5LPRA 2G8TA 1THSH 1UW7A 1O37A 3BTTE 1BT7A 1BRAA 4UFEH 1QBOA 2Q1JA 1KXBA 2W26A 1YCPH 2PKAB 1O3AA 3OFND 2YNBA 2C3SA 9LPRA 5FPSA 3PLKA 2ZTYA 1EASA 2FMJA 4DGJA 1C1WH 3QK1A 1C5TA 3LGWA 8ESTE 3RXTA 2ANWA 4RI0A 3RXCA 4CR5A 1ZTLA 3A82A 4HZHA 2BQ6B 4UE7H 3FO8D 4YLUA 2AHME 4Y6DA 4M9FA 5A09A 1DITH 1AZ8A 3UWJH 3A85A 4B6FA 1Z7KA 1O3FA 2HLDD 3I78A 1HRTH 3PV5A 1RXPA 3S9BA 3V13A 4BAMB 5SGAE 3EE0B 1MBMA 2ZCKP 3DT0H 2THFB 4WXIA 1WTHD 2W3IA 3KQEA 1MUEB 1YPLH 1AWHB 4K3JA 2F4LA 2R3YA 1OXGA 4MQAA 1O2JA 2AMPA 1K28D 3QN7A 3HKJB 2WSSD 1SGTA 1QIXB 2BLQA 3I29A 1EAWA 3E16B 1WSSH 1TBRH 1HJAB 3M35A 3BV9B 2VIDA 1TYNA 3NCLA 4Y8ZA 1EX3A 2YOLA 2HOBA 3ATKA 2UUJB 2WPLS 2OK5A 2BTCE 4IN1A 3ZZDA 1YYY1 2GTBA 1WYKA 2DUCA 1XUHA 1LHCH 1O33A 2ZCLP 2XTTB 1V2MT 5EJZA 4WVPE 3NZIA 1LVMA 2TPIZ 1AMHA 2FO9A 2G00A 1K9OE 1AD8H 1ABIH 2Y6TA 3VGCC 1D4PB 4I86A 3PRDA 3TGKE 3PMHB 5TCCA 3RDZA 2BVSH 3D62A 5IDKA 1Y5AT 4JMYA 1IQJA 2QF3A 3TJUA 5AVDA 1ANDA 1EOJA 2AIQA 3AW0A 3URCA 3T2NA 1YC0A 4IMQA 1A1RA 3ZYEA 1NO9H 1F0SA 4JZ1A 4ABGA 3RXMA 2K0QA 3UWIA 3ZVCA 1VGCB 3RLYH 1P03A 1KYNA 1UTQA 1YKTA 2WV9A 2GCTC 5AFYH 2GT8A 1GI5A 2Z9KA 1ELAA 1ELCA 4SGBE 4JCNA 1P09A 4JZDH 2WUCA 3FP8E 4YESB 3MO6A 2A4RA 3ZVAA 1UTPA 4TYDA 1ZGVA 1G2LA 5DG6A 4O9VA 2ASUB 3GY8A 1O2RA 1ABJH 1W13U 2QF4A 4Q4LA 1FY4A 1A46H 3H7TA 1L0ZA 1SC8U 2Y82A 4MPWA 1INCA 1COWD 2IN2A 4K60A 2ZGJA 4OM9A 2XNIA 1B5GH 4DVAU 2ZU3A 5EG4A 3GY6A 2A2XH 1G3EA 1JRTA 3O8RA 1VCWA 3TJOA 3QZRA 3MMGA 2Z9IA 3TK5A 1Q31A 2GD4B 3P92A 4X2XA 1NROH 1O2ZA 2F9BH 4OS1A 1TB6H 3SGAE 1B0EA 1GBHA 1E0FD 1EQ9A 1NY22 3UREA 2QY0B 1L2EA 1FAKH 1RS0A 3KIDU 4IW4E 4OS5A 3OY6U 1LQDB 3VB5A 3QLPH 1BTZA 2BVXH 1YPHE 4TWYA 4B74A 2XCFA 1P04A 6CHAB 2B9LA 3SNEA 5DP4A 2FLBH 4WMFA 1HDTH 1MD8A 4B71A 1ELBA 1UTMA 2XC0A 3VB6A 1UK2A 5DP9A 1A5HA 1UTNA 3GCNA 1GI0A 5BPEA 1C2JA 4BTIB 4CBOA 1TRMA 1A5IA 1FY8E 1TQ7B 3LGTA 2I6SA 4UONA 5GXPA 3T29A 2R3UA 1MAXA 1XXFA 5TJXA 1S6LA 3TU7H 4MDSA 5B6OA 1A61H 1UJ1A 3I77A 3ODDA 2OTVA 1Z71A 2QXHA 5C1XA 3M7TA 1E79D 4AFQA 2GCHG 1O5AB 3ZZ8A 2BDCA 2F43B 1LPGB 3U1IB 2STBE 1H1BA 2VH0A 3SJKA 1FJSA 2EEKA 5CHBA 2EI7A 4BAQB 4VGCC 4SGAE 2A1DB 3Q76A 3SYJA 5GJ4B 5ESBA 4ZROA 4MTBA 4UFDH 2ZFRH 4RKJB 5EW2H 3UAIC 3BEFB 3N7OA 2J98B 2FOGA 1L1JA 2RDEA 1HUTH 2J95A 1AFQB 1HAVB 3ZZAA 3KYFA 4Y7BA 3MOCA 2QAAA 3A8AA 3E6PH 1HAIH 3SJ8A 1GBMA 5AHGH 1QJ6B 2ZCHP 2C90B 3UPEA 2WPIS 2JJ1D 2ANKH 2XWBI 4NA8A 2XRCA 2B8OH 2P16A 1FIZA 3GY5A 3SJIA 3MYWA 1ZZZA 3ZVFA 3PO1B 2RA3A 4XD7D 1ANEA 1C9TA 3U28C 2ZA5A 2D26C 3AASA 1C2FA 1MAYA 3TK9A 4J2YB 1SFQB 1TPOA 1H9HE 1MU8B 3Q77A 2QN5T 4M7GA 3RC5A 2VGCB 1W3CA 4RSPA 4FETA 4LZ1H 5DSFA 4TPYA 3V7TA 2G51A 1DE7H 3BTDE 1G3DA 8KME2 5ESTE 1ZSLA 4JYUH 1BMAA 3SV2H 4BNRA 4GLYA 3SV8A 1T4UH 3F2GA 2BDYA 1GPZA 6ESTA 2PP6A 2G81E 3GS9A 3GY2A 1DICA 8LPRA 3MFJA 1QQ4A 1UK3A 3VGCB 2AGEX 1GGDC 2VIQA 3MNXA 1ELTA 2BYAX 1GHZA 5BRRE 1E37B 1D3DB 3NK8A 2A5AA 2H1UA 2WPKS 4MNXA 1GBAA 2ZDLA 4Q63A 3KGPA 1JXPA 3SN8A 3DD2H 1NU9A 1UK4A 3MO9A 4FUIA 3QO6A 4NWLA 5ETXA 2ZU1A 1TGNA 3RXOA 5I25A 2PSXA 5DP5A 1DVAH 1IHTH 7GCHF 1NM6A 3QGJA 1ACBE 1O2NA 4DY7B 1RJXB 2BXUH 3Q3XA 4WJG2 8GCHG 1LTOA 5E0GA 1C2EA 4YOJA 1YPKH 2AGIX 3M3VA 4XOJA 5T6GA 1OKXA 1BRUP 4MNYA 2WPDD 3WWFA 2WINI 3PTBA 1TOMH 1DS2E 1V2UT 1P01A 2BD8A 4NZQA 2NU0E 1N6XA 4AOQA 3BG4B 4HGCA 4JK5A 1A0JA 4TPIZ 3SNBA 1P06A 2FLRH 4AN7A 3ZVGA 3A80A 3LJJA 2W7UA 4CRFA 1LMWB 1RFNA 4CHAB 1P11E 1Y3WA 1TRYA 4I32A 3ZZ9A 4AC9A 1TONA 4FUDA 3SHAH 4DURA 1ESBA 4UDWH 1CGIE 1EOLA 5T6FA 2F91A 1TX8A 3SJOA 1O3KA 3F2HA 3MU5A 2YMSB 2FX6A 1O2PA 5A8ZA 1AI8H 1OWIA 4CH2B 4MVNA 3LH3A 2VH6A 4NIWA 2A5IA 1ZHMA 1ETRH 1ZTJA 3CS0A 3KQCA 1IQMA 2A32A 1P2MA 2VJ1A 4ZCNA 4GUXA 1P10A 3KF2A 2G4TA 5DP8A 5C17A 1T4VH 1Y5UT 3A7XA 5EXNA 1A3BH 2LNCA 1ZTKA 2CK3D 3R3GB 4Q7YA 4X6PA 2A7JA 2ALPA 3U8OH 2Z94A 2XBYA 5EJLA 1J17T 2HPPH 5K0HA 1GCTB 2FI5E 3GCOA 3MNSA 2BY8X 4BAKB 1BA8B 1P8VC 1IOEA 1S0RA 1HPGA 1PQ8A 4INHA 3RXFA 5L30H 2O8UA 3F0OA 1TWXB 1D3PB 2GX4A 2UUKB 4ZKSU 1V2NT 1O5EH 2SNWA 1HJAC 5GNDA 1OPHB 5LPFA 1D6RA 1YY3A 1O35A 1QRWA 2J97A 3JZ1B 3P95A 1DX5M 2GZ7A 1BJVA 1AFEH 5LPEA 1WUNH 5ABWA 3SBKA 1K2I1 2A0QB 4B2AA 2ZQ1A 1HAXB 1C2MA 4NFFA 2FWWA 2C93B 3U1JB 4Q7ZA 3MTYA 2V6NA 3NXPA 1F0RA 4U2WA 3RXGA 3D49H 2SGEE 2P8OB 1LHFH 2J9NA 1DWDH 1OWDA 3ATMA 2QXIA 2QCYA 1DWBH 4RN6A 2SGFE 1BDAA 9ESTA 2F9OA 4Y0ZE 5A0BA 3HGPA 2FS9A 1GJ4H 1MKWK 5FX5A 5C2ZA 4Y7AA 1YP9A 1W11U 4YXWD 1CA0B 2GJGA 2XC4A 2GKVE 2NU2E 4YOIA 1K21H 1FDPA 4A1TA 1AKSB 1SGRE 4LK4A 1Y3XA 1QA7A 1VGCC 1IQEA 2FOHA 1EPTB 1IAUA 1SSXA 4BXSA 2UWPA 4KGAA 1MKWH 4WH8A 3UNQA 1O5DH 1PPBH 1LPZB 3DSPA 3PWBA 1DXWA 1KY9A 1MCTA 1HNEE 1EAXA 3E8LA 2TGDA 1J8AA 1N8OB 1RIWB 1T8LA 1K1LA 1QGFA 2BMGB 2UWOA 3MU4A 4FUGA 2UUYA 5E0HA 1VITH 4TY6A 4H42U 1P3EA 1FMGA 4H4FA 3RXBA 1GJAB 1LPKB 5FCRA 2CF9H 2RG3A 1GMHG 3P8FA 4FU7A 3HKIB 1HAHH 1GJ5H 1JBUH 1YLNA 3GCTF 1ZPBA 5GDSH 1SGIB 5E0JA 1O31A 1OX1A 1G37A 3A88A 1KDQB 1MMJN 2ODQA 3FZZA 2A5KA 3PB1E 2R9PA 3TH4H 1ZMLA 4XBDA 4BTUB 1MTUA 2ODYB 3LPRA 3MH5A 5CHAB 1AWFH 1T8NA 1UVUH 4ZMAH 2OQUA 2RCEA 1O5CB 3M5MA 2IOTA 1WV7H 1ZJKA 5KECA 3URDA 4Y8YA 1A2CH 2PFEA 3RLWH 4X1SU 2OC7A 1CU1A 3SW2B 6CHAC 3MH4A 2F9PA 1YF4A 1SR5C 4Y79A 2Y7ZA 1O5GH 5JDUB 3UUZA 1HAZB 4GAWA 2J94A 4NGAH 1LCYA 2CV3A 4P02A 4IS5A 1WDIA 1TIOA 1LVBA 1ZMJA 3RU4T 3A8DA 3M5LA 1SL3A 2FOAA 1GI4A 2OC8A 1NFWA 1ZMNA 1C5OH 1F0TA 3BSQA 2WZQA 2OQ5A 2ZDNA 3RXSA 2PGQB 1DOJA 4AZ2B 1SOTA 1L4DA 1SMFE 2XBWA 1WXRA 1GI6A 3AAUA 1BZXE 1L4ZA 2R0KA 4KKDA 2BY6X 4R0IA 1W0JD 1O2WA 5CDFE 4Y71A 1WQVH 5FPYA 1DPOA 2P3TB 1GJDB 4BANB 1GVLA 3T25A 1TLDA 1BQYA 2XXLA 2PWXA 1EZSC 3O8DA 1HIAB 4XRNA 3A7TA 2CN0H 1NN6A 1QBNA 1EXFA 1EZQA 1BIOA 1ZHRA 4CRAA 3M36A 5C0TA 1FI8A 1ZRKA 1PPHE 2H5DA 2AGGX 3BF6H 3P8GA 3A7VA 1VCPA 1JOUB 2OLGA 1GJ6A 1FN8A 2H9HA 2ZHEH 4MPVA 3MH7A 6GCHF 1FY3A 3EQ0H 5TCAA 1AFQC 2G55A 1O2MA 4FUCA 1PPGE 1O2TA 1Q2WA 3FP7E 2ZFSA 4E05H 3LH1A 1S6FA 4O03A 4AGJA 3PRBA 1Z1JA 1SKYE 3MI4A 4I31A 3RMNH 3LGUA 1P57B 2QE7D 3RUOA 1GJCB 1Z8IB 1YLDA 4X8SH 2Z3CA 3PO1C 1MZDA 1QRXA 3SNAA 1DFPA 2G52A 1MTNB 1J9CH 1NFYA 2FTLE 3PMJA 5T6DA 3RXAA 2FEQH 2FYQA 4ABIA 1TNHA 3S9AA 1XKAC 1H9IE 4ABHA 1P05A 2VGCC 3P70B 3K6YA 2ALVA 1LQEA 1GJ9B 1YM0A 3UNSA 5DPAA 2ZTXA 3L6PA 1HAVA 1DLKB 3DSGA 1QJ1B 2Y5GA 1PPZA 1UHBB 2AYWA 1CGHA 4K2YA 3VB3A 3EAJA 3TNTA 2OBQA 3F1SB 5EODA 1CSOE 3AAVA 1P9UA 1SGQE 5GCHF 1SQOA 5C94A 4FVBA 3HGNA 1MTSA 4WMEA 1AQ7A 1SOZA 2ZFTA 2BHGA 2FS8A 1FZZA 1GBFA 3UQVA 4TSFD 2ZKSA 4U01A 1C1MA 1O3NA 4Z0KA 1FN6A 3WY8A 1O3GA 4ISHH 2QC2A 2QA9E 3E1XB 1V2TT 4I8KA 4K69A 1E35B 4DJZB 3MWIU 2J92A 1NT1A 4GSOA 3L33A 5KGOA 2A4GA 3GYMA 2ZPQA 1D9IA 1QZ8A 1H9LB 1WTGH 5A0AE 1G9IE 3CNRA 4BTTB 1O36A 2CXVA 4AX9H 5HIZA 3UY9A 1SGCA 1VITF 2O9QA 3V12A 2L74A 3TNSA 2FOCA 4ISOA 2UUFB 4DT4A 4ZAEA 1EB1H 4AB9A 1XX9A 3EA9A 3BG4C 5EXMA 4HFPB 2WV4A 4A5TS 4GCHF 3RXQA 2XOKD 4LZ4B 4FUBA 2VVUA 1C4Y2 1EAIA 4CHAC 3PYHA 4HTCH 1CBWB 4XE4A 3HK3B 1AGJA 1GDQA 7GCHG 2H2ZA 1C1NA 1C2KA 4F4OC 1XVMA 4A1XA 2BLWA 3KCGH 4OGXA 1O3LA 2ZFFH 1ANBA 3MO3A 3S9CA 1YPHC 1TBZH 1TA6A 1K1MA 1TPPA 2YMSC 3SOSA 2PUXB 5LGOA 2V0BA 1KSNA 3W94A 1HGTH 1QHRB 2G4UA 2EC9H 2FZZA 3FN8A 3Q3YA 1TX7A 4JZEH 1O0DH 1C5SA 2BDAA 2TBSA 2EI8A 4K1TA 1MKXK 1A4WH 1CT4E 1C5YB 4X8VH 2BVRH 1ARCA 3GYLB 2ZWLH 5HGGA 3WW7A 3CS7A 3HK6B 1XKBC 4NIVA 1NRRH 2BD9A 5EQSA 4BXWA 5T1VA 2F3CE 3DCLA 3TPIZ 4B6EA 2VIOA 2FESH 1A5GH 1GCTC 1KLJH 2ZP0H 4NZLA 2BY5X 1NBMD 1SB1H 2C8ZB 3STIA 4B2BA 1O34A 2EA3A 1BJUA 2PV9B 4RT0A 2XWAA 4I8LA 1UO6A 1PQ5A 2O8TA 1C9PA 3TIUA 1RGQA 5JPMH 2AMQA 3M5NA 5EU8A 2B7DH 1BITA 3QWCH 4YTAA 3SV6A 1O2VA 2BDIA 2VIPA 1GL0E 3PV4A
chains in the Genus database with same CATH topology
2BDGA 1DSUA 4YLQH 1KXDA 1O38A 1QL7A 3RMMH 1TRNA 1NFXA 4NSVA 5F8ZA 3LKWA 2AMDA 2DE8A 3SI4H 1DUAA 1G32B 2Z3EA 1C5XB 5L2YH 1FLEE 2ZDAH 1GBBA 3SUFA 3M3TA 1KXEA 2AH4X 1ETTH 1DWEH 1QR3E 4X0WU 1OWJA 3MU1A 2ZU4A 4BAOB 2FDAA 2PGBB 3BTFE 5DK1A 1YPMH 5EW1H 2C8YB 2P8OC 1TX6A 4RKOB 1ZRBA 3ATLA 1ID5H 2K1QA 1J14A 2P59A 3IWMA 4YT6H 2GGVB 2P93A 1L1NA 4KP0A 1HXFH 3RXVA 2IJOB 1BTWA 3P6ZB 4B73A 1FPHH 1FPCH 1GJ8B 1CT0E 3K2UA 5AF9H 1CA0C 1GG6B 3UR6A 2ZFQH 4THNH 7ESTE 4AYYB 4IMZA 3ZVDA 3OU0A 3U98H 1TMUH 1Z8RA 3QUMP 1AUTC 1H8IH 3A87A 4UD9H 5DP3A 1EPTC 3ZZBA 4H6TA 3SU0A 3U8TH 1C5ZB 1S82A 1EJMA 5E2OA 4D9RA 1GBDA 5JBTA 3UIRA 3UFAA 2FYRA 1TGCA 1BBRK 1O2SA 3RXKA 4KTSA 1N8OC 1RIWC 1V2RT 5PTPA 1UMAH 1HV7A 2JETB 3SZNA 1BTYA 2QXGA 4AB8A 4AG1A 1OP2A 1GBIA 1XVOA 1V2LT 4NSYA 1IQFA 2WPJS 1HBTH 4X6OA 3RU4E 2VVVA 1J15A 4X2WA 3QX5H 2ILNA 3ZVEA 1K22H 1XMNB 2ZHWH 2NWNA 2PUQH 4ISIH 3OSYA 4QT8C 2CF8H 4WY3A 5C5OA 3FANA 5CHAC 2H5CA 4ZKOU 2BD3A 2FOFA 2QIQA 2BOHB 1NZQH 1PQAA 1WQSA 2P3FH 1YPEH 2FTMA 2I6QA 2D8WA 1QL8A 3Q3KA 1AVWA 1MCVA 2FM2A 1BTPA 1HB0B 4ABAA 1Y5BT 1S0QA 1WAYB 3OY5U 3C1KA 1ELDE 1UTJA 1ESTA 1Y59T 4FUEA 1QB9A 1EAUA 3ZVBA 3KQDA 1GMCF 1AZZA 4WMDA 3LT3A 3GCTG 3SUDA 1VR1H 5J4QA 3PLPA 1S85A 2XCNA 3BTGE 2ZO3H 3UOPA 1TA2A 1TGTA 1YCPM 1GBEA 1FIWA 1MTWA 1TGBA 2J34A 1C1SA 3FAOA 1GBTA 4GPGA 2BY9X 4UFFH 2IPHA 1V2ST 5F6MA 4F49A 3TGJE 3A8BA 1GCDA 1N6YA 3GDUA 4IBLH 1N1LA 1V2JT 3K65B 2OCVB 2CHAB 1O2LA 2CJIA 4D7GA 2A7HA 2ZI2H 3PLBA 2P3UB 2TRMA 1XUGA 2WYGA 2SGQE 1TPAE 2PHBA 2ZECA 3R0FA 1QY6A 2DE9A 3BIUH 4O3UA 1TNJA 1AN1E 1KTSB 1E36B 1PYTC 3MNBA 1UVOA 3BTME 4B75A 2R2MB 3FZDA 1O2HA 4CRGA 3LGYA 1AVGH 3FP6E 1ELGA 4B76A 4Y76A 4J1YA 1F92A 2D2DA 5DGJA 1IQHA 3ZZ3A 3NWUA 1MZAA 4U32A 3DHKH 1O2UA 2WPHS 3CENA 5HXFA 3M61U 1C5MD 1GHVH 4DIIH 1XUKA 1F7ZA 2BD4A 4LXBH 5A0CA 1SQAA 1P02A 2FOEA 4AGKA 2XBVA 1SHYA 1BTUA 3Q00A 5JBBS 1HIAA 1SI5H 2J38A 2PKAA 1MTNC 1DLEA 1CQQA 5E8EH 2KAIB 1P0SH 2C8XB 3VPKA 1S81A 1BHXB 4X1NU 2SNVA 3M5OA 2V3OH 5J4SA 4FUHA 1SLWB 6GCHG 2WPMS 1FY1A 3VXFH 1NRNH 2TGTA 1W10U 1VCQA 1K1NA 1WOFA 1CHOF 4CRDA 1RTFB 4JZIA 1P2QA 2J2UA 3GY3A 1MD7A 4D8NA 1GMDF 2PKSB 1TGSZ 1EATA 3U8RH 3LOXA 4A6LA 4CRBA 3LGIA 2ULLA 4ZHAA 2Z6BD 4B1TA 1Y3UA 4DCDA 5HYOA 2XBXA 4E06H 4ISNA 1EKBB 1LHDH 1DY8A 3F6UH 2EI6A 1MQ6A 5EXLA 1FNIA 3EYDA 1QL9A 1HAYB 3ZZ6A 1C5NH 1LDTT 4Y8XA 5C5NA 2Z7FE 5H4IB 1UTOA 3UR9A 1BHXF 2A7CA 2ANYA 2F9VA 3RXHA 2Z9LA 3FFGA 1O39A 1NESE 2FPZA 3B8JA 4DIHH 1VZQH 1XM1A 3QTOH 4MNVA 1TNGA 4X8TH 3ZV8A 1PJPA 2ZIQH 5GCHG 1O5FH 1E34B 1MTVA 1FY5A 4A1VA 3SNCA 3LC3A 1TALA 2A4OA 1GDNA 7LPRA 2Z9GA 1EP6A 3BEIB 3K9XB 3RXRA 1P2KA 3S7HB 4ZHMU 1TOCB 1P12E 1HJ8A 2BXTH 1SGYE 2QF0A 2Z9JA 3RXUA 5L6NH 1D3TB 1CBWC 1ZYOA 3KEEA 4AFUA 2ZDMA 1GI1A 1BMNH 1F5LA 3BEUA 4Q7XA 1Y8TA 2V35A 4UFGH 1O5BB 4ABDA 3MU8A 1TNKA 1ELEE 3SGBE 1VITG 2VWLA 1WBGB 1KTTB 3E0NB 4ZXYH 3GCHB 1QRZA 2AFQB 2ZNKH 3RC6A 1Q3XA 1SLXB 1W0ZU 1DT2A 3GDVA 2ZGCA 5EOKA 4E7RG 2FXRA 1DSTA 1HYLA 1Z8GA 4GCHG 5A8XA 3QGNB 1OP8A 1C2HA 1X7AC 4I8GA 1M9UA 2XYAA 2Q6DA 4TWWA 1ZHPA 4I7YH 4GVUA 1GHWH 1O2QA 3A81A 3QTVH 3E0PB 2HALA 3SJ9A 3A7WA 2WV5A 1AVXA 2HLCA 3GY4A 1SBWA 4KTCA 1PPEE 4K1SA 2OUAA 1QFKH 3AVZA 2GP9B 1CA8B 5C1UA 3LONA 3BTQE 2HNTE 2FI4E 4I8JA 1YCPK 4XBCA 1RRKA 3A7ZA 1TFXA 1D3QB 2Y81A 1JIMA 1ETSH 5FX6A 2AERH 1A0HB 3RM0H 4OS2A 1GJ7B 4OS6A 4NCYA 4NIXA 3STJA 1G30B 3H7OA 2NU3E 1BUIA 3A84A 3V0XA 2VB0A 3RXPA 3SU1A 2ZGBH 1NC6A 2G5NA 3BTWE 2TIOA 2AS9A 1YLCA 3IITA 4Z6AH 5A8YA 2PLXA 1O3BA 1GHAF 2JH6D 4A92A 4WWYA 1T7CA 2PSYA 1W7GH 1C1QA 3T27A 1A0LA 2R2WU 3GOVB 3M7QA 1BB0B 4E7NA 3VEQB 1NTPA 2ZHQH 3ZZ4A 5GIBA 3UNRA 1GG6C 1P2NA 2FODA 3BTKE 1TBQH 2ZGHA 5DP6A 3GDSA 4FU8A 1PYTD 2STAE 4CH8B 1C1VH 1LHGH 1Z6JH 1UTLM 3TJVA 3TJNA 2BLOA 1ZSKA 4K8YA 1GI3A 2GMTB 3RC4A 2Y80A 3HATH 4DW2U 1NPMA 1C4U2 2ZC9H 4O97A 2ZHFH 2ESTE 1IQIA 1OS8A 1AE5A 3FVFB 3KN2A 2BLVA 3RXLA 1L1GA 4XFQA 2ZDVH 3A83A 4R8TB 4ABBA 1XUIA 4K5ZA 4MG3A 3MU0A 4PROA 1GBKA 3HPTB 2JETC 2BY7X 3PMBB 5F8TA 1UVSH 5C3NA 5AFZH 4X1PU 2O8WA 3NKKA 4AORA 1K1IA 2C8WB 1V2PT 2SGPE 3MH6A 5EPNA 4ZXXH 4YT7H 1ZGIA 1G3BA 1THPB 1NS3A 3PROA 5JB9S 1ZR0A 2BQWB 4AG2A 2ZU5A 1V2KT 3G01A 1V2VT 2BD7A 5L2ZH 1EP5A 1OWHA 1QBVH 2VVCA 1GHBF 1ZPCA 1CE5A 4ASHA 4GHQA 4Y0YE 5DKMA 3SU3A 1GBJA 3B9FH 1QTFA 2OD3B 1SFIA 3QZQA 1GMHF 1S84A 2HGTH 2XC5A 3PMAB 3LU9B 3V3MA 1T8MA 2OXSA 2CMYA 3P8NA 1O2IA 1C5QA 4NA9H 4NG9H 3RXIA 4U30A 3TH2H 2FOMB 5CMXH 1EB2A 4D9QA 3OX7U 2B5TB 4FUJA 2HVXA 1P2IA 4YM9A 3AW1A 1LO6A 1A7SA 1SG8B 5FAHA 1SGEE 2O8LA 3EA7A 2FOBA 2BDHA 1JWTA 1T32A 2ZU2A 1OYQA 2W3KA 4NA7A 3TGIE 1HAGE 1C2DA 4X2VA 4DT7B 1BMMH 1HCGA 5GWZA 3H5CB 1XXDA 1QQUA 1A3EH 1Z1IA 4CREA 3PWCA 1VJAU 3BN9A 4JZFH 2BZAA 3KHVA 1Z6EA 3VB4A 1EUFA 3QDZB 1QA0A 5FBEA 1WCZA 1RD3B 2YNAA 1UTKA 1KLIH 1LKBA 2CHAC 3SU5A 3VXEH 4XDEA 3S69A 4KELA 2D1JA 1SLUB 1AO5A 4I33A 1W12U 1LKAA 4LOYH 1GMCG 1JIRA 2ZQ2A 1BCUH 3RM2H 1C2GA 1SGNE 3ITIA 3RXEA 1P2OA 1TPSA 2VWMA 1O3OA 3D23A 1O2XA 1AIXH 5EGMA 1O30A 1DY9A 2A4QA 5FCKA 4MLFB 2GZ9A 2GV7A 1MKXH 2ZDKA 4BOHA 3VB7A 2Z3DA 4X1QU 1OYTH 4O3TA 2AIPA 1O2KA 2XW9A 1W8BH 2ZPSA 3BG8A 1IQLA 4CRCA 3RMOH 5FXLA 1IHSH 5JBCS 1KXAA 4HI3A 2BX4A 3KNXA 1YGCH 1J16A 3NUMA 2QV1A 1YPGH 3MHWU 5C67A 1AB9C 1G2MA 3LJOA 3T26A 4IN2A 2VWNA 1ZJDA 1W0YH 4X6MA 1SGPE 1G3CA 1GVZA 3CP7A 3F9GA 1EJNA 1GI9B 2PTNA 5HM2A 4DOQA 1GHYH 1DWCH 4FUFA 1DM4B 3S7KB 3VFEA 2QGRA 1RTKA 1YBWA 2H6MA 1BBRE 1GDUA 1GI7B 1O3MA 4YO9A 4D7FA 2H9TH 1BTHH 1HAOH 4Q2KA 1K1PA 2BZ6H 2PKSC 4ZKNU 1LVYA 3NPSA 1B0FA 5EQRA 4H6SB 4Y10E 5JB8S 4ABEA 2G5VA 3A7YA 1D6WA 1YPJH 1TAWA 2UWLA 1FONA 3B23B 1ZOMA 1TABE 4UEHH 3RP2A 3EDXB 3LGVA 2KAIA 1PQ7A 3E90B 1FV9A 2HNTF 3M37A 3PM3A 1B7XB 1KXFA 1P2JA 2JH0D 4AFSA 3O8CA 1OWKA 1VJ9U 2PTCE 3LIWA 3SGQE 4NWKA 2ANMH 1GWAA 1T31A 3JZ2B 3DFJA 2LPRA 1CHOG 2M5TA 1FAXA 1O3HA 1BTXA 2GV6A 5C1YA 5G4BA 1FUJA 1ELFA 5DJ7A 1SVPA 1ORFA 1O3PB 3SQEE 3F9EA 2TGPZ 1CGJE 1GMDG 3TITA 3TH3H 1GI8B 2GVFA 3F9HA 1K1JA 1V2QT 4FXGH 5I46H 5JYIA 1V2WT 1ZPZA 2GZ8A 1P9SA 1ESAA 1KIGH 1BRBE 2SGAA 3TK6A 1BBRH 3SORA 2FX4A 3U69H 3E3TA 2OP9A 3LC5A 2AEIH 1QNJA 5JBAS 1XUJA 3KL6A 1AKSA 2FI3E 4ABJA 4B2CA 4YOGA 1E38B 1EPTA 1O32A 1AUJA 1GI2A 4Q80A 3T5FH 3SV7A 2ZF0H 1SPJA 2BX3A 2GT7A 1BOQA 2BB4A 3IG6B 1NU7B 2VINA 2TGAA 1T8OA 2VWOA 2VU8E 2GCTB 1CHGA 3C27B 3GCHC 2WUBA 3ESTA 1EJAA 1UVTH 1IQKA 1ELVA 4ZHLU 3ATWA 3SQHE 5HMAA 1F0UA 1NRQH 1C4V2 2V3HH 3D65E 4IGDA 4CR9A 1S6HA 2BD5A 1C5RA 1GBCA 5CE1A 2W7SA 2ZTZA 1CT2E 1KDQA 3S0NA 1FXYA 4D76A 1O2YA 3K6ZA 3W95A 3EGKH 3T28A 4OS4A 3SV9A 3ODFA 3SI3H 1SQTA 1SGFA 1MU6B 3SU6A 2F9UA 3F9FA 4DG4A 1IQNA 4YZUA 3UQOA 4ABFA 1EZXC 1HXEH 1QCPA 2ZGXH 1LVOA 4X1RU 4WF8A 3ZV9A 5T3HA 1GHXH 1KXCA 1V3XA 4INKA 1JMOH 1GVKB 2P95A 2RA0A 4IC5A 1O3IA 3RXDA 3A8CA 5EPYA 1GBLA 4A7IB 2GCHF 4Y11E 1HFDA 2BM2A 3ZZCA 1C1OA 1WU1A 4K8BA 1IQGA 2A31A 2ZG0H 3ZYDA 1W14U 1KLTA 2F9NA 4WH6A 1CVWH 1TNLA 1BRCE 3OTJE 1TQ0B 5FHTA 4X8UH 1F5RA 3MNCA 1SGFG 5FPTA 1BMLA 1C5UA 3EA8A 2ZFPH 2SFAA 2GDEH 3ENSB 1HLTH 1AB9B 2ZEBA 3E91A 1SGDE 1TNIA 1C2IA 2R0LA 2RDLA 2Q6GA 2F83A 2W5EA 4I8HA 1OP0A 4CBNA 1SLVB 2VIWA 2BQ7B 3GY7A 1AHTH 2FIRH 4X6NA 4VGCB 4ESTE 2NU1E 2HPQH 2SGDE 4NFEA 2GMTC 2NU4E 5F03A 1PFXC 2OC1A 4WXVA 2P94A 1GHAG 1OSSA 1HAPH 2BOKA 2QYIA 1AU8A 3P8OA 1ANCA 3ATIA 1RTLA 1C5LH 4ISLA 2OINA 4MNWA 3M7UA 2HRVA 2ZZUH 1F5KU 3ZZ5A 3BTEE 5EQQA 1S5SA 3OYPA 3SHCH 1DDJA 5E2PA 3ELAH 7KMEH 5FBIA 2HWLB 1AE8H 1UCYE 3GICB 1QJ7B 1MQ5A 4ZUHA 1DUEA 1G36A 4GHTA 2JKHA 3BTHE 1O3CA 4FU9A 4ZKRU 3SUEA 1NRPH 4MPXA 1UVPA 5DP7A 3UTUH 1UHBA 4ZH8A 3SNDA 3TVJB 2BDBA 1OWEA 2Y5FA 1TMTH 3O8BA 5IYTA 1MH0A 1LHEH 4INLA 1Y3YA 3SU4A 2O8MA 1C5WB 4FVDA 2QXJA 1DXPA 3UOUA 2CGAA 8GCHF 2B0FA 4JYTA 3U9AH 3TLOA 3L3TA 2GDDA 1W7XH 2Y5HA 3F68H 3SO3A 4AYVB 1PPCE 3DFLA 1GGDB 3A86A 4MPUA 1C1UH 2WYJA 1UCYK 5HM9A 2A2QH 3RMLH 1ARBA 1C1TA 1GHBG 1THRH 3RXJA 5DO4H 3P17H 1O3DA 2OBOA 4XBBA 2PR3A 3A89A 4K1EA 1C1PA 5F8XA 1SHHB 2VNTA 3KQBA 1MBQA 1Y3VA 3PTNA