3UREA

Repack mutant (t181i, w199l, q210i) of alpha-lytic protease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLIQGNACMGRGDSGGSLITSAGQAIGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
molecule keywords Alpha-lytic protease
total genus 48
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA01
5AFZH 2O9QA 3MU8A 4JZ1A 3AW1A 4MNYA 1HFDA 1W7XH 3NZIA 3S7HB 2OC0A 4XBDA 4E06H 1KDQA 2G81E 3TU7H 1AVXA 2PR3A 3T25A 5EW1H 4A6LA 1CO7E 1LKAA 1Z1JA 3PTNA 4ZAEA 1SR5C 1Y3UA 3ZVAA 1O32A 2SGEE 1IQFA 1WTHD 1EPTB 4AB8A 2AGEX 1E0FD 1TWXB 3GYMA 2K1QA 1TONA 4AOQA 2FTLE 3GCOA 3GCTF 5HGGA 1FPCH 1SFIA 1BDAA 2SNWA 4WWYA 5HYOA 3DFLA 3SUGA 1GVZA 3HPTB 2UUKB 1AKSA 2STAE 1SGCA 4IMZA 1UTKA 2CF9H 3R3GB 1F0SA 1DFPA 1SGTA 1P0SH 5I25A 4XFQA 2ZFQH 1O3OA 2H6MA 2BVSH 4OS4A 3SNBA 3UTUH 1RXPA 3RDZA 2ZDLA 2GCTC 1S0RA 2XW9A 4E05H 4Q2KA 1DLEA 3CP7A 1FMGA 1LMWB 1LO6A 4Y0ZE 5F8XA 4UE7H 4SGAE 7KMEH 1BMMH 2A7CA 4X6MA 2IPHA 1KYNA 4UEHH 1T32A 4BAKB 1C2GA 2ZHEH 4FUBA 1V2LT 4IN1A 4E7NA 5IYTA 2ZHFH 2WV5A 4KELA 1N8OC 2G5NA 1NFXA 3F9FA 3RC5A 1O3LA 1OWJA 2BLOA 3UPEA 2H5CA 3M3SA 3ZVCA 1O3DA 1SHYA 2ZTXA 1FN8A 1TNIA 2OBQA 4MPXA 1DPOA 3MU0A 4I7YH 5A2MH 4NFFA 3SNCA 2XC5A 1KXDA 4Y71A 5AHGH 1QJ1B 1MH0A 1XUHA 2TRMA 1ZSLA 4MNVA 4Y10E 1O2RA 5A0BA 1YPGH 2BY7X 3RMOH 3CS7A 1Q3XA 3S9BA 1E37B 4JMYA 1S84A 3O8DA 1G3CA 1MTWA 1JRTA 1OP2A 1OWKA 1IAUA 1QB9A 2XTTB 1PYTC 2ZZUH 2ESTE 4CH2B 1LHGH 1TGBA 3PO1B 5A8XA 4DOQA 2P8OC 5TCCA 1LPZB 1Q2WA 4HTCH 3ZZAA 5TCAA 3T27A 3A85A 4LXBH 2R0LA 4SGBE 1BTYA 5FBIA 4INLA 1O36A 2OC7A 2W7UA 1BMNH 2ZDNA 1PJPA 1LVMA 1BT7A 1TB6H 4AORA 4D7FA 1BIOA 1OWEA 2BVXH 2VIOA 2FXRA 1H8DH 1NRQH 2R2WU 1F5LA 3E90B 1BTHH 2FX6A 1VCWA 1A0JA 1OOKB 3CENA 4X8SH 3S0NA 1TIOA 2Y5FA 2HGTH 2ZTYA 1YC0A 2CGAA 3JZ1B 3TK9A 1DT2A 1ELVA 2CJIA 1W0YH 1C1RA 2TGTA 1EZUC 1NPMA 2BDBA 4GHTA 1TALA 1NN6A 3ZZBA 1O2MA 1O34A 4NG9H 3MNCA 1CQQA 1O31A 3ELAH 5T6GA 3VB4A 3VXFH 1O2OA 1XXFA 2OC1A 3AW0A 3U98H 3SHAH 7ESTE 2OXSA 3U8RH 5E8EH 3UQOA 4JZIA 3UUZA 3BTME 2ZF0H 4X1RU 4OS7A 5T6FA 2PWXA 4IW4E 2ANYA 1A5IA 1GBLA 4AYVB 1DY8A 1FUJA 5C3NA 1N1LA 1J17T 2HNTC 3ESTA 2J92A 2GDEH 3LT3A 4GVUA 2A32A 1SC8U 2OUAA 2GV7A 4GHQA 1K21H 4O9VA 1KY9A 2FYQA 3AVZA 1EAWA 5F8ZA 3SQHE 3EE0B 2QF0A 2ZCHP 1TMBH 3Q3KA 4A1TA 1EUFA 3KQCA 4MQAA 1IQHA 1DXWA 2GVFA 1ABIH 2FX4A 1SLXB 2GZ7A 1IQIA 2BY6X 4X8TH 5EPYA 2F9BH 2FM2A 1D9IA 5CE1A 1LVOA 1P57B 3DUXH 3E3TA 3NCLA 3ZZ9A 2ZWLH 5CHAB 1GHXH 4ISNA 2GZ9A 1AB9B 1GBDA 3UREA 4BNRA 1RTKA 1QIXB 1K1IA 2XCFA 3E16B 1UTLM 2QV1A 1GBIA 4Y8XA 2VU8E 2HPPH 1P01A 2ASUB 2VVUA 1CGJE 2BYAX 3QUMP 3QGNB 1GVLA 2J95A 4X1PU 1G9IE 2P16A 3RXJA 5DPAA 2ZHWH 1GL1A 3Q00A 3PLBA 5ETXA 1VCPA 9LPRA 3SUFA 1ZJDA 3KGPA 3TH3H 1KDQB 4K1SA 1GI8B 4WXVA 3GDVA 1HPGA 1TNKA 2FYRA 3UWJH 2EI7A 4K2YA 1BJVA 1C5PA 3F1SB 3A89A 1KSNA 3LIWA 5EQRA 3MNBA 1VITG 3MO9A 3LGYA 1V2RT 3M37A 3A88A 1TRMA 3UR9A 4MLFB 1GHVH 1Y5BT 1WYKA 1ELAA 1UTOA 1C5ZB 1O2KA 4YLQH 4VGCB 1VJ9U 1WCZA 2BD2A 1DDJA 1UJ1A 3EA9A 1QTFA 4ZKRU 5FBEA 3SQEE 2Z9IA 2QXHA 3ATMA 2VGCB 2B7DH 4FUCA 1RJXB 1Z6JH 3P17H 1TBQH 3PWBA 3VFEA 1YCPM 4IS5A 5LH8A 2GV6A 2GTBA 3RXGA 1K1NA 3MMGA 1HJAC 1GG6B 3MO3A 4BTUB 1T8MA 1HDTH 1L4ZA 1LHEH 3GCNA 1GBTA 4ISIH 5GXPA 1HUTH 1WAYB 3RXBA 1BOQA 2SGQE 1O3PB 1MKXH 1O3HA 1YBWA 1EAIA 3GDSA 3SGBE 4MPVA 2G51A 4OS2A 3A81A 2BY9X 1LCYA 1TPOA 1C5VA 3QDZB 3SU3A 1SGYE 2J34A 3BV9B 1GBHA 1L1GA 1UTMA 5GDSH 8KME2 1SLUB 1AO5A 4CH8B 2ZGCA 3BTQE 1NRSH 3SNDA 1L1JA 3MOCA 5L30H 4LZ1H 1T4UH 3TNSA 2DUCA 1GMHG 1ZJKA 3F68H 1HIAB 1ABJH 1K22H 1SQTA 1UCYH 1X7AC 4O97A 1LPGB 1SQAA 4JYVH 1O3BA 2FO9A 4H4FA 3TJVA 2Z7FE 4IN2A 2ALPA 3ODDA 1UVOA 4Y7AA 1GJ7B 2DE8A 2Q6FA 2A4GA 2GKVE 1TGSZ 3HKJB 5E0HA 1S0QA 4VGCC 1KTTB 1KLJH 1YPLH 2HNTF 5EODA 2RDLA 5EG4A 1FAXA 3E8LA 3B23B 1EZXC 1AUTC 1KXEA 1AZ8A 1W2KH 3SJIA 1HXEH 3RXPA 3PV4A 3TK6A 1CA8B 1VGCC 2VGCC 2OC8A 1IQMA 1TX7A 2ZPRA 4BAQB 2WPHS 1M9UA 1NY22 1KIGH 3A7VA 3BG8A 3ZZ3A 1T8NA 1GBAA 3RXIA 3LC3A 3MH7A 1H9IE 4UD9H 2XWBI 3R0FA 3ZZ6A 1C9TA 1OPHB 2G4UA 1GBFA 2W5EA 4OGYA 1ZMLA 1CVWH 3IITA 3U1JB 2SFAA 2JH6D 4U01A 1N6YA 3SU0A 3QTOH 1O2NA 2Q6DA 3FVFB 4UFGH 4Z6AH 1LHCH 4AZ2B 4NIXA 2ZO3H 2BD4A 1L4DA 3SUDA 4NZQA 3Q76A 4O03A 5CMXH 4XDEA 2O8WA 2PKAA 3M5LA 4K1EA 2W3KA 1AMHA 1NS3A 4GSOA 1W10U 2ZG0H 4WJG2 1K1PA 1SI5H 3H7OA 4X2WA 3RXTA 2F3CE 3GY7A 2A7HA 4IMQA 4NSYA 4R8TB 5FPTA 1RTFB 2A5AA 4A7IB 1NRPH 3A7YA 4ISLA 1C4Y2 1MBMA 1V2KT 3PWCA 2PSYA 1TBZH 1TX8A 1GBEA 2KAIA 1ANEA 3LH3A 1YCPH 4GCHG 2WPKS 4IBLH 4CBNA 1IOEA 2BD8A 1QGFA 3AAUA 1L1NA 1UHBB 3GY2A 2FI3E 1SOZA 1ELGA 3T29A 3ZZ5A 2OINA 3DHKH 1LQEA 2O8TA 4MTBA 2SGPE 1N6XA 1DUAA 2D2DA 3BEIB 4RN6A 1HB0B 1V2UT 1EPTC 3BTKE 3VGCC 3TH2H 1LHFH 1IHTH 1P2IA 1NC6A 3LC5A 1GMDF 4I32A 1O3IA 1E35B 4D7GA 1O3EA 3S9CA 2Q6GA 3E91A 4ABJA 3RXEA 2Z94A 3SZNA 1HGTH 4AG1A 1ESBA 1GBMA 1LHDH 2LPRA 5EW2H 1SB1H 2OD3B 1P06A 5DP4A 2BXUH 3LGIA 3SU4A 1AE5A 3PB1E 3SJOA 1BTPA 4KP0A 1UVSH 1ZRKA 4BANB 1S6HA 4NWLA 4CRAA 1F0RA 1BTWA 1BUIA 3UY9A 1PPBH 1BRUP 1DY9A 2ZQ1A 3ZYEA 1VJAU 1OX1A 3KQBA 2ZFFH 5ESBA 1TYNA 1G30B 1HNEE 2EI6A 3A87A 4BXWA 1P04A 1O2SA 1A2CH 1QL8A 1TRNA 1RGQA 4JYTA 2A4RA 2ZPQA 3ZYDA 1D6WA 1WV7H 3LH1A 1F2SE 1GVKB 3BTWE 2BY8X 1XUIA 1SQOA 2P8OB 1AVGH 1K1LA 2BX4A 2J9NA 3DD2H 1ZHPA 3MHWU 2G00A 2Z3CA 3C1KA 3M3TA 1QJ6B 1LDTT 3ZZ7A 4YOJA 1SGRE 4PROA 4WH6A 3HK6B 2GT8A 1TPSA 4LK4A 5L6NH 1ELDE 1O3CA 1RRKA 4B1TA 1JIRA 1Y59T 5JBAS 1IQLA 1GGDC 1DWBH 1JIMA 1FIZA 2XXLA 1W11U 4R0IA 1QBVH 5E0GA 3FP6E 1BTXA 4J1YA 1BA8B 1ZSJA 1B0FA 4I8JA 4YOGA 3RU4T 3RXAA 2FOGA 3SJ8A 5FXLA 1YCPK 1IQJA 3V12A 1DWCH 1MKWK 2Y82A 4B76A 1K28D 1Y3XA 3TK5A 4AYYB 4DURA 1V2TT 2EI8A 3BTEE 1RFNA 4B75A 1TBRH 3SNEA 2UWPA 5EGMA 1K1JA 1P2NA 1KXCA 2CMYA 1AN1E 5LPEA 3DFJA 4UFDH 1WOFA 2XBYA 1C4U2 2ZU1A 1G37A 2PLXA 3M5NA 4Y7BA 4ZXYH 5SGAE 3HGPA 1ELBA 1O37A 4YTAA 1DSUA 1CHGA 3F9HA 1TA2A 2PTCE 4I8HA 3TGKE 1HXFH 3EA7A 1C2DA 4I8GA 2RA0A 1ELCA 2QC2A 3PMHB 3URCA 1O3NA 4KKDA 2FTMA 1FY1A 4QT8C 5K0HA 1P3EA 1C9PA 1QFKH 5DP5A 1SGFA 3QTVH 1AQ7A 3ZVEA 1P02A 1GBCA 4KTCA 4X6NA 5LGOA 2WYJA 3QWCH 1F5KU 1CGIE 2PGQB 1KXFA 1KTSB 1DX5M 1DXPA 1AB9C 1J14A 1QA7A 1H9LB 2FOFA 2BD5A 1CT0E 3ZVFA 2NWNA 2TBSA 2ZU4A 2QIQA 1P10A 3B8JA 1YP9A 1UK3A 4IC5A 5FCKA 1ZR0A 1AHTH 2XC4A 1ZTKA 4ZKNU 1D3TB 3WY8A 5L2ZH 1PPHE 4ZXXH 1NFYA 1C5YB 3ZZCA 1HJ8A 3LU9B 5FPYA 3H7TA 4CRFA 1BRBE 5A09A 2VJ1A 3KL6A 4CRDA 3A8AA 1CSOE 2BQ6B 1C1VH 4NWKA 2OP9A 3S7KB 3SI4H 1J8AA 2FIRH 3T2NA 3U69H 1JMOH 2P3TB 3UNRA 3QLPH 1P9UA 5B6OA 2BDAA 1GWAA 4X6OA 4X8UH 2BY5X 2BVRH 4ZHMU 2M5TA 1ANDA 1Z8IB 1PFXC 2R3UA 7GCHG 3STJA 2ZFPH 4K8BA 4D76A 3SV8A 4DGJA 1YF4A 2R0KA 3E0NB 1QRZA 1C1OA 4WMEA 3PO1C 1VR1H 2F83A 1PPEE 4ZKOU 2HVXA 4K60A 1TRYA 2B5TB 4UFFH 1ZTLA 5GWZA 3P8OA 1GCTB 4GAWA 2BDIA 1QB6A 4H6TA 1TGNA 1GI5A 1GJDB 5PTPA 2BTCE 2ANMH 2THFB 2WPJS 6CHAB 3ZV8A 1BQYA 4YT7H 2STBE 2PKSB 1WQVH 1ORFA 1FJSA 1O2YA 4A92A 4Y79A 2BDHA 1KXBA 5JPMH 1QY6A 4OS1A 1GHYH 1DICA 3MU4A 1BCUH 4X1QU 4OS5A 1Z1IA 1BITA 1CE5A 1ZMNA 2C8ZB 3B9FH 4JK6A 1QL9A 1ZLRA 2ILNA 5AVDA 3V3MA 4ABAA 4X2XA 1ZSKA 3O8BA 1G2LA 3RMNH 1TGCA 2WUCA 1S5SA 3LPRA 4B2AA 2PUQH 1TFXA 4AGKA 1D3QB 5EXMA 5ESTE 3RUOA 2CXVA 4B71A 4INHA 2PV9B 3ITIA 2Y7ZA 3HGNA 1H4WA 2BOKA 1WTGH 1Z6EA 1CU1A 1K9OE 1D4PB 1HBTH 2Z9KA 1O3JA 1U6QA 2BQWB 4AFUA 4AFQA 1ELFA 3M61U 4YZUA 1HLTH 4XOJA 1MKXK 1DANH 4ZROA 3OU0A 1VZQH 1W13U 5GJ4B 1S85A 5J4SA 2ZCKP 3BTTE 1AIXH 1J15A 4M7GA 5J4QA 3SV6A 1P8VC 5FCRA 1GBBA 1SGQE 1Y3YA 2EC9H 3I29A 3V7TA 4DW2U 2VIQA 3RU4D 5FAHA 5C1YA 3RXLA 2H9EH 3QZRA 3A7TA 2C4FH 3K6ZA 1FONA 1YPKH 4NIYA 6GCHF 1C2KA 2XRCA 3A8BA 5HM9A 1ZGVA 2ZTZA 2ZU5A 2BMGB 1UCYE 1HJ9A 1K1MA 4ISHH 2A4QA 1P3CA 1C1NA 4KTUA 1V2PT 2ZKSA 4Q80A 2I6SA 3TGIE 3RXOA 4LZ4B 4O3TA 1THSH 4K69A 2NU4E 4INKA 1V2OT 4F49A 1AWFH 3RXMA 3H5CB 1A0LA 2RG3A 4AFZA 2V35A 5AFYH 1C2EA 4FU8A 5GCHF 2Y7XA 4CRBA 1BTZA 2SNVA 3W95A 2WYGA 4Y8ZA 2AIQA 1GHAG 2FOMB 2A2QH 2ALVA 3MH4A 1GHWH 1MQ6A 4XE4A 3SV2H 2DE9A 2Z9GA 1O2LA 1QQUA 1VGCB 2BX3A 1C1MA 4IGDA 1CHOG 1TOMH 1FY3A 1MMJN 1Y5AT 2O8UA 3PM3A 3RLWH 1BHXF 1OSSA 2AS9A 1ZTJA 2AGIX 2AYWA 3RC6A 2CHAC 1ANCA 5E0JA 4ZHAA 1EX3A 1TPAE 2ZHQH 3EGKH 3ZVBA 2A0QB 1EZSC 2VB0A 2VIPA 3BIVH 4AX9H 5DK1A 2B9LA 5I46H 4DVAU 1GI9B 3LDXH 1WQSA 1TA6A 3MH5A 1G3EA 3W94A 1CA0C 3KHVA 1V3XA 1ZPCA 1PQ7A 4JCNA 4O3UA 2QF3A 2VIVA 5T6DA 1TQ7B 2FWWA 3ATLA 1SGIB 3TVJB 1A3BH 1UCYK 1Y5UT 2C8YB 1A0HB 3SN8A 2BM2A 3Q77A 2FPZA 2AMQA 2GCHG 2VIDA 1C2FA 4WVPE 1MD7A 1W12U 1O35A 2AMPA 2G52A 3IWMA 1EPTA 1FDPA 1JWTA 3GCHB 3A8DA 3PMAB 1C1PA 1CHOF 5HM2A 1C5UA 1LVBA 1ZPZA 1DVAH 4AN7A 1Y8TA 3RXCA 1KXAA 4CR9A 3RXDA 3RM2H 4RKJB 2FEQH 1LPKB 1GDNA 4LOYH 3SBKA 3EDXB 2IJOB 3AAVA 1ETSH 3FP7E 1TMUH 4WXIA 1EP6A 1QNJA 1FPHH 1SVPA 2HWLB 2PGBB 1YLCA 3GY3A 3KQDA 1S81A 3GY4A 3LJOA 1O5CB 3KEEA 1WU1A 2GD4B 5G4BA 4RSPA 4XSKU 1GHBG 1O3KA 4GLYA 3SW2B 3KN2A 1BMAA 3ZV9A 1AGJA 1BBRE 2TGAA 2ZU2A 3L6PA 1E38B 3PLPA 4JZFH 1WBGB 1O2HA 4NIWA 4BTTB 5EXLA 1TPPA 1MBQA 4UONA 2BLQA 1V2WT 2TPIZ 3VB6A 2C8XB 3RP2A 3K65B 4DIHH 2VNTA 4D8NA 3SJ9A 2IOTA 1FY5A 4FVDA 3T26A 1MUEB 3SOSA 3PTBA 8GCHF 2R2MB 1V2ST 1S82A 2JH0D 5C1XA 4CR5A 3GY6A 3VB3A 5BPEA 2ZHDA 2ANWA 4ABDA 3SU6A 2C3SA 1AY6H 2BHGA 1O5AB 1XVOA 4X2YA 1OKXA 1W0ZU 5EQSA 2H5DA 1VCQA 3P6ZB 1RD3B 3LKWA 1GBJA 1EOLA 1W14U 3OSYA 1QHRB 2V6NA 1GPZA 1VITF 3P8FA 1MU6B 2YOLA 3S69A 4DG4A 1HAOH 1W8BH 5GPIB 1AKSB 5E2OA 1GDUA 1TOCB 1AFQB 2FZZA 3A86A 2HALA 3GDUA 3SGAE 1KLTA 1QJ7B 2A7JA 1GJ6A 2FP7B 4GCHF 5H4IB 1SGFG 5LPRA 2RA3A 2VVVA 1SPJA 3EQ0H 3TLOA 4MPWA 1P12E 2XNIA 5T3HA 2GCTB 2QN5T 4ABGA 1WSSH 3QZQA 3SHCH 4CBOA 2KAIB 1ZHMA 1XUKA 1YPJH 2J94A 5F8TA 1O5BB 2I6QA 4CHAC 3UFAA 1MCVA 2XBWA 3BN9A 3A7ZA 3JZ2B 3T28A 3EAJA 4DJZB 5K7RA 3NUMA 1EJMA 4WMDA 4WY3A 3TH4H 4F4OC 1NFUA 1TABE 2WUBA 2FOBA 2ZIQH 1W3CA 4RKOB 2G5VA 2J4IA 3Q3YA 1GMDG 4YOIA 5F6MA 3MWIU 3M5MA 1P9SA 2QA9E 1LKBA 1OYTH 1ELTA 1ZMJA 2OLGA 1THPB 2BLWA 1ID5H 3URDA 4X6PA 2BB4A 1UO6A 1GI4A 2Z3DA 1AVWA 2R3YA 3OYPA 4MNWA 2NU3E 1A3EH 1V2NT 5C5OA 1E36B 1SLVB 1XUFA 1Z8GA 2ODPA 1Q31A 2VINA 4X8VH 1QA0A 1GI6A 2ZDMA 1GMCF 1Y3WA 1AWHB 5GIBA 1Z71A 3FAOA 1C5QA 1K2I1 4KTSA 1O5FH 1Z8RA 1P2KA 4ABEA 2HLCA 3KNXA 4ZKSU 1FXYA 2RCEA 1PQ5A 1DSTA 2GMTB 2LNCA 2FDAA 3ZZ4A 2P94A 1GJAB 2W26A 3N7OA 3P70B 2F9OA 4TWYA 3TJNA 1A7SA 2Z3EA 5HXFA 4YO9A 1S83A 3TJOA 3RMMH 4D9QA 1AUJA 2SGAA 1GG6C 2FI4E 2F9PA 3UNSA 3A7XA 4Y6DA 1NU9A 1XVMA 4Y8YA 1O38A 1O2PA 3HATH 4FU7A 2HOBA 1RS0A 1P2OA 4B2CA 2ZDVH 2ZU3A 1HAVB 1QB1A 3SJKA 1MTNB 1UHBA 2A1DB 1NU7B 1TNHA 1JXPA 4X1NU 4NGAH 3TJUA 1P03A 4NZLA 2FESH 1BBRK 3RXHA 2A2XH 2XBXA 1C2HA 2QXGA 1YGCH 1MTUA 1SGPE 1C1TA 2VH0A 2FI5E 1CA0B 2ANKH 3FZZA 5GCHG 5DP3A 2FS8A 4CRCA 2AEIH 1O2ZA 2HNTE 4THNH 1ZGIA 2UUYA 1GJCB 3MH6A 2ZFRH 5TJXA 2FOCA 1LQDB 1AD8H 4TWWA 2OBOA 1SOTA 4X1SU 1BRCE 2ZPSA 3GOVB 2SGDE 2UUJB 2C8WB 4Y0YE 1MAYA 5A8YA 2O8MA 1RTLA 2NU2E 4X0WU 1FIWA 4FUDA 3TGJE 4BAOB 2CV3A 2P3FH 4CREA 4BAHB 2Z9LA 4FUIA 1EJNA 3M7UA 3QK1A 1UMAH 1HAVA 2OCVB 4IC6A 4NA7A 2UWLA 2W7SA 4FVBA 5DP8A 3SI3H 2QXJA 1AI8H 1CT4E 4AG2A 3I77A 5DO4H 5F03A 2FLRH 1QL7A 2ZFTA 1ZOMA 1O0DH 1G36A 6CHAC 3BF6H 4FUFA 2XC0A 4A1VA 1EB1H 1Z7KA 1OYQA 3NWUA 4WF8A 2D1JA 2F9VA 1H9HE 1CGHA 1TNJA 1IQKA 2AFQB 2PHBA 1GI3A 4WMFA 2FLBH 4ZHLU 3U9AH 1GI0A 1F0TA 2QXIA 2XWAA 1EJAA 2CN0H 3M7QA 3UR6A 1C5WB 4TYDA 3MO6A 1CT2E 1EXFA 1TE0A 3VEQB 4YM9A 4MDSA 1XUJA 1ZHRA 1A4WH 1YPMH 1HAGE 3PLKA 3ENSB 2R9PA 1T8OA 3D23A 1ETRH 1V2QT 1MZDA 2AH4X 5JB9S 3M35A 4I31A 2WINI 4U32A 3A8CA 2ZNKH 1ETTH 5DP6A 3GISB 1A46H 1C5NH 2J2UA 2YNAA 1C5MD 2A5IA 2Y80A 5JBBS 4K5ZA 1FI8A 1BBRH 1O30A 3RM0H 1ACBE 2FOEA 1A5GH 3P95A 1F5RA 1YPHE 2UUFB 3NPSA 3K2UA 2O8LA 3P8GA 5FHTA 5A0AE 2Y5HA 2BZ6H 1MTVA 3RMLH 1UVTH 1NRRH 4FUHA 3RXKA 1QRWA 3O8CA 3S9AA 3SO3A 1O3AA 3V0XA 5EU8A 1P09A 1ANBA 1G32B 1C2JA 3SU5A 1UTQA 1TGTA 2BD9A 3EA8A 1C1SA 1EOJA 2PSXA 2P95A 5ABWA 1PQAA 2IN2A 2ZEBA 2Q1JA 5FX6A 1EATA 1QBNA 2OTVA 1HCGA 5JDUB 3KIDU 1C5SA 3C27B 5DKMA 3Q3XA 3QGJA 1EKBB 1TMTH 2GT7A 1GCDA 2A45B 3RU4E 3L3TA 1FLEE 4NSVA 1DS2E 4DT7B 1O5GH 1V2MT 3BTDE 1O2UA 3UWIA 1Z8JB 5C67A 1AFQC 4JYUH 2G4TA 1XMNB 4ABIA 1MAXA 4BOHA 1OWIA 2JETB 2PKSC 2V0BA 4YLUA 4HGCA 4K1TA 1V2VT 1TNLA 4XBBA 2OQUA 3RXUA 3BEUA 4I33A 3NKKA 1W7GH 1GHBF 3FP8E 7LPRA 3U1IB 1FQ3A 3RXFA 4CHAB 2J38A 2BDYA 3QX5H 4H42U 1XUGA 1OP0A 2VWNA 2QGRA 1L2EA 1O2IA 4ABBA 1IQGA 1O39A 5A0CA 4HI3A 1SLWB 5C20A 1CBWC 1D3DB 1YKTA 1GI2A 1RIWB 2C93B 1SGNE 2TIOA 3M3VA 3LJJA 1ELEE 1NESE 4UFEH 3UOUA 1GCTC 1FV9A 1G3BA 1OWHA 2VVCA 1AU8A 4ISOA 3M7TA 5BRRE 3D49H 3HK3B 1J9CH 1EB2A 1DLKB 5E2PA 2A4OA 3RXQA 4ABFA 1XM1A 2ZGJA 1O3FA 3ODFA 1MD8A 1YM0A 2OQ5A 1N8OB 1XKBC 1O2TA 1GJ4H 1BMLA 4NA9H 1V2JT 1UK4A 4BTIB 2D8WA 4H6SB 1SHHB 1NO9H 1ZYOA 2ZP0H 3LONA 2AMDA 4JZEH 4K3JA 3SNAA 3SUEA 1GJ8B 3GY5A 2BD3A 4Q7ZA 1MZAA 2P3UB 3ATIA 3M5OA 1T31A 3GCHC 1AZZA 1A1RA 1OXGA 1YYY1 2PTNA 4ZUHA 1C2MA 2VIWA 2P93A 2WV4A 3PMJA 5C5NA 3MI4A 3SU1A 2ODQA 4FUJA 3FFGA 4TPYA 1O2XA 3BSQA 2ZDAH 1BJUA 3TIUA 1TLDA 3TNTA 1GJBB 1AE8H 1G3DA 5JBCS 3AASA 3LGUA 4BXSA 1O2WA 1KLIH 4OS6A 1E34B 3F6UH 2ZFSA 3OY5U 1UK2A 2VH6A 2FMJA 4BAMB 1SBWA 4B73A 2ZCLP 3U8TH 1SG8B 3BIUH 1D6RA 1PPGE 4YT6H 2Z9JA 2H2ZA 2ULLA 2V3HH 1C1WH 1EASA 1FY4A 2XYAA 1K1OA 4YESB 9ESTA 1GMCG 1Y3VA 4HFPB 1FNIA 1F0UA 1BHXB 2NU1E 3VB5A 2WPMS 4NFEA 5C1UA 2ZA5A 1MKWH 1MQ5A 3BTHE 3OTJE 2QY0B 3A84A 2BOHB 4U2WA 3K6YA 1ZPBA 2BLVA 4K8YA 1P2QA 2FODA 2FOHA 3D65E 3TITA 1UTNA 3K9XB 4TY7A 8LPRA 1NRNH 1IHSH 3BTGE 5JBTA 2ZC9H 1TQ0B 5L2YH 1HAYB 1P11E 1L0ZA 1CBWB 1ESAA 4KGAA 4Y11E 1RIWC 3ATWA 4NCYA 6LPRA 1T8LA 1SSXA 1PPCE 2D26C 2JH5D 3T62A 3CS0A 1EZQA 1QBOA 1HV7A 3SV7A 2FS9A 2HRVA 4MPUA 1OWDA 2TGDA 5C2ZA 1UTPA 2ZECA 1GJ9B 2F9NA 2JKHA 2B0FA 1JRSA 6ESTA 2GMTC 2BDCA 3RXRA 1NT1A 1QQ4A 8ESTE 1C2LA 1O2QA 3E6PH 1B5GH 3EYDA 1NZQH 3SGQE 4OGXA 2GX4A 8GCHG 5CHAC 3SU2A 3M36A 3LOXA 3A80A 1GDQA 1VITH 2ODYB 4FUGA 3PMBB 1DUEA 4JK5A 2BXTH 3BEFB 2Y6TA 4UDWH 1ESTA 3D62A 3SORA 1MTNC 1C5XB 3T5FH 4FXGH 1YPHC 1ZRBA 2NU0E 1IQNA 4DY7B 1LTOA 1HYLA 1IQEA 1G2MA 1F92A 3VB7A 3GCTG 1HIAA 2EEKA 1EAXA 2Z6BD 1YPEH 3STIA 1O33A 3NK8A 5A8ZA 1PQ8A 2XCNA 3MU1A 4ZH8A 1C5TA 3F9GA 1FY8E 2QCYA 1MU8B 2TGPZ 3FANA 1P05A 1SGEE 1C1QA 4CRGA 1C5OH 2AERH 2PUXB 5AF9H 2F9UA 4AGJA 1DWEH 5DJ7A 2ZQ2A 1BRAA 3PROA 1WUNH 1LVYA 1PYTD 1HAHH 1DWDH 1A5HA 3ATKA 5EOKA 4Q7YA 2ZGXH 1C4V2 1B7XB 5JYIA 3NXPA 1PPZA 7GCHF 4WH8A 1O2VA 2PFEA 4I8LA 3BG4B 1YLDA 2C90B 4AFSA 4MVNA 2B8OH 2GDDA 3OY6U 1C2IA 4GPGA 2GP9B 1MCTA 4B74A 2F91A 4ABHA 2Y81A 3UNQA 3RXSA 1J16A 1C5LH 4NIVA 3RLYH 3A7WA 4JZDH 5JB8S 4I8KA 3GYLB 1O2GH 2QAAA 1H8IH 2ZI2H 3DT0H 1SFQB 4U30A 1C1UH 1ZZZA 5FX5A 5DP9A 4E7RG 1T7CA 3GY8A 2BD7A 5DG6A 1HJAB 3E0PB 3P8NA 1O3MA 1TNGA 3VGCB 2AGGX 3I78A 2G8TA 3KQEA 1QR3E 2GCHF 1XXDA 2EA3A 3KF2A 1OP8A 4FUEA 3MTYA 3HKIB 1O5EH 5IDKA 1EQ9A 3OX7U 1XKAC 1DM4B 4Z0KA 1TAWA 2PW8H 3IG6B 2SGFE 3GICB 3SV9A 3KCGH 4GUXA 3O8RA 3MFJA 3U8OH 2W3IA 1GI7B 1DOJA 2V3OH 2VWMA 4D9RA 1AFEH 2BZAA 2AIPA 2CF8H 2A31A 1HAIH 3RXVA 1GHAF 1A61H 3BTFE 1QRXA 1UVPA 3ZVGA 3PYHA 4DIIH 5DGJA 1B0EA 3DA9B 4TPIZ 1FZZA 1F7ZA 1NM6A 1GI1A 5FPSA 1DITH 1GBKA 2FOAA 1UVUH 2YNBA 1PPFE 3VXEH 3BG4C 4DCDA 1HAPH 2ZDKA 5EQQA 2CHAB 1ARBA 1NTPA 1V6DA 3LGWA 2VWOA 2ZGBH 1DE7H 1OS8A 3F9EA 5HMAA 1P2JA 2WPIS 2GGVB 1EP5A 1ARCA 3E1XB 3MNXA 5DP7A 1SL3A 1BB0B 1UTJA 2BQ7B 1JBUH 4FU9A 3V13A 3ZZ8A 5LPFA 5EPNA 1GHZA 3G01A 3LGTA 3RC4A 1FAKH 1TX6A 3A83A 4Q7XA 1BTUA 2GZ8A 4HZHA 4Y76A 3P92A 3VPKA 1QURH 1QCPA 4XBCA 4NA8A 1GGDB 2G55A 1SGDE 3FZDA 4X2VA 1HAXB 3ZVDA 1C5RA 1O5DH 1H1BA 4J2YB 1NROH 1S6FA 3TPIZ 1THRH 1D3PB 3MU5A 1XX9A 3A82A 4ESTE 2H9HA 4B2BA 1O3GA 2A5KA 4A5TS 2UWOA 2H1UA 6GCHG 3L33A 4MG3A 1FN6A 2QYIA 1JOUB 4ZMAH 4TY6A 1INCA 1MTSA 3QN7A 4ASHA 4AB9A 3UQVA 3QO6A 2WPLS 1EAUA 1GMHF 2JETC 3UIRA 3LGVA 1HAZB 2HPQH 2XBVA 3MNSA 1GJ5H 1P2MA 1GL0E 2VWLA 4MNXA 3MYWA 1SMFE 1O2JA 2Y5GA 1HRTH 2PKAB 2ZGHA 2BDGA 2H9TH 3UOPA 3ZZDA 1T4VH 5EXNA 2P59A 4A1XA 1NFWA 1BZXE
chains in the Genus database with same CATH superfamily
2QF4A 5AFZH 2O9QA 3MU8A 4JZ1A 3AW1A 4MNYA 1HFDA 1W7XH 3NZIA 3S7HB 2OC0A 4XBDA 4E06H 1KDQA 2G81E 3TU7H 1AVXA 2PR3A 3T25A 5EW1H 4A6LA 1CO7E 1LKAA 1Z1JA 3PTNA 4ZAEA 1SR5C 1Y3UA 3ZVAA 1O32A 2SGEE 1IQFA 1WTHD 1EPTB 4AB8A 2AGEX 1E0FD 1TWXB 3GYMA 2K1QA 3PV5A 1TONA 4AOQA 2FTLE 3GCOA 3GCTF 5HGGA 1FPCH 1SFIA 1BDAA 2SNWA 4WWYA 5HYOA 3DFLA 3SUGA 1GVZA 3HPTB 2UUKB 1AKSA 2STAE 1SGCA 4IMZA 1UTKA 4YXWD 2CF9H 3R3GB 1F0SA 1DFPA 1SGTA 1P0SH 5I25A 4XFQA 2OK5A 2ZFQH 1O3OA 2H6MA 2BVSH 1FX0B 4OS4A 3SNBA 3UTUH 2YMSB 1RXPA 3RDZA 2ZDLA 2GCTC 1S0RA 2XW9A 4AC9A 4E05H 4Q2KA 1DLEA 3CP7A 1FMGA 1LMWB 1LO6A 4RI0A 4Y0ZE 5F8XA 4UE7H 4SGAE 7KMEH 1BMMH 2A7CA 4X6MA 2IPHA 1KYNA 4UEHH 1T32A 4BAKB 1C2GA 2ZHEH 2WPDD 4FUBA 1V2LT 4IN1A 4E7NA 5IYTA 2ZHFH 3UB0A 2WV5A 4KELA 1N8OC 2G5NA 1NFXA 3F9FA 3RC5A 1O3LA 1OWJA 2BLOA 3UPEA 3VG8A 2H5CA 3M3SA 3ZVCA 1O3DA 1SHYA 2ZTXA 1FN8A 1TNIA 2OBQA 4MPXA 1DPOA 3MU0A 4I7YH 5A2MH 4NFFA 3SNCA 2XC5A 3F2GA 1KXDA 3KQ5A 4Y71A 4B6FA 5AHGH 1QJ1B 1MH0A 1XUHA 2TRMA 1ZSLA 4MNVA 4Y10E 1O2RA 5A0BA 1YPGH 2BY7X 3RMOH 3CS7A 1Q3XA 3S9BA 1E37B 4JMYA 1S84A 3O8DA 1G3CA 1MTWA 1JRTA 1OP2A 1OWKA 1IAUA 1QB9A 2XTTB 1PYTC 3N7DA 2ZZUH 2ESTE 4CH2B 1LHGH 1TGBA 3PO1B 5A8XA 4DOQA 2P8OC 5TCCA 1LPZB 1Q2WA 4HTCH 3ZZAA 5TCAA 3T27A 3A85A 4LXBH 2R0LA 4SGBE 1BTYA 5FBIA 4INLA 1O36A 2OC7A 2W7UA 1BMNH 2ZDNA 1PJPA 1LVMA 1BT7A 1TB6H 4AORA 4D7FA 1BIOA 1OWEA 2BVXH 2VIOA 2FXRA 1H8DH 1NRQH 2R2WU 1F5LA 3E90B 1BTHH 2FX6A 1VCWA 1A0JA 1OOKB 3CENA 4X8SH 3S0NA 1TIOA 2Y5FA 2HGTH 2ZTYA 1YC0A 2CGAA 3JZ1B 3TK9A 1DT2A 1ELVA 4Q63A 2CJIA 3W1EA 1W0YH 1C1RA 2TGTA 1EZUC 1NPMA 2BDBA 4GHTA 1TALA 1NN6A 3ZZBA 1O2MA 1O34A 4NG9H 3MNCA 5EJLA 1CQQA 1O31A 3ELAH 5T6GA 3VB4A 3VXFH 1O2OA 1XXFA 2OC1A 3AW0A 3SYJA 3U98H 3SHAH 7ESTE 2OXSA 3U8RH 5E8EH 3UQOA 4JZIA 3UUZA 3BTME 2ZF0H 4X1RU 4OS7A 5T6FA 2PWXA 4IW4E 2ANYA 1A5IA 1GBLA 4AYVB 1DY8A 1FUJA 5C3NA 1N1LA 1J17T 2HNTC 1WDIA 4RT0A 3ESTA 2J92A 2GDEH 3LT3A 4GVUA 2A32A 1SC8U 2OUAA 2GV7A 4GHQA 1K21H 1E1QD 4O9VA 1KY9A 2FYQA 3AVZA 1EAWA 3DCLA 5F8ZA 3SQHE 3EE0B 2QF0A 2ZCHP 1TMBH 3Q3KA 4A1TA 1EUFA 3KQCA 4MQAA 1IQHA 4XRNA 1DXWA 2GVFA 1ABIH 2FX4A 1SLXB 2GZ7A 1IQIA 2BY6X 4X8TH 5EPYA 4FOUC 2F9BH 2FM2A 1D9IA 5CE1A 1LVOA 1P57B 3DUXH 3E3TA 3NCLA 3ZZ9A 2ZWLH 5CHAB 1GHXH 4ISNA 2GZ9A 1AB9B 5DSFA 1GBDA 3UREA 4BNRA 1RTKA 1QIXB 1K1IA 2XCFA 3E16B 4P02A 1UTLM 2QV1A 1GBIA 4Y8XA 2VU8E 2HPPH 1P01A 2ASUB 2VVUA 1CGJE 2BYAX 3QUMP 3QGNB 1GVLA 2J95A 4X1PU 5C17A 1G9IE 2P16A 3RXJA 5DPAA 2ZHWH 1GL1A 3Q00A 3PLBA 3SZEA 5ETXA 1VCPA 9LPRA 3SUFA 1ZJDA 3KGPA 3TH3H 1KDQB 4K1SA 1GI8B 4WXVA 3GDVA 1HPGA 1TNKA 2FYRA 3UWJH 2EI7A 4K2YA 1BJVA 1C5PA 3F1SB 3A89A 1KSNA 3LIWA 5EQRA 3MNBA 1VITG 3U28C 4P00A 3MO9A 3LGYA 1V2RT 3M37A 3A88A 1TRMA 3UR9A 4MLFB 1GHVH 1Y5BT 1WYKA 1ELAA 1UTOA 1C5ZB 1O2KA 4YLQH 2LP6A 4VGCB 1VJ9U 1WCZA 2BD2A 1DDJA 1UJ1A 3EA9A 1QTFA 4ZKRU 5FBEA 3SQEE 2Z9IA 2QXHA 3ATMA 2VGCB 1BMFD 2B7DH 4FUCA 1RJXB 3OTPA 1Z6JH 3P17H 1TBQH 3PWBA 3VFEA 1YCPM 4IS5A 1NBMD 5LH8A 2GV6A 2GTBA 3RXGA 1K1NA 3MMGA 1HJAC 1GG6B 3MO3A 4BTUB 1T8MA 1HDTH 1L4ZA 1LHEH 3GCNA 1GBTA 1E79D 4ISIH 5GXPA 3FOAA 1WAYB 5FL7D 1BOQA 2SGQE 3RXBA 1HUTH 1O3PB 2L74A 1MKXH 1O3HA 1YBWA 1EAIA 3GDSA 3SGBE 4MPVA 2G51A 4OS2A 3A81A 2BY9X 1LCYA 1TPOA 1C5VA 3QDZB 3SU3A 1SGYE 2J34A 3BV9B 3WWFA 1GBHA 1L1GA 1UTMA 5GDSH 8KME2 1SLUB 1YLNA 1AO5A 4CH8B 2ZGCA 3BTQE 1NRSH 1QZ8A 3SNDA 1L1JA 2AHME 3MOCA 5L30H 4LZ1H 1T4UH 3TNSA 2DUCA 1GMHG 1ZJKA 3F68H 1HIAB 1ABJH 1X7AC 1K22H 1SQTA 1UCYH 4O97A 1LPGB 1SQAA 4JYVH 1O3BA 2FO9A 4H4FA 3TJVA 2Z7FE 4IN2A 2ALPA 3ODDA 1UVOA 4Y7AA 1GJ7B 2DE8A 2Q6FA 2A4GA 2GKVE 1TGSZ 3HKJB 5E0HA 1S0QA 4VGCC 1KTTB 1KLJH 1YPLH 2HNTF 5EODA 2RDLA 5EG4A 5EJZA 1W0JD 1FAXA 3E8LA 3B23B 4FETA 1EZXC 1AUTC 5T1VA 1KXEA 1AZ8A 1W2KH 1EFRD 3SJIA 1HXEH 3RXPA 3PV4A 3TK6A 1CA8B 1VGCC 2VGCC 2OC8A 1IQMA 2HLDD 1TX7A 2ZPRA 4BAQB 2WPHS 1M9UA 1NY22 1KIGH 3A7VA 3BG8A 3ZZ3A 1T8NA 1GBAA 3RXIA 3LC3A 3MH7A 1H9IE 3OEHD 4UD9H 2XWBI 3R0FA 3ZZ6A 1C9TA 5DN6D 1OPHB 2G4UA 1GBFA 2W5EA 4OGYA 1ZMLA 1CVWH 3IITA 5KEDA 3U1JB 2SFAA 2JH6D 4U01A 1N6YA 3SU0A 3QTOH 1O2NA 2Q6DA 1WXRA 3FVFB 4UFGH 4Z6AH 1LHCH 1SKYE 4AZ2B 4NIXA 2ZO3H 2BD4A 1L4DA 3SUDA 4NZQA 3Q76A 4O03A 5CMXH 4XDEA 2O8WA 2PKAA 3M5LA 4K1EA 2W3KA 1AMHA 1NS3A 4GSOA 1W10U 2ZG0H 4WJG2 1K1PA 1SI5H 3H7OA 4X2WA 3RXTA 2F3CE 3GY7A 2A7HA 4IMQA 2WHXA 4NSYA 4R8TB 3F2FA 1RTFB 2A5AA 4TSFD 5FPTA 5EIYA 4A7IB 1NRPH 3A7YA 4ISLA 1C4Y2 1MBMA 1V2KT 3PWCA 2PSYA 1TBZH 1TX8A 2WV9A 1GBEA 2KAIA 1ANEA 3LH3A 2JJ1D 1YCPH 4GCHG 2WPKS 4IBLH 4CBNA 1IOEA 2BD8A 1QGFA 3AK5A 3AAUA 1L1NA 1UHBB 3GY2A 2FI3E 1SOZA 1ELGA 3T29A 3ZZ5A 2OINA 3DHKH 1LQEA 2O8TA 4MTBA 2SGPE 1N6XA 1DUAA 2D2DA 3BEIB 4RN6A 1HB0B 1V2UT 1EPTC 3BTKE 3VGCC 5GNDA 3TH2H 1LHFH 1IHTH 1P2IA 1NC6A 3LC5A 1GMDF 4I32A 1O3IA 1E35B 4D7GA 1E1RD 1O3EA 3S9CA 2Q6GA 3E91A 4ABJA 3RXEA 2Z94A 3SZNA 1HGTH 3PV2A 4AG1A 4ACBA 1ESBA 1GBMA 1LHDH 2LPRA 5EW2H 1SB1H 2OD3B 1P06A 5DP4A 2BXUH 3LGIA 3SU4A 1AE5A 3PB1E 3SJOA 1BTPA 4KP0A 1UVSH 1ZRKA 4BANB 1S6HA 4NWLA 4CRAA 1F0RA 1BTWA 1BUIA 3UY9A 1PPBH 1BRUP 1DY9A 2ZQ1A 3ZYEA 2KR7A 1VJAU 1OX1A 2PP6A 3KQBA 2ZFFH 5ESBA 1TYNA 1G30B 1HNEE 2EI6A 3A87A 4BXWA 1P04A 1O2SA 1A2CH 1QL8A 3DSGA 1TRNA 1RGQA 4JYTA 2A4RA 2ZPQA 3ZYDA 1D6WA 1WV7H 3LH1A 1F2SE 1GVKB 3BTWE 2BY8X 1XUIA 1SQOA 2P8OB 1AVGH 1K1LA 2BX4A 2J9NA 3DD2H 1ZHPA 3MHWU 2G00A 4Z1MD 2Z3CA 3C1KA 3M3TA 1QJ6B 1LDTT 3ZZ7A 4YOJA 1SGRE 4PROA 4WH6A 3HK6B 2GT8A 1TPSA 4LK4A 5L6NH 1ELDE 1O3CA 1RRKA 4B1TA 1JIRA 1Y59T 3CNRA 5JBAS 1IQLA 1GGDC 1DWBH 1JIMA 1FIZA 2XXLA 1W11U 4R0IA 1QBVH 5E0GA 3FP6E 1BTXA 4J1YA 1BA8B 1ZSJA 1B0FA 4I8JA 2WSSD 4YOGA 3RU4T 3RXAA 2FOGA 3SJ8A 5FXLA 1YCPK 1IQJA 3V12A 1DWCH 1MKWK 2Y82A 4B76A 1K28D 1Y3XA 3TK5A 4AYYB 4DURA 1V2TT 2EI8A 3BTEE 4M9FA 1RFNA 4B75A 5EJ1A 1TBRH 3SNEA 2UWPA 5EGMA 1K1JA 1P2NA 1KXCA 2CMYA 1AN1E 5LPEA 3DFJA 4UFDH 1WOFA 2XBYA 2IJD1 1C4U2 2ZU1A 1G37A 2PLXA 3M5NA 4Y7BA 4ZXYH 5SGAE 3HGPA 1ELBA 1O37A 4YTAA 1DSUA 1CHGA 3F9HA 1TA2A 2PTCE 4I8HA 3TGKE 1HXFH 3EA7A 1C2DA 4I8GA 2RA0A 1ELCA 2QC2A 3PMHB 3URCA 1O3NA 4KKDA 2FTMA 1FY1A 4QT8C 5K0HA 1P3EA 1C9PA 1QFKH 5DP5A 1SGFA 3QTVH 1AQ7A 3ZVEA 1P02A 1GBCA 4KTCA 4X6NA 5HKKD 5LGOA 2WYJA 3QWCH 1F5KU 1CGIE 2PGQB 1KXFA 1KTSB 1DX5M 1DXPA 1AB9C 1J14A 1QA7A 1H9LB 2FOFA 2BD5A 1CT0E 3ZVFA 2NWNA 2TBSA 2V3MA 2ZU4A 2QIQA 5C0TA 1P10A 3B8JA 1YP9A 1UK3A 4IC5A 5FCKA 1ZR0A 1AHTH 2XC4A 1ZTKA 4ZKNU 1D3TB 3WY8A 5L2ZH 1PPHE 4ZXXH 3UAIC 1NFYA 1C5YB 3ZZCA 1HJ8A 3LU9B 5FPYA 3H7TA 2IPQX 4CRFA 1BRBE 5A09A 2VJ1A 3KL6A 4Q4LA 4CRDA 3A8AA 3NRLA 1CSOE 2BQ6B 1C1VH 4NWKA 2V7QD 2OP9A 3S7KB 3SI4H 1J8AA 2FIRH 3T2NA 3U69H 1JMOH 2P3TB 3UNRA 3QLPH 1P9UA 5B6OA 2BDAA 1GWAA 4X6OA 1W0KD 2K8IA 4X8UH 2BY5X 2BVRH 4ZHMU 2M5TA 1ANDA 1Z8IB 1PFXC 2R3UA 7GCHG 3STJA 2ZFPH 4K8BA 4D76A 2RDEA 3SV8A 4DGJA 1YF4A 2R0KA 3E0NB 1QRZA 1C1OA 4WMEA 3PO1C 1VR1H 2F83A 1PPEE 4ZKOU 2HVXA 4K60A 1TRYA 2B5TB 4UFFH 1ZTLA 5GWZA 3P8OA 1GCTB 4GAWA 2BDIA 1QB6A 4OM9A 4H6TA 1TGNA 1GI5A 1GJDB 5PTPA 2BTCE 2ANMH 2THFB 2WPJS 6CHAB 3ZV8A 1BQYA 4YT7H 2STBE 2PKSB 1WQVH 1ORFA 1FJSA 1O2YA 4A92A 4Y79A 2BDHA 1KXBA 5JPMH 1QY6A 4OS1A 1UW7A 1GHYH 1DICA 3MU4A 1BCUH 4X1QU 4OS5A 1Z1IA 1BITA 1CE5A 1ZMNA 2C8ZB 3B9FH 4JK6A 1QL9A 1ZLRA 2ILNA 5AVDA 3V3MA 4ABAA 4X2XA 1ZSKA 3O8BA 1G2LA 3RMNH 1TGCA 2WUCA 1S5SA 3LPRA 4B2AA 2PUQH 1TFXA 4AGKA 1D3QB 5EXMA 5ESTE 3RUOA 2CXVA 4B71A 4INHA 2PV9B 3F2HA 2VBCA 3ITIA 2Y7ZA 3HGNA 1H4WA 2BOKA 1WTGH 1Z6EA 1CU1A 1K9OE 1D4PB 1HBTH 2Z9KA 1O3JA 1U6QA 2BQWB 4AFUA 4AFQA 1ELFA 3FN8A 3M61U 4YZUA 1HLTH 4XOJA 1MKXK 1DANH 4ZROA 3OU0A 1VZQH 1W13U 5GJ4B 3ZIAD 1S85A 5J4SA 3OEED 2ZCKP 1S6LA 3BTTE 1AIXH 1J15A 4M7GA 5J4QA 3SV6A 1P8VC 5FCRA 1GBBA 1SGQE 1Y3YA 2EC9H 3I29A 3V7TA 4DW2U 5C0UA 2VIQA 3RU4D 5FAHA 2HVYB 5C1YA 3RXLA 2H9EH 4ZCNA 2EQNA 3A7TA 3QZRA 2C4FH 3K6ZA 1FONA 1YPKH 4NIYA 6GCHF 1C2KA 2XRCA 3A8BA 5HM9A 1ZGVA 2ZTZA 2ZU5A 2BMGB 1UCYE 1HJ9A 1K1MA 4ISHH 2A4QA 1P3CA 1C1NA 4KTUA 1V2PT 2ZKSA 4Q80A 2I6SA 3TGIE 3RXOA 4LZ4B 4O3TA 2RFKC 1THSH 4K69A 2NU4E 4INKA 1V2OT 4F49A 1AWFH 4F55A 3RXMA 3H5CB 1A0LA 2RG3A 4AFZA 2V35A 5AFYH 1C2EA 4FU8A 5GCHF 2Y7XA 4CRBA 1BTZA 2SNVA 3W95A 2WYGA 4Y8ZA 2AIQA 1GHAG 2FOMB 2A2QH 2ALVA 3MH4A 1GHWH 1MQ6A 4XE4A 3SV2H 2DE9A 2Z9GA 1O2LA 1QQUA 2JDID 1VGCB 2BX3A 1C1MA 4IGDA 1CHOG 1TOMH 1FY3A 1MMJN 1Y5AT 2O8UA 3PM3A 3RLWH 1BHXF 1OSSA 2AS9A 2KZ4A 1ZTJA 2AGIX 3PRBA 2AYWA 3RC6A 2CHAC 1ANCA 5E0JA 4ZHAA 1EX3A 1TPAE 2ZHQH 3EGKH 3ZVBA 2A0QB 1EZSC 2VB0A 2VIPA 3OE7D 3BIVH 4AX9H 5DK1A 2B9LA 5I46H 4DVAU 1GI9B 3LDXH 1WQSA 1TA6A 3MH5A 1G3EA 3W94A 1CA0C 3KHVA 1V3XA 1ZPCA 1PQ7A 4JCNA 4O3UA 2QF3A 2VIVA 5T6DA 1TQ7B 2FWWA 3ATLA 1SGIB 3TVJB 1A3BH 1UCYK 1Y5UT 2C8YB 1A0HB 3SN8A 2BM2A 3Q77A 2FPZA 2AMQA 2GCHG 2VIDA 2KCAA 1C2FA 4WVPE 1MD7A 1W12U 1O35A 2AMPA 2G52A 3IWMA 1EPTA 1FDPA 1JWTA 3GCHB 3PRDA 3A8DA 3PMAB 1C1PA 1CHOF 5HM2A 1C5UA 1LVBA 1ZPZA 1DVAH 4AN7A 1Y8TA 3RXCA 1KXAA 4CR9A 3RXDA 3RM2H 4RKJB 2FEQH 1LPKB 1GDNA 3H09A 4LOYH 3SBKA 3EDXB 2IJOB 3AAVA 1ETSH 3FP7E 1TMUH 4WXIA 1EP6A 1QNJA 1FPHH 1SVPA 5CDFE 2HWLB 2PGBB 1YLCA 3GY3A 2EY4C 3KQDA 4RT1A 1S81A 3GY4A 3LJOA 2JIZD 1O5CB 3KEEA 1WU1A 2JJ2D 2GD4B 5G4BA 4RSPA 4XSKU 1GHBG 1O3KA 4GLYA 3SW2B 3KN2A 1BMAA 3ZV9A 1AGJA 1BBRE 2TGAA 2ZU2A 3L6PA 1E38B 3PLPA 4JZFH 1WBGB 2LELA 1O2HA 4NIWA 4BTTB 5EXLA 1TPPA 1MBQA 4UONA 2BLQA 1V2WT 2TPIZ 3VB6A 2C8XB 3RP2A 3K65B 4DIHH 2VNTA 4D8NA 3SJ9A 2IOTA 1FY5A 4FVDA 3T26A 1MUEB 3SOSA 3PTBA 8GCHF 2R2MB 1V2ST 1S82A 2JH0D 5C1XA 4CR5A 3GY6A 3VB3A 5BPEA 2ZHDA 2ANWA 4ABDA 3SU6A 2C3SA 1AY6H 2BHGA 1O5AB 1XVOA 4X2YA 1OKXA 1W0ZU 5EQSA 2H5DA 1VCQA 2KCYA 3P6ZB 1RD3B 3LKWA 1GBJA 1EOLA 1W14U 3OSYA 1QHRB 2V6NA 1GPZA 1VITF 3P8FA 1MU6B 2YOLA 3S69A 4DG4A 1HAOH 1W8BH 5GPIB 1AKSB 5E2OA 1GDUA 1TOCB 1AFQB 2FZZA 3A86A 2HALA 3GDUA 3SGAE 1KLTA 1QJ7B 2A7JA 1GJ6A 2FP7B 4GCHF 5H4IB 1SGFG 5LPRA 2RA3A 2VVVA 1SPJA 3EQ0H 3TLOA 4MPWA 1P12E 2XNIA 5T3HA 2GCTB 2QN5T 4ABGA 1WSSH 3QZQA 3SHCH 4CBOA 2KAIB 1ZHMA 1XUKA 1YPJH 2J94A 5F8TA 1O5BB 1YWUA 2I6QA 4CHAC 3UFAA 1MCVA 2XBWA 3BN9A 3A7ZA 3JZ2B 3T28A 3EAJA 4DJZB 5K7RA 3NUMA 1EJMA 4WMDA 4WY3A 3TH4H 4F4OC 1NFUA 3OAAD 1TABE 2FOBA 2WUBA 2ZIQH 1W3CA 4RKOB 2G5VA 2J4IA 3Q3YA 4ACAA 1GMDG 4YOIA 5F6MA 3MWIU 3M5MA 1P9SA 2QA9E 1LKBA 1OYTH 1ELTA 1ZMJA 2OLGA 1THPB 2BLWA 1ID5H 3URDA 4X6PA 2BB4A 3F0OA 1UO6A 1GI4A 2Z3DA 1AVWA 2R3YA 3OYPA 4MNWA 2NU3E 1A3EH 1V2NT 5C5OA 1E36B 1SLVB 1XUFA 1Z8GA 2ODPA 1Q31A 2F43B 2VINA 4X8VH 1H8HD 1QA0A 5CHBA 1GI6A 2ZDMA 1GMCF 1Y3WA 1AWHB 5GIBA 1Z71A 3FAOA 1C5QA 1K2I1 4KTSA 1O5FH 1Z8RA 1P2KA 4ABEA 2HLCA 3KNXA 4ZKSU 1FXYA 2RCEA 1PQ5A 1DSTA 2GMTB 2LNCA 2FDAA 3ZZ4A 2P94A 1GJAB 2W26A 3N7OA 1K0HA 3P70B 2F9OA 4TWYA 3TJNA 1A7SA 2Z3EA 5HXFA 2KCOA 1S83A 4YO9A 3TJOA 3RMMH 1H8ED 4D9QA 3N99A 1AUJA 2SGAA 1GG6C 2FI4E 2F9PA 3UNSA 3A7XA 4Y6DA 1NU9A 1XVMA 4Y8YA 1O38A 1O2PA 3HATH 4FU7A 2HOBA 1RS0A 1P2OA 4B2CA 2ZDVH 2ZU3A 1HAVB 1QB1A 3SJKA 1MTNB 1UHBA 2A1DB 1NU7B 1TNHA 1JXPA 4X1NU 4NGAH 3TJUA 1P03A 2K0QA 2QE7D 4NZLA 2FESH 1BBRK 3RXHA 2A2XH 2XBXA 1C2HA 2QXGA 1YGCH 1MTUA 1SGPE 1C1TA 2VH0A 2FI5E 1CA0B 2ANKH 2QF5A 3FZZA 5GCHG 5DP3A 2FS8A 4CRCA 2AEIH 1O2ZA 2HNTE 4THNH 1ZGIA 2UUYA 1GJCB 3MH6A 2ZFRH 5TJXA 2FOCA 1LQDB 1AD8H 4TWWA 2OBOA 1SOTA 4X1SU 1BRCE 2ZPSA 3GOVB 5IK2D 2SGDE 2UUJB 2C8WB 4Y0YE 1MAYA 2KM0A 5A8YA 2O8MA 1RTLA 2NU2E 4X0WU 1FIWA 4FUDA 3TGJE 4BAOB 2CV3A 2P3FH 4CREA 4BAHB 2Z9LA 4FUIA 1EJNA 3M7UA 3QK1A 1UMAH 1HAVA 2OCVB 4IC6A 4NA7A 5KGOA 2UWLA 2W7SA 4FVBA 5DP8A 3SI3H 2QXJA 1AI8H 1CT4E 4AG2A 3I77A 5DO4H 5F03A 2FLRH 1QL7A 2ZFTA 1ZOMA 1O0DH 1G36A 5HIYA 6CHAC 2W6JD 3BF6H 4FUFA 2XC0A 4A1VA 1EB1H 1Z7KA 1OYQA 3NWUA 4WF8A 2D1JA 2F9VA 1H9HE 1OHHD 4I86A 1CGHA 1TNJA 1IQKA 2AFQB 2PHBA 4DT4A 1GI3A 2F4LA 2FLBH 4WMFA 4ZHLU 3U9AH 1GI0A 1F0TA 2QXIA 2XWAA 1EJAA 2CN0H 3M7QA 3UR6A 1C5WB 4TYDA 3MO6A 1CT2E 1EXFA 1TE0A 3VEQB 4YM9A 4MDSA 1XUJA 1ZHRA 3DSPA 1A4WH 1YPMH 1HAGE 3PLKA 3ENSB 2R9PA 1T8OA 3D23A 1ETRH 1V2QT 1MZDA 2AH4X 5JB9S 3M35A 4I31A 2WINI 4U32A 3A8CA 3F0PA 2ZNKH 1ETTH 5DP6A 3GISB 1A46H 1C5NH 2J2UA 2YNAA 1C5MD 2A5IA 2Y80A 5JBBS 4K5ZA 1FI8A 1BBRH 5B6LA 1O30A 3RM0H 1ACBE 2FOEA 1A5GH 3P95A 1F5RA 1YPHE 2UUFB 3NPSA 3K2UA 2J97A 2O8LA 3P8GA 5FHTA 5A0AE 2KX4A 2Y5HA 2BZ6H 1MTVA 3RMLH 2J5UA 1UVTH 1NRRH 4FUHA 3RXKA 1QRWA 3O8CA 3S9AA 3SO3A 1O3AA 3V0XA 5EU8A 1P09A 1ANBA 1G32B 3EE7A 1C2JA 4ASUD 3SU5A 1UTQA 1TGTA 2BD9A 2GJGA 2J98A 3EA8A 1C1SA 1EOJA 2PSXA 2P95A 5ABWA 1PQAA 2IN2A 2ZEBA 2Q1JA 5FX6A 1EATA 1QBNA 2OTVA 1HCGA 5JDUB 3KIDU 1C5SA 3C27B 3F3BA 5DKMA 3Q3XA 3QGJA 1EKBB 1TMTH 2GT7A 1GCDA 2A45B 2M2AA 3RU4E 3L3TA 1FLEE 4NSVA 1DS2E 4DT7B 1O5GH 1V2MT 3BTDE 1O2UA 3UWIA 1Z8JB 5C67A 1AFQC 4JYUH 2G4TA 5HIZA 1XMNB 4ABIA 2KCPA 1MAXA 4BOHA 1OWIA 2JETB 2PKSC 2V0BA 4YLUA 4HGCA 4K1TA 1V2VT 1TNLA 4XBBA 2OQUA 3DSOA 3RXUA 3BEUA 4I33A 3NKKA 1W7GH 1GHBF 3FP8E 7LPRA 3U1IB 1FQ3A 3RXFA 4CHAB 2J38A 2BDYA 3QX5H 4H42U 1XUGA 1OP0A 2QGRA 2VWNA 1L2EA 1O2IA 4ABBA 1IQGA 1MABB 1O39A 5A0CA 4HI3A 1SLWB 1VKYA 5C20A 1CBWC 1D3DB 1YKTA 1GI2A 1RIWB 2C93B 1SGNE 2TIOA 3M3VA 3LJJA 1ELEE 1NESE 4UFEH 3UOUA 1GCTC 1FV9A 3KYFA 3N7EA 1G3BA 1OWHA 2VVCA 2YMSD 1AU8A 4ISOA 3FO8D 3M7TA 5BRRE 3D49H 3HK3B 1J9CH 1EB2A 1DLKB 5E2PA 2A4OA 3RXQA 4ABFA 1XM1A 2ZGJA 1O3FA 3ODFA 1MD8A 1YM0A 2OQ5A 1N8OB 1XKBC 1O2TA 1GJ4H 1BMLA 4NA9H 1V2JT 1UK4A 4BTIB 2D8WA 4H6SB 1SHHB 1NO9H 1ZYOA 2ZP0H 3LONA 2AMDA 4JZEH 4K3JA 3SNAA 3KYGA 3SUEA 1GJ8B 3GY5A 2BD3A 4Q7ZA 1MZAA 2P3UB 3ATIA 3M5OA 1T31A 3GCHC 1AZZA 1A1RA 1OXGA 1YYY1 2PTNA 4ZUHA 1C2MA 2VIWA 2P93A 2WV4A 3PMJA 5C5NA 1YY3A 3MI4A 3SU1A 2ODQA 4FUJA 3FFGA 4TPYA 1O2XA 2J98B 3BSQA 2YMSC 1BJUA 2ZDAH 2W6ID 1COWD 3TIUA 1TLDA 3TNTA 1GJBB 1AE8H 1G3DA 5JBCS 3AASA 3LGUA 4BXSA 1SQRA 1O2WA 1KLIH 4OS6A 1E34B 3FKSD 3F6UH 2ZFSA 3OFND 3OY5U 1UK2A 2VH6A 2FMJA 4BAMB 1SBWA 4B73A 2ZCLP 3U8TH 1SG8B 3BIUH 1D6RA 1PPGE 4YT6H 2Z9JA 2H2ZA 2ULLA 2V3HH 1C1WH 1EASA 1FY4A 2XYAA 1K1OA 4YESB 9ESTA 1GMCG 1Y3VA 4HFPB 1FNIA 1F0UA 1BHXB 2NU1E 3VB5A 2WPMS 4NFEA 5C1UA 2ZA5A 1MKWH 1MQ5A 3BTHE 3OTJE 2QY0B 3A84A 2BOHB 4U2WA 3K6YA 1ZPBA 2BLVA 4K8YA 1P2QA 2FODA 2FOHA 3D65E 3TITA 1UTNA 3K9XB 4TY7A 4XD7D 8LPRA 1NRNH 1IHSH 3BTGE 5JBTA 2ZC9H 1TQ0B 5L2YH 1HAYB 1P11E 1L0ZA 1CBWB 1ESAA 4KGAA 4Y11E 1RIWC 3ATWA 4NCYA 6LPRA 1T8LA 1SSXA 1PPCE 2D26C 2JH5D 3T62A 3CS0A 1EZQA 1QBOA 1HV7A 3SV7A 2FS9A 2WZQA 2HRVA 4MPUA 1OWDA 2TGDA 5C2ZA 1UTPA 2ZECA 1KMHB 1GJ9B 2F9NA 2JKHA 2B0FA 1JRSA 6ESTA 2GMTC 2BDCA 3RXRA 1NT1A 1QQ4A 8ESTE 1C2LA 1O2QA 3E6PH 1B5GH 3EYDA 1NZQH 3SGQE 4OGXA 2GX4A 8GCHG 5CHAC 3SU2A 3M36A 3LOXA 3A80A 1GDQA 1VITH 2ODYB 4FUGA 3PMBB 4F48B 1DUEA 4JK5A 2BXTH 3BEFB 2Y6TA 4UDWH 1ESTA 3D62A 3SORA 1MTNC 1C5XB 3T5FH 4FXGH 1YPHC 1ZRBA 2NU0E 4HG6A 1IQNA 4DY7B 1LTOA 1HYLA 1IQEA 1G2MA 1F92A 3VB7A 3MQKC 3GCTG 1HIAA 2EEKA 1EAXA 2Z6BD 1YPEH 3STIA 1O33A 3NK8A 5A8ZA 1PQ8A 2XCNA 3MU1A 4ZH8A 1C5TA 3F9GA 1FY8E 2QCYA 1MU8B 2TGPZ 3FANA 4TT3D 1P05A 1SGEE 1C1QA 2CK3D 4CRGA 1C5OH 2AERH 2PUXB 5AF9H 2F9UA 4AGJA 1DWEH 3WW7A 5DJ7A 2ZQ2A 1BRAA 3PROA 1WUNH 1LVYA 1PYTD 1HAHH 1DWDH 1A5HA 3ATKA 5EOKA 4Q7YA 2ZGXH 1C4V2 1B7XB 5JYIA 3NXPA 1PPZA 2XOKD 7GCHF 4WH8A 1O2VA 2PFEA 4I8LA 3BG4B 1YLDA 2C90B 4AFSA 4MVNA 5KECA 2B8OH 2GDDA 3OY6U 1C2IA 4GPGA 2GP9B 1MCTA 4B74A 4B6EA 2F91A 4ABHA 2Y81A 3UNQA 3RXSA 1J16A 1C5LH 4NIVA 3RLYH 3A7WA 4JZDH 5JB8S 4I8KA 3GYLB 1O2GH 2QAAA 1H8IH 2ZI2H 3DT0H 1SFQB 4U30A 1C1UH 1ZZZA 5FX5A 5DP9A 4E7RG 5C94A 1T7CA 3GY8A 2BD7A 5DG6A 1HJAB 3E0PB 3P8NA 1O3MA 1TNGA 3VGCB 2AGGX 3I78A 2G8TA 3KQEA 1QR3E 2GCHF 1XXDA 2EA3A 3KF2A 1OP8A 4FUEA 3MTYA 3HKIB 1O5EH 5IDKA 1EQ9A 3OX7U 1XKAC 1DM4B 4Z0KA 1TAWA 2PW8H 3IG6B 2SGFE 3GICB 3SV9A 3KCGH 4GUXA 3O8RA 1NBME 3GS9A 3MFJA 3U8OH 2W3IA 1GI7B 1DOJA 2V3OH 2VWMA 3WWBA 1AFEH 4D9RA 2BZAA 2AIPA 2CF8H 2A31A 1HAIH 3RXVA 2L6OA 1GHAF 1A61H 3BTFE 1QRXA 1UVPA 3ZVGA 3PYHA 4DIIH 5DGJA 1B0EA 3DA9B 4TPIZ 1FZZA 1F7ZA 1NM6A 1GI1A 5FPSA 1DITH 1GBKA 2FOAA 1UVUH 2YNBA 1PPFE 3VXEH 3BG4C 4DCDA 1HAPH 2ZDKA 5EQQA 2CHAB 1ARBA 1NTPA 1V6DA 3LGWA 2VWOA 2ZGBH 1DE7H 1OS8A 3F9EA 5HMAA 1P2JA 2WPIS 2GGVB 1EP5A 1ARCA 3E1XB 3MNXA 5DP7A 1SL3A 1BB0B 1UTJA 2BQ7B 1JBUH 4FU9A 3V13A 3ZZ8A 5LPFA 5EPNA 1GHZA 3G01A 3LGTA 3RC4A 1FAKH 1TX6A 3A83A 4Q7XA 1BTUA 2GZ8A 4HZHA 4Y76A 3P92A 3VPKA 1QURH 1QCPA 4XBCA 4NA8A 1GGDB 2G55A 1SGDE 3FZDA 4X2VA 1HAXB 2KFWA 3ZVDA 1C5RA 1O5DH 1H1BA 4J2YB 1NROH 1S6FA 3TPIZ 1THRH 1D3PB 3MU5A 1XX9A 3A82A 4ESTE 2H9HA 4B2BA 1O3GA 2A5KA 4A5TS 2UWOA 2H1UA 6GCHG 3L33A 4MG3A 1FN6A 2QYIA 1JOUB 4ZMAH 4TY6A 1INCA 1MTSA 3QN7A 4ASHA 4AB9A 3UQVA 3QO6A 2WPLS 1EAUA 1GMHF 2JETC 3UIRA 3LGVA 1HAZB 2XNDD 2HPQH 2XBVA 3MNSA 1GJ5H 1P2MA 1GL0E 2VWLA 4MNXA 3MYWA 1SMFE 5F53A 1O2JA 2Y5GA 1HRTH 2PKAB 2ZGHA 2BDGA 2H9TH 3UOPA 3ZZDA 1T4VH 5EXNA 2P59A 4A1XA 1NFWA 1BZXE
chains in the Genus database with same CATH topology
5AFZH 2O9QA 3MU8A 4JZ1A 3AW1A 4MNYA 1HFDA 1W7XH 3NZIA 3S7HB 2OC0A 4XBDA 4E06H 1KDQA 2G81E 3TU7H 1AVXA 2PR3A 3T25A 5EW1H 4A6LA 1CO7E 1LKAA 1Z1JA 3PTNA 4ZAEA 1SR5C 1Y3UA 3ZVAA 1O32A 2SGEE 1IQFA 1WTHD 1EPTB 4AB8A 2AGEX 1E0FD 1TWXB 3GYMA 2K1QA 1TONA 4AOQA 2FTLE 3GCOA 3GCTF 5HGGA 1FPCH 1SFIA 1BDAA 2SNWA 4WWYA 5HYOA 3DFLA 3SUGA 1GVZA 3HPTB 2UUKB 1AKSA 2STAE 1SGCA 4IMZA 1UTKA 2CF9H 3R3GB 1F0SA 1DFPA 1SGTA 1P0SH 5I25A 4XFQA 2ZFQH 1O3OA 2H6MA 2BVSH 4OS4A 3SNBA 3UTUH 1RXPA 3RDZA 2ZDLA 2GCTC 1S0RA 2XW9A 4E05H 4Q2KA 1DLEA 3CP7A 1FMGA 1LMWB 1LO6A 4Y0ZE 5F8XA 4UE7H 4SGAE 7KMEH 1BMMH 2A7CA 4X6MA 2IPHA 1KYNA 4UEHH 1T32A 4BAKB 1C2GA 2ZHEH 4FUBA 1V2LT 4IN1A 4E7NA 5IYTA 2ZHFH 2WV5A 4KELA 1N8OC 2G5NA 1NFXA 3F9FA 3RC5A 1O3LA 1OWJA 2BLOA 3UPEA 2H5CA 3M3SA 3ZVCA 1O3DA 1SHYA 2ZTXA 1FN8A 1TNIA 2OBQA 4MPXA 1DPOA 3MU0A 4I7YH 5A2MH 4NFFA 3SNCA 2XC5A 1KXDA 4Y71A 5AHGH 1QJ1B 1MH0A 1XUHA 2TRMA 1ZSLA 4MNVA 4Y10E 1O2RA 5A0BA 1YPGH 2BY7X 3RMOH 3CS7A 1Q3XA 3S9BA 1E37B 4JMYA 1S84A 3O8DA 1G3CA 1MTWA 1JRTA 1OP2A 1OWKA 1IAUA 1QB9A 2XTTB 1PYTC 2ZZUH 2ESTE 4CH2B 1LHGH 1TGBA 3PO1B 5A8XA 4DOQA 2P8OC 5TCCA 1LPZB 1Q2WA 4HTCH 3ZZAA 5TCAA 3T27A 3A85A 4LXBH 2R0LA 4SGBE 1BTYA 5FBIA 4INLA 1O36A 2OC7A 2W7UA 1BMNH 2ZDNA 1PJPA 1LVMA 1BT7A 1TB6H 4AORA 4D7FA 1BIOA 1OWEA 2BVXH 2VIOA 2FXRA 1H8DH 1NRQH 2R2WU 1F5LA 3E90B 1BTHH 2FX6A 1VCWA 1A0JA 1OOKB 3CENA 4X8SH 3S0NA 1TIOA 2Y5FA 2HGTH 2ZTYA 1YC0A 2CGAA 3JZ1B 3TK9A 1DT2A 1ELVA 2CJIA 1W0YH 1C1RA 2TGTA 1EZUC 1NPMA 2BDBA 4GHTA 1TALA 1NN6A 3ZZBA 1O2MA 1O34A 4NG9H 3MNCA 1CQQA 1O31A 3ELAH 5T6GA 3VB4A 3VXFH 1O2OA 1XXFA 2OC1A 3AW0A 3U98H 3SHAH 7ESTE 2OXSA 3U8RH 5E8EH 3UQOA 4JZIA 3UUZA 3BTME 2ZF0H 4X1RU 4OS7A 5T6FA 2PWXA 4IW4E 2ANYA 1A5IA 1GBLA 4AYVB 1DY8A 1FUJA 5C3NA 1N1LA 1J17T 2HNTC 3ESTA 2J92A 2GDEH 3LT3A 4GVUA 2A32A 1SC8U 2OUAA 2GV7A 4GHQA 1K21H 4O9VA 1KY9A 2FYQA 3AVZA 1EAWA 5F8ZA 3SQHE 3EE0B 2QF0A 2ZCHP 1TMBH 3Q3KA 4A1TA 1EUFA 3KQCA 4MQAA 1IQHA 1DXWA 2GVFA 1ABIH 2FX4A 1SLXB 2GZ7A 1IQIA 2BY6X 4X8TH 5EPYA 2F9BH 2FM2A 1D9IA 5CE1A 1LVOA 1P57B 3DUXH 3E3TA 3NCLA 3ZZ9A 2ZWLH 5CHAB 1GHXH 4ISNA 2GZ9A 1AB9B 1GBDA 3UREA 4BNRA 1RTKA 1QIXB 1K1IA 2XCFA 3E16B 1UTLM 2QV1A 1GBIA 4Y8XA 2VU8E 2HPPH 1P01A 2ASUB 2VVUA 1CGJE 2BYAX 3QUMP 3QGNB 1GVLA 2J95A 4X1PU 1G9IE 2P16A 3RXJA 5DPAA 2ZHWH 1GL1A 3Q00A 3PLBA 5ETXA 1VCPA 9LPRA 3SUFA 1ZJDA 3KGPA 3TH3H 1KDQB 4K1SA 1GI8B 4WXVA 3GDVA 1HPGA 1TNKA 2FYRA 3UWJH 2EI7A 4K2YA 1BJVA 1C5PA 3F1SB 3A89A 1KSNA 3LIWA 5EQRA 3MNBA 1VITG 3MO9A 3LGYA 1V2RT 3M37A 3A88A 1TRMA 3UR9A 4MLFB 1GHVH 1Y5BT 1WYKA 1ELAA 1UTOA 1C5ZB 1O2KA 4YLQH 4VGCB 1VJ9U 1WCZA 2BD2A 1DDJA 1UJ1A 3EA9A 1QTFA 4ZKRU 5FBEA 3SQEE 2Z9IA 2QXHA 3ATMA 2VGCB 2B7DH 4FUCA 1RJXB 1Z6JH 3P17H 1TBQH 3PWBA 3VFEA 1YCPM 4IS5A 5LH8A 2GV6A 2GTBA 3RXGA 1K1NA 3MMGA 1HJAC 1GG6B 3MO3A 4BTUB 1T8MA 1HDTH 1L4ZA 1LHEH 3GCNA 1GBTA 4ISIH 5GXPA 1HUTH 1WAYB 3RXBA 1BOQA 2SGQE 1O3PB 1MKXH 1O3HA 1YBWA 1EAIA 3GDSA 3SGBE 4MPVA 2G51A 4OS2A 3A81A 2BY9X 1LCYA 1TPOA 1C5VA 3QDZB 3SU3A 1SGYE 2J34A 3BV9B 1GBHA 1L1GA 1UTMA 5GDSH 8KME2 1SLUB 1AO5A 4CH8B 2ZGCA 3BTQE 1NRSH 3SNDA 1L1JA 3MOCA 5L30H 4LZ1H 1T4UH 3TNSA 2DUCA 1GMHG 1ZJKA 3F68H 1HIAB 1ABJH 1K22H 1SQTA 1UCYH 1X7AC 4O97A 1LPGB 1SQAA 4JYVH 1O3BA 2FO9A 4H4FA 3TJVA 2Z7FE 4IN2A 2ALPA 3ODDA 1UVOA 4Y7AA 1GJ7B 2DE8A 2Q6FA 2A4GA 2GKVE 1TGSZ 3HKJB 5E0HA 1S0QA 4VGCC 1KTTB 1KLJH 1YPLH 2HNTF 5EODA 2RDLA 5EG4A 1FAXA 3E8LA 3B23B 1EZXC 1AUTC 1KXEA 1AZ8A 1W2KH 3SJIA 1HXEH 3RXPA 3PV4A 3TK6A 1CA8B 1VGCC 2VGCC 2OC8A 1IQMA 1TX7A 2ZPRA 4BAQB 2WPHS 1M9UA 1NY22 1KIGH 3A7VA 3BG8A 3ZZ3A 1T8NA 1GBAA 3RXIA 3LC3A 3MH7A 1H9IE 4UD9H 2XWBI 3R0FA 3ZZ6A 1C9TA 1OPHB 2G4UA 1GBFA 2W5EA 4OGYA 1ZMLA 1CVWH 3IITA 3U1JB 2SFAA 2JH6D 4U01A 1N6YA 3SU0A 3QTOH 1O2NA 2Q6DA 3FVFB 4UFGH 4Z6AH 1LHCH 4AZ2B 4NIXA 2ZO3H 2BD4A 1L4DA 3SUDA 4NZQA 3Q76A 4O03A 5CMXH 4XDEA 2O8WA 2PKAA 3M5LA 4K1EA 2W3KA 1AMHA 1NS3A 4GSOA 1W10U 2ZG0H 4WJG2 1K1PA 1SI5H 3H7OA 4X2WA 3RXTA 2F3CE 3GY7A 2A7HA 4IMQA 4NSYA 4R8TB 5FPTA 1RTFB 2A5AA 4A7IB 1NRPH 3A7YA 4ISLA 1C4Y2 1MBMA 1V2KT 3PWCA 2PSYA 1TBZH 1TX8A 1GBEA 2KAIA 1ANEA 3LH3A 1YCPH 4GCHG 2WPKS 4IBLH 4CBNA 1IOEA 2BD8A 1QGFA 3AAUA 1L1NA 1UHBB 3GY2A 2FI3E 1SOZA 1ELGA 3T29A 3ZZ5A 2OINA 3DHKH 1LQEA 2O8TA 4MTBA 2SGPE 1N6XA 1DUAA 2D2DA 3BEIB 4RN6A 1HB0B 1V2UT 1EPTC 3BTKE 3VGCC 3TH2H 1LHFH 1IHTH 1P2IA 1NC6A 3LC5A 1GMDF 4I32A 1O3IA 1E35B 4D7GA 1O3EA 3S9CA 2Q6GA 3E91A 4ABJA 3RXEA 2Z94A 3SZNA 1HGTH 4AG1A 1ESBA 1GBMA 1LHDH 2LPRA 5EW2H 1SB1H 2OD3B 1P06A 5DP4A 2BXUH 3LGIA 3SU4A 1AE5A 3PB1E 3SJOA 1BTPA 4KP0A 1UVSH 1ZRKA 4BANB 1S6HA 4NWLA 4CRAA 1F0RA 1BTWA 1BUIA 3UY9A 1PPBH 1BRUP 1DY9A 2ZQ1A 3ZYEA 1VJAU 1OX1A 3KQBA 2ZFFH 5ESBA 1TYNA 1G30B 1HNEE 2EI6A 3A87A 4BXWA 1P04A 1O2SA 1A2CH 1QL8A 1TRNA 1RGQA 4JYTA 2A4RA 2ZPQA 3ZYDA 1D6WA 1WV7H 3LH1A 1F2SE 1GVKB 3BTWE 2BY8X 1XUIA 1SQOA 2P8OB 1AVGH 1K1LA 2BX4A 2J9NA 3DD2H 1ZHPA 3MHWU 2G00A 2Z3CA 3C1KA 3M3TA 1QJ6B 1LDTT 3ZZ7A 4YOJA 1SGRE 4PROA 4WH6A 3HK6B 2GT8A 1TPSA 4LK4A 5L6NH 1ELDE 1O3CA 1RRKA 4B1TA 1JIRA 1Y59T 5JBAS 1IQLA 1GGDC 1DWBH 1JIMA 1FIZA 2XXLA 1W11U 4R0IA 1QBVH 5E0GA 3FP6E 1BTXA 4J1YA 1BA8B 1ZSJA 1B0FA 4I8JA 4YOGA 3RU4T 3RXAA 2FOGA 3SJ8A 5FXLA 1YCPK 1IQJA 3V12A 1DWCH 1MKWK 2Y82A 4B76A 1K28D 1Y3XA 3TK5A 4AYYB 4DURA 1V2TT 2EI8A 3BTEE 1RFNA 4B75A 1TBRH 3SNEA 2UWPA 5EGMA 1K1JA 1P2NA 1KXCA 2CMYA 1AN1E 5LPEA 3DFJA 4UFDH 1WOFA 2XBYA 1C4U2 2ZU1A 1G37A 2PLXA 3M5NA 4Y7BA 4ZXYH 5SGAE 3HGPA 1ELBA 1O37A 4YTAA 1DSUA 1CHGA 3F9HA 1TA2A 2PTCE 4I8HA 3TGKE 1HXFH 3EA7A 1C2DA 4I8GA 2RA0A 1ELCA 2QC2A 3PMHB 3URCA 1O3NA 4KKDA 2FTMA 1FY1A 4QT8C 5K0HA 1P3EA 1C9PA 1QFKH 5DP5A 1SGFA 3QTVH 1AQ7A 3ZVEA 1P02A 1GBCA 4KTCA 4X6NA 5LGOA 2WYJA 3QWCH 1F5KU 1CGIE 2PGQB 1KXFA 1KTSB 1DX5M 1DXPA 1AB9C 1J14A 1QA7A 1H9LB 2FOFA 2BD5A 1CT0E 3ZVFA 2NWNA 2TBSA 2ZU4A 2QIQA 1P10A 3B8JA 1YP9A 1UK3A 4IC5A 5FCKA 1ZR0A 1AHTH 2XC4A 1ZTKA 4ZKNU 1D3TB 3WY8A 5L2ZH 1PPHE 4ZXXH 1NFYA 1C5YB 3ZZCA 1HJ8A 3LU9B 5FPYA 3H7TA 4CRFA 1BRBE 5A09A 2VJ1A 3KL6A 4CRDA 3A8AA 1CSOE 2BQ6B 1C1VH 4NWKA 2OP9A 3S7KB 3SI4H 1J8AA 2FIRH 3T2NA 3U69H 1JMOH 2P3TB 3UNRA 3QLPH 1P9UA 5B6OA 2BDAA 1GWAA 4X6OA 4X8UH 2BY5X 2BVRH 4ZHMU 2M5TA 1ANDA 1Z8IB 1PFXC 2R3UA 7GCHG 3STJA 2ZFPH 4K8BA 4D76A 3SV8A 4DGJA 1YF4A 2R0KA 3E0NB 1QRZA 1C1OA 4WMEA 3PO1C 1VR1H 2F83A 1PPEE 4ZKOU 2HVXA 4K60A 1TRYA 2B5TB 4UFFH 1ZTLA 5GWZA 3P8OA 1GCTB 4GAWA 2BDIA 1QB6A 4H6TA 1TGNA 1GI5A 1GJDB 5PTPA 2BTCE 2ANMH 2THFB 2WPJS 6CHAB 3ZV8A 1BQYA 4YT7H 2STBE 2PKSB 1WQVH 1ORFA 1FJSA 1O2YA 4A92A 4Y79A 2BDHA 1KXBA 5JPMH 1QY6A 4OS1A 1GHYH 1DICA 3MU4A 1BCUH 4X1QU 4OS5A 1Z1IA 1BITA 1CE5A 1ZMNA 2C8ZB 3B9FH 4JK6A 1QL9A 1ZLRA 2ILNA 5AVDA 3V3MA 4ABAA 4X2XA 1ZSKA 3O8BA 1G2LA 3RMNH 1TGCA 2WUCA 1S5SA 3LPRA 4B2AA 2PUQH 1TFXA 4AGKA 1D3QB 5EXMA 5ESTE 3RUOA 2CXVA 4B71A 4INHA 2PV9B 3ITIA 2Y7ZA 3HGNA 1H4WA 2BOKA 1WTGH 1Z6EA 1CU1A 1K9OE 1D4PB 1HBTH 2Z9KA 1O3JA 1U6QA 2BQWB 4AFUA 4AFQA 1ELFA 3M61U 4YZUA 1HLTH 4XOJA 1MKXK 1DANH 4ZROA 3OU0A 1VZQH 1W13U 5GJ4B 1S85A 5J4SA 2ZCKP 3BTTE 1AIXH 1J15A 4M7GA 5J4QA 3SV6A 1P8VC 5FCRA 1GBBA 1SGQE 1Y3YA 2EC9H 3I29A 3V7TA 4DW2U 2VIQA 3RU4D 5FAHA 5C1YA 3RXLA 2H9EH 3QZRA 3A7TA 2C4FH 3K6ZA 1FONA 1YPKH 4NIYA 6GCHF 1C2KA 2XRCA 3A8BA 5HM9A 1ZGVA 2ZTZA 2ZU5A 2BMGB 1UCYE 1HJ9A 1K1MA 4ISHH 2A4QA 1P3CA 1C1NA 4KTUA 1V2PT 2ZKSA 4Q80A 2I6SA 3TGIE 3RXOA 4LZ4B 4O3TA 1THSH 4K69A 2NU4E 4INKA 1V2OT 4F49A 1AWFH 3RXMA 3H5CB 1A0LA 2RG3A 4AFZA 2V35A 5AFYH 1C2EA 4FU8A 5GCHF 2Y7XA 4CRBA 1BTZA 2SNVA 3W95A 2WYGA 4Y8ZA 2AIQA 1GHAG 2FOMB 2A2QH 2ALVA 3MH4A 1GHWH 1MQ6A 4XE4A 3SV2H 2DE9A 2Z9GA 1O2LA 1QQUA 1VGCB 2BX3A 1C1MA 4IGDA 1CHOG 1TOMH 1FY3A 1MMJN 1Y5AT 2O8UA 3PM3A 3RLWH 1BHXF 1OSSA 2AS9A 1ZTJA 2AGIX 2AYWA 3RC6A 2CHAC 1ANCA 5E0JA 4ZHAA 1EX3A 1TPAE 2ZHQH 3EGKH 3ZVBA 2A0QB 1EZSC 2VB0A 2VIPA 3BIVH 4AX9H 5DK1A 2B9LA 5I46H 4DVAU 1GI9B 3LDXH 1WQSA 1TA6A 3MH5A 1G3EA 3W94A 1CA0C 3KHVA 1V3XA 1ZPCA