3URDA

T181a mutant of alpha-lytic protease
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLAQGNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
molecule tags Hydrolase
source organism Lysobacter enzymogenes
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
total genus 60
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urdA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3urdA01
1J15A 1EASA 1GBMA 1TB6H 1ZJKA 1GBIA 2FO9A 5DP4A 3QTVH 4E7NA 3QLPH 2BLOA 4B75A 1O2RA 1YKTA 2Y6TA 4D7GA 5DGJA 1SL3A 2R0LA 3HKJB 2A0QB 4X6NA 7GCHG 1WQSA 2ZTZA 3A7TA 2Y7ZA 2I6SA 1NN6A 1QURH 1O32A 1K9OE 2GV7A 1C5PA 2F83A 1O38A 3A89A 3SUFA 1MZDA 3LKWA 1PYTD 2OC1A 1Q3XA 4A6LA 4B2CA 4E05H 1W3CA 3RXBA 2PWXA 2VWMA 3T26A 1ZMLA 1KLJH 2VIWA 2ILNA 4GHQA 4VGCC 1HV7A 1AFQB 3MO6A 5T3HA 3RDZA 2ZPSA 4MNWA 3TPIZ 3PB1E 1ZPZA 5TJXA 2VWNA 1GGDB 1T8OA 1Y5UT 1HIAB 1QJ7B 4CR5A 5GCHG 1V6DA 1OYTH 2QGRA 3E0NB 1LPGB 3QN7A 1Y3WA 2C93B 4X2VA 1S83A 2V0BA 3M35A 3M5LA 2ZGJA 1XUHA 1GHVH 5J4SA 1BTUA 4JZEH 3RMOH 4BAMB 1P09A 1V2VT 1C5WB 2G4TA 1MMJN 4ZKNU 1AMHA 1FY3A 1GI1A 1YPJH 3A7XA 1P05A 2O8TA 2ZECA 3PLPA 1S81A 1DE7H 4UD9H 3KGPA 3AAUA 1P2IA 3A8BA 1C2JA 3BIVH 5LH8A 1ELGA 1WU1A 2WUCA 3KQDA 2ANYA 1YLCA 3QTOH 4X1NU 4AGJA 2ANMH 1INCA 1P02A 1TX7A 4WH8A 5EU8A 4CHAC 2GVFA 2G5VA 3BTQE 2JH0D 1X7AC 2FOBA 1F0TA 3FAOA 1QCPA 2B8OH 1TA6A 2Z6BD 1GMCG 1UMAH 3EGKH 2Q6GA 2J34A 3MH6A 1OPHB 1W7GH 1DLKB 5FXLA 3H7OA 1Z8RA 2ZTYA 2F9VA 3FVFB 2VB0A 3BG8A 1K22H 1DY9A 1HAVB 3QUMP 1W0YH 2P93A 4NZQA 4A1XA 1GJ5H 2D8WA 3TITA 1VGCB 3ZZBA 1TGTA 1DWBH 2GV6A 2BDIA 1VCWA 4AFQA 2GMTC 1JWTA 3MWIU 3RXAA 3UPEA 1MKXK 1SGTA 1WYKA 5H4IB 1S84A 1OP2A 3BTWE 3AW0A 3UNQA 2D1JA 2AGIX 4HI3A 1NFYA 5FCRA 3BEIB 1MCVA 3RU4D 2B7DH 3T2NA 1GGDC 2QC2A 3OU0A 1GVLA 3ZYEA 4ABJA 3E16B 1GCTC 3ATWA 2VU8E 1NU9A 1OWKA 1AFQC 1Y3UA 3A87A 2H9HA 5L2ZH 1EKBB 2O8WA 4GVUA 1GBTA 4O3TA 1V2ST 1CA0B 1O31A 1CA8B 5GDSH 5L30H 1HIAA 3ZZ6A 2VVVA 2P94A 1NRRH 1B5GH 5DP7A 2CF9H 7LPRA 1O2YA 4X2YA 1K21H 1MAXA 2A32A 1S0RA 7GCHF 3A83A 3KQEA 1TPSA 3GYLB 3L33A 2SNVA 1P06A 1UTPA 2UUJB 2G5NA 1SLUB 1HLTH 3G01A 1HRTH 1YPMH 2OTVA 1CVWH 1DUEA 1P11E 1UVUH 1CT0E 2A45B 1FNIA 2ZPRA 2VGCC 4KGAA 1QQ4A 2XC0A 1AKSB 4JK5A 1EZSC 1MD7A 1AB9B 1O3DA 1QR3E 2AMQA 1LVYA 2UUKB 3DA9B 3HGPA 3HPTB 3PLKA 3MTYA 5A8XA 5K0HA 3SNCA 3I78A 4ZUHA 5GCHF 3V12A 1Z7KA 5GWZA 2VIOA 1U6QA 4OS1A 5FX6A 5TCCA 2BD8A 2TIOA 1ELTA 4FUIA 4BAOB 1CHGA 1Y5AT 3E3TA 2BD5A 3GISB 2QF0A 1A46H 1EATA 1N8OB 1QRWA 3JZ1B 4O3UA 2QV1A 1NRPH 1KLIH 1Y8TA 1C1MA 4Z6AH 1BTPA 1Q2WA 3O8RA 3U69H 3JZ2B 5C5NA 1PPZA 2BQ7B 2ZG0H 1V2RT 4KKDA 1ZHRA 4UONA 1AKSA 4J1YA 3U1JB 1FMGA 1TNLA 2ZTXA 3FANA 2OXSA 2QA9E 3M5MA 2J2UA 3E6PH 2FS9A 2EI6A 1SHHB 3PYHA 3SUGA 4NGAH 3NCLA 3KN2A 1AO5A 1GMDF 3M37A 1O2GH 3BN9A 3ZZ7A 2H6MA 2ESTE 4NIWA 5EPNA 1AE5A 2IPHA 2ZZUH 1EAIA 4XDEA 2VWLA 1SOZA 3ZVEA 1ETSH 3WY8A 3M5OA 1S6FA 2ZCHP 1O3LA 4GAWA 1O35A 1GJ6A 1C5QA 2FX4A 5A0BA 1XMNB 2OCVB 1RTFB 3LT3A 4DW2U 2ZP0H 1RS0A 1KXFA 1MZAA 2BX4A 4XE4A 1PFXC 1SFIA 4DURA 1G3CA 3A85A 4HGCA 1SGYE 4NSYA 3HK3B 5HYOA 1G9IE 3PTNA 4OS5A 2A7JA 1XXDA 3SU0A 2FMJA 3A7VA 4K69A 4VGCB 4Y8XA 2VVUA 2XWAA 3GY8A 2BY5X 1TPAE 2ANKH 4KTCA 1UVPA 4AFSA 4DVAU 3VPKA 4MVNA 4IN1A 1HUTH 2Q6FA 5F03A 1CBWB 5I25A 2ZU3A 3UWIA 2XBVA 3ZZDA 3MNSA 2PR3A 1NZQH 1ZMNA 2W5EA 1C2IA 1PPGE 2B9LA 4INHA 2UUFB 2QY0B 3UQVA 1DDJA 4CRFA 1FN6A 1UTLM 3U8RH 4R0IA 1QB6A 1J14A 4A7IB 3VGCB 1BQYA 2JH6D 1LKAA 1JRSA 1AZ8A 3A8DA 2BHGA 1TX6A 2FODA 3F9FA 1IQMA 1S82A 4WF8A 2ZGHA 1IQEA 1FI8A 1TOMH 1F0RA 4CREA 1BTYA 1AB9C 4TY6A 1MH0A 1HCGA 1A5IA 2FLBH 4JYUH 1LPZB 1HAIH 1HPGA 1O2QA 3OX7U 8LPRA 2GX4A 2KAIA 2ZGXH 1BRAA 2TGTA 2C90B 4AB8A 1DXWA 3P8NA 4IS5A 1J16A 1K2I1 3LGTA 1ZLRA 3NXPA 4I8JA 4ISOA 1O3JA 2VH6A 3BSQA 4MPUA 4DCDA 3MU0A 3BTHE 2XC5A 1E36B 3AAVA 1TRMA 1D3DB 1P12E 1UTMA 5BPEA 1SGDE 2FOMB 1C2HA 4ZKSU 3RU4E 1UVOA 5EODA 7KMEH 3SOSA 3STIA 3QO6A 3U9AH 1SQTA 1IQIA 5DG6A 2BXUH 2J95A 3O8DA 1C2GA 2Y82A 1QTFA 4JZ1A 3D23A 2UWPA 3SV2H 1QL9A 1Z8JB 4Q7XA 4YT7H 2FI5E 5C1UA 2LPRA 1TNIA 2FOGA 1BCUH 1RTLA 4INKA 2CV3A 1OXGA 3SV9A 4GSOA 1MQ5A 1GPZA 1OWDA 1O2ZA 4ZMAH 3V0XA 3GY7A 4MPWA 1MKXH 4TWYA 2PSXA 4XOJA 1K1MA 5C3NA 1F0SA 3VXEH 1RGQA 4BTIB 5SGAE 1AGJA 1OP8A 4NCYA 2JETC 2ZI2H 1LTOA 1NFXA 3FFGA 1GI2A 3UOUA 3ESTA 3SNEA 1GG6C 1NRQH 1YCPK 3LC5A 5JBTA 1TALA 2RDLA 4WMEA 3I29A 2BDBA 3NZIA 3MO3A 4JMYA 4FXGH 5IYTA 4ABGA 1TNKA 3RXGA 3RM2H 1ELBA 2PW8H 4Y6DA 1GI8B 2ALPA 1V3XA 1BRUP 2FYRA 1OKXA 2OINA 2Z3DA 1GJ7B 2G00A 4MNVA 2FS8A 3SV8A 4JYVH 6CHAC 2XCFA 2ZHWH 2P3UB 5FBEA 3VB4A 3T28A 1O2MA 1O5FH 4XFQA 4ZKRU 1K1LA 1SGFA 4INLA 3AVZA 5CMXH 1BBRE 3FP7E 1BA8B 2ZF0H 4J2YB 2GTBA 3EE0B 3HK6B 3SV7A 1HAOH 2YNAA 3A86A 3UUZA 1GCTB 3Q76A 3ENSB 2ZQ1A 2K1QA 1UO6A 2CN0H 3BV9B 2ZDNA 2R3UA 4Y7BA 4BAHB 2F9BH 3TIUA 2PUQH 3KQCA 3LGWA 1B7XB 1N8OC 3U98H 2JH5D 1GL0E 3H7TA 1MUEB 1S5SA 1TMUH 1PPHE 2B0FA 4IC5A 2J38A 4XSKU 2VVCA 1A7SA 2VWOA 3BEFB 3GDVA 3Q77A 3ZV9A 4ABFA 1ZRBA 6LPRA 2G81E 1J17T 3RXPA 1PPCE 1TWXB 3VGCC 3SU4A 1P57B 1TGNA 1T7CA 1MTSA 1VR1H 3A7ZA 3F9EA 1CHOG 5I46H 4ZHAA 1ZJDA 2BOKA 3SJOA 1FY4A 1D3TB 2WPKS 4FUCA 4AFZA 2A5KA 1O5BB 1V2NT 2BOHB 1B0FA 2BMGB 1ANEA 1T4VH 3ATLA 3F9HA 2WYGA 3F9GA 3P8OA 4H4FA 1C9PA 3E90B 1C1RA 4I8GA 3BF6H 2CHAC 1C5TA 4B73A 1C1QA 5GIBA 1KTSB 4O97A 2OUAA 1SQOA 3LOXA 4H42U 1QL7A 2BX3A 1O37A 5ESTE 4JZIA 3MI4A 3MU5A 1BTHH 2ZU4A 4U30A 1SLXB 3UNSA 1L0ZA 2BVSH 1C1VH 2UUYA 1ORFA 4WMFA 3ZVCA 1TA2A 4RSPA 3RC4A 3BIUH 1RFNA 4Y0YE 1GHYH 2ANWA 2XCNA 3EA9A 4JZFH 4YOGA 1BBRH 1SGIB 1IQHA 1TMTH 3EAJA 2BY8X 2PV9B 1A0HB 1IQGA 4Y11E 3SGQE 1NRNH 1T4UH 3RXJA 3ZZ5A 2BDCA 3M3SA 1EAWA 3DUXH 1G3DA 2ODPA 1C1OA 4BANB 1GDUA 2VNTA 1Y5BT 2B5TB 3BTME 2ZWLH 2F9PA 2YOLA 1BB0B 2PUXB 1P9UA 3ODDA 1QGFA 1V2LT 4THNH 4ZROA 3VB3A 4H6TA 4ZHMU 2BQWB 1V2KT 1G3EA 2FOEA 4IMZA 1YYY1 4ZH8A 1N1LA 1PQAA 1C1UH 1MD8A 2AH4X 4NZLA 3ZVFA 3Q3XA 4UE7H 2JETB 1SGFG 1UTOA 3LJOA 1VJ9U 2F3CE 5EQQA 1ZMJA 7ESTE 1XUGA 2FP7B 2EC9H 1C5MD 4Y71A 1NPMA 1BT7A 1TNGA 1AQ7A 2VH0A 1C5UA 3C27B 4FUBA 1SSXA 1DXPA 1NO9H 3SNAA 1G2LA 1TGBA 1H4WA 8ESTE 2BVXH 1UK4A 2BLVA 2F9UA 3GCTF 3Q3KA 2QCYA 3PMHB 2EA3A 3ODFA 1OWJA 1F7ZA 1WQVH 1O5DH 5JBCS 1FIZA 1K1OA 3GDSA 4IMQA 2XYAA 1FZZA 1GMHF 1ACBE 1SFQB 1THPB 3OSYA 4D9RA 3RXUA 2ZPQA 3M3VA 4GLYA 5T6GA 2FIRH 3HGNA 1ZPCA 1HAHH 4H6SB 3SW2B 4K3JA 4AYVB 3L6PA 2LNCA 1EJMA 4YLQH 1DWDH 4NWLA 2GCHF 4CRCA 1L4ZA 5FCKA 2PFEA 5EOKA 3UWJH 1AY6H 1F0UA 2ZQ2A 4MLFB 1O39A 1XKAC 2H2ZA 1JMOH 3KEEA 4ZXXH 1S6HA 3A7WA 4K2YA 3I77A 1XUIA 1GHWH 4F4OC 4YLUA 2BDGA 2XRCA 3FP6E 4X8SH 1O30A 3CP7A 1EZUC 4K1EA 1EQ9A 3GCHC 5F8XA 1P8VC 1GJ8B 3MMGA 1LQEA 1MTVA 4CRAA 1GHAF 4AX9H 1ZGIA 1O2OA 3NKKA 5CHAB 1EUFA 2AERH 3MFJA 1C5RA 1D4PB 1J8AA 1V2JT 3S9BA 1W10U 2BB4A 1GJBB 2ZGBH 1GBKA 2NU1E 1QBVH 4DOQA 1HYLA 2ZFRH 2V35A 3L3TA 1DY8A 4O03A 2DE9A 1HJ8A 1O2IA 4IC6A 2Z3EA 1GVKB 5C67A 1H9LB 2FTMA 4GPGA 1P9SA 2A1DB 1Z8GA 2W7UA 2ZU1A 3W94A 2R2MB 1O2UA 1IQNA 1ZZZA 5LPRA 3RLYH 4LZ1H 3E1XB 2A2QH 1Z71A 5F6MA 1VITG 1T8NA 3RXRA 1QIXB 5C5OA 5DPAA 1DX5M 3SU2A 1F5RA 1KSNA 1MTUA 3URCA 5HMAA 1BIOA 2Z9LA 2CXVA 2Z9GA 2HPQH 1W14U 1WSSH 3TGKE 1TABE 4AGKA 1AWHB 2A4QA 1G36A 1PPBH 4TYDA 5F8TA 2AMDA 2F9OA 1Z1JA 3LC3A 1XXFA 1V2OT 3PROA 3ZVAA 3DHKH 3RC5A 3KCGH 3URDA 1AE8H 2AGEX 4IW4E 1GHBG 1K28D 4TWWA 1WTHD 2DE8A 2GGVB 1ETTH 2HLCA 2ZHEH 2J92A 2ASUB 1O3OA 2PSYA 3BG4C 4RKOB 1L1JA 1ZR0A 4FUGA 4AOQA 1GCDA 1T8LA 3GY5A 4K8YA 2ZCLP 3R3GB 2TRMA 5TCAA 1DSTA 2VINA 1EPTB 3GOVB 1FXYA 2P8OB 1GHZA 1LVMA 1VITH 5C20A 1IHTH 1MKWK 1ESAA 2BLWA 4Q7ZA 1P04A 5JBBS 1GMCF 3A81A 3QGNB 4X1SU 4K60A 1GG6B 1A1RA 2BLQA 1SB1H 4ABIA 3LIWA 1C5NH 2WPLS 1FN8A 4WH6A 2P3TB 2J4IA 1A5GH 2UWOA 4OS4A 4IN2A 3PLBA 1QJ1B 1OWIA 3A7YA 1MTNC 1SC8U 2BDHA 4YOIA 4FU9A 1HXFH 4MNYA 3DFLA 2Q1JA 1UTJA 3EDXB 2W3KA 2FOFA 3RXDA 2AMPA 3RU4T 2WINI 1TLDA 1J9CH 4DGJA 2GCHG 1WV7H 4M7GA 1TX8A 3RM0H 3MH4A 1O2TA 3D65E 5DP3A 1YM0A 3UQOA 3K6ZA 1YGCH 8KME2 2M5TA 1ZTKA 1W8BH 4NWKA 2GD4B 1UTKA 3SO3A 1NY22 2AYWA 5GPIB 2XBWA 3T27A 2H5CA 4X2XA 1UCYE 1ZHPA 3SJKA 3SZNA 1EB2A 2F91A 5E0HA 2R9PA 1BUIA 3TGIE 1K1IA 2C8XB 2A2XH 1EP5A 4YZUA 1C1NA 1FPHH 1KDQB 2BDYA 2O8MA 1AZZA 5LGOA 1BMMH 1LHCH 1QB9A 4D7FA 1O2PA 4Y10E 4X8VH 1NT1A 2FZZA 1MKWH 2Y81A 4U01A 1YCPM 3RXCA 1DITH 4CBOA 1ABIH 1AN1E 2HRVA 1O5EH 9ESTA 3S9AA 4HTCH 1FPCH 1EB1H 1QBNA 4NA7A 2A5IA 3PV4A 1N6YA 2G8TA 1OSSA 1CQQA 3GY2A 5DK1A 3LGVA 5CHAC 4YESB 3CS0A 3SHCH 3P95A 3N7OA 4ISLA 4B74A 3TLOA 3ATMA 1LDTT 4WY3A 4GUXA 3BTEE 2ULLA 2GCTB 2PKSC 3EA8A 1BRBE 1MU6B 2Y7XA 3E0PB 4GCHG 3SU1A 1YPHC 4KTUA 3EYDA 1MCTA 1DVAH 3RUOA 2ZEBA 3B9FH 2QXJA 1O3AA 1FY5A 1CGJE 1ZSKA 2EI8A 3IG6B 3RLWH 5FX5A 2NU2E 1ID5H 2HGTH 3ATIA 1UVSH 1GMHG 3K65B 1VCQA 5FBIA 3UFAA 4JYTA 5JDUB 2PTNA 3RXVA 1O2HA 1O2WA 2C8ZB 2FOCA 4BAQB 2AIPA 4Y8ZA 4NG9H 1THRH 3RMLH 1ZTJA 2G51A 3FZDA 1AVGH 1BTXA 2ZHDA 3HKIB 3TVJB 4YM9A 2ODQA 3RXEA 2YNBA 4XBDA 1AD8H 3F1SB 4OS6A 1NC6A 3MHWU 4ISNA 1F5KU 1EPTA 2AIQA 1NM6A 2R2WU 3M7TA 2SGFE 3UOPA 3SUEA 1MTNB 2QIQA 3S69A 1Y3YA 2Y5GA 1KY9A 3FP8E 1C2EA 4K1TA 4CRBA 3D62A 1DWEH 1GBJA 1GDQA 4LK4A 1IOEA 1BMLA 1GHXH 1E34B 1QQUA 3VB6A 4AG2A 5DP8A 1BBRK 1P2JA 3TNTA 1O2KA 3A82A 3ZZAA 3P92A 5JB9S 5EG4A 4ABHA 3SN8A 1CU1A 4E06H 4Y79A 1AIXH 1H8IH 1A3EH 4UEHH 1CSOE 2HWLB 4YTAA 1SI5H 2BY6X 1SGRE 4IBLH 4UFEH 1RTKA 1FIWA 1YPKH 4MPVA 1O3BA 4LXBH 1Z6EA 1C5YB 4GHTA 3OY6U 1S85A 2GZ9A 1ELFA 4Z0KA 4BXSA 1NROH 2Y5FA 3TK5A 1P3CA 1G32B 5LPFA 3ITIA 1A61H 3A84A 2QXHA 2JKHA 2RA3A 1GBHA 1VJAU 2RG3A 1O3IA 1C5SA 2PLXA 3SGAE 3P8GA 3VB7A 1XUKA 1ZSLA 3HATH 4ABDA 2Z9JA 3UREA 2WV4A 2BYAX 3Q3YA 1TNJA 5AF9H 1K1NA 3D49H 4NA9H 3RXSA 1TFXA 4NFEA 1O33A 1LO6A 5G4BA 3IWMA 5JBAS 3S9CA 4XBCA 4XBBA 5FPYA 1ANBA 3RMNH 5EPYA 2CGAA 1BMAA 1D9IA 1SLVB 1ELDE 1D3PB 1C2FA 1KXAA 1QB1A 2ZU5A 1O3GA 1LMWB 1T32A 4FVDA 1OYQA 5L2YH 6GCHG 1WBGB 1A5HA 1SHYA 1Z1IA 1YPGH 2ZHQH 1A2CH 1DSUA 4MG3A 2P16A 3S0NA 1A0JA 4I31A 2FPZA 1LPKB 1V2UT 4FUEA 1V2QT 2CHAB 5AHGH 1C1TA 1O5GH 4DIIH 2GDEH 3MU4A 1O3HA 2TBSA 1O2NA 4ABEA 1C2LA 1BHXF 3SORA 1C2KA 3KNXA 4TY7A 5HM2A 2HOBA 2VIDA 2ZGCA 1ZTLA 1YPEH 5E2PA 1C5XB 5T6FA 2A7HA 5IDKA 1HBTH 4OS2A 1FJSA 2STBE 5ESBA 3S7HB 3BTDE 1SBWA 1EJNA 1KIGH 4R8TB 2NWNA 3PM3A 2OBQA 1HAZB 2J9NA 1FY1A 3OY5U 2H9EH 2WPJS 1QA0A 4JZDH 1YCPH 1JOUB 4ESTE 1XVOA 1UTNA 1P2QA 2QN5T 5EXMA 3T5FH 1C5VA 4BXWA 1E37B 2P8OC 3M7UA 4ABAA 2SFAA 1EPTC 2D26C 3BEUA 2ZCKP 2EI7A 1V2WT 4Y8YA 2OQUA 1W7XH 1VZQH 3RP2A 3AW1A 4X2WA 1EOJA 2Z9IA 1V2PT 1XUFA 4DY7B 1T31A 4UFDH 1DLEA 3PO1C 1UCYH 1GHBF 1C1WH 3BG4B 2CMYA 3M7QA 3SHAH 3TJVA 4AB9A 1Q31A 3TH3H 1GI4A 1KTTB 3GCOA 2VIPA 3SQHE 3H5CB 5B6OA 1UK2A 1FQ3A 2TGPZ 2ZHFH 3MNBA 1L1NA 1DICA 4ISHH 3UY9A 1HXEH 1P3EA 1AUJA 4NIYA 1EX3A 1RIWC 3NK8A 4B2AA 2QYIA 2BDAA 1QL8A 2ZA5A 1GJ4H 1P2OA 1DFPA 1YF4A 1QBOA 1C9TA 3LGUA 1W12U 3MH5A 4FUJA 3VXFH 2F9NA 1UJ1A 2BY9X 4K5ZA 4Y0ZE 4Q80A 1GWAA 5FPSA 2FXRA 4AN7A 1FDPA 3KIDU 1S0QA 1H9IE 3M5NA 2Y80A 1C2MA 2DUCA 1GJDB 2GZ7A 3R0FA 1LHFH 1MBMA 2AGGX 4X8UH 2FOHA 3GYMA 9LPRA 4AYYB 2XBYA 1BTZA 3SUDA 3QZRA 1ELCA 1IAUA 1G2MA 3AASA 2P3FH 1BRCE 4I8LA 1ARBA 3KL6A 3RXIA 3RXKA 4CH8B 3F68H 2BY7X 2ZNKH 3ZZ8A 3QWCH 1SR5C 3O8BA 4UFGH 3BTKE 2V3HH 3QDZB 1GBBA 1KXDA 1BMNH 4X6MA 1UK3A 1FV9A 2IN2A 1WTGH 2BQ6B 2FM2A 2Z7FE 3RC6A 5ETXA 2XC4A 5EW1H 3GCTG 2FEQH 2C8WB 1IQFA 1GBDA 1F92A 1JIRA 1L1GA 1HFDA 1AUTC 4MDSA 3A8AA 5DP6A 5HXFA 5JB8S 1FY8E 5FPTA 3KHVA 2HPPH 5LPEA 2HALA 4HFPB 1V2TT 4MTBA 1SLWB 2HVXA 2I6QA 1P03A 1PJPA 1RJXB 4Q7YA 1T8MA 5T6DA 3TJOA 1GJ9B 1GBAA 4SGBE 4FUHA 2O8UA 4FU7A 1ESBA 1VGCC 1EZQA 4O9VA 2XBXA 2PKSB 2QF3A 3T29A 4ABBA 2SGDE 2ZC9H 1C5ZB 1O3NA 2BZAA 2ZFSA 4A5TS 3UTUH 3SU3A 4X6OA 1O2SA 1YP9A 1AWFH 1O5CB 1XKBC 5CE1A 1O2VA 3NPSA 4I33A 3BTTE 2BTCE 1OP0A 5AFYH 1P10A 3K6YA 2GMTB 3UR9A 3B8JA 1BITA 1P2NA 3PMJA 1HJAB 4LOYH 1CT2E 3V3MA 3PMAB 1KDQA 3P17H 4FU8A 5DP9A 4AZ2B 4U32A 2QXGA 5EW2H 1QRZA 2BZ6H 4ZXYH 1JIMA 1ZPBA 4X6PA 1O36A 5DO4H 3VB5A 4B71A 2O8LA 1UCYK 1TBZH 2TGDA 1HAVA 3KQBA 1FLEE 1ELVA 3BTFE 2XNIA 2H1UA 3MH7A 1FONA 2ODYB 1TRNA 5K7RA 3PTBA 2BVRH 2PGBB 2SGPE 2PTCE 3M36A 1QHRB 1O3KA 2BD9A 2GT8A 4MQAA 3SGBE 1KXCA 1LHEH 3C1KA 4OS7A 3MU1A 1P2MA 1UVTH 1GMDG 2Z94A 2C8YB 4OGYA 3TK9A 1TRYA 1C5OH 5JYIA 3SNBA 1QA7A 1DPOA 4D76A 2OP9A 3LGYA 6CHAB 3UIRA 2ZFPH 4IGDA 1MBQA 3GY6A 1BZXE 4TPIZ 1W13U 1GBFA 1HAXB 1B0EA 1LHGH 2HNTF 2BD4A 1DWCH 3GCNA 3U8TH 3ZZ3A 3ZYDA 1FAKH 1TAWA 3SV6A 1YBWA 3LH3A 2ZO3H 3PO1B 1KYNA 3K9XB 1CHOF 3F6UH 1YC0A 2SGEE 1LVOA 4LZ4B 1ANDA 3RXLA 5DKMA 1XVMA 3OYPA 1CGIE 5EQRA 4Q2KA 2O9QA 5L6NH 1QFKH 3KF2A 3K2UA 1VCPA 1SQAA 1NESE 1A0LA 1V2MT 2RCEA 4U2WA 3SQEE 5C1XA 2GDDA 3P6ZB 1QJ6B 1SGCA 1DS2E 1D3QB 1H8DH 2A4OA 1KXEA 2GP9B 4AG1A 1IQLA 4MNXA 1ZGVA 4NIXA 4A1VA 1C4U2 1GBLA 2A4RA 1CT4E 1OWEA 3LONA 4AFUA 3T62A 3UNRA 1AVWA 4FUFA 1Z8IB 4K8BA 1E35B 1RD3B 3ZZCA 3O8CA 4BTTB 1N6XA 2NU0E 2QXIA 1K1PA 3GICB 1GJAB 2OC7A 1O3MA 2H9TH 2XTTB 1WCZA 1TE0A 3ZV8A 1O2XA 2HNTE 5JPMH 1GI3A 1SGEE 3SJIA 3TJNA 1GHAG 1MTWA 5DP5A 1W2KH 4WWYA 2ZDKA 3SNDA 1QY6A 1O2LA 3IITA 1TQ7B 4UDWH 5A2MH 2ZFQH 3GY4A 3A88A 6GCHF 3ZVBA 1NFUA 1O3PB 5A09A 3SBKA 3OTJE 2WPHS 1JXPA 1YPHE 1L4DA 3UR6A 1OS8A 4YO9A 3SU6A 1O34A 5EQSA 1ELAA 2ZFFH 1C1SA 1CBWC 1D6WA 3SJ8A 1CGHA 1G3BA 1BHXB 2FYQA 3M61U 1GI9B 1ETRH 2FLRH 2IOTA 1SGNE 1O3FA 2VJ1A 3RXOA 1HNEE 4K1SA 4X0WU 2FESH 1GDNA 1GI5A 2OLGA 1G37A 2FWWA 1BOQA 5HGGA 1HGTH 3EA7A 1AU8A 1ELEE 4I8KA 1P0SH 3BTGE 1GI6A 3RMMH 3M3TA 5EXLA 2P59A 2TGAA 4BOHA 1ZRKA 2NU3E 3TNSA 1L2EA 1ESTA 2GCTC 4A1TA 3P70B 1C2DA 2ZKSA 1SVPA 4WMDA 5A8ZA 1OOKB 4CRGA 2FX6A 2PHBA 1ZOMA 3NWUA 4WJG2 4NFFA 4I8HA 3B23B 4D8NA 2WYJA 2A7CA 2BM2A 2EEKA 3TU7H 1SGPE 1IQJA 2D2DA 4X1PU 3MOCA 2ZIQH 4CR9A 1WOFA 2OBOA 2UWLA 3MNXA 1PPFE 2R0KA 2W3IA 1ARCA 4DT7B 3PMBB 1C4V2 4F49A 1CA0C 2QAAA 1TNHA 1ZHMA 1P2KA 1A3BH 1SPJA 3PWCA 1O2JA 1DT2A 1DUAA 1GBCA 3LPRA 3LH1A 2Z9KA 1HB0B 1A4WH 1O3CA 2FI3E 4AORA 3ELAH 2ZDAH 1Z6JH 2NU4E 3ATKA 5FHTA 3RXQA 3ZZ9A 1JRTA 1EOLA 1FUJA 3VEQB 1SMFE 2C3SA 4Y7AA 1WAYB 1F2SE 1F5LA 1TMBH 2A31A 2ZDLA 5C1YA 1O0DH 4ZAEA 4ZKOU 2GKVE 4CH2B 1CO7E 2C4FH 1CE5A 1NFWA 1NTPA 1YLDA 5DJ7A 2GT7A 1E0FD 4NSVA 3CENA 4DIHH 4QT8C 2HNTC 3GCHB 1HDTH 3GY3A 2PKAB 3LGIA 3SJ9A 2VGCB 1RXPA 3VFEA 1EP6A 1GBEA 2Z3CA 1PQ7A 1LQDB 5FAHA 1C4Y2 2PGQB 1HJAC 4JCNA 3E91A 8GCHG 4Y76A 2V3OH 1KLTA 2WV5A 5HM9A 4X1QU 1BJUA 2SNWA 5GXPA 2WPMS 1AI8H 2OQ5A 1GL1A 4ASHA 2AS9A 5GJ4B 1FAXA 2FOAA 3SI3H 1OWHA 2BD3A 2VIQA 4TPYA 5EGMA 1PQ5A 3TK6A 1G30B 4DG4A 2ZDVH 2ZU2A 5BRRE 5F8ZA 5A8YA 2WPIS 1HAPH 2W7SA 3U1IB 4MPXA 1C1PA 1EXFA 2SGQE 1TPPA 2SGAA 6ESTA 4FVBA 8GCHF 3TGJE 1TGSZ 4BNRA 3A80A 4B1TA 1O5AB 1QNJA 3MO9A 1NU7B 1NS3A 4HZHA 4FUDA 1LCYA 1GI0A 2XWBI 3A8CA 1GJCB 3U8OH 1O3EA 4GCHF 3DD2H 5E0JA 1MAYA 3PWBA 1LKBA 1TYNA 4I7YH 3RXTA 2OC8A 4ISIH 1NRSH 1UTQA 5AVDA 1TOCB 2Q6DA 3STJA 1BJVA 3GDUA 3QK1A 3MNCA 5E8EH 3W95A 5J4QA 2KAIB 4YT6H 1RIWB 1TONA 2AFQB 3QZQA 3RXFA 2IJOB 5PTPA 3E8LA 1TQ0B 4PROA 5ABWA 5C2ZA 1TIOA 1XX9A 1VITF 2FDAA 4UFFH 1TBRH 3ZVDA 4B2BA 1IHSH 1E38B 1C5LH 1YPLH 4BTUB 4CRDA 1PQ8A 1MU8B 1GI7B 1JBUH 2TPIZ 1LVBA 3DT0H 3T25A 1EAUA 1SG8B 3LU9B 2RA0A 2CF8H 4B76A 4WXIA 1W0ZU 1GVZA 2ZFTA 4E7RG 2ALVA 4A92A 2ZDMA 2G55A 2PKAA 3V13A 4WVPE 1HAYB 3SU5A 3LDXH 1ZSJA 4SGAE 1UHBA 5E2OA 3NUMA 2Y5HA 1EAXA 2CJIA 3LJJA 3MU8A 4RKJB 1HJ9A 4ZHLU 2OC0A 1Y3VA 3QGJA 2FI4E 1TGCA 1THSH 1PPEE 2XW9A 4JK6A 3TJUA 2A5AA 1MQ6A 1K1JA 2AEIH 1AVXA 1LHDH 2BD7A 3RXHA 5E0GA 2J94A 1H9HE 4DJZB 1TBQH 4CHAB 1SOTA 2VIVA 3SI4H 4WXVA 1AHTH 1OX1A 1XM1A 2WUBA 1AFEH 1M9UA 2H5DA 3EQ0H 1XUJA 3S7KB 3ZVGA 5A0CA 2BXTH 1BDAA 3TH4H 3V7TA 1HAGE 1WUNH 2R3YA 3RXMA 4X8TH 4CBNA 2THFB 1UHBB 1ZYOA 1P01A 1EJAA 3P8FA 2FTLE 4NIVA 1ABJH 1QRXA 3CS7A 2G52A 2STAE 4BAKB 1ANCA 2OD3B 1Y3XA 4I32A 4OGXA 2W26A 2G4UA 2GZ8A 1RRKA 1TPOA 3ZZ4A 5AFZH 3MYWA 2V6NA 4YOJA 2BD2A 2P95A 3Q00A 1SGQE 2XXLA 4RN6A 1DOJA 1H1BA 4NA8A 4X1RU 3FZZA 1IQKA 2A4GA 4KELA 1DANH 5EXNA 1BTWA 1EZXC 1Y59T 5A0AE 1DM4B 1W11U 4D9QA 1D6RA 1KXBA 4KTSA 3QX5H 1PYTC 3DFJA 3TH2H 4KP0A
chains in the Genus database with same CATH superfamily
1J15A 1EASA 1GBMA 5EJ1A 2XOKD 1TB6H 1ZJKA 1GBIA 2FO9A 5DP4A 2RFKC 3QTVH 4E7NA 1NBMD 3QLPH 2BLOA 4B75A 1O2RA 1YKTA 2Y6TA 4D7GA 5DGJA 1SL3A 2R0LA 3HKJB 2A0QB 4X6NA 7GCHG 1WQSA 2ZTZA 3A7TA 2Y7ZA 2I6SA 1NN6A 3H09A 1QURH 1O32A 1K9OE 2GV7A 1C5PA 2F83A 1O38A 3A89A 3SUFA 2W6ID 1MZDA 3LKWA 1PYTD 2OC1A 1Q3XA 4A6LA 4B2CA 4E05H 1W3CA 3RXBA 2PWXA 4ASUD 2VWMA 3T26A 1ZMLA 1KLJH 2VIWA 2ILNA 4GHQA 4VGCC 1HV7A 1AFQB 3MO6A 5T3HA 3RDZA 4XD7D 2ZPSA 4MNWA 3TPIZ 3PB1E 1ZPZA 5TJXA 2VWNA 1GGDB 1T8OA 1Y5UT 1HIAB 1QJ7B 4CR5A 5GCHG 1V6DA 1OYTH 2QGRA 3E0NB 1LPGB 3QN7A 1Y3WA 2C93B 4X2VA 1S83A 2V0BA 3M35A 3M5LA 2ZGJA 1XUHA 1GHVH 5J4SA 1BTUA 4JZEH 3RMOH 4BAMB 1P09A 1V2VT 1C5WB 2G4TA 1MMJN 4ZKNU 1AMHA 1FY3A 1GI1A 1YPJH 3A7XA 1P05A 2O8TA 2ZECA 3PLPA 1S81A 4YXWD 1DE7H 4UD9H 3KGPA 3EE7A 3AAUA 1P2IA 3A8BA 1C2JA 3BIVH 5LH8A 1ELGA 1WU1A 2WUCA 3KQDA 2ANYA 1YLCA 3QTOH 4X1NU 4AGJA 2ANMH 1INCA 1P02A 1TX7A 4WH8A 5EU8A 4CHAC 2GVFA 2G5VA 3BTQE 2JH0D 1X7AC 2FOBA 1F0TA 3FAOA 1QCPA 2B8OH 4B6EA 1TA6A 2Z6BD 1GMCG 1UMAH 3EGKH 2Q6GA 2J34A 3MH6A 1OPHB 1W7GH 1DLKB 5T1VA 5FXLA 3H7OA 1Z8RA 2ZTYA 2F9VA 3FVFB 2VB0A 3BG8A 1K22H 1DY9A 1HAVB 3QUMP 1W0YH 2P93A 4NZQA 3UB0A 4A1XA 1GJ5H 2D8WA 3TITA 1VGCB 3ZZBA 1TGTA 2EQNA 1DWBH 2GV6A 2BDIA 1VCWA 4AFQA 2GMTC 1JWTA 3MWIU 3RXAA 3UPEA 1MKXK 1SGTA 2VBCA 1WYKA 1MABB 5H4IB 1S84A 1OP2A 3BTWE 3AW0A 3UNQA 2D1JA 2AGIX 4HI3A 1NFYA 5FCRA 3BEIB 1MCVA 3RU4D 2B7DH 3T2NA 1GGDC 2QC2A 3OU0A 1YLNA 1GVLA 3ZYEA 4ABJA 3E16B 1GCTC 3ATWA 2VU8E 1NU9A 1OWKA 1AFQC 1Y3UA 3A87A 2H9HA 5L2ZH 1EKBB 2O8WA 4GVUA 1GBTA 4O3TA 1V2ST 1CA0B 1O31A 1CA8B 5GDSH 5L30H 1HIAA 3ZZ6A 2VVVA 2P94A 1NRRH 1B5GH 5DP7A 2CF9H 7LPRA 1O2YA 4X2YA 1K21H 1MAXA 3F0OA 2A32A 1S0RA 7GCHF 3A83A 3KQEA 1TPSA 3GYLB 3L33A 2SNVA 1P06A 1UTPA 2UUJB 2G5NA 1SLUB 1HLTH 3G01A 1HRTH 1YPMH 2OTVA 1CVWH 1DUEA 1P11E 1UVUH 5HIYA 1CT0E 2A45B 1FNIA 2ZPRA 2VGCC 4KGAA 1QQ4A 2XC0A 1AKSB 4JK5A 1EZSC 1MD7A 1AB9B 1O3DA 1QR3E 2AMQA 1LVYA 2UUKB 3DA9B 3MQKC 3HGPA 3HPTB 3PLKA 3MTYA 5A8XA 5K0HA 3SNCA 3I78A 4ZUHA 5GCHF 3V12A 1Z7KA 5GWZA 5HIZA 2VIOA 1U6QA 4OS1A 5FX6A 3F0PA 5TCCA 2BD8A 1SKYE 2TIOA 1ELTA 4FUIA 4BAOB 1CHGA 1Y5AT 3E3TA 2BD5A 3GISB 2QF0A 5EJZA 1A46H 1EATA 1N8OB 1QRWA 3JZ1B 4O3UA 2QV1A 1NRPH 1KLIH 1Y8TA 3OAAD 1C1MA 4Z6AH 1BTPA 1Q2WA 3O8RA 3U69H 3JZ2B 5C5NA 5FL7D 1PPZA 2BQ7B 2ZG0H 1V2RT 4KKDA 1ZHRA 4UONA 1AKSA 4J1YA 3U1JB 1FMGA 1TNLA 2ZTXA 3FANA 1NBME 2OXSA 2QA9E 3M5MA 2J2UA 3E6PH 2FS9A 2EI6A 1SHHB 3PYHA 3SUGA 4NGAH 3NCLA 3KN2A 1AO5A 1GMDF 3M37A 1O2GH 3BN9A 3ZZ7A 2H6MA 2ESTE 4NIWA 5EPNA 1AE5A 2IPHA 2ZZUH 1EAIA 4XDEA 2VWLA 1SOZA 3ZVEA 1ETSH 3WY8A 3M5OA 1S6FA 2ZCHP 1O3LA 4GAWA 1O35A 1GJ6A 1C5QA 2FX4A 5A0BA 1XMNB 2OCVB 5B6LA 1RTFB 3LT3A 4DW2U 2ZP0H 1RS0A 1KXFA 1MZAA 2BX4A 4XE4A 1PFXC 1SFIA 4DURA 1G3CA 3A85A 4HGCA 1SGYE 4NSYA 4RT0A 3HK3B 5HYOA 1G9IE 3PTNA 4OS5A 2A7JA 1XXDA 3SU0A 2FMJA 3A7VA 4K69A 4VGCB 4Y8XA 2VVUA 2XWAA 3GY8A 2BY5X 1TPAE 2ANKH 4KTCA 1UVPA 4AFSA 4DVAU 3VPKA 4MVNA 4IN1A 1HUTH 2Q6FA 5F03A 1CBWB 5I25A 2ZU3A 3UWIA 2XBVA 3ZZDA 3MNSA 2PR3A 1NZQH 1ZMNA 2W5EA 1C2IA 1PPGE 2B9LA 4INHA 2UUFB 2QY0B 3UQVA 1DDJA 4CRFA 1FN6A 1UTLM 3U8RH 4R0IA 1QB6A 1J14A 4A7IB 3VGCB 1BQYA 2JH6D 1LKAA 1JRSA 1AZ8A 3A8DA 3W1EA 2BHGA 1TX6A 2FODA 3F9FA 1IQMA 1S82A 4WF8A 2ZGHA 1IQEA 1FI8A 1TOMH 4TT3D 1F0RA 4CREA 1BTYA 1AB9C 4TY6A 1MH0A 1HCGA 1A5IA 2FLBH 4JYUH 1LPZB 1HAIH 1HPGA 1O2QA 3OX7U 8LPRA 2GX4A 2KAIA 2ZGXH 1BRAA 3VG8A 2TGTA 2YMSD 2C90B 4AB8A 1DXWA 3P8NA 4IS5A 1J16A 1K2I1 3LGTA 1ZLRA 3NXPA 4I8JA 4ISOA 1O3JA 2VH6A 5DSFA 3BSQA 4MPUA 4DCDA 3MU0A 3BTHE 5C0UA 2XC5A 1E36B 3AAVA 1TRMA 1D3DB 1P12E 1UTMA 5BPEA 1SGDE 2FOMB 1C2HA 4ZKSU 3RU4E 1UVOA 5EODA 7KMEH 3SOSA 3STIA 3QO6A 3U9AH 1SQTA 1IQIA 5DG6A 2BXUH 2J95A 3O8DA 1C2GA 2Y82A 1QTFA 4JZ1A 3D23A 2UWPA 3SV2H 1QL9A 1Z8JB 4Q7XA 4YT7H 2FI5E 5C1UA 2LPRA 5GNDA 1TNIA 2FOGA 1BCUH 1RTLA 2J98A 4INKA 2CV3A 1OXGA 3SV9A 4GSOA 1MQ5A 1GPZA 1OWDA 1O2ZA 4ZMAH 3V0XA 3GY7A 4MPWA 4Q4LA 1MKXH 4TWYA 2PSXA 4XOJA 1K1MA 5C3NA 1F0SA 3VXEH 1RGQA 3OEED 4BTIB 3SZEA 5SGAE 1AGJA 1OP8A 4NCYA 2JETC 2ZI2H 1LTOA 2AHME 1NFXA 3FFGA 1GI2A 3UOUA 2WZQA 3ESTA 3SNEA 1GG6C 1NRQH 1YCPK 3LC5A 5JBTA 1TALA 2RDLA 4WMEA 3I29A 2BDBA 3NZIA 3MO3A 4RI0A 3WWFA 4JMYA 4FXGH 5IYTA 4ABGA 1TNKA 3RXGA 3RM2H 1ELBA 2PW8H 4Y6DA 1GI8B 2ALPA 1V3XA 1BRUP 2FYRA 1OKXA 2OINA 2Z3DA 4B6FA 1GJ7B 2G00A 4MNVA 2FS8A 3SV8A 4JYVH 6CHAC 2XCFA 2ZHWH 2P3UB 5FBEA 3VB4A 2QE7D 3SYJA 3T28A 1O2MA 1O5FH 4XFQA 4ZKRU 1K1LA 1SGFA 4INLA 3AVZA 5CMXH 1BBRE 3FP7E 1BA8B 2ZF0H 4J2YB 2GTBA 3FN8A 3EE0B 3HK6B 3SV7A 1HAOH 1H8HD 2YNAA 3A86A 3UUZA 1GCTB 3Q76A 2JIZD 2ZQ1A 3ENSB 2K1QA 1UO6A 2CN0H 3BV9B 2ZDNA 2R3UA 4Y7BA 4BAHB 2F9BH 3TIUA 2PUQH 3KQCA 3LGWA 1B7XB 1N8OC 3U98H 2JH5D 1GL0E 3H7TA 1MUEB 1S5SA 1TMUH 1PPHE 2B0FA 4IC5A 2J38A 4XSKU 3F2HA 2VVCA 1A7SA 2VWOA 3BEFB 3GDVA 3Q77A 3ZV9A 4ABFA 1ZRBA 6LPRA 3F2FA 2G81E 1J17T 3RXPA 1PPCE 1TWXB 3VGCC 4ACBA 3SU4A 1P57B 1TGNA 1T7CA 1MTSA 1VR1H 3A7ZA 3F9EA 1CHOG 5I46H 4ZHAA 1ZJDA 2BOKA 3SJOA 1FY4A 1D3TB 2WPKS 4FUCA 4AFZA 2A5KA 1O5BB 1V2NT 2BOHB 1B0FA 2BMGB 1ANEA 1H8ED 1T4VH 3ATLA 3F9HA 2WYGA 3F9GA 2L6OA 3P8OA 4H4FA 1C9PA 3E90B 1C1RA 4I8GA 3BF6H 2CHAC 1C5TA 4B73A 3PRDA 1C1QA 5GIBA 1KTSB 4O97A 2OUAA 1SQOA 3LOXA 4H42U 1QL7A 2BX3A 1O37A 5ESTE 4JZIA 3MI4A 3MU5A 1EFRD 1BTHH 2ZU4A 4U30A 1SLXB 3UNSA 1L0ZA 2KCOA 2BVSH 1C1VH 2UUYA 1ORFA 4WMFA 3ZVCA 1TA2A 4RSPA 3RC4A 3BIUH 1RFNA 4Y0YE 1GHYH 2ANWA 2XCNA 3EA9A 4JZFH 4YOGA 1BBRH 1SGIB 4TSFD 1IQHA 1TMTH 3EAJA 2BY8X 2PV9B 1A0HB 1IQGA 4Y11E 3SGQE 1NRNH 2KCYA 1T4UH 3RXJA 3UAIC 3ZZ5A 2BDCA 3M3SA 1EAWA 3DUXH 1G3DA 2ODPA 1C1OA 4BANB 1GDUA 2VNTA 1Y5BT 2B5TB 3BTME 2ZWLH 2F9PA 2YOLA 1BB0B 2PUXB 1P9UA 3ODDA 1QGFA 1V2LT 4THNH 4ZROA 3VB3A 4H6TA 4ZHMU 2BQWB 1V2KT 1G3EA 2FOEA 4IMZA 2QF4A 1YYY1 4ZH8A 1N1LA 1PQAA 1C1UH 1MD8A 2AH4X 4NZLA 3ZVFA 3Q3XA 4UE7H 2JETB 1SGFG 1UTOA 3LJOA 3WWBA 1VJ9U 2F3CE 5EQQA 1ZMJA 7ESTE 1XUGA 2FP7B 2EC9H 1C5MD 4Y71A 1NPMA 1BT7A 1TNGA 1AQ7A 2VH0A 2XNDD 1C5UA 3C27B 4FUBA 4OM9A 1SSXA 1DXPA 1NO9H 3SNAA 1G2LA 2IPQX 1TGBA 1H4WA 8ESTE 2BVXH 1UK4A 2BLVA 2F9UA 3GCTF 3Q3KA 2QCYA 3PMHB 2EA3A 3ODFA 1OWJA 1S6LA 2KCAA 1F7ZA 1WQVH 1O5DH 5JBCS 1FIZA 2WPDD 1K1OA 3GDSA 4IMQA 2XYAA 1FZZA 1GMHF 1ACBE 1SFQB 1THPB 3OSYA 4D9RA 3U28C 3RXUA 5EJLA 2ZPQA 3M3VA 4GLYA 5T6GA 2FIRH 3HGNA 1ZPCA 1HAHH 4H6SB 3SW2B 4K3JA 4AYVB 3L6PA 2LNCA 1EJMA 4YLQH 1DWDH 4HG6A 4NWLA 2GCHF 4CRCA 1L4ZA 5FCKA 2PFEA 5EOKA 3UWJH 1AY6H 2KR7A 1F0UA 2ZQ2A 4MLFB 1O39A 1XKAC 2H2ZA 1JMOH 3KEEA 4ZXXH 1S6HA 3A7WA 4K2YA 3I77A 1XUIA 1GHWH 4F4OC 2IJD1 4YLUA 2BDGA 2XRCA 3FP6E 4X8SH 1O30A 3CP7A 1EZUC 4K1EA 1EQ9A 3GCHC 5F8XA 1P8VC 1GJ8B 3MMGA 5CDFE 1LQEA 1MTVA 4CRAA 1GHAF 4AX9H 1ZGIA 1O2OA 3NKKA 5CHAB 1EUFA 2AERH 3MFJA 1C5RA 3NRLA 1D4PB 1J8AA 1V2JT 3S9BA 1W10U 2BB4A 1GJBB 2ZGBH 1GBKA 2NU1E 1QBVH 4DOQA 1HYLA 2ZFRH 2V35A 3L3TA 1DY8A 4O03A 2DE9A 1HJ8A 1O2IA 4IC6A 2Z3EA 1GVKB 5C67A 2LELA 1H9LB 2FTMA 4GPGA 1P9SA 2A1DB 1Z8GA 2W7UA 2ZU1A 3W94A 2R2MB 1O2UA 1IQNA 1ZZZA 5LPRA 3RLYH 4LZ1H 3E1XB 2A2QH 1Z71A 5F6MA 1VITG 1T8NA 3RXRA 1QIXB 5C5OA 5DPAA 1DX5M 3SU2A 1F5RA 1KSNA 1MTUA 3URCA 5HMAA 1BIOA 2Z9LA 2CXVA 2Z9GA 2HPQH 1W14U 3ZIAD 1WSSH 3TGKE 1TABE 4AGKA 1AWHB 4RT1A 2A4QA 1G36A 1PPBH 4TYDA 5F8TA 2AMDA 2F9OA 1Z1JA 3LC3A 1XXFA 1V2OT 2M2AA 3PROA 3ZVAA 3DHKH 3RC5A 3KCGH 3URDA 1AE8H 2AGEX 4IW4E 1GHBG 1K28D 4TWWA 1WTHD 2DE8A 2GGVB 1ETTH 2HLCA 2ZHEH 2J92A 2ASUB 1O3OA 2PSYA 3BG4C 4RKOB 1L1JA 1ZR0A 4FUGA 4AOQA 5KGOA 5KEDA 1GCDA 1T8LA 3GY5A 4K8YA 2ZCLP 3R3GB 2TRMA 5TCAA 1DSTA 2VINA 1EPTB 3GOVB 1FXYA 2P8OB 1GHZA 1LVMA 1VITH 5C20A 1IHTH 1MKWK 1ESAA 2BLWA 4Q7ZA 1P04A 5JBBS 3N99A 1E79D 1GMCF 3A81A 3QGNB 4X1SU 4K60A 1GG6B 1A1RA 2BLQA 2KZ4A 1SB1H 4ABIA 3LIWA 1C5NH 2WPLS 1FN8A 4WH6A 2P3TB 2J4IA 1A5GH 2UWOA 3DSPA 4OS4A 4IN2A 3PLBA 1QJ1B 1OWIA 3A7YA 1MTNC 1SC8U 2BDHA 4YOIA 4FU9A 1HXFH 4MNYA 3DFLA 2Q1JA 1UTJA 3EDXB 2W3KA 2FOFA 3RXDA 2AMPA 3RU4T 2WINI 5C17A 1TLDA 4FOUC 1J9CH 4DGJA 2GCHG 1WV7H 4M7GA 1TX8A 3RM0H 3MH4A 1O2TA 3D65E 5DP3A 1YM0A 3UQOA 3K6ZA 1YGCH 8KME2 2M5TA 1ZTKA 1W8BH 4NWKA 2GD4B 1UTKA 3SO3A 1NY22 2AYWA 5GPIB 2XBWA 3T27A 2H5CA 4X2XA 1UCYE 1ZHPA 3SJKA 3PV2A 3SZNA 1EB2A 2F91A 5E0HA 2R9PA 4M9FA 3F2GA 1BUIA 3TGIE 1K1IA 2C8XB 2A2XH 1EP5A 2WHXA 4YZUA 1C1NA 1FPHH 1KDQB 2BDYA 2O8MA 1AZZA 5LGOA 1BMMH 1LHCH 1QB9A 4D7FA 1O2PA 4Y10E 4X8VH 1NT1A 2FZZA 1MKWH 2Y81A 4U01A 1YCPM 3RXCA 1DITH 4CBOA 3DSOA 1ABIH 1AN1E 2HRVA 1O5EH 9ESTA 3S9AA 4HTCH 1FPCH 1EB1H 1QBNA 4NA7A 2A5IA 3PV4A 1N6YA 2G8TA 1OSSA 1CQQA 3GY2A 5DK1A 3LGVA 5CHAC 4YESB 3CS0A 3SHCH 3P95A 3N7OA 4ISLA 4B74A 3TLOA 3ATMA 1LDTT 4WY3A 4GUXA 3BTEE 2ULLA 2GCTB 2PKSC 3EA8A 1BRBE 1MU6B 2Y7XA 3E0PB 4GCHG 3SU1A 1YPHC 4KTUA 3EYDA 1MCTA 1DVAH 3RUOA 2ZEBA 3B9FH 5C0TA 2QXJA 1O3AA 1FY5A 1CGJE 1ZSKA 2EI8A 3IG6B 3RLWH 5FX5A 2NU2E 1ID5H 2HGTH 3ATIA 1UVSH 1GMHG 3K65B 1VCQA 5FBIA 3UFAA 4JYTA 5JDUB 2PTNA 3RXVA 1O2HA 1O2WA 2C8ZB 2FOCA 4BAQB 2AIPA 4Y8ZA 4NG9H 1THRH 3RMLH 1ZTJA 2G51A 3FZDA 1AVGH 1BTXA 2ZHDA 3HKIB 3TVJB 4YM9A 5IK2D 2ODQA 3RXEA 3DSGA 2YNBA 4XBDA 1AD8H 3F1SB 4OS6A 1NC6A 3KYFA 3MHWU 4ISNA 1F5KU 1EPTA 2AIQA 1NM6A 2R2WU 3M7TA 2SGFE 3UOPA 3SUEA 1MTNB 2QIQA 3S69A 1Y3YA 2Y5GA 1KY9A 3FP8E 1C2EA 4K1TA 4CRBA 3D62A 1DWEH 1GBJA 1GDQA 4LK4A 1IOEA 1BMLA 1GHXH 1E34B 1QQUA 3VB6A 4AG2A 5DP8A 1BBRK 1P2JA 3TNTA 1O2KA 3A82A 3ZZAA 3P92A 5JB9S 1W0JD 5EG4A 4ABHA 3SN8A 1CU1A 3WW7A 4E06H 4Y79A 1AIXH 1H8IH 1SQRA 1A3EH 4UEHH 1CSOE 2HWLB 4YTAA 1SI5H 2BY6X 1SGRE 4IBLH 4UFEH 1RTKA 1FIWA 1YPKH 4MPVA 1O3BA 4LXBH 1Z6EA 1C5YB 1UW7A 4GHTA 3OY6U 1S85A 2GZ9A 1ELFA 4Z0KA 4BXSA 1NROH 2Y5FA 3TK5A 1P3CA 1G32B 5LPFA 3ITIA 1A61H 3A84A 2QXHA 2JKHA 2RA3A 2V3MA 1GBHA 1VJAU 2RG3A 1O3IA 1C5SA 2PLXA 3SGAE 3P8GA 3VB7A 1XUKA 1ZSLA 3HATH 4ABDA 2Z9JA 3UREA 2WV4A 2BYAX 3Q3YA 1TNJA 2EY4C 5AF9H 1K1NA 3D49H 4NA9H 3RXSA 1TFXA 4NFEA 1O33A 1LO6A 5G4BA 3IWMA 5JBAS 3S9CA 4XBCA 4XBBA 5FPYA 1ANBA 3RMNH 5EPYA 2CGAA 3OFND 1BMAA 1D9IA 1SLVB 1E1QD 3FOAA 1ELDE 1D3PB 1C2FA 1KXAA 1QB1A 2ZU5A 1O3GA 1LMWB 1T32A 4FVDA 1OYQA 5DN6D 5L2YH 1OHHD 6GCHG 1WBGB 1A5HA 1SHYA 1Z1IA 1YPGH 2ZHQH 1A2CH 1DSUA 4MG3A 2P16A 3S0NA 1A0JA 4I31A 2FPZA 1LPKB 1V2UT 4FUEA 1V2QT 2CHAB 5AHGH 1C1TA 1O5GH 4DIIH 2GDEH 3MU4A 2K8IA 1O3HA 2TBSA 1O2NA 4ABEA 1C2LA 1BHXF 4I86A 3SORA 1C2KA 3KNXA 4TY7A 5HM2A 2HOBA 2VIDA 2ZGCA 1ZTLA 2V7QD 1YPEH 5E2PA 1C5XB 5T6FA 2A7HA 5IDKA 1HBTH 4OS2A 1FJSA 2STBE 5ESBA 3S7HB 3BTDE 1SBWA 1EJNA 1KIGH 4R8TB 2NWNA 3PM3A 2OBQA 1HAZB 2J9NA 1FY1A 3OY5U 2H9EH 2WPJS 1QA0A 4JZDH 1YCPH 1JOUB 4ESTE 1XVOA 1UTNA 1P2QA 2QN5T 5EXMA 3T5FH 1C5VA 4BXWA 1E37B 2P8OC 3M7UA 4ABAA 2SFAA 1EPTC 2D26C 3BEUA 2ZCKP 2EI7A 1V2WT 4Y8YA 2OQUA 1W7XH 1VZQH 3RP2A 2OK5A 3AW1A 4X2WA 1EOJA 2Z9IA 1V2PT 1XUFA 4DY7B 1T31A 4UFDH 1DLEA 3PO1C 3KYGA 1UCYH 1GHBF 1C1WH 3BG4B 2CMYA 3M7QA 3SHAH 3TJVA 4AB9A 1Q31A 3TH3H 1GI4A 1KTTB 3GCOA 2VIPA 3SQHE 3H5CB 5B6OA 1UK2A 1FQ3A 2TGPZ 2ZHFH 2J97A 3MNBA 3FO8D 1L1NA 2CK3D 1DICA 4ISHH 3UY9A 1HXEH 1P3EA 2WSSD 1AUJA 4NIYA 1EX3A 1RIWC 3NK8A 4B2AA 2QYIA 2BDAA 1QL8A 2ZA5A 1GJ4H 1P2OA 2QF5A 1DFPA 1YF4A 1QBOA 2YMSC 1C9TA 3LGUA 1W12U 3MH5A 4FUJA 3VXFH 2F9NA 1UJ1A 2BY9X 4K5ZA 4Y0ZE 4Q80A 1GWAA 5FPSA 2FXRA 4AN7A 1FDPA 2KCPA 3KIDU 1S0QA 1H9IE 3M5NA 2Y80A 1C2MA 2DUCA 1GJDB 2GZ7A 3R0FA 5KECA 1LHFH 1MBMA 2AGGX 4X8UH 2FOHA 3GYMA 4F48B 9LPRA 4AYYB 2XBYA 1BTZA 3SUDA 3QZRA 1ELCA 1IAUA 1G2MA 3AASA 2P3FH 1BRCE 4I8LA 1ARBA 3KL6A 3RXIA 3RXKA 4CH8B 3F68H 2BY7X 2HLDD 2ZNKH 3ZZ8A 3QWCH 1SR5C 3O8BA 4UFGH 3BTKE 2V3HH 3QDZB 1GBBA 1KXDA 3OEHD 1BMNH 4X6MA 1UK3A 1FV9A 2IN2A 1WTGH 2BQ6B 2FM2A 2Z7FE 3RC6A 5ETXA 2XC4A 5EW1H 3GCTG 2FEQH 2C8WB 1IQFA 1GBDA 2F4LA 1F92A 1JIRA 1L1GA 1HFDA 1AUTC 4MDSA 3A8AA 5DP6A 5HXFA 5HKKD 5JB8S 1FY8E 5FPTA 3KHVA 2HPPH 5LPEA 2HALA 4HFPB 1V2TT 4MTBA 1SLWB 2HVXA 2I6QA 1P03A 1PJPA 1RJXB 4Q7YA 1T8MA 5T6DA 3CNRA 3TJOA 1GJ9B 1GBAA 4SGBE 4FUHA 2O8UA 4FU7A 1ESBA 1VGCC 1EZQA 4O9VA 2XBXA 2PKSB 2QF3A 3T29A 4ABBA 2SGDE 2ZC9H 1C5ZB 1O3NA 2BZAA 2ZFSA 4A5TS 3UTUH 2JJ2D 3SU3A 4X6OA 1O2SA 1YP9A 1AWFH 1O5CB 1XKBC 5CE1A 1O2VA 3NPSA 2WV9A 4I33A 3BTTE 2BTCE 1OP0A 5AFYH 1P10A 3K6YA 2GMTB 3UR9A 3B8JA 1BITA 1P2NA 3PMJA 1HJAB 4LOYH 1CT2E 3V3MA 3PMAB 1KDQA 3P17H 4FU8A 3OTPA 5DP9A 4AZ2B 4U32A 2QXGA 5EW2H 1QRZA 2GJGA 5C94A 2BZ6H 4ZXYH 1JIMA 1ZPBA 4X6PA 1O36A 1VKYA 5DO4H 3VB5A 4B71A 2O8LA 1UCYK 1TBZH 2TGDA 1HAVA 3KQBA 5EIYA 1FLEE 1ELVA 3BTFE 2H1UA 2XNIA 3MH7A 1WDIA 1FONA 2ODYB 1TRNA 2K0QA 3PTBA 5K7RA 2BVRH 2PGBB 2SGPE 2PTCE 3M36A 1QHRB 1O3KA 2BD9A 2GT8A 4MQAA 3SGBE 1KXCA 1LHEH 3C1KA 4OS7A 3MU1A 1P2MA 1UVTH 1GMDG 2Z94A 2C8YB 4OGYA 3TK9A 1TRYA 1C5OH 5JYIA 3SNBA 1QA7A 1DPOA 4D76A 2OP9A 3KQ5A 3LGYA 6CHAB 3UIRA 2ZFPH 4IGDA 1MBQA 3GY6A 1BZXE 4TPIZ 1W13U 1GBFA 1HAXB 1B0EA 1LHGH 2HNTF 2BD4A 2J98B 1DWCH 3GCNA 3U8TH 3ZZ3A 3FKSD 1COWD 1FAKH 1TAWA 3ZYDA 3SV6A 4FETA 1YBWA 3LH3A 2ZO3H 3PO1B 1KYNA 3K9XB 2KFWA 1CHOF 3F6UH 1YC0A 2SGEE 1LVOA 4AC9A 4LZ4B 1ANDA 3RXLA 5DKMA 1XVMA 3OYPA 1CGIE 5EQRA 4Q2KA 2O9QA 5L6NH 1QFKH 3KF2A 3K2UA 1VCPA 1SQAA 3F3BA 4Q63A 1NESE 1A0LA 1V2MT 2RCEA 4U2WA 3SQEE 5C1XA 2GDDA 3P6ZB 1QJ6B 1SGCA 1DS2E 1D3QB 1H8DH 2A4OA 1KXEA 2GP9B 4AG1A 1IQLA 4MNXA 1ZGVA 4NIXA 4A1VA 1C4U2 1GBLA 2A4RA 1CT4E 1OWEA 3LONA 4AFUA 3T62A 3UNRA 1AVWA 4FUFA 1Z8IB 4K8BA 1E35B 1RD3B 3ZZCA 3O8CA 4BTTB 1N6XA 2NU0E 2QXIA 1K1PA 3GICB 4Z1MD 1GJAB 2OC7A 1O3MA 2H9TH 2XTTB 1WCZA 1TE0A 3ZV8A 1O2XA 2HNTE 5JPMH 1GI3A 1BMFD 1SGEE 3SJIA 3TJNA 1GHAG 1MTWA 5DP5A 1W2KH 4WWYA 2ZDKA 3SNDA 1QY6A 1O2LA 3IITA 1TQ7B 4UDWH 2J5UA 5A2MH 2ZFQH 4P00A 3GY4A 3A88A 6GCHF 3ZVBA 1NFUA 1O3PB 5A09A 3SBKA 3OTJE 2WPHS 1JXPA 1YPHE 1L4DA 2YMSB 2F43B 3UR6A 1OS8A 4YO9A 3SU6A 1O34A 5EQSA 1ELAA 2ZFFH 1C1SA 1CBWC 1D6WA 3SJ8A 1CGHA 1G3BA 1BHXB 2FYQA 3M61U 1GI9B 1ETRH 1KMHB 2FLRH 2IOTA 1SGNE 1O3FA 2VJ1A 3RXOA 1HNEE 4K1SA 4X0WU 2FESH 1GDNA 1GI5A 2OLGA 1G37A 2FWWA 1BOQA 5HGGA 1HGTH 3EA7A 1AU8A 1ELEE 4I8KA 1P0SH 3BTGE 1GI6A 3RMMH 3M3TA 5EXLA 2P59A 2TGAA 4BOHA 1ZRKA 4F55A 2NU3E 3TNSA 1L2EA 1ESTA 2GCTC 4A1TA 3P70B 1C2DA 2ZKSA 1SVPA 4WMDA 5A8ZA 1OOKB 4CRGA 2FX6A 2PHBA 1ZOMA 3NWUA 4WJG2 4NFFA 4I8HA 3B23B 4D8NA 2WYJA 2A7CA 2BM2A 2EEKA 3TU7H 1SGPE 1IQJA 2D2DA 4X1PU 3MOCA 2ZIQH 4CR9A 1WOFA 2OBOA 2UWLA 3MNXA 1PPFE 2R0KA 2W3IA 1ARCA 4DT7B 2KX4A 3PMBB 1C4V2 4F49A 1CA0C 2QAAA 1TNHA 1ZHMA 1P2KA 1A3BH 4XRNA 1SPJA 1YY3A 3PWCA 1O2JA 1DT2A 2L74A 1DUAA 1GBCA 3LPRA 3LH1A 2Z9KA 1HB0B 1A4WH 1O3CA 2FI3E 4AORA 3ELAH 4P02A 1FX0B 2ZDAH 1Z6JH 2NU4E 3ATKA 3PV5A 5FHTA 3RXQA 3ZZ9A 1JRTA 1EOLA 1FUJA 3VEQB 1SMFE 2C3SA 4Y7AA 1WAYB 1F2SE 1F5LA 2RDEA 1TMBH 2A31A 2ZDLA 5C1YA 1O0DH 4ZAEA 4ZKOU 3PRBA 2GKVE 4CH2B 1CO7E 2C4FH 1CE5A 1NFWA 3N7DA 1NTPA 1YLDA 5DJ7A 2GT7A 1E0FD 4NSVA 3CENA 4DIHH 4QT8C 2HNTC 3GCHB 1HDTH 3GY3A 2PKAB 3LGIA 3SJ9A 2VGCB 1RXPA 3VFEA 1EP6A 1GBEA 2Z3CA 1PQ7A 1LQDB 1QZ8A 5FAHA 1C4Y2 2PGQB 1HJAC 4JCNA 3E91A 8GCHG 4Y76A 2V3OH 1KLTA 2WV5A 5HM9A 4X1QU 1BJUA 2SNWA 5GXPA 2WPMS 1AI8H 2OQ5A 1GL1A 4ASHA 2AS9A 5GJ4B 1FAXA 2FOAA 3SI3H 1OWHA 2BD3A 2VIQA 4TPYA 5EGMA 3OE7D 1PQ5A 3TK6A 1G30B 4DG4A 2ZDVH 2ZU2A 5BRRE 5F8ZA 5A8YA 2WPIS 1HAPH 2W7SA 3U1IB 4MPXA 1C1PA 1EXFA 2SGQE 1TPPA 2SGAA 6ESTA 4FVBA 8GCHF 3TGJE 1TGSZ 3GS9A 2JDID 4BNRA 3A80A 4B1TA 1O5AB 1QNJA 3MO9A 1NU7B 1NS3A 4HZHA 4FUDA 1LCYA 1GI0A 2XWBI 3A8CA 1GJCB 2JJ1D 1O3EA 3U8OH 2KM0A 4GCHF 3DD2H 5E0JA 1MAYA 3PWBA 1LKBA 1TYNA 4I7YH 3RXTA 2OC8A 2W6JD 4ISIH 1NRSH 1W0KD 1UTQA 5AVDA 1TOCB 2Q6DA 3STJA 2HVYB 1BJVA 3GDUA 3QK1A 3MNCA 1WXRA 4ACAA 5E8EH 3W95A 5J4QA 2KAIB 2LP6A 1RIWB 4YT6H 1TONA 2AFQB 1K0HA 3QZQA 3RXFA 2IJOB 5PTPA 3E8LA 1TQ0B 3N7EA 4PROA 5ABWA 5C2ZA 1TIOA 1XX9A 1VITF 2FDAA 4UFFH 1TBRH 3ZVDA 4B2BA 1IHSH 1E38B 1C5LH 1YPLH 4BTUB 4CRDA 1PQ8A 1MU8B 1GI7B 1JBUH 2TPIZ 1LVBA 3DT0H 3T25A 1EAUA 1SG8B 3LU9B 2RA0A 2CF8H 4B76A 2PP6A 4WXIA 1W0ZU 1GVZA 2ZFTA 4E7RG 2ALVA 4A92A 2ZDMA 4ZCNA 2G55A 2PKAA 3V13A 4WVPE 1HAYB 3SU5A 3LDXH 1ZSJA 3AK5A 4SGAE 1UHBA 5E2OA 3NUMA 2Y5HA 1EAXA 2CJIA 3LJJA 3MU8A 4RKJB 1HJ9A 4ZHLU 1YWUA 2OC0A 1Y3VA 3QGJA 5CHBA 2FI4E 1TGCA 1THSH 1PPEE 2XW9A 4JK6A 3TJUA 2A5AA 1MQ6A 1K1JA 2AEIH 1AVXA 1LHDH 2BD7A 3RXHA 4DT4A 5E0GA 2J94A 1H9HE 4DJZB 1TBQH 3DCLA 4CHAB 1SOTA 2VIVA 3SI4H 4WXVA 1AHTH 1OX1A 1XM1A 2WUBA 1AFEH 1M9UA 2H5DA 3EQ0H 1XUJA 3S7KB 3ZVGA 5A0CA 2BXTH 1BDAA 3TH4H 3V7TA 1HAGE 1WUNH 2R3YA 3RXMA 5F53A 4X8TH 4CBNA 2THFB 1UHBB 1ZYOA 1P01A 1EJAA 3P8FA 2FTLE 4NIVA 1ABJH 1QRXA 3CS7A 2G52A 2STAE 4BAKB 1ANCA 2OD3B 1Y3XA 4I32A 4OGXA 2W26A 2G4UA 2GZ8A 1RRKA 1TPOA 3ZZ4A 5AFZH 3MYWA 2V6NA 4YOJA 2BD2A 2P95A 3Q00A 1SGQE 2XXLA 4RN6A 1DOJA 1H1BA 4NA8A 4X1RU 3FZZA 1IQKA 2A4GA 4KELA 1DANH 5EXNA 1BTWA 1EZXC 1Y59T 5A0AE 1DM4B 1W11U 4D9QA 1D6RA 1KXBA 4KTSA 3QX5H 1PYTC 3DFJA 1E1RD 3TH2H 4KP0A
chains in the Genus database with same CATH topology
1J15A 1EASA 1GBMA 1TB6H 1ZJKA 1GBIA 2FO9A 5DP4A 3QTVH 4E7NA 3QLPH 2BLOA 4B75A 1O2RA 1YKTA 2Y6TA 4D7GA 5DGJA 1SL3A 2R0LA 3HKJB 2A0QB 4X6NA 7GCHG 1WQSA 2ZTZA 3A7TA 2Y7ZA 2I6SA 1NN6A 1QURH 1O32A 1K9OE 2GV7A 1C5PA 2F83A 1O38A 3A89A 3SUFA 1MZDA 3LKWA 1PYTD 2OC1A 1Q3XA 4A6LA 4B2CA 4E05H 1W3CA 3RXBA 2PWXA 2VWMA 3T26A 1ZMLA 1KLJH 2VIWA 2ILNA 4GHQA 4VGCC 1HV7A 1AFQB 3MO6A 5T3HA 3RDZA 2ZPSA 4MNWA 3TPIZ 3PB1E 1ZPZA 5TJXA 2VWNA 1GGDB 1T8OA 1Y5UT 1HIAB 1QJ7B 4CR5A 5GCHG 1V6DA 1OYTH 2QGRA 3E0NB 1LPGB 3QN7A 1Y3WA 2C93B 4X2VA 1S83A 2V0BA 3M35A 3M5LA 2ZGJA 1XUHA 1GHVH 5J4SA 1BTUA 4JZEH 3RMOH 4BAMB 1P09A 1V2VT 1C5WB 2G4TA 1MMJN 4ZKNU 1AMHA 1FY3A 1GI1A 1YPJH 3A7XA 1P05A 2O8TA 2ZECA 3PLPA 1S81A 1DE7H 4UD9H 3KGPA 3AAUA 1P2IA 3A8BA 1C2JA 3BIVH 5LH8A 1ELGA 1WU1A 2WUCA 3KQDA 2ANYA 1YLCA 3QTOH 4X1NU 4AGJA 2ANMH 1INCA 1P02A 1TX7A 4WH8A 5EU8A 4CHAC 2GVFA 2G5VA 3BTQE 2JH0D 1X7AC 2FOBA 1F0TA 3FAOA 1QCPA 2B8OH 1TA6A 2Z6BD 1GMCG 1UMAH 3EGKH 2Q6GA 2J34A 3MH6A 1OPHB 1W7GH 1DLKB 5FXLA 3H7OA 1Z8RA 2ZTYA 2F9VA 3FVFB 2VB0A 3BG8A 1K22H 1DY9A 1HAVB 3QUMP 1W0YH 2P93A 4NZQA 4A1XA 1GJ5H 2D8WA 3TITA 1VGCB 3ZZBA 1TGTA 1DWBH 2GV6A 2BDIA 1VCWA 4AFQA 2GMTC 1JWTA 3MWIU 3RXAA 3UPEA 1MKXK 1SGTA 1WYKA 5H4IB 1S84A 1OP2A 3BTWE 3AW0A 3UNQA 2D1JA 2AGIX 4HI3A 1NFYA 5FCRA 3BEIB 1MCVA 3RU4D 2B7DH 3T2NA 1GGDC 2QC2A 3OU0A 1GVLA 3ZYEA 4ABJA 3E16B 1GCTC 3ATWA 2VU8E 1NU9A 1OWKA 1AFQC 1Y3UA 3A87A 2H9HA 5L2ZH 1EKBB 2O8WA 4GVUA 1GBTA 4O3TA 1V2ST 1CA0B 1O31A 1CA8B 5GDSH 5L30H 1HIAA 3ZZ6A 2VVVA 2P94A 1NRRH 1B5GH 5DP7A 2CF9H 7LPRA 1O2YA 4X2YA 1K21H 1MAXA 2A32A 1S0RA 7GCHF 3A83A 3KQEA 1TPSA 3GYLB 3L33A 2SNVA 1P06A 1UTPA 2UUJB 2G5NA 1SLUB 1HLTH 3G01A 1HRTH 1YPMH 2OTVA 1CVWH 1DUEA 1P11E 1UVUH 1CT0E 2A45B 1FNIA 2ZPRA 2VGCC 4KGAA 1QQ4A 2XC0A 1AKSB 4JK5A 1EZSC 1MD7A 1AB9B 1O3DA 1QR3E 2AMQA 1LVYA 2UUKB 3DA9B 3HGPA 3HPTB 3PLKA 3MTYA 5A8XA 5K0HA 3SNCA 3I78A 4ZUHA 5GCHF 3V12A 1Z7KA 5GWZA 2VIOA 1U6QA 4OS1A 5FX6A 5TCCA 2BD8A 2TIOA 1ELTA 4FUIA 4BAOB 1CHGA 1Y5AT 3E3TA 2BD5A 3GISB 2QF0A 1A46H 1EATA 1N8OB 1QRWA 3JZ1B 4O3UA 2QV1A 1NRPH 1KLIH 1Y8TA 1C1MA 4Z6AH 1BTPA 1Q2WA 3O8RA 3U69H 3JZ2B 5C5NA 1PPZA 2BQ7B 2ZG0H 1V2RT 4KKDA 1ZHRA 4UONA 1AKSA 4J1YA 3U1JB 1FMGA 1TNLA 2ZTXA 3FANA 2OXSA 2QA9E 3M5MA 2J2UA 3E6PH 2FS9A 2EI6A 1SHHB 3PYHA 3SUGA 4NGAH 3NCLA 3KN2A 1AO5A 1GMDF 3M37A 1O2GH 3BN9A 3ZZ7A 2H6MA 2ESTE 4NIWA 5EPNA 1AE5A 2IPHA 2ZZUH 1EAIA 4XDEA 2VWLA 1SOZA 3ZVEA 1ETSH 3WY8A 3M5OA 1S6FA 2ZCHP 1O3LA 4GAWA 1O35A 1GJ6A 1C5QA 2FX4A 5A0BA 1XMNB 2OCVB 1RTFB 3LT3A 4DW2U 2ZP0H 1RS0A 1KXFA 1MZAA 2BX4A 4XE4A 1PFXC 1SFIA 4DURA 1G3CA 3A85A 4HGCA 1SGYE 4NSYA 3HK3B 5HYOA 1G9IE 3PTNA 4OS5A 2A7JA 1XXDA 3SU0A 2FMJA 3A7VA 4K69A 4VGCB 4Y8XA 2VVUA 2XWAA 3GY8A 2BY5X 1TPAE 2ANKH 4KTCA 1UVPA 4AFSA 4DVAU 3VPKA 4MVNA 4IN1A 1HUTH 2Q6FA 5F03A 1CBWB 5I25A 2ZU3A 3UWIA 2XBVA 3ZZDA 3MNSA 2PR3A 1NZQH 1ZMNA 2W5EA 1C2IA 1PPGE 2B9LA 4INHA 2UUFB 2QY0B 3UQVA 1DDJA 4CRFA 1FN6A 1UTLM 3U8RH 4R0IA 1QB6A 1J14A 4A7IB 3VGCB 1BQYA 2JH6D 1LKAA 1JRSA 1AZ8A 3A8DA 2BHGA 1TX6A 2FODA 3F9FA 1IQMA 1S82A 4WF8A 2ZGHA 1IQEA 1FI8A 1TOMH 1F0RA 4CREA 1BTYA 1AB9C 4TY6A 1MH0A 1HCGA 1A5IA 2FLBH 4JYUH 1LPZB 1HAIH 1HPGA 1O2QA 3OX7U 8LPRA 2GX4A 2KAIA 2ZGXH 1BRAA 2TGTA 2C90B 4AB8A 1DXWA 3P8NA 4IS5A 1J16A 1K2I1 3LGTA 1ZLRA 3NXPA 4I8JA 4ISOA 1O3JA 2VH6A 3BSQA 4MPUA 4DCDA 3MU0A 3BTHE 2XC5A 1E36B 3AAVA 1TRMA 1D3DB 1P12E 1UTMA 5BPEA 1SGDE 2FOMB 1C2HA 4ZKSU 3RU4E 1UVOA 5EODA 7KMEH 3SOSA 3STIA 3QO6A 3U9AH 1SQTA 1IQIA 5DG6A 2BXUH 2J95A 3O8DA 1C2GA 2Y82A 1QTFA 4JZ1A 3D23A 2UWPA 3SV2H 1QL9A 1Z8JB 4Q7XA 4YT7H 2FI5E 5C1UA 2LPRA 1TNIA 2FOGA 1BCUH 1RTLA 4INKA 2CV3A 1OXGA 3SV9A 4GSOA 1MQ5A 1GPZA 1OWDA 1O2ZA 4ZMAH 3V0XA 3GY7A 4MPWA 1MKXH 4TWYA 2PSXA 4XOJA 1K1MA 5C3NA 1F0SA 3VXEH 1RGQA 4BTIB 5SGAE 1AGJA 1OP8A 4NCYA 2JETC 2ZI2H 1LTOA 1NFXA 3FFGA 1GI2A 3UOUA 3ESTA 3SNEA 1GG6C 1NRQH 1YCPK 3LC5A 5JBTA 1TALA 2RDLA 4WMEA 3I29A 2BDBA 3NZIA 3MO3A 4JMYA 4FXGH 5IYTA 4ABGA 1TNKA 3RXGA 3RM2H 1ELBA 2PW8H 4Y6DA 1GI8B 2ALPA 1V3XA 1BRUP 2FYRA 1OKXA 2OINA 2Z3DA 1GJ7B 2G00A 4MNVA 2FS8A 3SV8A 4JYVH 6CHAC 2XCFA 2ZHWH 2P3UB 5FBEA 3VB4A 3T28A 1O2MA 1O5FH 4XFQA 4ZKRU 1K1LA 1SGFA 4INLA 3AVZA 5CMXH 1BBRE 3FP7E 1BA8B 2ZF0H 4J2YB 2GTBA 3EE0B 3HK6B 3SV7A 1HAOH 2YNAA 3A86A 3UUZA 1GCTB 3Q76A 3ENSB 2ZQ1A 2K1QA 1UO6A 2CN0H 3BV9B 2ZDNA 2R3UA 4Y7BA 4BAHB 2F9BH 3TIUA 2PUQH 3KQCA 3LGWA 1B7XB 1N8OC 3U98H 2JH5D 1GL0E 3H7TA 1MUEB 1S5SA 1TMUH 1PPHE 2B0FA 4IC5A 2J38A 4XSKU 2VVCA 1A7SA 2VWOA 3BEFB 3GDVA 3Q77A 3ZV9A 4ABFA 1ZRBA 6LPRA 2G81E 1J17T 3RXPA 1PPCE 1TWXB 3VGCC 3SU4A 1P57B 1TGNA 1T7CA 1MTSA 1VR1H 3A7ZA 3F9EA 1CHOG 5I46H 4ZHAA 1ZJDA 2BOKA 3SJOA 1FY4A 1D3TB 2WPKS 4FUCA 4AFZA 2A5KA 1O5BB 1V2NT 2BOHB 1B0FA 2BMGB 1ANEA 1T4VH 3ATLA 3F9HA 2WYGA 3F9GA 3P8OA 4H4FA 1C9PA 3E90B 1C1RA 4I8GA 3BF6H 2CHAC 1C5TA 4B73A 1C1QA 5GIBA 1KTSB 4O97A 2OUAA 1SQOA 3LOXA 4H42U 1QL7A 2BX3A 1O37A 5ESTE 4JZIA 3MI4A 3MU5A 1BTHH 2ZU4A 4U30A 1SLXB 3UNSA 1L0ZA 2BVSH 1C1VH 2UUYA 1ORFA 4WMFA 3ZVCA 1TA2A 4RSPA 3RC4A 3BIUH 1RFNA 4Y0YE 1GHYH 2ANWA 2XCNA 3EA9A 4JZFH 4YOGA 1BBRH 1SGIB 1IQHA 1TMTH 3EAJA 2BY8X 2PV9B 1A0HB 1IQGA 4Y11E 3SGQE 1NRNH 1T4UH 3RXJA 3ZZ5A 2BDCA 3M3SA 1EAWA 3DUXH 1G3DA 2ODPA 1C1OA 4BANB 1GDUA 2VNTA 1Y5BT 2B5TB 3BTME 2ZWLH 2F9PA 2YOLA 1BB0B 2PUXB 1P9UA 3ODDA 1QGFA 1V2LT 4THNH 4ZROA 3VB3A 4H6TA 4ZHMU 2BQWB 1V2KT 1G3EA 2FOEA 4IMZA 1YYY1 4ZH8A 1N1LA 1PQAA 1C1UH 1MD8A 2AH4X 4NZLA 3ZVFA 3Q3XA 4UE7H 2JETB 1SGFG 1UTOA 3LJOA 1VJ9U 2F3CE 5EQQA 1ZMJA 7ESTE 1XUGA 2FP7B 2EC9H 1C5MD 4Y71A 1NPMA 1BT7A 1TNGA 1AQ7A 2VH0A 1C5UA 3C27B 4FUBA 1SSXA 1DXPA 1NO9H 3SNAA 1G2LA 1TGBA 1H4WA 8ESTE 2BVXH 1UK4A 2BLVA 2F9UA 3GCTF 3Q3KA 2QCYA 3PMHB 2EA3A 3ODFA 1OWJA 1F7ZA 1WQVH 1O5DH 5JBCS 1FIZA 1K1OA 3GDSA 4IMQA 2XYAA 1FZZA 1GMHF 1ACBE 1SFQB 1THPB 3OSYA 4D9RA 3RXUA 2ZPQA 3M3VA 4GLYA 5T6GA 2FIRH 3HGNA 1ZPCA 1HAHH 4H6SB 3SW2B 4K3JA 4AYVB 3L6PA 2LNCA 1EJMA 4YLQH 1DWDH 4NWLA 2GCHF 4CRCA 1L4ZA 5FCKA 2PFEA 5EOKA 3UWJH 1AY6H 1F0UA 2ZQ2A 4MLFB 1O39A 1XKAC 2H2ZA 1JMOH 3KEEA 4ZXXH 1S6HA 3A7WA 4K2YA 3I77A 1XUIA 1GHWH 4F4OC 4YLUA 2BDGA 2XRCA 3FP6E 4X8SH 1O30A 3CP7A 1EZUC 4K1EA 1EQ9A 3GCHC 5F8XA 1P8VC 1GJ8B 3MMGA 1LQEA 1MTVA 4CRAA 1GHAF 4AX9H 1ZGIA 1O2OA 3NKKA 5CHAB 1EUFA 2AERH 3MFJA 1C5RA 1D4PB 1J8AA 1V2JT 3S9BA 1W10U 2BB4A 1GJBB 2ZGBH 1GBKA 2NU1E 1QBVH 4DOQA 1HYLA 2ZFRH 2V35A 3L3TA 1DY8A 4O03A 2DE9A 1HJ8A 1O2IA 4IC6A 2Z3EA 1GVKB 5C67A 1H9LB 2FTMA 4GPGA 1P9SA 2A1DB 1Z8GA 2W7UA 2ZU1A 3W94A 2R2MB 1O2UA 1IQNA 1ZZZA 5LPRA 3RLYH 4LZ1H 3E1XB 2A2QH 1Z71A 5F6MA 1VITG 1T8NA 3RXRA 1QIXB 5C5OA 5DPAA 1DX5M 3SU2A 1F5RA 1KSNA 1MTUA 3URCA 5HMAA 1BIOA 2Z9LA 2CXVA 2Z9GA 2HPQH 1W14U 1WSSH 3TGKE 1TABE 4AGKA 1AWHB 2A4QA 1G36A 1PPBH 4TYDA 5F8TA 2AMDA 2F9OA 1Z1JA 3LC3A 1XXFA 1V2OT 3PROA 3ZVAA 3DHKH 3RC5A 3KCGH 3URDA 1AE8H 2AGEX 4IW4E 1GHBG 1K28D 4TWWA 1WTHD 2DE8A 2GGVB 1ETTH 2HLCA 2ZHEH 2J92A 2ASUB 1O3OA 2PSYA 3BG4C 4RKOB 1L1JA 1ZR0A 4FUGA 4AOQA 1GCDA 1T8LA 3GY5A 4K8YA 2ZCLP 3R3GB 2TRMA 5TCAA 1DSTA 2VINA 1EPTB 3GOVB 1FXYA 2P8OB 1GHZA 1LVMA 1VITH 5C20A 1IHTH 1MKWK 1ESAA 2BLWA 4Q7ZA 1P04A 5JBBS 1GMCF 3A81A 3QGNB 4X1SU 4K60A 1GG6B 1A1RA 2BLQA 1SB1H 4ABIA 3LIWA 1C5NH 2WPLS 1FN8A 4WH6A 2P3TB 2J4IA 1A5GH 2UWOA 4OS4A 4IN2A 3PLBA 1QJ1B 1OWIA 3A7YA 1MTNC 1SC8U 2BDHA 4YOIA 4FU9A 1HXFH 4MNYA 3DFLA 2Q1JA 1UTJA 3EDXB 2W3KA 2FOFA 3RXDA 2AMPA 3RU4T 2WINI 1TLDA 1J9CH 4DGJA 2GCHG 1WV7H 4M7GA 1TX8A 3RM0H 3MH4A 1O2TA 3D65E 5DP3A 1YM0A 3UQOA 3K6ZA 1YGCH 8KME2 2M5TA 1ZTKA 1W8BH 4NWKA 2GD4B 1UTKA 3SO3A 1NY22 2AYWA 5GPIB 2XBWA 3T27A 2H5CA 4X2XA 1UCYE 1ZHPA 3SJKA 3SZNA 1EB2A 2F91A 5E0HA 2R9PA 1BUIA 3TGIE 1K1IA 2C8XB 2A2XH 1EP5A 4YZUA 1C1NA 1FPHH 1KDQB 2BDYA 2O8MA 1AZZA 5LGOA 1BMMH 1LHCH 1QB9A 4D7FA 1O2PA 4Y10E 4X8VH 1NT1A 2FZZA 1MKWH 2Y81A 4U01A 1YCPM 3RXCA 1DITH 4CBOA 1ABIH 1AN1E 2HRVA 1O5EH 9ESTA 3S9AA 4HTCH 1FPCH 1EB1H 1QBNA 4NA7A 2A5IA 3PV4A 1N6YA 2G8TA 1OSSA