3UREA

Repack mutant (t181i, w199l, q210i) of alpha-lytic protease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLIQGNACMGRGDSGGSLITSAGQAIGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-lytic protease
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
total genus 48
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA01
1J9CH 1GJ7B 1BB0B 2AIPA 1GJ8B 2Y5GA 4UONA 1CT2E 1IAUA 1ETSH 1QB1A 2ZDVH 2ZHQH 5F8TA 3RXPA 3F9FA 3SOSA 3IWMA 1SGFA 3B9FH 2ZEBA 3JZ2B 1V2TT 4Q7ZA 1E35B 5FPTA 3K6YA 3SZNA 3RXUA 2JH5D 1TNGA 4CRGA 1ELAA 1V6DA 4THNH 2RA0A 1DDJA 1Y3UA 2GT7A 1AE5A 1HJAC 3QWCH 4MVNA 1Y3YA 1ELTA 1L1GA 3JZ1B 3RM2H 4KTUA 1ELDE 4FU8A 5AFZH 2WV5A 4Y6DA 3MNXA 2ZGJA 3MH6A 1HAIH 2NWNA 1C9TA 5F8XA 1EZXC 4GUXA 1ZR0A 3OU0A 2C8ZB 3LH3A 1TNHA 2FO9A 2ZFFH 3TLOA 1LPKB 2Z9KA 1Z1JA 1INCA 3T27A 3OYPA 1CSOE 1OWDA 2ZU1A 4IN1A 1QURH 4CRBA 1ARCA 1P3EA 2FODA 2QIQA 4RKJB 1P2MA 1O34A 1A1RA 2FP7B 1LMWB 3A87A 3RXAA 3N7OA 1GBMA 3PB1E 1O2OA 4I8LA 2Z9LA 1Z8GA 3GY2A 7LPRA 3A8BA 3MU4A 3PO1C 1O2QA 1BJVA 4MNYA 4BAMB 1A5GH 1EAIA 1QBNA 1O2WA 2QV1A 1W8BH 3E0NB 1ZMLA 3KF2A 1S0RA 4JZEH 2BY9X 1GBJA 1Q31A 3AASA 1GMHG 2D1JA 2Q6DA 4XFQA 4Y7AA 1EJMA 3F9HA 1OWKA 1VJ9U 4Q80A 4LK4A 3UWJH 3ZVGA 5L2ZH 1ZSKA 5DP5A 1FY4A 1DM4B 5PTPA 3OSYA 3ZZ8A 2QXHA 4AOQA 4QT8C 1ID5H 2BY7X 2A1DB 1G32B 3A7YA 4MG3A 2Z94A 2ZQ1A 1C2JA 4CHAB 3QX5H 3S9AA 4DY7B 1JOUB 1P06A 1YLDA 1GL0E 2BZAA 2HALA 3SNBA 2BY5X 3P17H 2FS8A 3GCNA 1BRBE 1T8MA 3TVJB 1PYTC 2XCNA 2J9NA 2ZDKA 3RXQA 4NIYA 3ITIA 1BMMH 2SNVA 3FANA 4A92A 3V12A 1G3BA 4ASHA 3B8JA 4B76A 1O2XA 3S69A 2GD4B 3MMGA 3PMBB 3V0XA 2BVRH 1HDTH 5GCHG 4WXVA 1C5MD 5I25A 1SGCA 5AFYH 2O9QA 5DPAA 4BTUB 4OGYA 1HAOH 3RMMH 4A1VA 2CXVA 1ELEE 4X2WA 1ACBE 4CH2B 1C2LA 4SGAE 1YCPM 3AW0A 1EJNA 1SPJA 2C3SA 3TJUA 4R0IA 1C1VH 1TPAE 1P01A 5GWZA 1CGHA 1UCYK 1QBVH 1V2KT 2BDBA 1OP0A 1YPHE 2RA3A 2ZC9H 1G30B 5CE1A 3GYLB 1GCTB 3Q76A 1RJXB 1XUGA 5L30H 4H6SB 2XC4A 1TBRH 3LC3A 1SOZA 1QIXB 1GHWH 1WCZA 1HB0B 1GHBG 5C67A 1GMDG 2V6NA 2Q6FA 1C2MA 5GPIB 4A6LA 1MZAA 5T6DA 4E7RG 3L33A 4B74A 4INLA 1OWIA 1F92A 1UHBA 2O8UA 3GCTF 5DP9A 3ZZAA 1EASA 1NM6A 1ZTLA 2VWNA 7GCHG 1BRAA 1VCPA 1YPHC 3M36A 1B0EA 4OS2A 4R8TB 2VINA 1O3EA 1S6FA 3RXHA 4F49A 4H42U 2PW8H 2TGDA 1N8OB 1C5TA 1GBEA 1HIAA 1GMCG 3VGCC 5C5OA 2I6SA 1QB9A 1GJBB 3Q3XA 2SNWA 1OS8A 8GCHG 4UFDH 1SGEE 3RXLA 1D6WA 1FY8E 4WMFA 1AVGH 5JBAS 2PTNA 2VH6A 3HATH 3F6UH 1GBIA 3STIA 3U9AH 2WPJS 1O3NA 2GCTB 3E1XB 1OX1A 5LPEA 1TWXB 2H5DA 1C5LH 3RXFA 1PPHE 4K8BA 1UJ1A 1IOEA 2ILNA 8ESTE 4A7IB 2VIDA 3KQDA 2QN5T 5I46H 4FUJA 1XMNB 2JETB 3K9XB 1MBMA 1O0DH 1FPHH 1EAXA 3A81A 4GCHF 2JH0D 1Y5UT 3SI3H 4HTCH 1K21H 2QXIA 1D3DB 3UNSA 5A0AE 3BTGE 1TPPA 3LOXA 3BTTE 1H4WA 1OXGA 3M5LA 4INHA 2J95A 1IQMA 1K1PA 2AMQA 1BT7A 1MTUA 1QL7A 3ZZ7A 4WF8A 2AH4X 2CV3A 3H7TA 1B5GH 2BD9A 1OOKB 1SLVB 2ZF0H 2FXRA 4ISIH 3AAUA 5EW1H 3SGQE 3A7VA 1ZPCA 4CRDA 2R3UA 5T6GA 3SI4H 1FLEE 2PHBA 1DY9A 2ZZUH 1YKTA 1NU7B 1EB2A 2BDGA 3RXRA 4NFFA 4AX9H 1THPB 3BTDE 5FX6A 4YLUA 1TX6A 4X2YA 1DSTA 1TONA 1EP5A 3LJOA 4UEHH 3U8TH 3BEUA 3GCOA 3RXVA 2FMJA 2GMTB 3RXGA 3FVFB 1KSNA 1U6QA 3MU5A 2C8XB 3W94A 3NWUA 1DLEA 4LZ1H 3KQBA 1AKSA 2O8WA 4ZHAA 3TNSA 2FX6A 4DW2U 4LOYH 4X2VA 1W12U 1C4V2 3MNSA 2PWXA 3BTWE 2R3YA 1XUHA 1C4U2 1LKBA 1A0JA 2DUCA 4GVUA 4YLQH 4MPWA 1GVKB 1MAYA 3PWBA 2NU3E 2J2UA 2KAIA 1C2EA 4TPYA 1E37B 2QA9E 2A5KA 3RMOH 1UHBB 2XWBI 1AVXA 3MO3A 3P70B 1YGCH 2XNIA 1C1UH 2CJIA 1KXAA 3EQ0H 2BVSH 3A85A 2ZG0H 2O8TA 3LJJA 2GDDA 2Z9JA 4XBCA 2OBQA 1MUEB 3KQEA 1HIAB 4ZH8A 3RXDA 4D7FA 2BLQA 3EGKH 2OINA 3UR9A 1BZXE 4KKDA 3ENSB 3A83A 4BAKB 1DWEH 1GMHF 4X6PA 3QK1A 2R2MB 3SU4A 1A61H 1K22H 5DK1A 1GGDB 1A3EH 4BNRA 2YNBA 1P03A 5AVDA 4X1NU 2GX4A 5LPRA 1HYLA 2M5TA 1WQSA 1NRQH 3W95A 1AD8H 3SHAH 1O5DH 1HLTH 1G2LA 1IQFA 2HRVA 5HGGA 1HFDA 2R9PA 1P2NA 1P8VC 1OSSA 5C1YA 4X8UH 1ZHPA 5EGMA 1C9PA 4XBBA 4AGJA 2F9BH 1AMHA 1SLXB 2W3IA 2WPIS 4I32A 2QGRA 2ULLA 3M3VA 4IMQA 3ATWA 3TPIZ 2R2WU 3HKJB 3U98H 2FLRH 4ZHLU 4X8VH 1BMNH 1GVLA 3FAOA 3DUXH 1P2QA 2FOMB 5GCHF 1O2UA 2HLCA 4B73A 1FV9A 2STBE 4FUHA 1PFXC 2B7DH 1EOLA 3ZZ4A 1QA7A 5EW2H 1LPZB 1GJ9B 1IHTH 1O31A 2BXTH 2QF0A 3SV8A 1EPTA 4ABEA 4KP0A 1V2JT 2ZDAH 1VGCB 2A2XH 2PKAA 5AF9H 4ISOA 1EJAA 3DD2H 1N6YA 2Q6GA 3EAJA 1HAVA 1GHXH 1HCGA 2BDIA 4I8JA 1ZMJA 5A0CA 1UTQA 2A7HA 2CHAB 2VVUA 1HRTH 1QFKH 3DT0H 2B8OH 2BB4A 2EI7A 1SC8U 3A86A 4BAQB 1ELCA 1GHBF 1MD7A 4O3UA 1GMDF 1XVMA 1DOJA 2PLXA 2BD5A 2R0LA 5F6MA 1HUTH 2HNTF 2DE8A 4AB8A 4BXSA 2A7CA 3MH7A 4XOJA 1AKSB 1P2IA 1Y59T 3BTFE 2BTCE 3RU4E 3UNRA 1F5RA 3LKWA 4INKA 2CGAA 5DKMA 1DX5M 7GCHF 3T62A 3FZZA 3ZZ9A 1HJ9A 2THFB 2A4GA 1KYNA 1WU1A 3RMNH 1JIMA 1O3KA 2WYJA 3OY6U 3M3TA 1NFXA 1MCTA 3BTME 3KNXA 3NUMA 4B2CA 2FM2A 2KAIB 1ZHRA 2IJOB 1FIZA 4AORA 1UK3A 1YPMH 4NIWA 2FOAA 1PYTD 3KL6A 8GCHF 1ZMNA 2HPQH 3GY3A 5EQSA 2C8YB 1GI4A 1THRH 4VGCB 3SU0A 1AU8A 1AHTH 1YCPK 3SV7A 3SHCH 1DXWA 5EOKA 1KXEA 1C1NA 3EA9A 5EQRA 1EUFA 1AFQC 2ZDMA 4DIHH 4Q7XA 1IQNA 2OQ5A 1DUEA 1P09A 2ZDNA 1FQ3A 3SU1A 2Z7FE 2ZFSA 1GJCB 1C5QA 5CMXH 2Z6BD 2ZCKP 4Z0KA 5HXFA 4IS5A 2ANMH 5K7RA 1BBRK 5EXMA 4GAWA 4ZKOU 1BHXF 1GBFA 1RIWC 1UTOA 2BVXH 3EA7A 2FOFA 3KIDU 2Z9IA 1JRTA 4IW4E 2F9OA 1WQVH 1C1MA 3SU6A 1LPGB 4K1SA 3UUZA 1HXEH 2OC8A 1FY5A 5JDUB 4BTIB 1PJPA 3S7HB 1BBRH 1O5CB 2BD7A 4H6TA 1MH0A 4I8HA 1BTXA 1O3IA 1W0YH 1ZGVA 1CT0E 2DE9A 2AIQA 3ATLA 1S82A 5DP4A 4I8KA 3SUGA 4B1TA 1LDTT 4O97A 2H9TH 1ELVA 1G3CA 2BQWB 1FY1A 3QGJA 4X1QU 3E90B 2UUFB 1O30A 1NT1A 1YLCA 1O2YA 5FPSA 1T8LA 3IITA 1D4PB 2ZFTA 2ZU4A 1GHZA 1D3QB 1Z8JB 5JB8S 4NGAH 1PPGE 4A1XA 1C2DA 1FY3A 1WV7H 3BTHE 3P92A 1O3MA 3KGPA 4FXGH 3EYDA 1QBOA 1QCPA 1C5VA 1MBQA 1AO5A 1XKBC 4NCYA 1O2KA 1UMAH 1H8IH 2PKSC 3ESTA 2VGCB 1CA0B 2PKAB 1LHGH 4X2XA 4AN7A 1DANH 3S9BA 2TBSA 4CBOA 2ZHFH 2F9VA 1ZOMA 8LPRA 5GXPA 1X7AC 2G51A 4BTTB 5E2PA 1YP9A 1NC6A 2ZFPH 1O5BB 4O3TA 1O3FA 1F2SE 4ZUHA 4B75A 1Y3WA 4K8YA 2P95A 3M7TA 3VB3A 4U30A 1Y3XA 2Z3DA 3QO6A 3SNCA 3UREA 4DVAU 1TQ0B 1IQKA 1DWDH 4NZQA 1XKAC 1L1NA 1MTVA 3TK5A 1PQAA 2PUQH 1NS3A 6ESTA 1KXCA 1Y5AT 2OXSA 1D6RA 2VIWA 3STJA 1BTWA 1H9LB 1FONA 4OS5A 6GCHG 1D3TB 1G9IE 2C90B 2TGTA 4FUEA 3U1JB 2HNTE 1Q2WA 1RTKA 4PROA 1ZTKA 2ZU5A 4M7GA 5C1XA 2JH6D 2CF9H 2GKVE 3UTUH 5EODA 1HJAB 4I7YH 1TNIA 1T31A 2ZGCA 1GBDA 2ZA5A 4CHAC 1GI9B 1P10A 4Y71A 3BIUH 1ELGA 2ZGBH 3PTBA 5L6NH 2G81E 2OTVA 3QTOH 1TABE 2NU0E 5EQQA 3RU4T 4CR9A 1O5GH 1TNKA 4ISNA 6CHAC 3PMJA 1HJ8A 1NTPA 1QB6A 1UCYE 3PLBA 2VNTA 2XC0A 1A3BH 1KLTA 1O5FH 1TALA 2UWLA 2BHGA 1W3CA 2HNTC 4HFPB 1GBTA 5FHTA 1UTJA 3URDA 1MU6B 1AUJA 3GY5A 1H9IE 2WPLS 1DT2A 1VR1H 4X1RU 4AFZA 2I6QA 5EXLA 4HI3A 1K1LA 1L2EA 5HMAA 1SGYE 1LKAA 4X6MA 1V2NT 4DOQA 4CRFA 4ABGA 5A2MH 3U1IB 1MTNB 4Y76A 3PM3A 1C5OH 2ZU2A 1LO6A 5FCRA 3D62A 2BM2A 1P2JA 3PO1B 1IQEA 4NFEA 1TMBH 3RXJA 3BG4B 5FBIA 1PPFE 1TE0A 2ZIQH 3CENA 4WJG2 1AI8H 2ALVA 3TK6A 1AE8H 1W2KH 1O37A 3M37A 1FJSA 5BPEA 3MTYA 1VITG 1O39A 1O3HA 4JYTA 5ABWA 1TRYA 1ANEA 3SJ9A 2SGEE 4I33A 3RC5A 2STAE 2UWPA 3ZZBA 1NN6A 3OX7U 4ZHMU 5C5NA 1GJ6A 2PR3A 1ZSJA 1EKBB 3Q00A 2ZGHA 4YTAA 1XX9A 1ZHMA 3K6ZA 2V3OH 5DP8A 2AMPA 2FPZA 1O36A 1LCYA 1DY8A 2GZ9A 2XYAA 1ZSLA 4O9VA 2BD3A 3SJKA 1GI1A 3F9GA 1C1OA 2ZCHP 1ABJH 5FPYA 2G5NA 1ESAA 1SGDE 1ORFA 4MDSA 2JKHA 1TNJA 4U32A 3TJNA 1SGFG 2FDAA 3MU1A 2W7SA 2J94A 2IOTA 1V2WT 2VIQA 4K1EA 1IQIA 1JXPA 1C1PA 1CBWC 1Z8IB 3KEEA 1DVAH 1NZQH 1K1IA 3EE0B 1C5PA 3VB4A 1YF4A 1FMGA 1G3EA 2WV4A 1BRCE 2H6MA 3AAVA 5JBBS 2XC5A 3O8BA 1NY22 5JBCS 1LVBA 1RRKA 4MNVA 2BLOA 5T3HA 3HK6B 3R0FA 2P3FH 3UR6A 2OBOA 3ATMA 1JRSA 2BQ7B 3GISB 1UVUH 2VVVA 2F9UA 4WY3A 3A7TA 2Y5HA 4Y7BA 3TH3H 1NFUA 1GI6A 3ZZ6A 4YT7H 1A0HB 1PQ5A 1GG6B 4RSPA 1AB9B 4NG9H 4DCDA 5A8YA 3A80A 1BTYA 1TAWA 1SLWB 1GBCA 2B9LA 4E7NA 5EXNA 1FN6A 2A0QB 2A32A 5DP3A 1Y5BT 4ABJA 1O2MA 3H5CB 4ABBA 1OWJA 1F0RA 1S81A 2IPHA 1UTLM 7ESTE 1FNIA 4ZAEA 2QYIA 2OP9A 1QRWA 4MNWA 1G2MA 1SMFE 1MMJN 2FI4E 6LPRA 5ESTE 4MPXA 2F9NA 2A4QA 1TRMA 1DFPA 3VGCB 1HPGA 3RLWH 1PPZA 4FUCA 4UFFH 4JMYA 2GMTC 4KTSA 3QDZB 1TGTA 3ZYDA 5JYIA 1KXBA 1OWEA 1NRSH 1P11E 3MO9A 3MO6A 4E05H 1E0FD 1O2LA 4KGAA 5GIBA 1S83A 1SQTA 3S7KB 1UVTH 5GJ4B 5FAHA 1AFEH 1SR5C 2ZFQH 3TJOA 3LH1A 2NU1E 4JYVH 1DUAA 2TRMA 1AUTC 4SGBE 1PQ8A 1MQ5A 3UIRA 2G4TA 1Z8RA 2VH0A 1KLIH 2OC1A 1F7ZA 1C2HA 1SGPE 5FXLA 1NFYA 3A89A 3RXOA 3RU4D 4Y10E 1OWHA 4HZHA 1NESE 4BANB 2ZPRA 7KMEH 3TGIE 3M3SA 1XXDA 1P12E 3RUOA 3LGTA 1EQ9A 1GJ5H 2ZHEH 2FOEA 1LHCH 2V3HH 5JPMH 4XE4A 1V2VT 2ZU3A 1TOMH 5FX5A 3SV9A 2TIOA 3VB6A 2FESH 4D8NA 1TGBA 3CS0A 2ESTE 4Y79A 4OS7A 3RXIA 1DPOA 1ANDA 4ABDA 6GCHF 3KQCA 3P95A 1TBZH 3GY6A 1O5AB 2PSXA 2VU8E 1ZPBA 1W0ZU 1V2UT 4NWKA 2FEQH 2GVFA 3ZV8A 1V2LT 2G52A 1J17T 1SGIB 2HPPH 1C5XB 1O3JA 2VJ1A 1MQ6A 3P6ZB 4XBDA 2OCVB 1ZTJA 2EA3A 2WPHS 3TJVA 1K28D 1H9HE 2P8OC 3SQHE 3T28A 1S0QA 1BMAA 1BMLA 1YM0A 1C2IA 3QLPH 2RCEA 3U8OH 1QQ4A 1K1NA 1FXYA 3ZV9A 1QGFA 3M7QA 1YPKH 1A2CH 3OTJE 4FU9A 3MU8A 4AGKA 1MKXK 1P9SA 2QY0B 1KTTB 4TPIZ 1O32A 1V2ST 2H9HA 3QUMP 2CF8H 1T7CA 2ZNKH 2F91A 1L4DA 3DA9B 3UOUA 4J2YB 5E0GA 1J16A 1DXPA 1QQUA 5A8XA 1QJ7B 3M35A 1MKXH 2VB0A 2XCFA 2OUAA 3ODFA 3VFEA 2SGDE 2OC0A 2FX4A 2HGTH 1SB1H 1RD3B 4GHTA 1WUNH 3Q77A 3S0NA 1P05A 1O2TA 1GDNA 2VIVA 2XBYA 2ZDLA 2PSYA 5HYOA 4K1TA 3O8CA 3GICB 1QR3E 1XVOA 4CRCA 3LGIA 4YOIA 2G5VA 1T8OA 1CQQA 2CHAC 2BD2A 2QAAA 3P8OA 4DURA 1QL9A 1SQOA 1HAHH 4RKOB 1AY6H 3LIWA 1F0TA 4ZXYH 2ZP0H 2IN2A 3VXEH 4JZ1A 1RXPA 1VITF 3UFAA 4FUGA 1SBWA 1IQHA 3SNDA 1W14U 3MI4A 3VPKA 1W10U 1C1SA 2B5TB 1SFIA 4WXIA 2ZTYA 5BRRE 1TA2A 2EC9H 2AYWA 1GBHA 4BOHA 1DSUA 3SGAE 2QCYA 1CA8B 4Y8XA 1QY6A 1FI8A 2ZKSA 1GHAG 2SFAA 2XBWA 1SFQB 3GY4A 4NA9H 5CHAC 3SV2H 4WMDA 1ZRKA 2VVCA 1GBBA 3ZVCA 2FYQA 1CT4E 2XW9A 2ANKH 1HXFH 1TGCA 3M7UA 4DT7B 1GI3A 5JB9S 1ZJKA 1UTKA 5TCCA 1WAYB 5LH8A 2EEKA 3AVZA 3T2NA 2QF3A 2A5AA 2TGPZ 1RFNA 4TY6A 1S85A 1CE5A 3SNEA 2G00A 1J15A 5TCAA 3HGNA 3VXFH 4ZXXH 4CH8B 3TIUA 3KHVA 4FU7A 2BLWA 4FUIA 2AGGX 3E16B 2FS9A 3K65B 9LPRA 1NO9H 1P0SH 1GMCF 3M61U 4I31A 1ZRBA 2VWOA 1D3PB 1K1JA 4JZFH 1QRZA 3GCHC 2Y7ZA 5FBEA 1A7SA 2F9PA 4B2BA 3IG6B 1QJ6B 1JBUH 1B0FA 3M5OA 3PWCA 1N6XA 4BAHB 1M9UA 1P02A 4KTCA 2Z3CA 2W5EA 1ETTH 2SGAA 1Z6JH 3UQOA 4K60A 4WH6A 3A8CA 2ZCLP 3A7XA 3ODDA 1UTMA 2ZWLH 1GI7B 3QZQA 1Y3VA 2B0FA 5A0BA 1J14A 5IYTA 1JMOH 1O3BA 5GDSH 3MFJA 2Z9GA 1W13U 3ATIA 3GOVB 2A31A 1XM1A 3A82A 1FAXA 1MZDA 1ABIH 1HAGE 3PLKA 2ALPA 1O3CA 3I78A 5TJXA 1EP6A 1Z6EA 2BZ6H 1MKWH 3WY8A 2QXJA 5AHGH 3E0PB 3D65E 2VGCC 1SVPA 3PYHA 1XUFA 3QTVH 3HKIB 2ASUB 1TPSA 1KLJH 3BTQE 4FUDA 1DS2E 3V13A 1LQDB 2WPMS 3BIVH 2G8TA 1GJAB 3O8RA 1YPLH 3RLYH 2PTCE 4CREA 1XXFA 3SW2B 5A8ZA 3P8GA 1O38A 1AIXH 4HGCA 3DFJA 4WWYA 1DICA 1ARBA 1GBLA 1DLKB 1UK2A 3A84A 1HAYB 4IGDA 1A46H 3C27B 1IQJA 2PUXB 3VB7A 4X8SH 4I8GA 1EPTB 1C1WH 2ZFRH 3NKKA 5HM9A 1WTHD 3RXEA 1QTFA 2FI5E 4AZ2B 4ESTE 3GDUA 1GL1A 1MAXA 1NPMA 1HAVB 1PPBH 1TMTH 1TRNA 1TX8A 4ISLA 3SGBE 1TQ7B 3K2UA 4IC6A 1BOQA 1CHOG 1ZYOA 4NIXA 1OYQA 3PROA 4ABFA 5A09A 3RMLH 3SORA 1G37A 2RDLA 1FZZA 2ANYA 2XXLA 4MPUA 2XRCA 9ESTA 2SGQE 2GCHG 2A4RA 3V7TA 1OYTH 3MH5A 2ZTXA 2A7JA 1UVSH 4UFEH 2D2DA 2FLBH 1CU1A 5DP6A 3CS7A 2OLGA 3LPRA 4WVPE 1C2GA 1G36A 2Z3EA 3KN2A 2BX3A 4FVDA 3QGNB 3MNCA 1BRUP 1QNJA 2XWAA 3HPTB 1VZQH 4GHQA 4XSKU 2PKSB 4H4FA 1QRXA 2FIRH 5EPNA 1P57B 2A45B 2AGIX 1O2VA 2YOLA 1P2KA 1AWFH 1IQGA 3D23A 1NROH 2AERH 1T4VH 3SU2A 1QJ1B 3FP8E 3LONA 3DHKH 3P8NA 3NCLA 1SOTA 1PPCE 1THSH 2Q1JA 1FPCH 3TGKE 3D49H 2C8WB 3UQVA 4IN2A 1HAPH 2ZHWH 3PMAB 5F8ZA 1PPEE 3ZZCA 1SHHB 1EATA 2R0KA 1J8AA 1C5ZB 2BDYA 1AN1E 1GCDA 1OPHB 4CR5A 2D8WA 1O2PA 1ZLRA 1GDUA 2P3TB 1MTNC 2SGPE 3BG8A 1TPOA 1EZQA 1A5IA 4NSVA 1E34B 1O2GH 1GJ4H 1EZUC 4AG1A 5T6FA 1YYY1 3SU3A 1GBKA 4IBLH 3BG4C 3HGPA 2FOGA 1SGQE 1O2HA 2GGVB 2WUBA 2UUYA 5SGAE 2P3UB 2SGFE 3HK3B 4NA8A 3T25A 4K3JA 4YT6H 3EA8A 3RXKA 2HOBA 2Y6TA 1ANBA 1DE7H 4OS4A 4JZIA 3LGYA 3SUFA 1VITH 1GCTC 1ESTA 3TK9A 5E2OA 1BQYA 5JBTA 1V2OT 1RS0A 2BXUH 4U2WA 3RC6A 1K1MA 2FI3E 4AB9A 1K2I1 3E91A 2BDAA 3I77A 1O2SA 2VIOA 4Y0YE 1O35A 3UNQA 2BDHA 2G4UA 1P3CA 2J34A 5DJ7A 6CHAB 3SJIA 2A4OA 2FTLE 1FAKH 1LVMA 2ODPA 3MYWA 3RXTA 1GHAF 1V2MT 1S84A 1O2JA 2AMDA 3S9CA 1TNLA 5F03A 5C2ZA 1TYNA 2CN0H 3E3TA 3NPSA 1LVYA 1ETRH 3F68H 1O3GA 2FTMA 3LGVA 3ZYEA 1O3AA 1ZJDA 1AWHB 1UTNA 3GY8A 2Y81A 5C20A 4Y11E 4KELA 2ZECA 2BOHB 2J4IA 5DG6A 4MPVA 2BY6X 3BV9B 1N8OC 1C2KA 1ELFA 5EU8A 4ABIA 1SI5H 1AZ8A 1ANCA 1C1TA 1GI8B 1B7XB 2FOBA 2YNAA 3G01A 2H9EH 3RXCA 3M5MA 1V2RT 1V2PT 2FYRA 3BTKE 4YOGA 3PTNA 1EB1H 3UOPA 2F3CE 1UCYH 2GCTC 1FIWA 2G55A 3SN8A 4NIVA 3ZVBA 1MTWA 3MOCA 3H7OA 4K2YA 1FDPA 1SQAA 2ZHDA 4U01A 1S5SA 2BD8A 1SGTA 1ZZZA 2WINI 2XBVA 4JK5A 4RN6A 4AYVB 1GG6C 2FOCA 1AB9C 3RDZA 1O2IA 4X1SU 2GT8A 2BD4A 1NFWA 3BEIB 1WSSH 2JETC 3T29A 4YESB 1BTZA 3PMHB 5E0HA 2Y5FA 1T4UH 1ELBA 4GLYA 1TA6A 1BHXB 3C1KA 4JCNA 4Y8YA 3O8DA 3SU5A 2GP9B 1OP2A 2AEIH 2XBXA 2Y82A 1C5SA 3QN7A 1MTSA 2WYGA 3VB5A 2A5IA 4NWLA 4YZUA 1C5NH 5LGOA 3TU7H 3GYMA 1DWCH 1P9UA 3MH4A 1UTPA 2LNCA 1TIOA 1KXDA 4LXBH 4UE7H 5ETXA 4WMEA 4ZKSU 1Q3XA 3BSQA 2C93B 1KDQA 1RGQA 2Y7XA 1OKXA 2GV7A 4CRAA 4ZROA 5J4QA 4F4OC 1QHRB 3LGUA 4UDWH 4UFGH 3Q3YA 1JWTA 3A8AA 4JZDH 3SJ8A 1CBWB 1JIRA 1L1JA 2ZI2H 4X8TH 4ZKNU 1XUKA 2UUKB 2OD3B 2ZO3H 3SUEA 1KY9A 1CGJE 2WUCA 3LGWA 1XUJA 1EAUA 1TFXA 4D76A 4K69A 1W7XH 5L2YH 1CVWH 4K5ZA 3F1SB 4X0WU 3BTEE 4B71A 5H4IB 1GDQA 2C4FH 3F9EA 4OS1A 4FUFA 1SGRE 4DJZB 1WOFA 2LPRA 4FUBA 1WTGH 4Z6AH 4D9QA 1TOCB 2BOKA 1D9IA 1RTFB 1BTPA 2TPIZ 3A7ZA 2BMGB 1CHOF 2H2ZA 3PLPA 3Q3KA 3FZDA 3SUDA 1QA0A 2GDEH 4D9RA 1EX3A 3L3TA 4X6OA 3ZVFA 3LDXH 1L0ZA 8KME2 1AGJA 1LHFH 1SGNE 4Y8ZA 1N1LA 1IQLA 2GCHF 1UVPA 3PV4A 2O8LA 1LTOA 2V35A 2BQ6B 2J38A 1C1RA 3AW1A 1SHYA 3TH4H 1AQ7A 1KTSB 3LU9B 1YC0A 1UK4A 1F5LA 1V3XA 2BX4A 1GI2A 4XDEA 2QC2A 4GSOA 5HM2A 5K0HA 1AVWA 4CBNA 1FUJA 1F0UA 5LPFA 1A5HA 2W26A 2AS9A 1F5KU 1TLDA 5C3NA 3NXPA 3SJOA 4AFUA 2VIPA 2K1QA 1GGDC 1HAXB 2GV6A 1EAWA 3SNAA 1SSXA 3MWIU 3ZVAA 1V2QT 3GDVA 4GPGA 1P04A 1VCWA 1O3OA 3BEFB 5J4SA 1EXFA 4ISHH 2H1UA 2ODQA 1EOJA 4ABHA 1O3DA 1BDAA 1NRPH 1GPZA 1GVZA 2HVXA 3I29A 1MCVA 3U8RH 2P94A 2VWLA 1ESBA 2GTBA 1P2OA 3P8FA 4YO9A 1UVOA 2ZPQA 1T8NA 2EI6A 2PGQB 5E8EH 5G4BA 1C2FA 2FZZA 3T5FH 4IMZA 2P16A 1HV7A 2BY8X 3B23B 4MQAA 4FVBA 2QXGA 2W3KA 1H1BA 1ZGIA 1QL8A 3ZZ5A 1YPEH 1BJUA 2VWMA 4DG4A 3EDXB 4OGXA 2GZ8A 1MD8A 1BIOA 1O3LA 3URCA 2ZQ2A 4AFSA 2CMYA 3OY5U 1Z7KA 1Z1IA 1YPJH 4D7GA 1Y8TA 4NZLA 1TX7A 4ZKRU 4Y0ZE 4B2AA 3ZVEA 3LC5A 1HAZB 3UWIA 2O8MA 1KDQB 1VGCC 1SLUB 1C5UA 4TYDA 4MTBA 3MNBA 1WBGB 1BCUH 1NRRH 2WPKS 2ZGXH 4UD9H 1C4Y2 3SQEE 3T26A 4AFQA 2ODYB 2P8OB 4J1YA 2AFQB 3R3GB 1FN8A 2TGAA 2V0BA 2F83A 1TGSZ 3SBKA 3SO3A 1DWBH 2OQUA 2UUJB 4WH8A 3TNTA 3DFLA 4IC5A 1EZSC 3FP7E 3BN9A 1IHSH 4MNXA 1SL3A 1TGNA 2H5CA 1VCQA 2RG3A 5C1UA 1YPGH 1HNEE 4TY7A 5DP7A 3UPEA 3NZIA 1W11U 2FWWA 1DITH 1KXFA 1C1QA 3SV6A 1OP8A 1HGTH 1GJDB 1MU8B 3LT3A 1GI5A 2J92A 1A0LA 2PV9B 1CO7E 1YBWA 3ZVDA 3GY7A 1BTUA 1L4ZA 4VGCC 4MLFB 3FP6E 1KIGH 1LQEA 1BBRE 1O33A 3ELAH 1E38B 3TITA 1CHGA 4O03A 3CP7A 2A2QH 1WYKA 4BXWA 4DGJA 5B6OA 5DO4H 3BF6H 1TB6H 1AZZA 3U69H 1GBAA 1LHDH 3A7WA 1CGIE 2P93A 1GHVH 3RXMA 1VJAU 1F0SA 4AG2A 1G3DA 5EPYA 1E36B 2Y80A 1NU9A 4JYUH 1LHEH 1LVOA 1BUIA 3KCGH 2OC7A 5IDKA 2D26C 4AYYB 1BTHH 2W7UA 3L6PA 3ZZ3A 2BLVA 1GI0A 1H8DH 4TWYA 1HBTH 2ANWA 4BAOB 5CHAB 2AGEX 3MU0A 1O2ZA 3MHWU 4OS6A 3GCTG 2NU2E 4X1PU 1BA8B 3A8DA 5DGJA 4ABAA 2BYAX 1C5RA 1TMUH 3VEQB 3ZZDA 1GWAA 1NRNH 1Z71A 4JK6A 1PQ7A 3E6PH 3RM0H 3V3MA 1T32A 1ZPZA 4TWWA 1UO6A 1O5EH 3FFGA 3QZRA 1XUIA 4A5TS 4LZ4B 4A1TA 1MKWK 2ZTZA 2BDCA 1C5WB 1RTLA 5ESBA 1YCPH 2PGBB 1K1OA 4YM9A 2XTTB 3ATKA 4ZMAH 5E0JA 1O3PB 2EI8A 3GCHB 1EPTC 4Q2KA 1CA0C 1W7GH 1C5YB 3E8LA 1BITA 2P59A 3RP2A 3TH2H 3RC4A 4DIIH 2ZPSA 5FCKA 3M5NA 4E06H 4YOJA 1AFQB 3RXBA 4Q7YA 1O2RA 4NA7A 1GHYH 4X6NA 5EG4A 1A4WH 2UWOA 3TGJE 1S6HA 1TBQH 2NU4E 1K9OE 3A88A 3NK8A 2PFEA 2HWLB 4GCHG 2FOHA 3GDSA 4NSYA 1SG8B 1O2NA 2GZ7A 3UY9A 1RIWB 3RXSA
chains in the Genus database with same CATH superfamily
1J9CH 1GJ7B 1BB0B 2AIPA 2KM0A 1GJ8B 2KCPA 2Y5GA 4UONA 1CT2E 1IAUA 1ETSH 1QB1A 2ZDVH 2ZHQH 5F8TA 3RXPA 3F9FA 3SOSA 3IWMA 1SGFA 3B9FH 2ZEBA 3JZ2B 1V2TT 4Q7ZA 1E35B 5FPTA 3K6YA 3SZNA 2WHXA 3RXUA 2JH5D 1TNGA 4CRGA 3F2GA 2XOKD 1ELAA 1V6DA 4THNH 2RA0A 1DDJA 1Y3UA 2GT7A 1AE5A 1HJAC 3QWCH 4MVNA 1Y3YA 1ELTA 1L1GA 3JZ1B 3RM2H 4KTUA 1ELDE 4FU8A 5AFZH 2WV5A 5KGOA 4Y6DA 3MNXA 2ZGJA 3MH6A 1HAIH 2NWNA 1C9TA 5F8XA 1EZXC 4GUXA 1ZR0A 3OU0A 2C8ZB 3LH3A 1TNHA 2FO9A 2ZFFH 3TLOA 1LPKB 2Z9KA 1Z1JA 1INCA 3T27A 3OYPA 1CSOE 1OWDA 1W0KD 2ZU1A 4IN1A 1QURH 4CRBA 1ARCA 1P3EA 5CDFE 2FODA 2K8IA 2QIQA 4RKJB 1P2MA 1O34A 1A1RA 2FP7B 1LMWB 3A87A 3RXAA 3N7OA 2YMSD 1GBMA 3PB1E 1O2OA 5KECA 4I8LA 2Z9LA 1Z8GA 3GY2A 7LPRA 3A8BA 3MU4A 3PO1C 1O2QA 1BJVA 4MNYA 4BAMB 1H8HD 1A5GH 1EAIA 1QBNA 1O2WA 2QV1A 1W8BH 3E0NB 5EJZA 1ZMLA 3KF2A 1S0RA 4JZEH 2BY9X 1GBJA 1Q31A 3AASA 1GMHG 2D1JA 2Q6DA 4XFQA 4Y7AA 1EJMA 3F9HA 1OWKA 1VJ9U 4Q80A 4LK4A 3UWJH 3ZVGA 5L2ZH 1ZSKA 5DP5A 1FY4A 1DM4B 5PTPA 2W6JD 3OSYA 2QXHA 3ZZ8A 5HIZA 4AOQA 4QT8C 1ID5H 2BY7X 2A1DB 1G32B 3A7YA 4MG3A 2Z94A 2ZQ1A 1C2JA 4CHAB 3QX5H 3S9AA 4DY7B 1JOUB 1P06A 1YLDA 1GL0E 2BZAA 2HALA 3SNBA 2BY5X 3P17H 2FS8A 3GCNA 1BRBE 1T8MA 3PV5A 3TVJB 1PYTC 2XCNA 2J9NA 2ZDKA 3RXQA 4NIYA 3ITIA 1BMMH 2SNVA 3OEHD 3FANA 4A92A 3V12A 1G3BA 4ASHA 4M9FA 3B8JA 4B76A 1O2XA 3S69A 2GD4B 3N7EA 3MMGA 3PMBB 3V0XA 2BVRH 1HDTH 5GCHG 4WXVA 1C5MD 5I25A 1SGCA 5AFYH 2O9QA 5DPAA 3SZEA 4OGYA 4BTUB 1HAOH 3RMMH 4A1VA 2CXVA 1ELEE 4X2WA 1ACBE 4CH2B 1C2LA 4SGAE 1YCPM 3AW0A 1EJNA 1SPJA 2C3SA 3TJUA 4R0IA 4TT3D 1C1VH 1TPAE 1P01A 5GWZA 1CGHA 1UCYK 1QBVH 1V2KT 2BDBA 1OP0A 1YPHE 2RA3A 2ZC9H 1G30B 5CE1A 3GYLB 1GCTB 3Q76A 1RJXB 1XUGA 5L30H 4H6SB 2XC4A 1TBRH 3LC3A 1SOZA 1QIXB 1GHWH 1WCZA 1HB0B 1GHBG 5C67A 1GMDG 2V6NA 2Q6FA 1C2MA 5GPIB 4A6LA 1MZAA 5T6DA 4E7RG 4YXWD 3L33A 4B74A 2HLDD 4INLA 1OWIA 1F92A 1UHBA 2O8UA 3GCTF 5DP9A 3ZZAA 1EASA 1NM6A 1ZTLA 2VWNA 7GCHG 1BRAA 1VCPA 1YPHC 3M36A 1B0EA 4OS2A 4R8TB 2VINA 1O3EA 1S6FA 4ACAA 3RXHA 4F49A 4H42U 2PW8H 2TGDA 1N8OB 1C5TA 1GBEA 1HIAA 1GMCG 3VGCC 5C5OA 2I6SA 1QB9A 1GJBB 3Q3XA 2SNWA 1OS8A 8GCHG 4UFDH 1SGEE 3RXLA 1D6WA 1FY8E 4WMFA 1AVGH 5JBAS 2PTNA 2VH6A 3HATH 3F6UH 1GBIA 3STIA 3U9AH 2WPJS 1O3NA 2GCTB 3E1XB 1K0HA 1OX1A 5LPEA 1TWXB 2H5DA 1C5LH 3RXFA 1PPHE 4K8BA 1UJ1A 1IOEA 2ILNA 8ESTE 4A7IB 2VIDA 3KQDA 2QN5T 5I46H 4FUJA 1XMNB 2JETB 3K9XB 1MBMA 1O0DH 1FPHH 2QF4A 1EAXA 3A81A 4GCHF 2JH0D 1Y5UT 3SI3H 4HTCH 1K21H 2QXIA 1D3DB 3UNSA 5A0AE 3BTGE 1TPPA 3LOXA 3BTTE 1H4WA 1OXGA 3M5LA 4INHA 2J95A 5HKKD 1IQMA 1K1PA 2AMQA 1BT7A 1MTUA 1QL7A 3ZZ7A 4WF8A 2AH4X 2CV3A 3H7TA 1B5GH 3DSGA 2BD9A 1OOKB 1SLVB 2ZF0H 2FXRA 4ISIH 3AAUA 5EW1H 2JDID 3SGQE 3A7VA 1ZPCA 4CRDA 2R3UA 5T6GA 3SI4H 1FLEE 2PHBA 1DY9A 2ZZUH 1YKTA 1NU7B 1EB2A 2BDGA 3RXRA 4NFFA 4AX9H 1THPB 1E1QD 3BTDE 5FX6A 4YLUA 1TX6A 4X2YA 1DSTA 1TONA 1EP5A 3LJOA 4UEHH 3U8TH 3BEUA 3GCOA 3RXVA 2FMJA 2GMTB 3RXGA 3FVFB 2F4LA 1KSNA 1U6QA 3MU5A 2C8XB 3W94A 3NWUA 1DLEA 4LZ1H 3KQBA 1AKSA 2O8WA 4ZHAA 3TNSA 2FX6A 4DW2U 4LOYH 4X2VA 1W12U 4Z1MD 1C4V2 3MNSA 2PWXA 5KEDA 3BTWE 3NRLA 2R3YA 1XUHA 1C4U2 1LKBA 1A0JA 2DUCA 4GVUA 4YLQH 4MPWA 1GVKB 1MAYA 1S6LA 3PWBA 2NU3E 2J2UA 2KAIA 1C2EA 4TPYA 1E37B 2QA9E 2A5KA 3RMOH 1UHBB 2XWBI 1AVXA 3MO3A 3P70B 1YGCH 2XNIA 1C1UH 2CJIA 1KXAA 3EQ0H 2BVSH 3A85A 2ZG0H 2O8TA 3LJJA 2GDDA 2Z9JA 2WZQA 4XBCA 2OBQA 1MUEB 3KQEA 1HIAB 4ZH8A 3RXDA 4D7FA 2BLQA 3EGKH 2OINA 3UR9A 3W1EA 1BZXE 5C0UA 4KKDA 3ENSB 3A83A 4BAKB 1DWEH 1GMHF 4X6PA 3QK1A 2R2MB 3SU4A 1A61H 1K22H 5DK1A 1GGDB 1A3EH 1QZ8A 4BNRA 2YNBA 1P03A 5AVDA 4X1NU 2GX4A 5LPRA 1HYLA 2M5TA 2RFKC 1WQSA 1NRQH 3W95A 1AD8H 3SHAH 1O5DH 1HLTH 1G2LA 1IQFA 2HRVA 5HGGA 1HFDA 2R9PA 1P2NA 1P8VC 1OSSA 5C1YA 4X8UH 1ZHPA 5EGMA 1C9PA 4XBBA 4AGJA 2F9BH 1AMHA 3VG8A 1SLXB 2W3IA 2WPIS 4I32A 2QGRA 2ULLA 3M3VA 4IMQA 3ATWA 3TPIZ 2R2WU 3HKJB 3U98H 2FLRH 4ZHLU 4X8VH 1BMNH 1GVLA 3FAOA 3DUXH 1P2QA 2FOMB 5GCHF 1O2UA 1SKYE 2HLCA 4B73A 1FV9A 2STBE 4FUHA 1PFXC 2B7DH 1EOLA 3ZZ4A 1QA7A 5EW2H 1LPZB 1GJ9B 1IHTH 1O31A 2BXTH 2QF0A 3SV8A 1EPTA 4ABEA 4KP0A 1V2JT 2ZDAH 1VGCB 2A2XH 2PKAA 5AF9H 4ISOA 1EJAA 2M2AA 3DD2H 1N6YA 2Q6GA 3EAJA 1HAVA 1GHXH 1HCGA 2BDIA 4I8JA 1ZMJA 1SQRA 5A0CA 1UTQA 2A7HA 2CHAB 2VVUA 1HRTH 1QFKH 2J97A 3DT0H 5EJLA 2B8OH 2BB4A 2EI7A 1SC8U 3A86A 4BAQB 1ELCA 1GHBF 1MD7A 4O3UA 1GMDF 1XVMA 1DOJA 2PLXA 2BD5A 2R0LA 5F6MA 1HUTH 2HNTF 2DE8A 4AB8A 4BXSA 2A7CA 3MH7A 4XOJA 1AKSB 1P2IA 1Y59T 3BTFE 2BTCE 3RU4E 3UNRA 1F5RA 3LKWA 4INKA 2CGAA 5DKMA 1DX5M 7GCHF 3T62A 3FZZA 3ZZ9A 1HJ9A 2THFB 3F2FA 2A4GA 1KYNA 1WU1A 3RMNH 3OEED 1JIMA 1O3KA 2WYJA 3OY6U 3M3TA 1NFXA 1MCTA 3BTME 3KNXA 3NUMA 2CK3D 4B2CA 2FM2A 2KAIB 4OM9A 1ZHRA 2IJOB 1FIZA 4AORA 1UK3A 1YPMH 4NIWA 2FOAA 1PYTD 3KL6A 8GCHF 1ZMNA 2HPQH 3GY3A 5EQSA 2C8YB 1GI4A 1THRH 4VGCB 3SU0A 1AU8A 1AHTH 1YCPK 3SV7A 3SHCH 4ACBA 1DXWA 5EOKA 1KXEA 1C1NA 3EA9A 5EQRA 1EUFA 1AFQC 2ZDMA 4DIHH 4Q7XA 1IQNA 2OQ5A 1DUEA 1P09A 2ZDNA 1FQ3A 3SU1A 2Z7FE 2ZFSA 1GJCB 1C5QA 5CMXH 2Z6BD 2ZCKP 4Z0KA 5HXFA 4IS5A 2ANMH 5K7RA 1BBRK 5EXMA 4GAWA 4ZKOU 1BHXF 1GBFA 1RIWC 1UTOA 2BVXH 3EA7A 2FOFA 3KIDU 2Z9IA 1JRTA 4IW4E 2F9OA 3FKSD 1WQVH 1C1MA 3SU6A 1LPGB 4K1SA 3UUZA 1HXEH 2OC8A 1FY5A 5JDUB 4BTIB 1PJPA 3S7HB 1BBRH 1O5CB 2BD7A 4H6TA 1MH0A 4I8HA 2GJGA 1BTXA 1O3IA 1W0YH 1ZGVA 1CT0E 2DE9A 2AIQA 3ATLA 1S82A 5DP4A 4I8KA 3SUGA 4B1TA 1LDTT 4O97A 2H9TH 1ELVA 1G3CA 2BQWB 1FY1A 2LELA 3QGJA 4X1QU 3E90B 2UUFB 1O30A 1NT1A 1YLCA 1O2YA 5FPSA 1T8LA 3IITA 1D4PB 2ZFTA 2ZU4A 1GHZA 1D3QB 1Z8JB 2V7QD 5JB8S 3ZIAD 5IK2D 4NGAH 1PPGE 4A1XA 1C2DA 1FY3A 1WV7H 3BTHE 3P92A 1O3MA 3KGPA 4FXGH 5T1VA 3EYDA 1QBOA 1QCPA 1C5VA 1MBQA 5F53A 1AO5A 2JJ2D 1XKBC 4NCYA 1O2KA 1UMAH 1H8IH 2PKSC 3ESTA 2VGCB 1CA0B 2PKAB 1LHGH 4X2XA 4AN7A 1DANH 3S9BA 2TBSA 1UW7A 4CBOA 2ZHFH 2F9VA 1ZOMA 8LPRA 5GXPA 1X7AC 2G51A 4BTTB 5E2PA 1YP9A 1NC6A 2ZFPH 1O5BB 4O3TA 1O3FA 1F2SE 4ZUHA 4B75A 1Y3WA 4K8YA 2P95A 3M7TA 3VB3A 4U30A 1Y3XA 2Z3DA 3QO6A 3SNCA 3UREA 4DVAU 2WPDD 1TQ0B 1YY3A 1IQKA 1DWDH 4NZQA 1XKAC 1L1NA 1MTVA 3TK5A 1PQAA 2PUQH 1NS3A 6ESTA 1KXCA 1Y5AT 2OXSA 1D6RA 2VIWA 3STJA 1BTWA 1H9LB 1FONA 4OS5A 6GCHG 1D3TB 1G9IE 2C90B 2TGTA 4FUEA 3U1JB 2HNTE 1Q2WA 1RTKA 4PROA 1ZTKA 2ZU5A 4M7GA 5C1XA 2JH6D 2CF9H 2GKVE 3UTUH 3N99A 5EODA 1HJAB 4I7YH 1TNIA 1T31A 2ZGCA 1GBDA 2ZA5A 4CHAC 1GI9B 1P10A 4Y71A 3BIUH 1ELGA 2ZGBH 3PTBA 5L6NH 2G81E 2XNDD 2OTVA 3QTOH 1TABE 2NU0E 5EQQA 3RU4T 4CR9A 1O5GH 1TNKA 4ISNA 6CHAC 3PMJA 1HJ8A 1NTPA 1QB6A 1UCYE 3PLBA 3F0PA 2VNTA 2XC0A 1A3BH 1KLTA 1O5FH 1TALA 2UWLA 2BHGA 1W3CA 2HNTC 4HFPB 1GBTA 5FHTA 5DSFA 1UTJA 3URDA 1MU6B 1AUJA 3GY5A 1H9IE 2VBCA 2WPLS 1DT2A 3SYJA 1VR1H 4X1RU 4AFZA 2I6QA 5EXLA 4HI3A 1K1LA 1L2EA 5HMAA 1SGYE 1LKAA 4X6MA 1V2NT 4DOQA 4CRFA 4ABGA 5A2MH 3U1IB 1MTNB 1YWUA 4Y76A 3PM3A 1C5OH 2ZU2A 1LO6A 5FCRA 3D62A 4B6EA 2BM2A 5B6LA 1P2JA 3PO1B 1IQEA 4NFEA 1TMBH 3RXJA 3BG4B 5FBIA 1PPFE 1TE0A 2ZIQH 3CENA 4WJG2 1AI8H 2ALVA 3TK6A 1AE8H 1W2KH 1O37A 3M37A 1FJSA 5BPEA 2V3MA 1VITG 3MTYA 1O39A 1O3HA 4JYTA 5ABWA 1TRYA 1ANEA 3SJ9A 2SGEE 4I33A 3RC5A 2STAE 2UWPA 3ZZBA 1NN6A 3OX7U 4ZHMU 5C5NA 1GJ6A 2PR3A 1ZSJA 1EKBB 3Q00A 2ZGHA 4YTAA 1XX9A 1ZHMA 3K6ZA 2V3OH 5DP8A 2AMPA 2FPZA 1O36A 1LCYA 3UB0A 1DY8A 2GZ9A 2XYAA 1ZSLA 4O9VA 2BD3A 3SJKA 1GI1A 3F9GA 5C17A 1C1OA 2ZCHP 1ABJH 5FPYA 2G5NA 1ESAA 1SGDE 1ORFA 4MDSA 2JKHA 1TNJA 4U32A 3TJNA 1SGFG 2FDAA 3MU1A 2W7SA 2J94A 2IOTA 1V2WT 2VIQA 4K1EA 1IQIA 1JXPA 1C1PA 1CBWC 1Z8IB 3KEEA 4HG6A 1DVAH 1NZQH 1K1IA 3EE0B 1C5PA 3VB4A 1YF4A 1FMGA 1G3EA 2WV4A 1BRCE 2H6MA 3AAVA 5JBBS 2XC5A 3O8BA 1NY22 5JBCS 1LVBA 1RRKA 4MNVA 2BLOA 5T3HA 3HK6B 3R0FA 2P3FH 3UR6A 2OBOA 3ATMA 1JRSA 2BQ7B 3GISB 1UVUH 2VVVA 2F9UA 4WY3A 3A7TA 2Y5HA 4Y7BA 3TH3H 1NFUA 1GI6A 4RT0A 3ZZ6A 4YT7H 1A0HB 1PQ5A 1GG6B 4RSPA 1AB9B 4NG9H 4DCDA 5A8YA 3A80A 1BTYA 1TAWA 1SLWB 1GBCA 2B9LA 4E7NA 5EXNA 1FN6A 2A0QB 2A32A 5DP3A 3KYGA 1Y5BT 2EQNA 4ABJA 1O2MA 3H5CB 4ABBA 1OWJA 1F0RA 1S81A 2IPHA 1UTLM 7ESTE 1FNIA 4ZAEA 2QYIA 2OP9A 1QRWA 4MNWA 3CNRA 1G2MA 1SMFE 1MMJN 2FI4E 6LPRA 5ESTE 4MPXA 2F9NA 2A4QA 1TRMA 1DFPA 3N7DA 3VGCB 1HPGA 3RLWH 1PPZA 4FUCA 4UFFH 4JMYA 2GMTC 4KTSA 1WDIA 3QDZB 1TGTA 3PRDA 3ZYDA 5JYIA 1KXBA 1YLNA 1OWEA 1NRSH 1P11E 3MO9A 2QF5A 3MO6A 4E05H 1E0FD 1O2LA 4KGAA 5GIBA 1S83A 1SQTA 3S7KB 1UVTH 5GJ4B 5FAHA 1AFEH 1SR5C 2ZFQH 3TJOA 3LH1A 2NU1E 4JYVH 1DUAA 2TRMA 1AUTC 4SGBE 1PQ8A 1MQ5A 3UIRA 2G4TA 2KR7A 1Z8RA 2VH0A 1KLIH 2OC1A 1F7ZA 1C2HA 1SGPE 5FXLA 1NFYA 3A89A 3RXOA 3RU4D 4FETA 4Y10E 1OWHA 4HZHA 1NESE 4BANB 2ZPRA 7KMEH 4F55A 3TGIE 3M3SA 1XXDA 1P12E 3RUOA 3LGTA 1EQ9A 1GJ5H 2ZHEH 2YMSB 2FOEA 1LHCH 2V3HH 5JPMH 4XE4A 1V2VT 2ZU3A 1TOMH 5FX5A 4DT4A 3SV9A 2TIOA 3VB6A 2FESH 4D8NA 1TGBA 3CS0A 2ESTE 4Y79A 4OS7A 3RXIA 1DPOA 1ANDA 4ABDA 3GS9A 6GCHF 3KQCA 3P95A 1TBZH 3GY6A 1O5AB 2PSXA 2VU8E 1ZPBA 5C94A 1W0ZU 1V2UT 4NWKA 2FEQH 2GVFA 3ZV8A 1V2LT 2G52A 1J17T 1SGIB 2HPPH 1C5XB 1O3JA 2VJ1A 1MQ6A 3P6ZB 4XBDA 5DN6D 2OCVB 1ZTJA 2EA3A 2WPHS 3TJVA 1K28D 1H9HE 2P8OC 3SQHE 3T28A 1S0QA 1BMAA 1BMLA 1YM0A 1C2IA 3QLPH 2RCEA 3U8OH 1QQ4A 1K1NA 1FXYA 3ZV9A 1QGFA 3M7QA 1YPKH 1A2CH 3OTJE 4FU9A 3MU8A 4AGKA 1MKXK 1P9SA 2QY0B 1KTTB 4TPIZ 1O32A 1V2ST 2H9HA 3QUMP 2CF8H 1T7CA 2ZNKH 2F91A 1L4DA 3DA9B 3UOUA 4J2YB 5E0GA 1J16A 1DXPA 1QQUA 5A8XA 1QJ7B 3M35A 1MKXH 2VB0A 2XCFA 2OUAA 3ODFA 3VFEA 2SGDE 2OC0A 2FX4A 4Q4LA 2HGTH 1SB1H 1RD3B 4GHTA 1WUNH 3Q77A 3S0NA 1P05A 1O2TA 1GDNA 2VIVA 2XBYA 2ZDLA 2PSYA 5HYOA 4K1TA 3O8CA 3GICB 1QR3E 1XVOA 4CRCA 3LGIA 4YOIA 2G5VA 1T8OA 1CQQA 2CHAC 2BD2A 2QAAA 3P8OA 4DURA 1QL9A 1SQOA 1HAHH 4RKOB 1MABB 1AY6H 3UAIC 3LIWA 1F0TA 2KX4A 4ZXYH 2ZP0H 2IN2A 3VXEH 4JZ1A 1RXPA 1VITF 3UFAA 4FUGA 1SBWA 1IQHA 3SNDA 4ASUD 1W14U 3MI4A 3VPKA 1W10U 1C1SA 2B5TB 1SFIA 4WXIA 2ZTYA 5BRRE 1TA2A 2EC9H 2AYWA 1GBHA 4BOHA 1DSUA 3SGAE 2QCYA 1CA8B 1W0JD 4Y8XA 1QY6A 1FI8A 2ZKSA 1GHAG 2SFAA 2XBWA 1SFQB 3GY4A 4NA9H 5CHAC 3SV2H 4WMDA 1ZRKA 2VVCA 1GBBA 3ZVCA 2FYQA 1CT4E 2XW9A 2ANKH 1HXFH 1TGCA 3M7UA 4DT7B 1GI3A 2WSSD 1ZJKA 5JB9S 1UTKA 5TCCA 1BMFD 1WAYB 5LH8A 2EEKA 3AVZA 3T2NA 2QF3A 2A5AA 2TGPZ 1RFNA 4TY6A 1S85A 1CE5A 3SNEA 2G00A 1J15A 5TCAA 3HGNA 3VXFH 1NBME 4ZXXH 4CH8B 3TIUA 3KHVA 4FU7A 2BLWA 4FUIA 2AGGX 1E1RD 3E16B 2FS9A 3K65B 9LPRA 1NO9H 1P0SH 1GMCF 3M61U 4I31A 1ZRBA 2VWOA 1D3PB 1K1JA 4JZFH 1QRZA 3GCHC 2Y7ZA 5FBEA 1A7SA 2F9PA 4B2BA 3IG6B 1QJ6B 1JBUH 1B0FA 3M5OA 3PWCA 1N6XA 4BAHB 1M9UA 1P02A 4KTCA 2Z3CA 2W5EA 1ETTH 2SGAA 1Z6JH 3UQOA 4K60A 4WH6A 3DSOA 3OTPA 3A8CA 2ZCLP 1VKYA 3A7XA 3ODDA 1UTMA 2ZWLH 1GI7B 3QZQA 1Y3VA 2B0FA 5A0BA 4TSFD 1J14A 2K0QA 5IYTA 1JMOH 1O3BA 5GDSH 3MFJA 2Z9GA 1W13U 3ATIA 3GOVB 2A31A 1XM1A 3A82A 1FAXA 1MZDA 1ABIH 1HAGE 3PLKA 1FX0B 2ALPA 1O3CA 3I78A 5TJXA 1EP6A 1Z6EA 2BZ6H 1MKWH 3WY8A 2IJD1 1E79D 2QXJA 5AHGH 3E0PB 3D65E 2VGCC 1SVPA 3PYHA 1XUFA 3QTVH 3HKIB 2ASUB 1OHHD 1TPSA 1KLJH 3BTQE 4FUDA 2AHME 1DS2E 3V13A 1LQDB 2WPMS 3BIVH 2G8TA 1GJAB 3O8RA 1YPLH 3WWFA 3RLYH 2PTCE 4CREA 1XXFA 3SW2B 5A8ZA 3P8GA 1O38A 1AIXH 3OAAD 4HGCA 3DFJA 4WWYA 1DICA 1ARBA 1GBLA 1DLKB 1UK2A 3A84A 1HAYB 4IGDA 1A46H 3C27B 1IQJA 2PUXB 3VB7A 4X8SH 4I8GA 1EPTB 1C1WH 2ZFRH 3NKKA 5HM9A 1WTHD 3RXEA 1QTFA 2FI5E 4AZ2B 4ESTE 3GDUA 1GL1A 1MAXA 1NPMA 1HAVB 1PPBH 1TMTH 1TRNA 1TX8A 4ISLA 3SGBE 1TQ7B 3K2UA 4IC6A 1BOQA 1CHOG 1ZYOA 4NIXA 1OYQA 3PROA 4ABFA 5A09A 3RMLH 3SORA 1G37A 2RDLA 1FZZA 2ANYA 2XXLA 4MPUA 1WXRA 2XRCA 9ESTA 2SGQE 2GCHG 2A4RA 2KFWA 3V7TA 1OYTH 3H09A 3MH5A 2ZTXA 2A7JA 2F43B 1UVSH 4UFEH 2D2DA 2FLBH 1CU1A 5DP6A 3CS7A 2OLGA 3LPRA 4WVPE 1C2GA 1G36A 2Z3EA 3KN2A 2BX3A 4FVDA 3QGNB 3MNCA 5CHBA 1BRUP 1QNJA 1H8ED 2XWAA 1VZQH 3HPTB 5HIYA 4GHQA 4XSKU 2PKSB 4H4FA 1QRXA 2FIRH 5EPNA 1P57B 2A45B 2AGIX 1O2VA 2YOLA 1P2KA 1AWFH 2J98A 1IQGA 3D23A 1NROH 2AERH 1T4VH 3SU2A 1QJ1B 3FP8E 3LONA 3DHKH 3P8NA 3NCLA 1SOTA 1PPCE 1THSH 2Q1JA 1FPCH 3TGKE 3D49H 2C8WB 3UQVA 4IN2A 1HAPH 2ZHWH 3PMAB 5F8ZA 1PPEE 3ZZCA 1SHHB 1EATA 2R0KA 1J8AA 1C5ZB 2BDYA 1AN1E 1GCDA 1OPHB 4CR5A 2D8WA 1O2PA 1ZLRA 1GDUA 2P3TB 1MTNC 2SGPE 3BG8A 1TPOA 1EZQA 1A5IA 4NSVA 1E34B 1O2GH 3OE7D 1GJ4H 1EZUC 4AG1A 5T6FA 1YYY1 3SU3A 1GBKA 4IBLH 3BG4C 3HGPA 2FOGA 1COWD 1SGQE 1O2HA 2GGVB 2WUBA 2L74A 2UUYA 5SGAE 2P3UB 2SGFE 3HK3B 4NA8A 3T25A 4K3JA 4YT6H 3EA8A 3RXKA 2HOBA 2Y6TA 1ANBA 1DE7H 4OS4A 4JZIA 3LGYA 3SUFA 1VITH 1GCTC 1ESTA 3TK9A 4F48B 5E2OA 1BQYA 5JBTA 1V2OT 1RS0A 2BXUH 3EE7A 4U2WA 3RC6A 1K1MA 2FI3E 4AB9A 1K2I1 3E91A 2BDAA 3I77A 1O2SA 2VIOA 4Y0YE 1O35A 3UNQA 2BDHA 2G4UA 1P3CA 2J34A 5DJ7A 6CHAB 3SJIA 2A4OA 2FTLE 1FAKH 1LVMA 2ODPA 3MYWA 3FO8D 3RXTA 1GHAF 1V2MT 1S84A 1O2JA 3F0OA 2AMDA 3S9CA 1TNLA 5F03A 5C2ZA 1TYNA 2CN0H 3E3TA 3NPSA 1LVYA 1ETRH 2KCYA 3F68H 1O3GA 2FTMA 3LGVA 2J5UA 3ZYEA 1O3AA 1ZJDA 1AWHB 2W6ID 1UTNA 3GY8A 2Y81A 5EJ1A 2JIZD 5C20A 5EIYA 4Y11E 4KELA 2ZECA 2BOHB 2J4IA 5DG6A 4MPVA 2BY6X 3BV9B 1N8OC 3FN8A 1C2KA 1ELFA 5EU8A 4ABIA 1SI5H 1AZ8A 1ANCA 1C1TA 1GI8B 4P00A 3WWBA 1B7XB 2FOBA 2YNAA 3G01A 2H9EH 3RXCA 3M5MA 1V2RT 1V2PT 2FYRA 3BTKE 4YOGA 3PTNA 4XRNA 3PRBA 1EB1H 3UOPA 2F3CE 1UCYH 2GCTC 1FIWA 2G55A 3SN8A 4NIVA 3ZVBA 1MTWA 3MOCA 3H7OA 4K2YA 1FDPA 1SQAA 2ZHDA 4U01A 1S5SA 2BD8A 1SGTA 4AC9A 1ZZZA 2WINI 4Q63A 2XBVA 1EFRD 4JK5A 4RN6A 4AYVB 1GG6C 2FOCA 1AB9C 3RDZA 1O2IA 4X1SU 2GT8A 2BD4A 1NFWA 3BEIB 1WSSH 2JETC 3T29A 4YESB 1BTZA 3PMHB 5E0HA 1KMHB 2Y5FA 1T4UH 1ELBA 4GLYA 2J98B 1TA6A 1BHXB 3C1KA 4JCNA 4Y8YA 3O8DA 3SU5A 2GP9B 1OP2A 2AEIH 2XBXA 2IPQX 2Y82A 1C5SA 5FL7D 3QN7A 1MTSA 2WYGA 3VB5A 2A5IA 4NWLA 4YZUA 1C5NH 5LGOA 3TU7H 3GYMA 1DWCH 1P9UA 3MH4A 1UTPA 5GNDA 2LNCA 1TIOA 1KXDA 4LXBH 4UE7H 5ETXA 4WMEA 4ZKSU 1Q3XA 3BSQA 2C93B 1KDQA 1RGQA 2Y7XA 1OKXA 2GV7A 4CRAA 4ZROA 5J4QA 4F4OC 1QHRB 3LGUA 4RI0A 4UDWH 4UFGH 3Q3YA 1JWTA 3A8AA 4JZDH 3SJ8A 1CBWB 1JIRA 1L1JA 2ZI2H 4X8TH 4ZKNU 1XUKA 2UUKB 2OD3B 2ZO3H 3SUEA 1KY9A 1CGJE 2WUCA 3LGWA 1XUJA 1EAUA 1TFXA 4D76A 4K69A 1W7XH 5L2YH 1CVWH 4K5ZA 3F1SB 4X0WU 3BTEE 4B71A 5H4IB 5C0TA 1GDQA 2C4FH 3F9EA 4OS1A 4FUFA 1SGRE 4DJZB 1WOFA 2LPRA 4FUBA 2YMSC 1WTGH 4Z6AH 4D9QA 1TOCB 2BOKA 1D9IA 1RTFB 1BTPA 4B6FA 2TPIZ 3A7ZA 2BMGB 1CHOF 2H2ZA 3PLPA 3Q3KA 3FZDA 3SUDA 1QA0A 2GDEH 4D9RA 1EX3A 3L3TA 4X6OA 3ZVFA 3LDXH 1NBMD 1L0ZA 8KME2 1AGJA 1LHFH 1SGNE 4Y8ZA 1N1LA 1IQLA 2GCHF 1UVPA 3PV4A 2O8LA 1LTOA 2V35A 4P02A 2BQ6B 2J38A 1C1RA 3AW1A 1SHYA 3TH4H 1AQ7A 1KTSB 3LU9B 2EY4C 1YC0A 1UK4A 1F5LA 1V3XA 2BX4A 1GI2A 4XDEA 2QC2A 4GSOA 5HM2A 5K0HA 1AVWA 3DSPA 4CBNA 1FUJA 1F0UA 5LPFA 1A5HA 2W26A 2AS9A 1F5KU 1TLDA 5C3NA 3NXPA 3SJOA 4AFUA 2VIPA 2K1QA 1GGDC 1HAXB 2GV6A 1EAWA 3SNAA 1SSXA 3MWIU 3ZVAA 1V2QT 4FOUC 3GDVA 4GPGA 1P04A 1VCWA 1O3OA 3BEFB 5J4SA 1EXFA 4ISHH 2H1UA 2ODQA 1EOJA 3MQKC 4ABHA 1O3DA 1BDAA 1NRPH 1GPZA 1GVZA 2HVXA 3I29A 1MCVA 3U8RH 2P94A 2VWLA 1ESBA 2GTBA 1P2OA 3P8FA 4YO9A 1UVOA 2ZPQA 1T8NA 2EI6A 2PGQB 5E8EH 5G4BA 1C2FA 2FZZA 3T5FH 4IMZA 2P16A 1HV7A 2BY8X 2HVYB 2WV9A 3B23B 4MQAA 4FVBA 2QXGA 2W3KA 1H1BA 1ZGIA 1QL8A 3ZZ5A 1YPEH 1BJUA 2VWMA 4DG4A 3EDXB 4OGXA 2GZ8A 1MD8A 2LP6A 1BIOA 1O3LA 3URCA 2ZQ2A 4AFSA 2CMYA 3OY5U 1Z7KA 1Z1IA 1YPJH 4D7GA 1Y8TA 4NZLA 1TX7A 4ZKRU 4Y0ZE 4B2AA 3ZVEA 3LC5A 1HAZB 3UWIA 2O8MA 1KDQB 1VGCC 1SLUB 1C5UA 4TYDA 4MTBA 3FOAA 3MNBA 1WBGB 1BCUH 1NRRH 2WPKS 2ZGXH 4UD9H 1C4Y2 2RDEA 3SQEE 2QE7D 3T26A 4AFQA 2ODYB 2P8OB 4J1YA 2AFQB 2KZ4A 3WW7A 3R3GB 3DCLA 1FN8A 2TGAA 2V0BA 2F83A 1TGSZ 3SBKA 3SO3A 1DWBH 2OQUA 2UUJB 4WH8A 3TNTA 3DFLA 4IC5A 1EZSC 3FP7E 3BN9A 1IHSH 4MNXA 1SL3A 1TGNA 2H5CA 1VCQA 2RG3A 5C1UA 1YPGH 1HNEE 4TY7A 5DP7A 3UPEA 3NZIA 1W11U 2FWWA 1DITH 1KXFA 1C1QA 3SV6A 1OP8A 1HGTH 1GJDB 1MU8B 3LT3A 1GI5A 2J92A 1A0LA 2PV9B 4I86A 2PP6A 1CO7E 1YBWA 3ZVDA 3GY7A 1BTUA 1L4ZA 4VGCC 4MLFB 3FP6E 1KIGH 1LQEA 1BBRE 1O33A 3ELAH 3KYFA 1E38B 3TITA 1CHGA 3PV2A 4O03A 3CP7A 2A2QH 1WYKA 4BXWA 4DGJA 5B6OA 5DO4H 3BF6H 1TB6H 2JJ1D 1AZZA 3U69H 1GBAA 1LHDH 3A7WA 1CGIE 2P93A 1GHVH 3RXMA 1VJAU 1F0SA 4AG2A 1G3DA 3AK5A 5EPYA 1E36B 2Y80A 1NU9A 4JYUH 1LHEH 1LVOA 1BUIA 3KCGH 2OC7A 5IDKA 2D26C 4AYYB 1BTHH 2W7UA 3L6PA 3ZZ3A 2KCAA 2BLVA 3F3BA 4RT1A 1GI0A 1H8DH 4TWYA 4XD7D 1HBTH 2ANWA 4BAOB 5CHAB 2AGEX 3MU0A 1O2ZA 3MHWU 3U28C 4OS6A 3GCTG 2NU2E 4X1PU 1BA8B 3A8DA 5DGJA 4ABAA 2BYAX 1C5RA 1TMUH 3VEQB 3ZZDA 1GWAA 1NRNH 1Z71A 4JK6A 1PQ7A 3E6PH 3RM0H 3V3MA 1T32A 1ZPZA 4TWWA 1UO6A 3KQ5A 1O5EH 3FFGA 3QZRA 1XUIA 4A5TS 4LZ4B 4A1TA 1MKWK 2ZTZA 2BDCA 1C5WB 1RTLA 5ESBA 1YCPH 2PGBB 1K1OA 4YM9A 2XTTB 3ATKA 4ZMAH 2L6OA 5E0JA 1O3PB 2EI8A 3GCHB 1EPTC 4Q2KA 3F2HA 1CA0C 1W7GH 1C5YB 3E8LA 1BITA 2P59A 3RP2A 3TH2H 4ZCNA 3RC4A 4DIIH 2ZPSA 5FCKA 3M5NA 4E06H 4YOJA 1AFQB 3RXBA 4Q7YA 1O2RA 4NA7A 1GHYH 4X6NA 5EG4A 1A4WH 2KCOA 2UWOA 1S6HA 1TBQH 2NU4E 3TGJE 1K9OE 3A88A 3NK8A 2PFEA 2HWLB 4GCHG 3OFND 2FOHA 3GDSA 4NSYA 1SG8B 1O2NA 2OK5A 2GZ7A 3UY9A 1RIWB 3RXSA
chains in the Genus database with same CATH topology
1J9CH 1GJ7B 1BB0B 2AIPA 1GJ8B 2Y5GA 4UONA 1CT2E 1IAUA 1ETSH 1QB1A 2ZDVH 2ZHQH 5F8TA 3RXPA 3F9FA 3SOSA 3IWMA 1SGFA 3B9FH 2ZEBA 3JZ2B 1V2TT 4Q7ZA 1E35B 5FPTA 3K6YA 3SZNA 3RXUA 2JH5D 1TNGA 4CRGA 1ELAA 1V6DA 4THNH 2RA0A 1DDJA 1Y3UA 2GT7A 1AE5A 1HJAC 3QWCH 4MVNA 1Y3YA 1ELTA 1L1GA 3JZ1B 3RM2H 4KTUA 1ELDE 4FU8A 5AFZH 2WV5A 4Y6DA 3MNXA 2ZGJA 3MH6A 1HAIH 2NWNA 1C9TA 5F8XA 1EZXC 4GUXA 1ZR0A 3OU0A 2C8ZB 3LH3A 1TNHA 2FO9A 2ZFFH 3TLOA 1LPKB 2Z9KA 1Z1JA 1INCA 3T27A 3OYPA 1CSOE 1OWDA 2ZU1A 4IN1A 1QURH 4CRBA 1ARCA 1P3EA 2FODA 2QIQA 4RKJB 1P2MA 1O34A 1A1RA 2FP7B 1LMWB 3A87A 3RXAA 3N7OA 1GBMA 3PB1E 1O2OA 4I8LA 2Z9LA 1Z8GA 3GY2A 7LPRA 3A8BA 3MU4A 3PO1C 1O2QA 1BJVA 4MNYA 4BAMB 1A5GH 1EAIA 1QBNA 1O2WA 2QV1A 1W8BH 3E0NB 1ZMLA 3KF2A 1S0RA 4JZEH 2BY9X 1GBJA 1Q31A 3AASA 1GMHG 2D1JA 2Q6DA 4XFQA 4Y7AA 1EJMA 3F9HA 1OWKA 1VJ9U 4Q80A 4LK4A 3UWJH 3ZVGA 5L2ZH 1ZSKA 5DP5A 1FY4A 1DM4B 5PTPA 3OSYA 3ZZ8A 2QXHA 4AOQA 4QT8C 1ID5H 2BY7X 2A1DB 1G32B 3A7YA 4MG3A 2Z94A 2ZQ1A 1C2JA 4CHAB 3QX5H 3S9AA 4DY7B 1JOUB 1P06A 1YLDA 1GL0E 2BZAA 2HALA 3SNBA 2BY5X 3P17H 2FS8A 3GCNA 1BRBE 1T8MA 3TVJB 1PYTC 2XCNA 2J9NA 2ZDKA 3RXQA 4NIYA 3ITIA 1BMMH 2SNVA 3FANA 4A92A 3V12A 1G3BA 4ASHA 3B8JA 4B76A 1O2XA 3S69A 2GD4B 3MMGA 3PMBB 3V0XA 2BVRH 1HDTH 5GCHG 4WXVA 1C5MD 5I25A 1SGCA 5AFYH 2O9QA 5DPAA 4BTUB 4OGYA 1HAOH 3RMMH 4A1VA 2CXVA 1ELEE 4X2WA 1ACBE 4CH2B 1C2LA 4SGAE 1YCPM 3AW0A 1EJNA 1SPJA 2C3SA 3TJUA 4R0IA 1C1VH 1TPAE 1P01A 5GWZA 1CGHA 1UCYK 1QBVH 1V2KT 2BDBA 1OP0A 1YPHE 2RA3A 2ZC9H 1G30B 5CE1A 3GYLB 1GCTB 3Q76A 1RJXB 1XUGA 5L30H 4H6SB 2XC4A 1TBRH 3LC3A 1SOZA 1QIXB 1GHWH 1WCZA 1HB0B 1GHBG 5C67A 1GMDG 2V6NA 2Q6FA 1C2MA 5GPIB 4A6LA 1MZAA 5T6DA 4E7RG 3L33A 4B74A 4INLA 1OWIA 1F92A 1UHBA 2O8UA 3GCTF 5DP9A 3ZZAA 1EASA 1NM6A 1ZTLA 2VWNA 7GCHG 1BRAA 1VCPA 1YPHC 3M36A 1B0EA 4OS2A 4R8TB 2VINA 1O3EA 1S6FA 3RXHA 4F49A 4H42U 2PW8H 2TGDA 1N8OB 1C5TA 1GBEA 1HIAA 1GMCG 3VGCC 5C5OA 2I6SA 1QB9A 1GJBB 3Q3XA 2SNWA 1OS8A 8GCHG 4UFDH 1SGEE 3RXLA 1D6WA 1FY8E 4WMFA 1AVGH 5JBAS 2PTNA 2VH6A 3HATH 3F6UH 1GBIA 3STIA 3U9AH 2WPJS 1O3NA 2GCTB 3E1XB 1OX1A 5LPEA 1TWXB 2H5DA 1C5LH 3RXFA 1PPHE 4K8BA 1UJ1A 1IOEA 2ILNA 8ESTE 4A7IB 2VIDA 3KQDA 2QN5T 5I46H 4FUJA 1XMNB 2JETB 3K9XB 1MBMA 1O0DH 1FPHH 1EAXA 3A81A 4GCHF 2JH0D 1Y5UT 3SI3H 4HTCH 1K21H 2QXIA 1D3DB 3UNSA 5A0AE 3BTGE 1TPPA 3LOXA 3BTTE 1H4WA 1OXGA 3M5LA 4INHA 2J95A 1IQMA 1K1PA 2AMQA 1BT7A 1MTUA 1QL7A 3ZZ7A 4WF8A 2AH4X 2CV3A 3H7TA 1B5GH 2BD9A 1OOKB 1SLVB 2ZF0H 2FXRA 4ISIH 3AAUA 5EW1H 3SGQE 3A7VA 1ZPCA 4CRDA 2R3UA 5T6GA 3SI4H 1FLEE 2PHBA 1DY9A 2ZZUH 1YKTA 1NU7B 1EB2A 2BDGA 3RXRA 4NFFA 4AX9H 1THPB 3BTDE 5FX6A 4YLUA 1TX6A 4X2YA 1DSTA 1TONA 1EP5A 3LJOA 4UEHH 3U8TH 3BEUA 3GCOA 3RXVA 2FMJA 2GMTB 3RXGA 3FVFB 1KSNA 1U6QA 3MU5A 2C8XB 3W94A 3NWUA 1DLEA 4LZ1H 3KQBA 1AKSA 2O8WA 4ZHAA 3TNSA 2FX6A 4DW2U 4LOYH 4X2VA 1W12U 1C4V2 3MNSA 2PWXA 3BTWE 2R3YA 1XUHA 1C4U2 1LKBA 1A0JA 2DUCA 4GVUA 4YLQH 4MPWA 1GVKB 1MAYA 3PWBA 2NU3E 2J2UA 2KAIA 1C2EA 4TPYA 1E37B 2QA9E 2A5KA 3RMOH 1UHBB 2XWBI 1AVXA 3MO3A 3P70B 1YGCH 2XNIA 1C1UH 2CJIA 1KXAA 3EQ0H 2BVSH 3A85A 2ZG0H 2O8TA 3LJJA 2GDDA 2Z9JA 4XBCA 2OBQA 1MUEB 3KQEA 1HIAB 4ZH8A 3RXDA 4D7FA 2BLQA 3EGKH 2OINA 3UR9A 1BZXE 4KKDA 3ENSB 3A83A 4BAKB 1DWEH 1GMHF 4X6PA 3QK1A 2R2MB 3SU4A 1A61H 1K22H 5DK1A 1GGDB 1A3EH 4BNRA 2YNBA 1P03A 5AVDA 4X1NU 2GX4A 5LPRA 1HYLA 2M5TA 1WQSA 1NRQH 3W95A 1AD8H 3SHAH 1O5DH 1HLTH 1G2LA 1IQFA 2HRVA 5HGGA 1HFDA 2R9PA 1P2NA 1P8VC 1OSSA 5C1YA 4X8UH 1ZHPA 5EGMA 1C9PA 4XBBA 4AGJA 2F9BH 1AMHA 1SLXB 2W3IA 2WPIS 4I32A 2QGRA 2ULLA 3M3VA 4IMQA 3ATWA 3TPIZ 2R2WU 3HKJB 3U98H 2FLRH 4ZHLU 4X8VH 1BMNH 1GVLA 3FAOA 3DUXH 1P2QA 2FOMB 5GCHF 1O2UA 2HLCA 4B73A 1FV9A 2STBE 4FUHA 1PFXC 2B7DH 1EOLA 3ZZ4A 1QA7A 5EW2H 1LPZB 1GJ9B 1IHTH 1O31A 2BXTH 2QF0A 3SV8A 1EPTA 4ABEA 4KP0A 1V2JT 2ZDAH 1VGCB 2A2XH 2PKAA 5AF9H 4ISOA 1EJAA 3DD2H 1N6YA 2Q6GA 3EAJA 1HAVA 1GHXH 1HCGA 2BDIA 4I8JA 1ZMJA 5A0CA 1UTQA 2A7HA 2CHAB 2VVUA 1HRTH 1QFKH 3DT0H 2B8OH 2BB4A 2EI7A 1SC8U 3A86A 4BAQB 1ELCA 1GHBF 1MD7A 4O3UA 1GMDF 1XVMA 1DOJA 2PLXA 2BD5A 2R0LA 5F6MA 1HUTH 2HNTF 2DE8A 4AB8A 4BXSA 2A7CA 3MH7A 4XOJA 1AKSB 1P2IA 1Y59T 3BTFE 2BTCE 3RU4E 3UNRA 1F5RA 3LKWA 4INKA 2CGAA 5DKMA 1DX5M 7GCHF 3T62A 3FZZA 3ZZ9A 1HJ9A 2THFB 2A4GA 1KYNA 1WU1A 3RMNH 1JIMA 1O3KA 2WYJA 3OY6U 3M3TA 1NFXA 1MCTA 3BTME 3KNXA 3NUMA 4B2CA 2FM2A 2KAIB 1ZHRA 2IJOB 1FIZA 4AORA 1UK3A 1YPMH 4NIWA 2FOAA 1PYTD 3KL6A 8GCHF 1ZMNA 2HPQH 3GY3A 5EQSA 2C8YB 1GI4A 1THRH 4VGCB 3SU0A 1AU8A 1AHTH 1YCPK 3SV7A 3SHCH 1DXWA 5EOKA 1KXEA 1C1NA 3EA9A 5EQRA 1EUFA 1AFQC 2ZDMA 4DIHH 4Q7XA 1IQNA 2OQ5A 1DUEA 1P09A 2ZDNA 1FQ3A 3SU1A 2Z7FE 2ZFSA 1GJCB 1C5QA 5CMXH 2Z6BD 2ZCKP 4Z0KA 5HXFA 4IS5A 2ANMH 5K7RA 1BBRK 5EXMA 4GAWA 4ZKOU 1BHXF 1GBFA 1RIWC 1UTOA 2BVXH 3EA7A 2FOFA 3KIDU 2Z9IA 1JRTA 4IW4E 2F9OA 1WQVH 1C1MA 3SU6A 1LPGB 4K1SA 3UUZA 1HXEH 2OC8A 1FY5A 5JDUB 4BTIB 1PJPA 3S7HB 1BBRH 1O5CB 2BD7A 4H6TA 1MH0A 4I8HA 1BTXA 1O3IA 1W0YH 1ZGVA 1CT0E 2DE9A 2AIQA 3ATLA 1S82A 5DP4A 4I8KA 3SUGA 4B1TA 1LDTT 4O97A 2H9TH 1ELVA 1G3CA 2BQWB 1FY1A 3QGJA 4X1QU 3E90B 2UUFB 1O30A 1NT1A 1YLCA 1O2YA 5FPSA 1T8LA 3IITA 1D4PB 2ZFTA 2ZU4A 1GHZA 1D3QB 1Z8JB 5JB8S 4NGAH 1PPGE 4A1XA 1C2DA 1FY3A 1WV7H 3BTHE 3P92A 1O3MA 3KGPA 4FXGH 3EYDA 1QBOA 1QCPA 1C5VA 1MBQA 1AO5A 1XKBC 4NCYA 1O2KA 1UMAH 1H8IH 2PKSC 3ESTA 2VGCB 1CA0B 2PKAB 1LHGH 4X2XA 4AN7A 1DANH 3S9BA 2TBSA 4CBOA 2ZHFH 2F9VA 1ZOMA 8LPRA 5GXPA 1X7AC 2G51A 4BTTB 5E2PA 1YP9A 1NC6A 2ZFPH 1O5BB 4O3TA 1O3FA 1F2SE 4ZUHA 4B75A 1Y3WA 4K8YA 2P95A 3M7TA 3VB3A 4U30A 1Y3XA 2Z3DA 3QO6A 3SNCA 3UREA 4DVAU 1TQ0B 1IQKA 1DWDH 4NZQA 1XKAC 1L1NA 1MTVA 3TK5A 1PQAA 2PUQH 1NS3A 6ESTA 1KXCA 1Y5AT 2OXSA 1D6RA 2VIWA 3STJA 1BTWA 1H9LB 1FONA 4OS5A 6GCHG 1D3TB 1G9IE 2C90B 2TGTA 4FUEA 3U1JB 2HNTE 1Q2WA 1RTKA 4PROA 1ZTKA 2ZU5A 4M7GA 5C1XA 2JH6D 2CF9H 2GKVE 3UTUH 5EODA 1HJAB 4I7YH 1TNIA 1T31A 2ZGCA 1GBDA 2ZA5A 4CHAC 1GI9B 1P10A 4Y71A 3BIUH 1ELGA 2ZGBH 3PTBA 5L6NH 2G81E 2OTVA 3QTOH 1TABE 2NU0E 5EQQA 3RU4T 4CR9A 1O5GH 1TNKA 4ISNA 6CHAC 3PMJA 1HJ8A 1NTPA 1QB6A 1UCYE 3PLBA 2VNTA 2XC0A 1A3BH 1KLTA 1O5FH 1TALA 2UWLA 2BHGA 1W3CA 2HNTC 4HFPB 1GBTA 5FHTA 1UTJA 3URDA 1MU6B 1AUJA 3GY5A 1H9IE 2WPLS 1DT2A 1VR1H 4X1RU 4AFZA 2I6QA 5EXLA 4HI3A 1K1LA 1L2EA 5HMAA 1SGYE 1LKAA 4X6MA 1V2NT 4DOQA 4CRFA 4ABGA 5A2MH 3U1IB 1MTNB 4Y76A 3PM3A 1C5OH 2ZU2A 1LO6A 5FCRA 3D62A 2BM2A 1P2JA 3PO1B 1IQEA 4NFEA 1TMBH 3RXJA 3BG4B 5FBIA 1PPFE 1TE0A 2ZIQH 3CENA 4WJG2 1AI8H 2ALVA 3TK6A 1AE8H 1W2KH 1O37A 3M37A 1FJSA 5BPEA 3MTYA 1VITG 1O39A 1O3HA 4JYTA 5ABWA 1TRYA 1ANEA 3SJ9A 2SGEE 4I33A 3RC5A 2STAE 2UWPA 3ZZBA 1NN6A 3OX7U 4ZHMU 5C5NA 1GJ6A 2PR3A 1ZSJA 1EKBB 3Q00A 2ZGHA 4YTAA 1XX9A 1ZHMA 3K6ZA 2V3OH 5DP8A 2AMPA 2FPZA 1O36A 1LCYA 1DY8A 2GZ9A 2XYAA 1ZSLA 4O9VA 2BD3A 3SJKA 1GI1A 3F9GA 1C1OA 2ZCHP 1ABJH 5FPYA 2G5NA 1ESAA 1SGDE 1ORFA 4MDSA 2JKHA 1TNJA 4U32A 3TJNA 1SGFG 2FDAA 3MU1A 2W7SA 2J94A 2IOTA 1V2WT 2VIQA 4K1EA 1IQIA 1JXPA 1C1PA 1CBWC 1Z8IB 3KEEA 1DVAH 1NZQH 1K1IA 3EE0B 1C5PA 3VB4A 1YF4A 1FMGA 1G3EA 2WV4A 1BRCE 2H6MA 3AAVA 5JBBS 2XC5A 3O8BA 1NY22 5JBCS 1LVBA 1RRKA 4MNVA 2BLOA 5T3HA 3HK6B 3R0FA 2P3FH 3UR6A 2OBOA 3ATMA 1JRSA 2BQ7B 3GISB 1UVUH 2VVVA 2F9UA 4WY3A 3A7TA 2Y5HA 4Y7BA 3TH3H 1NFUA 1GI6A 3ZZ6A 4YT7H 1A0HB 1PQ5A 1GG6B 4RSPA 1AB9B 4NG9H 4DCDA 5A8YA 3A80A 1BTYA 1TAWA 1SLWB 1GBCA 2B9LA 4E7NA 5EXNA 1FN6A 2A0QB 2A32A 5DP3A 1Y5BT 4ABJA 1O2MA 3H5CB 4ABBA 1OWJA 1F0RA 1S81A 2IPHA 1UTLM 7ESTE 1FNIA 4ZAEA 2QYIA 2OP9A 1QRWA 4MNWA 1G2MA 1SMFE 1MMJN 2FI4E 6LPRA 5ESTE 4MPXA 2F9NA 2A4QA 1TRMA 1DFPA 3VGCB 1HPGA 3RLWH 1PPZA 4FUCA 4UFFH 4JMYA 2GMTC 4KTSA 3QDZB 1TGTA 3ZYDA 5JYIA 1KXBA 1OWEA 1NRSH 1P11E 3MO9A 3MO6A 4E05H 1E0FD 1O2LA 4KGAA 5GIBA 1S83A 1SQTA 3S7KB 1UVTH 5GJ4B 5FAHA 1AFEH 1SR5C 2ZFQH 3TJOA 3LH1A 2NU1E 4JYVH 1DUAA 2TRMA 1AUTC 4SGBE 1PQ8A 1MQ5A 3UIRA 2G4TA 1Z8RA 2VH0A 1KLIH 2OC1A 1F7ZA 1C2HA 1SGPE 5FXLA 1NFYA 3A89A