3UREA

Repack mutant (t181i, w199l, q210i) of alpha-lytic protease
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLIQGNACMGRGDSGGSLITSAGQAIGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional modulation of a protein folding landscape via side-chain distortion.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase
molecule keywords Alpha-lytic protease
total genus 48
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ureA01
5DP9A 4MG3A 1V2RT 3A8BA 1C5VA 2RDLA 1HXFH 1HFDA 1N8OC 4HI3A 4WVPE 2V0BA 5PTPA 2BY6X 3OY6U 1TNLA 2P8OB 3SV7A 1MKXH 3SV2H 5A0AE 2BY7X 2VH6A 2JH5D 2ZGJA 2O8LA 3UNQA 1C4V2 3L3TA 3UQOA 2O8UA 1ZJKA 3QN7A 4O97A 2P95A 3Q3YA 1DSUA 3PB1E 4A7IB 5FX5A 3CS7A 5DK1A 3LC3A 5FX6A 1D6WA 1O2UA 4KTSA 1BRBE 2CXVA 3NUMA 5JDUB 3M5OA 4OS7A 2IPHA 3DFJA 5H4IB 5C3NA 1SGQE 1CT0E 4B2CA 3OTJE 3M3VA 1V2OT 3S9BA 3IWMA 2ZHWH 1GMDG 3KQCA 1AWFH 1GBLA 3SNCA 4NWKA 3D49H 5BPEA 3P92A 4K8YA 4U30A 2VINA 4MNVA 1OOKB 2ZCHP 3SHCH 3OSYA 1Z8JB 5L2YH 4ISOA 3RMLH 4X1PU 2CV3A 5GPIB 1SGPE 1KSNA 2ASUB 2ZF0H 3Q3XA 5T6GA 3MMGA 1SGIB 2FX6A 1G9IE 1KXAA 3FAOA 4XBCA 2XBVA 1ELVA 1QBNA 2P3TB 1FDPA 1C1OA 3LPRA 2B8OH 2ZECA 1VR1H 2VGCB 4PROA 3ZZAA 1EAWA 1DXWA 2JH0D 2Z6BD 2Y7ZA 1HJ9A 3BTGE 3S7KB 4INHA 4ABFA 1DWEH 1YPLH 3RM2H 3TJNA 3T62A 2BY9X 3ATLA 1QURH 1QJ6B 2GGVB 2C3SA 1AZ8A 1MAXA 1C2KA 4BXWA 2FEQH 1AGJA 2V6NA 4IMQA 1MH0A 1OYTH 3D23A 2ZU1A 4UFDH 5HYOA 1ZHRA 1SQAA 3LJOA 3UFAA 1C5ZB 1QY6A 1UVOA 2FLBH 4MLFB 3AW1A 1JXPA 1TLDA 2FO9A 1FIZA 5JBBS 3MNXA 2Y5HA 3SNAA 4ZXYH 4DGJA 1C2LA 1TGSZ 2PKAA 4U01A 1O39A 4ABBA 1T8MA 3CP7A 2Y5FA 4DY7B 1WAYB 1A4WH 3S9CA 1OPHB 2SGAA 2W5EA 1C5OH 4DOQA 1P10A 5TCAA 2J4IA 3MO3A 4CRDA 1FY8E 1QRWA 1KY9A 2A4RA 2PFEA 3RMMH 3WY8A 3QK1A 2FWWA 1MUEB 1O2OA 2ZFSA 3P6ZB 1MD8A 1NFYA 2V3HH 1ZSLA 2RCEA 4JYUH 4WMDA 1HJAC 1QRZA 4Y7BA 5E2PA 1B0FA 3A8CA 4O9VA 2A4QA 1QNJA 2NU1E 1TYNA 1LHFH 3F6UH 3RXSA 1B0EA 4I8LA 1GVKB 1C1QA 1C5LH 2GMTB 4ABJA 3MHWU 4ZKSU 4AORA 3D62A 3D65E 3MU8A 2GZ7A 2W7SA 1MZDA 3DHKH 4GUXA 3ZZ6A 1V6DA 4GSOA 1H9HE 3DT0H 4WH8A 2BX3A 2PGQB 3P8OA 1RIWB 1AHTH 1C2HA 3F9GA 1DM4B 4JYVH 1E34B 2LNCA 2FXRA 1C5XB 2B9LA 1YKTA 3IG6B 3SU5A 3ZYDA 5EQSA 1HAGE 4IN1A 1C1WH 2W26A 2VNTA 1N8OB 1YPKH 3SJ9A 3SU2A 1TRYA 1OWIA 1CT2E 1ELFA 5F8TA 4LZ4B 1O31A 1Y3XA 4F4OC 1DOJA 1C2DA 3A82A 3EA8A 2EI8A 4Y6DA 3VGCC 2SNWA 3GY5A 4CBNA 1EZXC 4J1YA 1WBGB 1MD7A 1LPGB 3R3GB 1JRSA 1TALA 1SBWA 4BOHA 3BTDE 1A46H 1Z7KA 3PYHA 2W3KA 3H5CB 1LDTT 4NG9H 2BD4A 4XFQA 3SGBE 2D1JA 1CA0B 2GP9B 5FXLA 4BAQB 3ODDA 1C2IA 4MPWA 1F0RA 1UJ1A 4AG2A 4ISLA 4I8JA 2QIQA 4JMYA 1CHOF 5C1YA 1TBRH 2PUQH 4DT7B 1AB9B 2HGTH 1Y5BT 5DPAA 5A09A 2O8WA 2BM2A 5GCHG 1ACBE 4ZKOU 2A4GA 1FPHH 1E36B 2BLVA 2C93B 3GY3A 7LPRA 1D3QB 1K1PA 3SN8A 1EP5A 4JK6A 1S81A 3Q3KA 4KKDA 4X6OA 1MKXK 1WU1A 1SLWB 1LCYA 2G00A 1KXCA 1GMHF 2J2UA 3SOSA 1TRNA 1QTFA 1P12E 3QWCH 3M36A 1K28D 4X1QU 4ISIH 1VITG 1V2UT 1RRKA 4A5TS 1HAZB 1CBWB 1O32A 2FOCA 1F7ZA 1GI4A 2R9PA 1TGCA 2XWBI 3S69A 3SU3A 3MI4A 1DUAA 1NU9A 3GY8A 2HOBA 3A7ZA 1TWXB 4FUFA 3LC5A 3PLKA 1AMHA 1GBMA 1FIWA 2VWLA 3UNRA 1ETRH 4D76A 2JETB 5LGOA 3SI3H 1WTHD 3VXFH 1CA0C 5J4SA 1IQIA 2F9VA 5DP3A 2FODA 3UTUH 1P3EA 1T8NA 3PV4A 6GCHF 1BJUA 1S0QA 1P2NA 2CHAB 2I6QA 1O2XA 3TU7H 2XBXA 4FU8A 4NIWA 3VGCB 2VIOA 1AVGH 1YGCH 3KL6A 3SJIA 5E8EH 2QXIA 1F5KU 1O3BA 2H6MA 3RXJA 1CHOG 2VGCC 1NFWA 2GT7A 3TGIE 3B9FH 1TA2A 1EUFA 2TGTA 3ZVCA 1LHGH 3U1IB 1EKBB 3JZ2B 1ZYOA 4WXVA 5EQQA 3S0NA 1TNKA 1W10U 3MO6A 1OP2A 3LDXH 1O3NA 1QL9A 4X0WU 1FV9A 3R0FA 1GHWH 4KTCA 4AB8A 1GDQA 3BF6H 1WCZA 1DT2A 1V2ST 1S84A 4X1RU 1QB9A 2FIRH 4HZHA 4BTIB 5F6MA 1CQQA 1HRTH 1C4U2 1V2QT 2F83A 3AASA 1UTQA 3ZZ7A 3MTYA 2BDCA 1T7CA 1OWDA 1VCQA 1HNEE 2NU3E 4CRCA 1ELBA 2CN0H 4AGKA 1RIWC 3ZZ9A 4FUIA 1J15A 1SQOA 1BTPA 5AHGH 3E16B 1DDJA 1S5SA 3DUXH 2GDEH 3P8FA 4GPGA 2W3IA 1P9SA 2H9EH 1GJ7B 4K60A 4KP0A 1CO7E 4I32A 2BD8A 2VIPA 2FOBA 1FPCH 3A8DA 2GZ8A 1LKAA 3G01A 3RXIA 1BTWA 2ZFFH 2G55A 1BTXA 4CREA 2CF8H 4YLQH 1ZGVA 4RN6A 5FBEA 1F92A 4NIXA 8LPRA 1GI1A 4FVBA 4YTAA 1P2JA 5EXNA 1E38B 4K5ZA 1QBOA 1LVOA 3ITIA 2YNAA 4UD9H 5J4QA 2PTNA 1WQSA 1HPGA 4UDWH 1OWHA 1FUJA 2UUFB 2ZTZA 1NM6A 4NIVA 1H9LB 2Z3CA 2BB4A 5EPYA 1DITH 1HYLA 1CA8B 1DY8A 1PPCE 1AFQC 4NSYA 2QCYA 1FAXA 7ESTE 2HWLB 4NA7A 5EOKA 1VJ9U 3TPIZ 4I8KA 1YBWA 1A5HA 1GMCF 5I25A 1WV7H 1QRXA 1TNIA 1AUJA 3CENA 3E0NB 1O3LA 2M5TA 2OUAA 3MOCA 3LU9B 3SU4A 4AGJA 2HPPH 2H9HA 5L30H 3SGQE 2WPLS 1HJ8A 2AGEX 3VB3A 4H4FA 2WPKS 1GHAF 4Y76A 1C1PA 4WXIA 1TMBH 1GBFA 1Z1IA 2A0QB 4A1TA 4ISNA 1UCYK 4I7YH 4B2BA 4NIYA 1CE5A 1DUEA 2J94A 4K1TA 2A45B 3UREA 1NROH 3SQHE 1FY1A 5DP8A 1TX7A 1H1BA 3EGKH 2ZHDA 3U8TH 8GCHG 3RXDA 1V2TT 1XUHA 1HIAA 1DXPA 1HAVA 3EDXB 1FY4A 4YOIA 3PLBA 2THFB 1QJ1B 3SJOA 5FBIA 2P93A 2Z94A 4FU9A 4AZ2B 2A32A 2UWPA 2G81E 5HXFA 2C8XB 2PGBB 1O37A 1Y3VA 2FOMB 1IHSH 1EAXA 1BUIA 4Z0KA 2FI3E 1P06A 1P11E 3BTFE 2ZDAH 1V2VT 3PWBA 1A61H 3UUZA 2WPMS 4ABDA 3ENSB 3O8CA 1QA0A 3TJUA 7GCHG 4FUJA 1F0SA 3I77A 1SGEE 3A81A 4IGDA 1P2QA 3U1JB 4OS5A 1GHBG 4IW4E 2BYAX 3FFGA 4ZH8A 2XC5A 5A8ZA 3BIVH 1XKBC 4NA8A 2G51A 4U2WA 1P9UA 3ZVGA 5LPRA 1ANBA 1YPEH 3BTME 2BDYA 2F9BH 4UFEH 1MCTA 6GCHG 1SHHB 2UUYA 5GWZA 1O3FA 3ATKA 2TIOA 3HGNA 4LXBH 1GI5A 1L4ZA 1ETSH 2C8ZB 1O33A 1ARCA 4BAOB 1HCGA 2QAAA 2OTVA 4XBDA 2AEIH 3M3TA 1P57B 1P05A 3GCNA 1AZZA 1DWBH 3PMHB 2ZP0H 5HGGA 1DE7H 3GDVA 4Q2KA 1G3CA 3ZZCA 1BTHH 6ESTA 3VPKA 5EW2H 2BD7A 4ABAA 1S85A 2GV6A 1Z8GA 3GYMA 2ZDNA 2BQ6B 1GBHA 4I31A 2KAIB 2ILNA 4BTUB 1A2CH 1Y3UA 1GCDA 1EX3A 1F5RA 2J92A 3EYDA 3A83A 4YT7H 1TIOA 1GJAB 4HFPB 1V2NT 2ZGBH 1K1NA 4IS5A 1KXBA 1XMNB 4WH6A 4JYTA 1GI3A 1D4PB 1O30A 4K3JA 1BRCE 1NFUA 1ZPCA 2SGEE 1B7XB 3EA7A 4Q7XA 2J34A 4IBLH 4VGCC 4OS6A 2BVRH 5A8YA 1DLEA 3LGTA 3VFEA 1L0ZA 4YLUA 1DY9A 1KLJH 1L1JA 4CH8B 2BX4A 2BY8X 1TPOA 3RXCA 4M7GA 1O3CA 4R0IA 1A3BH 4IN2A 1MU8B 2FTLE 4LK4A 1HAOH 3RC5A 1MKWH 3MH4A 1JOUB 1RGQA 1VITH 1BB0B 3DA9B 1ESTA 4WWYA 4NSVA 1BQYA 2Z3DA 3RXOA 1P2OA 2H2ZA 1UCYH 2UUKB 2F9PA 1SGYE 3LGUA 2JH6D 5EODA 3QO6A 3A7TA 3V0XA 3ATIA 2O8MA 1LVYA 2XC0A 2QGRA 2Z9IA 1THPB 3V3MA 3TH2H 2BVSH 1H4WA 2Z9GA 2ODPA 2VWMA 1JMOH 1CU1A 1P01A 2BD2A 1GJ4H 5C5OA 1RS0A 1GHBF 2XRCA 1O5EH 1TONA 4O3UA 1ELGA 3ZVAA 2ZO3H 2ZHEH 2F3CE 2RG3A 4YOJA 4ASHA 1S0RA 2PW8H 2ZEBA 1ZLRA 1IQJA 2FOFA 1ETTH 1S6FA 1NT1A 3PMBB 4CRBA 4GAWA 6CHAC 4FUGA 1ELTA 4B74A 3LOXA 5A0BA 1O34A 2VWOA 2BY5X 4AN7A 2R0KA 1P2KA 3MU5A 1J8AA 1QQUA 1ZZZA 5DGJA 1ZGIA 3BN9A 2ZIQH 1SFIA 3MFJA 1D9IA 1J17T 2QXHA 2FMJA 2V3OH 5EXMA 3RXMA 1NFXA 1BMMH 1GBJA 4ZHMU 4Q80A 1XUFA 1EPTA 3MO9A 4DIHH 4TPYA 1RTKA 1A0HB 1RTLA 1TMUH 4D7GA 2OC7A 1A5IA 2ALPA 1GG6C 1ZHMA 3PO1C 4AYVB 1BTZA 1QHRB 1LVMA 2STAE 1W2KH 2P94A 1RXPA 1DX5M 1O5GH 1C5SA 1GHXH 2FESH 2W7UA 1GBTA 4ZUHA 2ZCLP 1C5MD 1CHGA 1WQVH 1ZSKA 2FPZA 2XWAA 5JBTA 2GCHG 2ZQ1A 2BXTH 2AGGX 3FVFB 2OQ5A 4IC6A 5FPSA 1QIXB 4XE4A 1EB1H 2ZG0H 1NRRH 1SI5H 4TWYA 4U32A 5F8ZA 4Y0YE 3RU4D 4B1TA 1AN1E 1J16A 2SGFE 1QA7A 4GLYA 1AY6H 2WYGA 3UR9A 2FI4E 1GJ8B 3TVJB 3BTWE 2OBOA 5LPFA 1VCWA 3BEUA 3T28A 1G36A 3FP8E 2AIPA 1C5RA 1W7XH 1C9PA 1OWEA 1HBTH 1PFXC 2VB0A 1ANCA 1TX8A 3UQVA 1PYTD 3L6PA 1QJ7B 2PKSC 4MVNA 1D3TB 2BXUH 2JETC 1Z6EA 3RXRA 3JZ1B 5C5NA 3A7XA 3KCGH 2RA0A 1ZTKA 1GBDA 2WPHS 1G32B 3N7OA 4BAKB 1YM0A 4SGBE 4DG4A 4BXSA 1JBUH 1RFNA 3PTBA 3TH4H 2OQUA 2VJ1A 2CHAC 1MTNB 1ARBA 1TGNA 1RTFB 2XXLA 5GDSH 3RXLA 2BD5A 2LPRA 1O2NA 1ZPZA 1T4VH 1O3HA 4OS4A 1O3KA 1C5TA 1GJBB 3T27A 2A1DB 3VXEH 4AFUA 1O3IA 1C9TA 1UTKA 1C1VH 1V2MT 5A2MH 4FVDA 4WF8A 1P09A 3RXKA 4MTBA 3BTEE 2OP9A 1NESE 1FLEE 1UVUH 1SFQB 3TJVA 3QX5H 3SNDA 2PLXA 1AE8H 1TRMA 1TOMH 1TNHA 2YOLA 5IDKA 2KAIA 3SUGA 1SLUB 5EU8A 2A7CA 2HVXA 1V2KT 1A5GH 1BCUH 1FI8A 2NU0E 1G3BA 4WMFA 2SGPE 2A2XH 1MQ5A 1DANH 1MTNC 1ZR0A 3RXBA 3TJOA 1ELCA 1OWKA 3TK6A 1C2JA 4BAMB 1W12U 2DE8A 3OU0A 1DLKB 4MPUA 1O2TA 1DWDH 4DVAU 5JBAS 3A84A 3E91A 4TY6A 1HAXB 2P3FH 5GXPA 1LHEH 4F49A 1O2JA 2PKSB 2PUXB 3ATMA 1EZSC 1C2EA 3H7OA 5DP4A 4NZLA 3VEQB 4XOJA 1EJMA 1O2RA 1DFPA 4K69A 1YYY1 5CE1A 1SB1H 3RC4A 1LO6A 5DG6A 4UONA 3A7VA 1PPFE 3AAVA 1G30B 2G5VA 1RJXB 2FTMA 4CHAC 3BG8A 1WTGH 3UIRA 3TITA 4UFGH 4X6NA 5DKMA 2OXSA 2ZDKA 1E37B 1SOZA 2QF0A 3BTTE 2FYQA 4A1XA 1MTWA 1UCYE 1AD8H 1VGCC 4AFSA 2B5TB 1MBMA 2AYWA 1EPTC 2ZFQH 3NCLA 1YLDA 1EOJA 3M61U 2P59A 7KMEH 3M7TA 1C2GA 1O2MA 1GJ5H 1MAYA 1GI9B 1C1MA 4FUCA 2ULLA 2ZQ2A 2ZFPH 1AVXA 1IQGA 3F9EA 1PPHE 1UTJA 2FI5E 4TY7A 1YPJH 2XNIA 1NZQH 1PQAA 1QL8A 2Q6GA 2YNBA 4NZQA 1UVTH 2C8WB 2ZU3A 1GG6B 1O2VA 3CS0A 1Y5AT 5CMXH 3A88A 1Z8RA 2ZZUH 1G2LA 3MH7A 3TGJE 2PWXA 1HB0B 3LH3A 1O3EA 1UHBA 3P17H 2WYJA 5I46H 3UR6A 1IQHA 1GVLA 3K6ZA 3RU4E 3HPTB 1MCVA 5AFZH 1W3CA 4ISHH 1MTSA 5JBCS 1ZTJA 2BD3A 5C2ZA 1DPOA 1PPGE 2J38A 2R0LA 1UMAH 1PPZA 3E90B 1GMHG 2UWOA 3RP2A 1O5AB 4D9QA 3A87A 5DJ7A 2GCTC 1ZPBA 2CF9H 4INKA 4J2YB 3UPEA 1O3OA 1K1MA 2QYIA 1ABIH 2A5IA 2F91A 2Q1JA 4JZEH 3HKIB 4K8BA 2GZ9A 3QDZB 2NU2E 1OWJA 1C5NH 1HLTH 1NO9H 2AMQA 2ZTYA 6CHAB 1J14A 2FOAA 1IHTH 3O8RA 1GVZA 5DO4H 1TABE 4H6TA 4UFFH 1TX6A 1BBRH 3Q77A 3SUDA 1ZOMA 1EP6A 1HAIH 1SGFG 1T32A 1O38A 3DD2H 1B5GH 2FS8A 1JRTA 4CR5A 2A7JA 1SGCA 1GBKA 4ZHLU 1SMFE 3MH5A 1IAUA 1O2PA 1Y5UT 3RUOA 4A92A 3ODFA 5HMAA 5FCKA 1P04A 1C5UA 2NWNA 3BTKE 1OP8A 1K1IA 1LKBA 2EA3A 2G8TA 1W13U 2BMGB 1QL7A 1YLCA 1AO5A 1H8DH 2RA3A 5ESTE 1JIRA 3ZVDA 3FP7E 2GD4B 3SI4H 1W8BH 1W7GH 1G3DA 1GDNA 3V13A 4DURA 1GGDB 4QT8C 4DW2U 5ABWA 3KQBA 5TJXA 7GCHF 4UEHH 3KEEA 1Y8TA 1NRQH 2A31A 4Y7AA 4X2YA 2F9NA 4AG1A 1LVBA 1CGIE 5GIBA 3EA9A 1YC0A 4GCHG 2BDGA 4RKOB 2AERH 5EPNA 5DP5A 4GHQA 4YESB 4CBOA 5DP7A 2AIQA 1AE5A 1PPBH 5ETXA 1YCPM 1Z71A 4OS2A 2ZHFH 3RDZA 1VJAU 1BMAA 1QGFA 2FOGA 1MTVA 3C1KA 3ZZ8A 2GCHF 1BMNH 2BOKA 1BZXE 1K1JA 1W11U 2BTCE 1JWTA 1O2IA 1X7AC 1TGBA 2WV4A 1K1OA 3MNBA 2IJOB 1WOFA 1SGRE 1XUKA 1BHXB 2GTBA 2XBWA 4B73A 3OY5U 3HK3B 4Z6AH 3ZZ5A 1C4Y2 2ZU4A 1MTUA 1TPAE 4YM9A 2VIWA 1D3DB 2ANKH 1GBIA 2AFQB 1S83A 1V3XA 1C5PA 3P95A 1ID5H 3RU4T 2QF3A 4MNWA 2O9QA 4BANB 2FYRA 3ZV9A 2DUCA 3PM3A 3ZZDA 1HAPH 1XUIA 4X2WA 3SHAH 1TFXA 1BRUP 2F9UA 2TGAA 1AKSB 1GMDF 1WYKA 1O5DH 4INLA 1AI8H 5E0JA 3K2UA 3VB4A 4BTTB 2EC9H 2VIQA 1GHAG 4ZHAA 1GJCB 3M7QA 1SGTA 2A2QH 1FN6A 2B0FA 3LGYA 4B2AA 5G4BA 2PKAB 1BITA 1FY5A 1HJAB 1GHVH 3E0PB 3H7TA 2WV5A 1CGHA 5LPEA 1NPMA 3GOVB 3QUMP 3URCA 1EXFA 1FY3A 2H5CA 4XDEA 5GJ4B 2GMTC 5E0GA 2HALA 2WUBA 5T6DA 1OS8A 2VWNA 1Z1JA 2Q6FA 3LGIA 4Y71A 2TPIZ 5HM2A 3PO1B 1TQ0B 2NU4E 4BNRA 1LTOA 2H5DA 4IMZA 3C27B 4CHAB 1PPEE 2R3YA 1K22H 3F1SB 3SU6A 1UK3A 3A80A 2OC1A 4Y8ZA 3KQDA 1OP0A 3SU1A 2TGDA 3Q76A 3RLYH 1O2LA 1BJVA 2IN2A 3MU0A 4D8NA 1UK2A 2OLGA 3BV9B 5JB8S 2R3UA 3UOPA 3ZZ3A 1TMTH 1G2MA 2Y80A 1K1LA 3EAJA 2BVXH 4O3TA 2ZU5A 1AFEH 1K9OE 1IQLA 2P16A 2SNVA 1LMWB 4I8HA 4JZFH 1O3MA 2ZHQH 1CT4E 1P2MA 3SGAE 2EI6A 2HNTC 1C5WB 3SV6A 3GY6A 2G4TA 3E8LA 4XBBA 4AFZA 3QTVH 2DE9A 3W94A 1A0LA 2HPQH 1EJNA 3MU4A 2ZDMA 3GY7A 3ZVEA 1AVWA 1KXDA 1TB6H 1BRAA 3A8AA 4DCDA 4NFFA 2UWLA 1BIOA 4AYYB 1IOEA 5A0CA 1SLVB 3T26A 2BDIA 2K1QA 3TLOA 1GJ6A 5JPMH 1NC6A 1D3PB 2ZFTA 5B6OA 4MNYA 1ESAA 1DS2E 1SLXB 1L1GA 3BTHE 1YCPH 3A89A 1UTLM 5L2ZH 1O3JA 1TPPA 1IQEA 2PTCE 1GL0E 1GBAA 1ESBA 1O5CB 1W0YH 3GICB 3PMJA 2ODYB 1WSSH 1BA8B 3V12A 1GBBA 3SJKA 1BBRE 2H9TH 2R2WU 3F68H 2AH4X 4B76A 1GL1A 2FM2A 3E3TA 1A0JA 1O36A 2D8WA 3BTQE 4UE7H 1ZJDA 2PR3A 1M9UA 3BSQA 5FAHA 4ABHA 1NRPH 3GISB 1LQDB 4GHTA 1N6YA 1LPZB 4ABGA 1SVPA 1UVSH 3RXVA 1EATA 4RSPA 2Q6DA 1UTMA 1BTUA 5E2OA 5EW1H 3SUEA 3VB5A 3KHVA 3K6YA 1KLIH 1Z6JH 1AQ7A 1HDTH 2V35A 4OGXA 2GCTB 1ZRBA 2D26C 1HUTH 1KTSB 2BDBA 2AGIX 2GX4A 4K1SA 3U69H 3NPSA 3MNCA 2Z7FE 1GJDB 4ABIA 2H1UA 3RMNH 4FUBA 4I8GA 4A1VA 1E0FD 1EOLA 1WUNH 1XVMA 2BOHB 3TGKE 1FAKH 1NY22 1P3CA 3O8BA 2FP7B 3STJA 1K2I1 4NA9H 1XXFA 1UTOA 4NFEA 2OC8A 1O3PB 2AS9A 3L33A 1TBQH 3A86A 3AW0A 4X6PA 1D6RA 3RMOH 5EGMA 3RXFA 3GCTF 1INCA 3ZZBA 3UY9A 2OD3B 1S82A 8KME2 4X8UH 2CMYA 3KQEA 2ZI2H 2VVVA 3SBKA 3LGWA 1LPKB 3SW2B 3ZYEA 3ATWA 5AVDA 3SUFA 4DIIH 3RXGA 1GHZA 3SV9A 2ANMH 2C8YB 1C1RA 1GI7B 1EB2A 1N1LA 4TWWA 2WINI 3KIDU 3EQ0H 1C5YB 1O0DH 4GVUA 1HXEH 1C1NA 1TE0A 4WJG2 4NWLA 5L6NH 1SGNE 3FP6E 4ZMAH 2I6SA 2ZA5A 4MQAA 1QQ4A 1ZRKA 1L2EA 4XSKU 3OX7U 1Q3XA 4NCYA 3QZQA 3TNSA 1KDQB 1AIXH 1SOTA 3AVZA 1PQ8A 1GDUA 1MQ6A 1QB6A 1SSXA 1GPZA 1YCPK 3MNSA 1OYQA 4X2VA 3QGJA 3TK9A 4O03A 3VB7A 1KTTB 2C90B 5EQRA 5F03A 1UVPA 4Q7ZA 4ABEA 3Q00A 2ZTXA 3SNEA 1Z8IB 1SPJA 1O2ZA 5AFYH 2VVUA 2G52A 1GCTB 5GCHF 3TH3H 3U98H 3F9HA 1H8IH 5K0HA 2G5NA 1QCPA 1YPGH 4NGAH 1SGDE 2Z9KA 1IQNA 4R8TB 2QY0B 1NN6A 4FUEA 2Z9LA 2P3UB 1A1RA 1T8LA 1U6QA 5K7RA 3S9AA 3KNXA 1NRSH 2GVFA 1YP9A 2OCVB 1G3EA 2Y7XA 2F9OA 1IQKA 2FZZA 3TNTA 1S6HA 1EAIA 2CJIA 2ALVA 1AFQB 1MBQA 8ESTE 1K21H 1W0ZU 4CRFA 1TBZH 3B23B 5E0HA 2XCFA 1PJPA 2QXJA 3V7TA 3STIA 2BDHA 1EQ9A 2SGDE 4CR9A 1CVWH 3BEIB 1KDQA 3GDUA 1VCPA 3KF2A 1C2FA 1AB9C 1T8OA 1QR3E 3LH1A 1OSSA 1O2SA 1YF4A 4I33A 3RM0H 1OXGA 1UO6A 3FZDA 1XX9A 3QZRA 2GKVE 1VGCB 2OBQA 1HAYB 2XW9A 3T2NA 2Y6TA 1NTPA 1V2LT 2J9NA 3HGPA 1PQ5A 3PWCA 3QGNB 2ODQA 2WPIS 4FUDA 4ZROA 3UWJH 1ZMLA 1ELDE 1MMJN 4H6SB 3SO3A 1VITF 1DWCH 1H9IE 1Y59T 8GCHF 3M37A 1FJSA 1P0SH 2XC4A 3RXAA 2QV1A 1YPHC 1PYTC 2O8TA 3K65B 1EJAA 3A85A 5JYIA 1W14U 1SL3A 1SG8B 3QLPH 3RXEA 1JIMA 3SV8A 1GI0A 5C1UA 3RXPA 1QB1A 2GDDA 2FS9A 1P03A 3MU1A 3NXPA 2C4FH 1UTPA 3PMAB 2B7DH 2A7HA 5SGAE 1EPTB 5C20A 1V2WT 1MKWK 1VZQH 5TCCA 1J9CH 2VH0A 2XYAA 3MYWA 3URDA 2OINA 3BEFB 2PHBA 1F2SE 3DFLA 3UOUA 3HKJB 2Z9JA 1FQ3A 3BIUH 2BDAA 1FN8A 3BG4C 3GCHB 3LKWA 3E1XB 4GCHF 2TGPZ 2BLWA 3ZVFA 1RD3B 1C1UH 2ZPSA 1Y3WA 1GI6A 1HIAB 1BBRK 1TNGA 1OX1A 1GJ9B 4ESTE 1BHXF 4H42U 4CRGA 3RXUA 2GV7A 1YPHE 3GY2A 4X8TH 3RXHA 1F5LA 1XM1A 1GBEA 3B8JA 4BAHB 3PTNA 2FX4A 1GCTC 2SGQE 1BTYA 1KXEA 1DSTA 1TNJA 1XUGA 1QBVH 3PROA 3T25A 5ESBA 4E7NA 4X2XA 1HAVB 4YOGA 4X8SH 1GGDC 5FPYA 4Y8YA 3W95A 2FLRH 1ZTLA 2TBSA 3ZV8A 3M35A 1C1SA 1EASA 5BRRE 6LPRA 2EI7A 1UK4A 3I29A 5DP6A 1TGTA 2ZKSA 5FHTA 5T6FA 2QC2A 2Z3EA 1ZSJA 3BG4B 3GCHC 4RKJB 2HNTF 4JZ1A 4VGCB 1ZMJA 2UUJB 1GHYH 3SJ8A 1FMGA 2J95A 1Q2WA 4WY3A 1O2KA 1C5QA 1NS3A 4Q7YA 2BLQA 2HNTE 1CBWC 4LZ1H 1FZZA 2A5KA 1EZUC 4MPXA 3SU0A 4JCNA 1HAHH 4E05H 1O2WA 2ANYA 1IQFA 1LHDH 9ESTA 3EE0B 1FONA 1KIGH 3GY4A 4FXGH 1OKXA 1IQMA 2STBE 4ZAEA 1KXFA 1TAWA 4AB9A 3NZIA 3UWIA 1UHBB 1ANEA 3SNBA 4IC5A 5C67A 4D7FA 1SQTA 1FNIA 4LOYH 2VIDA 1T4UH 5HM9A 2BZAA 1CSOE 4JZIA 4X1SU 2P8OC 1NRNH 1GMCG 1L4DA 2ZGCA 5JB9S 2BQ7B 4ZKNU 1A3EH 3TIUA 5AF9H 1TQ7B 1ELEE 3ESTA 4B75A 3ZZ4A 3VB6A 1P02A 1HV7A 2ESTE 1AU8A 1ZMNA 2HRVA 2ANWA 5LH8A 1XXDA 3M5MA 2PSXA 3AAUA 3PLPA 1UTNA 3GDSA 1DVAH 3HATH 4FU7A 3FZZA 4CRAA 2OC0A 1O2GH 1LQEA 4YZUA 1QFKH 1C1TA 2XCNA 4AX9H 2Y5GA 3K9XB 2BD9A 3KN2A 2ZGXH 2R2MB 1E35B 1KLTA 2G4UA 4HGCA 4HTCH 3ZVBA 1O2QA 1A7SA 3TK5A 5FCRA 3T29A 5F8XA 1F0UA 1THSH 1YPMH 2ZPRA 4THNH 1MZAA 1HGTH 2ZPQA 4OGYA 1AUTC 3U8RH 1ZHPA 3M5LA 3UNSA 1O3DA 3LT3A 2CGAA 2AMDA 3FANA 3T5FH 5EG4A 1N6XA 1SC8U 1TPSA 9LPRA 1TOCB 1THRH 1XUJA 1SGFA 2TRMA 2XBYA 3NWUA 4CH2B 3RLWH 2Y82A 4ZXXH 4YO9A 2FOEA 2PV9B 1SR5C 2JKHA 3LGVA 1F0TA 4KTUA 2Y81A 3LONA 3RXTA 1GWAA 2BZ6H 2VIVA 4K2YA 1O3GA 1EZQA 1O2HA 3ELAH 1V2PT 1BDAA 2ZC9H 2ZNKH 4TPIZ 1PQ7A 1CGJE 2AMPA 3OYPA 2VU8E 2FOHA 1Q31A 2PSYA 2XTTB 1KYNA 2BLOA 4OS1A 4YT6H 2FDAA 1P2IA 1BT7A 3NK8A 3GCOA 5C1XA 1GBCA 1O5FH 1Y3YA 4D9RA 3KGPA 5A8XA 1L1NA 3O8DA 1V2JT 1AWHB 3NKKA 4A6LA 1ORFA 3LJJA 2ZFRH 4FUHA 4JZDH 4KELA 4TYDA 3E6PH 1FXYA 3M5NA 3GYLB 3M3SA 3U9AH 1XKAC 1G37A 2GT8A 3P8GA 3A7WA 4MPVA 5CHAC 4K1EA 1MU6B 2SFAA 2D2DA 3QTOH 1O3AA 3S7HB 2HLCA 3I78A 2WUCA 1EAUA 1DICA 4Y8XA 1BMLA 3SQEE 5IYTA 4MNXA 2BQWB 4B71A 1TA6A 1NU7B 4X8VH 2IOTA 3GCTG 4AOQA 3P8NA 5CHAB 1GI8B 3HK6B 4E06H 2QXGA 2ZCKP 4SGAE 2QA9E 4Y11E 3U8OH 2EEKA 2ZWLH 3M7UA 3RXQA 1GI2A 4JK5A 1O2YA 5EXLA 4WMEA 4KGAA 4Y10E 1ABJH 2A5AA 3LIWA 3IITA 1LHCH 4Y79A 1C2MA 3A7YA 1AKSA 2WPJS 5T3HA 1BOQA 4ZKRU 1SHYA 2QN5T 1O5BB 3MH6A 3P70B 4X6MA 2A4OA 2ZU2A 4DJZB 5FPTA 1ANDA 4X1NU 4AFQA 2ZGHA 2ZDLA 4E7RG 1XVOA 1ELAA 1P8VC 3F9FA 2VVCA 1T31A 1O35A 4MDSA 2ZDVH 2BHGA 3RC6A 3SZNA 3MWIU 3SORA 4Y0ZE
chains in the Genus database with same CATH superfamily
5DP9A 4MG3A 1V2RT 3A8BA 3F0PA 1C5VA 2LP6A 2RDLA 1HXFH 1HFDA 1N8OC 4HI3A 4WVPE 2V0BA 5PTPA 2BY6X 3OY6U 1TNLA 2P8OB 3SV7A 1MKXH 3SV2H 5A0AE 2BY7X 2VH6A 2JH5D 2ZGJA 2O8LA 3UNQA 1C4V2 3L3TA 3UQOA 2O8UA 1ZJKA 3QN7A 4O97A 2P95A 3Q3YA 1DSUA 3PB1E 4A7IB 5FX5A 3CS7A 5DK1A 3LC3A 4Z1MD 2WPDD 5FX6A 1D6WA 2YMSB 1O2UA 4KTSA 1BRBE 2CXVA 3NUMA 5JDUB 3M5OA 4OS7A 2IPHA 3DFJA 1S6LA 5H4IB 2IJD1 4F55A 5C3NA 1SGQE 1CT0E 4B2CA 3OTJE 3M3VA 1V2OT 3S9BA 3IWMA 2ZHWH 1GMDG 3KQCA 1AWFH 1GBLA 3SNCA 5C0UA 4NWKA 3D49H 5BPEA 3P92A 4K8YA 3WWBA 4U30A 2VINA 4MNVA 1OOKB 2ZCHP 3SHCH 3OSYA 1Z8JB 5L2YH 4ISOA 3RMLH 4X1PU 2CV3A 5GPIB 1SGPE 1KSNA 5C17A 2ASUB 2ZF0H 3Q3XA 5T6GA 3MMGA 1SGIB 2FX6A 1G9IE 1KXAA 3FAOA 4XBCA 2XBVA 1ELVA 1QBNA 2P3TB 1FDPA 1C1OA 3LPRA 2B8OH 2ZECA 1VR1H 2VGCB 4PROA 3ZZAA 1EAWA 1DXWA 2JH0D 2Z6BD 2Y7ZA 1HJ9A 3BTGE 3S7KB 4INHA 4ABFA 1DWEH 1YPLH 3RM2H 3TJNA 3T62A 2BY9X 3ATLA 1QURH 1QJ6B 2GGVB 2C3SA 1AZ8A 1MAXA 1C2KA 4BXWA 2FEQH 1AGJA 2V6NA 4IMQA 1MH0A 1OYTH 3D23A 2ZU1A 4UFDH 5HYOA 1ZHRA 1SQAA 3LJOA 3UFAA 1C5ZB 1QY6A 1UVOA 2FLBH 4MLFB 3AW1A 1JXPA 1TLDA 2FO9A 1FIZA 5JBBS 3MNXA 2Y5HA 3SNAA 4ZXYH 4DGJA 5CHBA 1C2LA 1TGSZ 2PKAA 4U01A 1O39A 4ABBA 1T8MA 3CP7A 2Y5FA 4DY7B 1WAYB 1A4WH 3S9CA 1OPHB 2SGAA 2W5EA 2W6ID 1C5OH 4DOQA 1P10A 5TCAA 2J4IA 3MO3A 2JJ1D 4CRDA 1FY8E 1QRWA 1KY9A 2A4RA 2PFEA 3RMMH 3WY8A 3QK1A 2FWWA 1MUEB 1O2OA 2ZFSA 3P6ZB 1MD8A 1NFYA 2V3HH 1ZSLA 2RCEA 4JYUH 4WMDA 1HJAC 1QRZA 4Y7BA 5E2PA 1B0FA 3A8CA 4O9VA 2A4QA 1QNJA 2NU1E 1TYNA 1LHFH 3F6UH 3RXSA 1B0EA 4I8LA 1GVKB 1C1QA 1C5LH 2GMTB 4ABJA 3MHWU 4ZKSU 4AORA 3D62A 5T1VA 3D65E 3MU8A 2GZ7A 2W7SA 1MZDA 3DHKH 4GUXA 3ZZ6A 1V6DA 4GSOA 1H9HE 3DT0H 4WH8A 2BX3A 2PGQB 3P8OA 1RIWB 4M9FA 1AHTH 1C2HA 3F9GA 1DM4B 4JYVH 1E34B 2LNCA 2FXRA 1C5XB 2B9LA 1YKTA 3IG6B 3SU5A 3F2HA 3ZYDA 5EQSA 1HAGE 4IN1A 1C1WH 2W26A 2VNTA 1N8OB 1YPKH 3SJ9A 3SU2A 1TRYA 1OWIA 1CT2E 1ELFA 2F43B 5F8TA 4LZ4B 1O31A 1Y3XA 4F4OC 1DOJA 1C2DA 3A82A 3EA8A 2EI8A 4Y6DA 3VGCC 2SNWA 3GY5A 4CBNA 1EZXC 4J1YA 1WBGB 3ZIAD 1MD7A 1LPGB 3R3GB 1JRSA 1TALA 1SBWA 4BOHA 3BTDE 1A46H 1Z7KA 3PYHA 2W3KA 3H5CB 1LDTT 4NG9H 2BD4A 4XFQA 3SGBE 2D1JA 1CA0B 2GP9B 5FXLA 4BAQB 3ODDA 1C2IA 4MPWA 1F0RA 1UJ1A 4AG2A 4ISLA 4I8JA 2QIQA 4JMYA 1CHOF 5C1YA 1TBRH 4P00A 2PUQH 4DT7B 1AB9B 2HGTH 1Y5BT 3DSGA 5DPAA 5A09A 2O8WA 2BM2A 5GCHG 1ACBE 4ZKOU 2A4GA 1FPHH 1E36B 4XRNA 2BLVA 2C93B 3GY3A 7LPRA 1D3QB 1K1PA 3SN8A 1EP5A 4JK6A 1S81A 3Q3KA 4KKDA 4X6OA 1MKXK 1WU1A 1SLWB 1LCYA 2G00A 1KXCA 1GMHF 2J2UA 3SOSA 1TRNA 1QTFA 1P12E 3QWCH 3M36A 3FOAA 1K28D 4X1QU 4ISIH 1VITG 1V2UT 1RRKA 4A5TS 1HAZB 1CBWB 1O32A 2FOCA 1F7ZA 1GI4A 2R9PA 1TGCA 2XWBI 3S69A 3SU3A 3MI4A 1DUAA 1NU9A 3GY8A 2HOBA 2WV9A 3A7ZA 1TWXB 4FUFA 3LC5A 3PLKA 1AMHA 2HVYB 1GBMA 1FIWA 2VWLA 3UNRA 1ETRH 4D76A 2JETB 3PRBA 1QZ8A 5LGOA 3SI3H 1WTHD 3VXFH 1CA0C 5J4SA 1IQIA 2F9VA 5DP3A 2FODA 2LELA 3UTUH 1P3EA 1T8NA 3PV4A 6GCHF 1BJUA 1S0QA 1P2NA 2KFWA 2CHAB 2I6QA 1O2XA 3TU7H 2XBXA 4FU8A 3WW7A 4NIWA 3VGCB 2VIOA 1AVGH 1YGCH 3KL6A 1SKYE 3SJIA 5E8EH 2QF5A 2QXIA 1F5KU 1O3BA 2H6MA 3RXJA 5B6LA 1CHOG 2VGCC 1NFWA 2GT7A 3TGIE 3B9FH 1TA2A 1EUFA 2TGTA 3ZVCA 1LHGH 3U1IB 1EKBB 3JZ2B 1ZYOA 4WXVA 5EQQA 3S0NA 1TNKA 1W10U 3MO6A 1FX0B 1OP2A 3LDXH 1O3NA 1QL9A 3F2GA 4X0WU 1FV9A 2YMSC 1GHWH 3R0FA 4KTCA 4AB8A 1GDQA 3BF6H 1WCZA 1DT2A 1V2ST 1S84A 4X1RU 1QB9A 2FIRH 4HZHA 4BTIB 5F6MA 1CQQA 1E79D 1HRTH 1C4U2 1V2QT 2F83A 3AASA 1UTQA 3ZZ7A 3MTYA 2BDCA 1T7CA 1YLNA 1OWDA 1VCQA 1HNEE 2NU3E 4CRCA 1COWD 1ELBA 2CN0H 4AGKA 1RIWC 3ZZ9A 4AC9A 4FUIA 1J15A 1SQOA 1BTPA 5AHGH 3E16B 1DDJA 1S5SA 3DUXH 2GDEH 3P8FA 4GPGA 2W3IA 1P9SA 2H9EH 2KZ4A 1GJ7B 4K60A 4KP0A 1CO7E 4I32A 4RI0A 2BD8A 2VIPA 2FOBA 1FPCH 3A8DA 2GZ8A 1LKAA 3G01A 3RXIA 1BTWA 2ZFFH 2G55A 1BTXA 4CREA 2CF8H 4YLQH 1ZGVA 4RN6A 5FBEA 1F92A 4NIXA 8LPRA 1GI1A 4FVBA 4YTAA 1P2JA 5EXNA 1E38B 1W0JD 4K5ZA 1QBOA 1LVOA 3ITIA 2YNAA 4UD9H 5J4QA 2PTNA 1WQSA 1HPGA 4UDWH 2GJGA 1OWHA 1FUJA 2UUFB 2ZTZA 1NM6A 4NIVA 1H9LB 2Z3CA 2BB4A 5EPYA 1DITH 1HYLA 1CA8B 1DY8A 1PPCE 1AFQC 4NSYA 2QCYA 1FAXA 7ESTE 2HWLB 4NA7A 5EOKA 1VJ9U 3TPIZ 4I8KA 1YBWA 1A5HA 1E1RD 1GMCF 5I25A 1WV7H 1QRXA 1TNIA 1AUJA 3CENA 3E0NB 1O3LA 2M5TA 2OUAA 3MOCA 2QF4A 3LU9B 3SU4A 4AGJA 2HPPH 2H9HA 2VBCA 5L30H 3SGQE 2WPLS 2F4LA 3F3BA 1HJ8A 2AGEX 3VB3A 4H4FA 2WPKS 1GHAF 4Y76A 2HLDD 1C1PA 4WXIA 1TMBH 1GBFA 1Z1IA 2A0QB 4A1TA 4ISNA 1UCYK 3PV5A 4I7YH 4B2BA 4NIYA 3CNRA 1CE5A 1DUEA 2J94A 4K1TA 2A45B 3UREA 1NROH 3SQHE 1FY1A 5DP8A 1TX7A 1H1BA 3EGKH 2ZHDA 5KEDA 3DSOA 3U8TH 8GCHG 3RXDA 1V2TT 1XUHA 1HIAA 1DXPA 1HAVA 5IK2D 3EDXB 1FY4A 4YOIA 3PLBA 2THFB 1QJ1B 3SJOA 5FBIA 2P93A 2Z94A 4FU9A 4AZ2B 2A32A 2UWPA 2G81E 5HXFA 2C8XB 2PGBB 1O37A 1Y3VA 2FOMB 1IHSH 1EAXA 1BUIA 1WDIA 4RT1A 4Z0KA 2FI3E 1P06A 1P11E 3BTFE 2V3MA 2ZDAH 1V2VT 3PWBA 1A61H 3UUZA 2WPMS 4ABDA 3ENSB 3O8CA 1QA0A 3TJUA 7GCHG 4FUJA 1F0SA 3I77A 1SGEE 3A81A 4IGDA 1P2QA 3U1JB 4OS5A 1GHBG 4IW4E 2BYAX 3FFGA 4ZH8A 2XC5A 5A8ZA 1K0HA 3BIVH 1XKBC 3OFND 4NA8A 2G51A 4U2WA 1P9UA 3ZVGA 5LPRA 1ANBA 1YPEH 3BTME 2BDYA 2F9BH 4UFEH 1MCTA 6GCHG 1SHHB 2UUYA 5GWZA 1O3FA 3ATKA 2TIOA 3HGNA 4LXBH 1GI5A 1L4ZA 1ETSH 2C8ZB 1O33A 1ARCA 4BAOB 1HCGA 2QAAA 2OTVA 5EJ1A 4XBDA 2AEIH 3M3TA 1P57B 1P05A 3GCNA 1AZZA 1DWBH 3PMHB 2ZP0H 5HGGA 1DE7H 3GDVA 4Q2KA 1G3CA 3ZZCA 1BTHH 6ESTA 3VPKA 5EW2H 2BD7A 4ABAA 1S85A 2L74A 2GV6A 1Z8GA 3GYMA 2ZDNA 2BQ6B 1GBHA 4I31A 2KAIB 2ILNA 4BTUB 1A2CH 3DCLA 1Y3UA 1GCDA 1EX3A 1F5RA 2J92A 3EYDA 3A83A 4YT7H 1TIOA 1GJAB 4HFPB 1V2NT 2ZGBH 1K1NA 3AK5A 4IS5A 1KXBA 1XMNB 4WH6A 4JYTA 1GI3A 1D4PB 1O30A 4K3JA 1BRCE 1NFUA 5CDFE 1ZPCA 2SGEE 1B7XB 3EA7A 4Q7XA 2J34A 4IBLH 4VGCC 4OS6A 2BVRH 5A8YA 1DLEA 3LGTA 3VFEA 1L0ZA 4YLUA 1DY9A 1KLJH 1L1JA 4CH8B 2BX4A 2BY8X 1TPOA 3RXCA 4M7GA 1O3CA 4R0IA 1A3BH 4IN2A 1MU8B 2FTLE 4LK4A 1HAOH 3RC5A 1MKWH 3MH4A 1JOUB 1RGQA 1VITH 1BB0B 3DA9B 1ESTA 4WWYA 4NSVA 1BQYA 4YXWD 2Z3DA 3RXOA 1P2OA 2H2ZA 1UCYH 2UUKB 2F9PA 1SGYE 1VKYA 3LGUA 2JH6D 5EODA 3QO6A 3A7TA 3V0XA 3ATIA 2O8MA 1LVYA 2XC0A 2QGRA 2Z9IA 1THPB 3V3MA 3TH2H 2BVSH 1H4WA 2Z9GA 2ODPA 2VWMA 1JMOH 1CU1A 1P01A 2BD2A 1GJ4H 5C5OA 3UB0A 1RS0A 1GHBF 2XRCA 1O5EH 1TONA 4O3UA 1ELGA 3ZVAA 2ZO3H 2ZHEH 2F3CE 2RG3A 4YOJA 4ASHA 1S0RA 2PW8H 2ZEBA 1BMFD 1IQJA 2FOFA 1ETTH 1S6FA 1NT1A 1ZLRA 3PMBB 4GAWA 4CRBA 6CHAC 4FUGA 1ELTA 4B74A 3LOXA 5A0BA 1O34A 2VWOA 2BY5X 4AN7A 2R0KA 1P2KA 3MU5A 1J8AA 1QQUA 1ZZZA 5DGJA 2RFKC 1ZGIA 3BN9A 2ZIQH 1SFIA 3MFJA 1D9IA 1J17T 2QXHA 2FMJA 5EJZA 2V3OH 5EXMA 3RXMA 1NFXA 1BMMH 1GBJA 4ZHMU 1H8ED 4Q80A 1XUFA 1EPTA 3MO9A 2J5UA 4DIHH 1SQRA 4TPYA 1RTKA 1A0HB 1RTLA 1TMUH 2V7QD 4D7GA 2OC7A 1A5IA 2ALPA 1GG6C 1ZHMA 3PO1C 5F53A 4AYVB 1BTZA 1QHRB 1LVMA 2STAE 1W2KH 2P94A 1RXPA 1DX5M 1O5GH 1C5SA 1GHXH 2FESH 2W7UA 1GBTA 4ZUHA 2ZCLP 1C5MD 1CHGA 1WQVH 1ZSKA 2FPZA 2XWAA 5JBTA 2GCHG 2ZQ1A 2BXTH 2AGGX 3FVFB 3EE7A 2OQ5A 4IC6A 5FPSA 3KQ5A 1QIXB 4XE4A 1EB1H 2ZG0H 1NRRH 1SI5H 4TWYA 4U32A 5F8ZA 4Y0YE 3RU4D 4B1TA 1AN1E 1J16A 2SGFE 1QA7A 4GLYA 1AY6H 2L6OA 2WYGA 3UR9A 2FI4E 1GJ8B 3TVJB 3BTWE 2OBOA 5LPFA 1VCWA 3BEUA 3T28A 1G36A 3FP8E 2AIPA 1C5RA 1W7XH 1C9PA 1OWEA 1HBTH 5KECA 1E1QD 1PFXC 2VB0A 1ANCA 1TX8A 3UQVA 1PYTD 3L6PA 1QJ7B 2PKSC 4MVNA 1D3TB 2BXUH 3SYJA 2JETC 1Z6EA 3RXRA 3JZ1B 5C5NA 4OM9A 3A7XA 3KCGH 2RA0A 1ZTKA 1GBDA 2WPHS 1G32B 3N7OA 4BAKB 1YM0A 4SGBE 4DG4A 4BXSA 1JBUH 1RFNA 3PTBA 4Q4LA 3TH4H 2OQUA 2VJ1A 2CHAC 1MTNB 1ARBA 1TGNA 1RTFB 2XXLA 5GDSH 3RXLA 2BD5A 2LPRA 4RT0A 1O2NA 1ZPZA 1T4VH 1O3HA 4OS4A 1O3KA 1C5TA 1GJBB 3T27A 2A1DB 3VXEH 4AFUA 2EQNA 1O3IA 1C9TA 1UTKA 2J98A 1C1VH 1V2MT 5A2MH 4FVDA 4WF8A 1P09A 3RXKA 4MTBA 3BTEE 2OP9A 1NESE 1FLEE 1UVUH 1SFQB 3TJVA 3QX5H 3SNDA 2PLXA 1AE8H 1TRMA 1TOMH 1TNHA 2YOLA 5IDKA 2KAIA 3SUGA 1SLUB 5EU8A 2A7CA 2HVXA 1V2KT 1A5GH 1BCUH 1FI8A 2NU0E 1G3BA 4WMFA 2SGPE 2A2XH 1MQ5A 1DANH 1MTNC 1ZR0A 3RXBA 3TJOA 1ELCA 1OWKA 3TK6A 1C2JA 4BAMB 1W12U 2DE8A 3OU0A 1DLKB 4MPUA 1O2TA 1DWDH 4DVAU 5JBAS 3A84A 3E91A 4TY6A 1HAXB 2P3FH 5GXPA 1LHEH 4F49A 1O2JA 2KM0A 2PKSB 2PUXB 3ATMA 1EZSC 1C2EA 3H7OA 5DP4A 4NZLA 3VEQB 4XOJA 1EJMA 1O2RA 1DFPA 4K69A 1YYY1 3OTPA 5CE1A 1SB1H 3RC4A 1LO6A 5DG6A 4UONA 3A7VA 1PPFE 3AAVA 1G30B 2G5VA 1RJXB 2FTMA 4CHAC 3BG8A 1WTGH 3UIRA 3TITA 4UFGH 4X6NA 5DKMA 2OXSA 2WSSD 2ZDKA 1E37B 1SOZA 2QF0A 3BTTE 2FYQA 4A1XA 1MTWA 1UCYE 1AD8H 4HG6A 1VGCC 4AFSA 2B5TB 1MBMA 2AYWA 1EPTC 2ZFQH 3NCLA 1YLDA 1EOJA 3M61U 2P59A 7KMEH 3FKSD 3M7TA 1C2GA 1O2MA 1GJ5H 1MAYA 1GI9B 1C1MA 4FUCA 2ULLA 2ZQ2A 2ZFPH 1AVXA 2OK5A 1IQGA 3F9EA 1PPHE 1UTJA 2FI5E 4TY7A 5KGOA 1YPJH 2XNIA 1NZQH 1PQAA 1QL8A 2Q6GA 3U28C 2YNBA 4NZQA 1UVTH 2C8WB 2ZU3A 1GG6B 1O2VA 1UW7A 3CS0A 1Y5AT 5CMXH 3A88A 1Z8RA 2ZZUH 1G2LA 3MH7A 3TGJE 2PWXA 1HB0B 3LH3A 1O3EA 1UHBA 3P17H 2WYJA 5I46H 3UR6A 1IQHA 1GVLA 3K6ZA 3RU4E 3HPTB 1MCVA 5AFZH 1W3CA 4ISHH 1MTSA 5JBCS 1ZTJA 2BD3A 5C2ZA 1DPOA 1PPGE 2J38A 2R0LA 1UMAH 1PPZA 3E90B 1GMHG 2UWOA 3RP2A 1O5AB 4D9QA 3A87A 5DJ7A 2GCTC 3OAAD 1ZPBA 2CF9H 4INKA 4J2YB 3UPEA 1O3OA 1K1MA 2QYIA 1ABIH 2A5IA 2F91A 2Q1JA 4JZEH 3HKIB 4K8BA 2GZ9A 3QDZB 2NU2E 3SZEA 1OWJA 1C5NH 1HLTH 1NO9H 2AMQA 2ZTYA 6CHAB 1J14A 2FOAA 1IHTH 3O8RA 1GVZA 2CK3D 3OE7D 5DO4H 1TABE 4H6TA 4UFFH 5C0TA 1TX6A 1BBRH 3Q77A 3SUDA 1ZOMA 1EP6A 1HAIH 1SGFG 1T32A 1O38A 3DD2H 1B5GH 2FS8A 1JRTA 4CR5A 2A7JA 1SGCA 1GBKA 4ZHLU 1SMFE 3MH5A 1IAUA 1O2PA 1Y5UT 3RUOA 2PP6A 4A92A 3ODFA 5HMAA 5FCKA 1P04A 1C5UA 2NWNA 3BTKE 1OP8A 1K1IA 1LKBA 2EA3A 2G8TA 1W13U 2BMGB 1QL7A 1YLCA 1AO5A 1H8DH 2RA3A 5ESTE 1JIRA 3ZVDA 3FP7E 2GD4B 3SI4H 4Q63A 1W8BH 1W7GH 1G3DA 1GDNA 3V13A 4DURA 1GGDB 4QT8C 4DW2U 5ABWA 3KQBA 5TJXA 7GCHF 4UEHH 3KEEA 1Y8TA 3OEHD 1NRQH 2A31A 4Y7AA 4X2YA 2F9NA 4AG1A 1LVBA 1CGIE 5GIBA 3EA9A 1YC0A 4GCHG 2BDGA 4RKOB 2AERH 2RDEA 5DP5A 5EPNA 4GHQA 4YESB 4CBOA 5DP7A 2AIQA 1AE5A 1PPBH 5ETXA 1YCPM 1Z71A 4OS2A 2ZHFH 3RDZA 1VJAU 1BMAA 1QGFA 2FOGA 1MTVA 3C1KA 3ZZ8A 2GCHF 1BMNH 2BOKA 1BZXE 1K1JA 1W11U 2BTCE 1JWTA 1O2IA 1X7AC 1TGBA 2WV4A 1K1OA 3MNBA 2IJOB 1WOFA 1SGRE 1XUKA 1BHXB 2GTBA 2XBWA 4B73A 3OY5U 3HK3B 4Z6AH 3ZZ5A 1C4Y2 2ZU4A 1MTUA 1TPAE 4YM9A 2VIWA 1D3DB 2ANKH 1GBIA 3VG8A 2AFQB 1S83A 3MQKC 1V3XA 1C5PA 3P95A 1ID5H 3RU4T 2QF3A 4MNWA 2O9QA 4BANB 2FYRA 3ZV9A 2DUCA 3PM3A 3ZZDA 1HAPH 1XUIA 4X2WA 3SHAH 1TFXA 1BRUP 2F9UA 2TGAA 1AKSB 1GMDF 1WYKA 1O5DH 4INLA 1AI8H 5E0JA 3K2UA 3VB4A 4BTTB 2EC9H 2VIQA 1GHAG 2XOKD 4ZHAA 1GJCB 3M7QA 1SGTA 2A2QH 1OHHD 1FN6A 2B0FA 3LGYA 4B2AA 5G4BA 2PKAB 1BITA 1FY5A 4ACAA 1HJAB 1GHVH 3E0PB 3H7TA 2WV5A 1CGHA 5LPEA 1NPMA 3GOVB 3QUMP 3URCA 1EXFA 1FY3A 2H5CA 4XDEA 5GJ4B 2GMTC 3F0OA 5E0GA 2HALA 2WUBA 5T6DA 1OS8A 2VWNA 1Z1JA 2Q6FA 3LGIA 4Y71A 2TPIZ 5HM2A 3PO1B 1TQ0B 2NU4E 4BNRA 1LTOA 3GS9A 2H5DA 4IMZA 3C27B 4CHAB 1PPEE 2R3YA 1K22H 3F1SB 3SU6A 1UK3A 1H8HD 3A80A 2KCOA 2OC1A 5GNDA 4Y8ZA 3KQDA 1OP0A 3SU1A 2TGDA 3Q76A 3RLYH 1O2LA 1BJVA 2IN2A 3MU0A 4D8NA 1UK2A 2OLGA 3BV9B 5JB8S 2R3UA 3UOPA 3ZZ3A 1TMTH 1G2MA 2Y80A 1K1LA 3EAJA 2BVXH 4O3TA 2ZU5A 1AFEH 1K9OE 1IQLA 2P16A 2SNVA 1LMWB 4I8HA 4JZFH 1O3MA 2ZHQH 1CT4E 1P2MA 5EJLA 3SGAE 2EI6A 2HNTC 1C5WB 3SV6A 3GY6A 4TSFD 2G4TA 3E8LA 4XBBA 4AFZA 3QTVH 2DE9A 3W94A 1A0LA 2HPQH 1EJNA 3MU4A 2ZDMA 3GY7A 3ZVEA 1AVWA 1KXDA 1TB6H 1BRAA 3A8AA 4DCDA 4NFFA 2UWLA 3NRLA 1BIOA 4AYYB 1IOEA 2W6JD 5A0CA 1SLVB 3T26A 2BDIA 2K1QA 3TLOA 1GJ6A 5JPMH 1NC6A 1D3PB 2ZFTA 5B6OA 4MNYA 2KCYA 1ESAA 1DS2E 1SLXB 1L1GA 3BTHE 1YCPH 3A89A 1UTLM 5L2ZH 1O3JA 1TPPA 1IQEA 2PTCE 1GL0E 2M2AA 1GBAA 1ESBA 1O5CB 1W0YH 3GICB 3PMJA 2ODYB 1WSSH 1BA8B 3V12A 3OEED 1GBBA 1KMHB 3SJKA 1BBRE 2H9TH 1NBME 2R2WU 3F68H 2AH4X 4B76A 1GL1A 2FM2A 3E3TA 1A0JA 1O36A 2D8WA 3BTQE 4UE7H 4XD7D 1ZJDA 2PR3A 1M9UA 3BSQA 5FAHA 4ABHA 1NRPH 3GISB 1LQDB 4GHTA 1N6YA 1LPZB 4ABGA 1SVPA 1UVSH 3RXVA 1EATA 4RSPA 2Q6DA 1NBMD 1UTMA 1BTUA 5E2OA 5EW1H 3SUEA 3VB5A 3KHVA 3K6YA 1KLIH 1Z6JH 1AQ7A 1HDTH 2V35A 4OGXA 2GCTB 1ZRBA 2D26C 1HUTH 1KTSB 2BDBA 5DSFA 2AGIX 2GX4A 4K1SA 3U69H 3NPSA 3MNCA 2Z7FE 1GJDB 4ABIA 2H1UA 3RMNH 4FUBA 4I8GA 4A1VA 1E0FD 1EOLA 1WUNH 1XVMA 2BOHB 3TGKE 1FAKH 1NY22 1P3CA 3O8BA 2FP7B 3STJA 4I86A 1K2I1 4NA9H 4F48B 1XXFA 1UTOA 4NFEA 2OC8A 1O3PB 2AS9A 3L33A 1TBQH 3A86A 3AW0A 4X6PA 1D6RA 3RMOH 5EGMA 3RXFA 3GCTF 1INCA 3ZZBA 3UY9A 2OD3B 1S82A 8KME2 4X8UH 2CMYA 3KQEA 2ZI2H 2VVVA 3SBKA 3LGWA 1LPKB 3SW2B 3ZYEA 3ATWA 5AVDA 3SUFA 4DIIH 3RXGA 1GHZA 3SV9A 2ANMH 2C8YB 1C1RA 1GI7B 1EB2A 1N1LA 4TWWA 2WINI 3KIDU 2XNDD 1C5YB 3EQ0H 1O0DH 4GVUA 1HXEH 1C1NA 1TE0A 4WJG2 4NWLA 5L6NH 1SGNE 3FP6E 4ZMAH 2I6SA 2ZA5A 4MQAA 1QQ4A 1ZRKA 1L2EA 4XSKU 3OX7U 1Q3XA 3FO8D 1MABB 4NCYA 3QZQA 3TNSA 1KDQB 1AIXH 1SOTA 3AVZA 1PQ8A 1GDUA 1W0KD 1MQ6A 1QB6A 1SSXA 1GPZA 1YCPK 3MNSA 1OYQA 4X2VA 3QGJA 3TK9A 4O03A 3VB7A 1KTTB 2C90B 5EQRA 5F03A 1UVPA 4Q7ZA 4ABEA 5FL7D 3Q00A 2ZTXA 5HIYA 3SNEA 1Z8IB 1SPJA 1O2ZA 5AFYH 2VVUA 2G52A 1GCTB 4TT3D 5GCHF 3TH3H 3U98H 3F9HA 1H8IH 5K0HA 2G5NA 1QCPA 1YPGH 4NGAH 1SGDE 2Z9KA 1IQNA 4R8TB 2QY0B 1NN6A 4FUEA 4ASUD 2Z9LA 2P3UB 1A1RA 1T8LA 1U6QA 5K7RA 2QE7D 3S9AA 5DN6D 5EIYA 3KNXA 1NRSH 2GVFA 1YP9A 2OCVB 1G3EA 2Y7XA 2F9OA 1IQKA 2FZZA 3TNTA 1S6HA 1EAIA 2CJIA 2ALVA 1AFQB 1MBQA 8ESTE 1K21H 1W0ZU 4CRFA 1TBZH 3B23B 5E0HA 2XCFA 1PJPA 2QXJA 3V7TA 3STIA 2BDHA 1EQ9A 2SGDE 4CR9A 1CVWH 3BEIB 1KDQA 3GDUA 1VCPA 3KF2A 2KCAA 1C2FA 1AB9C 1T8OA 1QR3E 3LH1A 2JDID 1OSSA 1O2SA 1YF4A 4I33A 3RM0H 1OXGA 1UO6A 3FZDA 1XX9A 3QZRA 2GKVE 1VGCB 2OBQA 1HAYB 2XW9A 3T2NA 2Y6TA 1NTPA 1V2LT 2J9NA 3HGPA 1PQ5A 3PWCA 3QGNB 2EY4C 2ODQA 2WPIS 4FUDA 4ZROA 3UWJH 1ZMLA 1ELDE 1MMJN 4H6SB 3PRDA 3SO3A 1VITF 1DWCH 1H9IE 1Y59T 8GCHF 3M37A 1FJSA 1P0SH 2XC4A 3RXAA 2QV1A 1YPHC 1PYTC 2O8TA 3K65B 1EJAA 3A85A 5JYIA 1W14U 1SL3A 1SG8B 3QLPH 3RXEA 1JIMA 3SV8A 1GI0A 5C1UA 3RXPA 1QB1A 2GDDA 2FS9A 1P03A 3MU1A 3NXPA 2C4FH 1UTPA 2YMSD 3PMAB 2B7DH 2A7HA 4B6EA 1EPTB 5C20A 5SGAE 1V2WT 1MKWK 1VZQH 5TCCA 1J9CH 2VH0A 2XYAA 3MYWA 3URDA 2OINA 3BEFB 2PHBA 1F2SE 3DFLA 3UOUA 3HKJB 2Z9JA 3DSPA 1FQ3A 3BIUH 2BDAA 1FN8A 3BG4C 3GCHB 3LKWA 3E1XB 4GCHF 2TGPZ 2BLWA 3ZVFA 1RD3B 1C1UH 2ZPSA 1Y3WA 1GI6A 1HIAB 1BBRK 1TNGA 1OX1A 1GJ9B 4ESTE 1BHXF 4H42U 4CRGA 3RXUA 2GV7A 1YPHE 3GY2A 4X8TH 3RXHA 1F5LA 1XM1A 1GBEA 5C94A 3B8JA 4BAHB 3PTNA 2FX4A 1GCTC 2SGQE 1BTYA 1KXEA 1DSTA 1TNJA 1XUGA 2K0QA 1QBVH 3PROA 3T25A 5ESBA 4E7NA 4X2XA 1HAVB 4YOGA 4X8SH 1GGDC 5FPYA 4Y8YA 3W95A 2FLRH 1ZTLA 2TBSA 3ZV8A 2J98B 3M35A 1C1SA 1EASA 5BRRE 6LPRA 2EI7A 1UK4A 3I29A 5DP6A 1TGTA 2ZKSA 5FHTA 4ACBA 5T6FA 2QC2A 2Z3EA 1ZSJA 3BG4B 3GCHC 4RKJB 4FETA 2HNTF 4JZ1A 4VGCB 1ZMJA 2UUJB 1GHYH 3SJ8A 1FMGA 2J95A 1Q2WA 4WY3A 1O2KA 1C5QA 1NS3A 4Q7YA 2BLQA 2HNTE 1CBWC 2K8IA 4LZ1H 1FZZA 2A5KA 1EZUC 4MPXA 3SU0A 4JCNA 1HAHH 4ZCNA 4E05H 1O2WA 2ANYA 1IQFA 1LHDH 9ESTA 3EE0B 1FONA 1KIGH 3GY4A 4FXGH 1OKXA 1IQMA 2STBE 4ZAEA 1KXFA 1TAWA 4AB9A 3NZIA 3UWIA 1UHBB 1ANEA 3SNBA 3KYFA 5HIZA 4IC5A 5C67A 4D7FA 1SQTA 1FNIA 4LOYH 2VIDA 1T4UH 5HM9A 2BZAA 1CSOE 4JZIA 4X1SU 2P8OC 1NRNH 1GMCG 1L4DA 2ZGCA 5JB9S 4DT4A 2BQ7B 4ZKNU 4FOUC 1A3EH 3KYGA 3TIUA 5AF9H 1TQ7B 1ELEE 2WHXA 3ESTA 1EFRD 4B75A 3ZZ4A 3VB6A 1P02A 2KCPA 1HV7A 2ESTE 1AU8A 1ZMNA 2HRVA 2ANWA 5LH8A 1XXDA 3H09A 2PSXA 2WZQA 3AAUA 3M5MA 3PLPA 1UTNA 3GDSA 1DVAH 3PV2A 3HATH 4FU7A 3FZZA 4CRAA 2OC0A 1O2GH 1LQEA 4YZUA 1QFKH 1C1TA 2JJ2D 2XCNA 4AX9H 2Y5GA 3K9XB 2BD9A 3KN2A 2KX4A 2ZGXH 2R2MB 1E35B 4B6FA 1KLTA 2G4UA 4HGCA 4HTCH 3ZVBA 1O2QA 1A7SA 3TK5A 5FCRA 3T29A 5F8XA 1F0UA 1THSH 1YPMH 2ZPRA 4THNH 1MZAA 1HGTH 2ZPQA 4OGYA 1AUTC 3U8RH 1YY3A 1ZHPA 3M5LA 3UNSA 3WWFA 1O3DA 3LT3A 2CGAA 2AMDA 3FANA 3T5FH 5EG4A 1N6XA 1SC8U 1TPSA 9LPRA 1TOCB 1THRH 1XUJA 5HKKD 1SGFA 2TRMA 2XBYA 3NWUA 2JIZD 4CH2B 3RLWH 2Y82A 4ZXXH 4YO9A 2PV9B 2FOEA 1SR5C 2JKHA 3LGVA 1F0TA 4KTUA 2Y81A 3LONA 3RXTA 1GWAA 2BZ6H 2VIVA 4K2YA 1O3GA 1EZQA 1O2HA 3ELAH 1V2PT 3N7EA 1BDAA 2ZC9H 2ZNKH 4TPIZ 1PQ7A 1CGJE 2AMPA 3OYPA 2FOHA 2VU8E 1Q31A 2PSYA 2BLOA 1KYNA 2XTTB 4OS1A 4YT6H 2FDAA 1P2IA 1BT7A 3NK8A 3GCOA 1WXRA 5C1XA 3W1EA 1GBCA 1O5FH 1Y3YA 4D9RA 3KGPA 5A8XA 2J97A 1L1NA 1YWUA 3O8DA 1V2JT 1AWHB 3NKKA 4A6LA 1ORFA 3LJJA 2ZFRH 4FUHA 4JZDH 4KELA 4TYDA 3E6PH 1FXYA 3M5NA 3GYLB 3M3SA 4P02A 3U9AH 1XKAC 1G37A 2GT8A 3P8GA 3A7WA 4MPVA 5CHAC 4K1EA 1MU6B 2SFAA 2D2DA 3QTOH 3FN8A 1O3AA 2KR7A 3S7HB 2HLCA 3UAIC 3I78A 2WUCA 1EAUA 1DICA 4Y8XA 1BMLA 3SQEE 5IYTA 4MNXA 2BQWB 4B71A 1TA6A 1NU7B 4X8VH 2IOTA 3GCTG 4AOQA 3P8NA 5CHAB 1GI8B 3HK6B 4E06H 3N99A 2QXGA 2ZCKP 4SGAE 2QA9E 4Y11E 3U8OH 2EEKA 2ZWLH 3M7UA 3RXQA 1GI2A 4JK5A 1O2YA 5EXLA 4WMEA 4KGAA 4Y10E 1ABJH 3N7DA 2A5AA 3LIWA 3IITA 1LHCH 4Y79A 1C2MA 3A7YA 1AKSA 2WPJS 5T3HA 1BOQA 4ZKRU 1SHYA 2QN5T 1O5BB 3MH6A 3P70B 4X6MA 2A4OA 3F2FA 2ZU2A 4DJZB 5FPTA 1ANDA 4X1NU 4AFQA 2ZGHA 2ZDLA 4E7RG 1XVOA 1ELAA 1P8VC 3F9FA 2VVCA 1T31A 1O35A 2IPQX 4MDSA 2ZDVH 2BHGA 3RC6A 3SZNA 3MWIU 3SORA 2AHME 4Y0ZE
chains in the Genus database with same CATH topology
5DP9A 4MG3A 1V2RT 3A8BA 1C5VA 2RDLA 1HXFH 1HFDA 1N8OC 4HI3A 4WVPE 2V0BA 5PTPA 2BY6X 3OY6U 1TNLA 2P8OB 3SV7A 1MKXH 3SV2H 5A0AE 2BY7X 2VH6A 2JH5D 2ZGJA 2O8LA 3UNQA 1C4V2 3L3TA 3UQOA 2O8UA 1ZJKA 3QN7A 4O97A 2P95A 3Q3YA 1DSUA 3PB1E 4A7IB 5FX5A 3CS7A 5DK1A 3LC3A 5FX6A 1D6WA 1O2UA 4KTSA 1BRBE 2CXVA 3NUMA 5JDUB 3M5OA 4OS7A 2IPHA 3DFJA 5H4IB 5C3NA 1SGQE 1CT0E 4B2CA 3OTJE 3M3VA 1V2OT 3S9BA 3IWMA 2ZHWH 1GMDG 3KQCA 1AWFH 1GBLA 3SNCA 4NWKA 3D49H 5BPEA 3P92A 4K8YA 4U30A 2VINA 4MNVA 1OOKB 2ZCHP 3SHCH 3OSYA 1Z8JB 5L2YH 4ISOA 3RMLH 4X1PU 2CV3A 5GPIB 1SGPE 1KSNA 2ASUB 2ZF0H 3Q3XA 5T6GA 3MMGA 1SGIB 2FX6A 1G9IE 1KXAA 3FAOA 4XBCA 2XBVA 1ELVA 1QBNA 2P3TB 1FDPA 1C1OA 3LPRA 2B8OH 2ZECA 1VR1H 2VGCB 4PROA 3ZZAA 1EAWA 1DXWA 2JH0D 2Z6BD 2Y7ZA 1HJ9A 3BTGE 3S7KB 4INHA 4ABFA 1DWEH 1YPLH 3RM2H 3TJNA 3T62A 2BY9X 3ATLA 1QURH 1QJ6B 2GGVB 2C3SA 1AZ8A 1MAXA 1C2KA 4BXWA 2FEQH 1AGJA 2V6NA 4IMQA 1MH0A 1OYTH 3D23A 2ZU1A 4UFDH 5HYOA 1ZHRA 1SQAA 3LJOA 3UFAA 1C5ZB 1QY6A 1UVOA 2FLBH 4MLFB 3AW1A 1JXPA 1TLDA 2FO9A 1FIZA 5JBBS 3MNXA 2Y5HA 3SNAA 4ZXYH 4DGJA 1C2LA 1TGSZ 2PKAA 4U01A 1O39A 4ABBA 1T8MA 3CP7A 2Y5FA 4DY7B 1WAYB 1A4WH 3S9CA 1OPHB 2SGAA 2W5EA 1C5OH 4DOQA 1P10A 5TCAA 2J4IA 3MO3A 4CRDA 1FY8E 1QRWA 1KY9A 2A4RA 2PFEA 3RMMH 3WY8A 3QK1A 2FWWA 1MUEB 1O2OA 2ZFSA 3P6ZB 1MD8A 1NFYA 2V3HH 1ZSLA 2RCEA 4JYUH 4WMDA 1HJAC 1QRZA 4Y7BA 5E2PA 1B0FA 3A8CA 4O9VA 2A4QA 1QNJA 2NU1E 1TYNA 1LHFH 3F6UH 3RXSA 1B0EA 4I8LA 1GVKB 1C1QA 1C5LH 2GMTB 4ABJA 3MHWU 4ZKSU 4AORA 3D62A 3D65E 3MU8A 2GZ7A 2W7SA 1MZDA 3DHKH 4GUXA 3ZZ6A 1V6DA 4GSOA 1H9HE 3DT0H 4WH8A 2BX3A 2PGQB 3P8OA 1RIWB 1AHTH 1C2HA 3F9GA 1DM4B 4JYVH 1E34B 2LNCA 2FXRA 1C5XB 2B9LA 1YKTA 3IG6B 3SU5A 3ZYDA 5EQSA 1HAGE 4IN1A 1C1WH 2W26A 2VNTA 1N8OB 1YPKH 3SJ9A 3SU2A 1TRYA 1OWIA 1CT2E 1ELFA 5F8TA 4LZ4B 1O31A 1Y3XA 4F4OC 1DOJA 1C2DA 3A82A 3EA8A 2EI8A 4Y6DA 3VGCC 2SNWA 3GY5A 4CBNA 1EZXC 4J1YA 1WBGB 1MD7A 1LPGB 3R3GB 1JRSA 1TALA 1SBWA 4BOHA 3BTDE 1A46H 1Z7KA 3PYHA 2W3KA 3H5CB 1LDTT 4NG9H 2BD4A 4XFQA 3SGBE 2D1JA 1CA0B 2GP9B 5FXLA 4BAQB 3ODDA 1C2IA 4MPWA 1F0RA 1UJ1A 4AG2A 4ISLA 4I8JA 2QIQA 4JMYA 1CHOF 5C1YA 1TBRH 2PUQH 4DT7B 1AB9B 2HGTH 1Y5BT 5DPAA 5A09A 2O8WA 2BM2A 5GCHG 1ACBE 4ZKOU 2A4GA 1FPHH 1E36B 2BLVA 2C93B 3GY3A 7LPRA 1D3QB 1K1PA 3SN8A 1EP5A 4JK6A 1S81A 3Q3KA 4KKDA 4X6OA 1MKXK 1WU1A 1SLWB 1LCYA 2G00A 1KXCA 1GMHF 2J2UA 3SOSA 1TRNA 1QTFA 1P12E 3QWCH 3M36A 1K28D 4X1QU 4ISIH 1VITG 1V2UT 1RRKA 4A5TS 1HAZB 1CBWB 1O32A 2FOCA 1F7ZA 1GI4A 2R9PA 1TGCA 2XWBI 3S69A 3SU3A 3MI4A 1DUAA 1NU9A 3GY8A 2HOBA 3A7ZA 1TWXB 4FUFA 3LC5A 3PLKA 1AMHA 1GBMA 1FIWA 2VWLA 3UNRA 1ETRH 4D76A 2JETB 5LGOA 3SI3H 1WTHD 3VXFH 1CA0C 5J4SA 1IQIA 2F9VA 5DP3A 2FODA 3UTUH 1P3EA 1T8NA 3PV4A 6GCHF 1BJUA 1S0QA 1P2NA 2CHAB 2I6QA 1O2XA 3TU7H 2XBXA 4FU8A 4NIWA 3VGCB 2VIOA 1AVGH 1YGCH 3KL6A 3SJIA 5E8EH 2QXIA 1F5KU 1O3BA 2H6MA 3RXJA 1CHOG 2VGCC 1NFWA 2GT7A 3TGIE 3B9FH 1TA2A 1EUFA 2TGTA 3ZVCA 1LHGH 3U1IB 1EKBB 3JZ2B 1ZYOA 4WXVA 5EQQA 3S0NA 1TNKA 1W10U 3MO6A 1OP2A 3LDXH 1O3NA 1QL9A 4X0WU 1FV9A 3R0FA 1GHWH 4KTCA 4AB8A 1GDQA 3BF6H 1WCZA 1DT2A 1V2ST 1S84A 4X1RU 1QB9A 2FIRH 4HZHA 4BTIB 5F6MA 1CQQA 1HRTH 1C4U2 1V2QT 2F83A 3AASA 1UTQA 3ZZ7A 3MTYA 2BDCA 1T7CA 1OWDA 1VCQA 1HNEE 2NU3E 4CRCA 1ELBA 2CN0H 4AGKA 1RIWC 3ZZ9A 4FUIA 1J15A 1SQOA 1BTPA 5AHGH 3E16B 1DDJA 1S5SA 3DUXH 2GDEH 3P8FA 4GPGA 2W3IA 1P9SA 2H9EH 1GJ7B 4K60A 4KP0A 1CO7E 4I32A 2BD8A 2VIPA 2FOBA 1FPCH 3A8DA 2GZ8A 1LKAA 3G01A 3RXIA 1BTWA 2ZFFH 2G55A 1BTXA 4CREA 2CF8H 4YLQH 1ZGVA 4RN6A 5FBEA 1F92A 4NIXA 8LPRA 1GI1A 4FVBA 4YTAA 1P2JA 5EXNA 1E38B 4K5ZA 1QBOA 1LVOA 3ITIA 2YNAA 4UD9H 5J4QA 2PTNA 1WQSA 1HPGA 4UDWH 1OWHA 1FUJA 2UUFB 2ZTZA 1NM6A 4NIVA 1H9LB 2Z3CA 2BB4A 5EPYA 1DITH 1HYLA 1CA8B 1DY8A 1PPCE 1AFQC 4NSYA 2QCYA 1FAXA 7ESTE 2HWLB 4NA7A 5EOKA 1VJ9U 3TPIZ 4I8KA 1YBWA 1A5HA 1GMCF 5I25A 1WV7H 1QRXA 1TNIA 1AUJA 3CENA 3E0NB 1O3LA 2M5TA 2OUAA 3MOCA 3LU9B 3SU4A 4AGJA 2HPPH 2H9HA 5L30H 3SGQE 2WPLS 1HJ8A 2AGEX 3VB3A 4H4FA 2WPKS 1GHAF 4Y76A 1C1PA 4WXIA 1TMBH 1GBFA 1Z1IA 2A0QB 4A1TA 4ISNA 1UCYK 4I7YH 4B2BA 4NIYA 1CE5A 1DUEA 2J94A 4K1TA 2A45B 3UREA 1NROH 3SQHE 1FY1A 5DP8A 1TX7A 1H1BA 3EGKH 2ZHDA 3U8TH 8GCHG 3RXDA 1V2TT 1XUHA 1HIAA 1DXPA 1HAVA 3EDXB 1FY4A 4YOIA 3PLBA 2THFB 1QJ1B 3SJOA 5FBIA 2P93A 2Z94A 4FU9A 4AZ2B 2A32A 2UWPA 2G81E 5HXFA 2C8XB 2PGBB 1O37A 1Y3VA 2FOMB 1IHSH 1EAXA 1BUIA 4Z0KA 2FI3E 1P06A 1P11E 3BTFE 2ZDAH 1V2VT 3PWBA 1A61H 3UUZA 2WPMS 4ABDA 3ENSB 3O8CA 1QA0A 3TJUA 7GCHG 4FUJA 1F0SA 3I77A 1SGEE 3A81A 4IGDA 1P2QA 3U1JB 4OS5A 1GHBG 4IW4E 2BYAX 3FFGA 4ZH8A 2XC5A 5A8ZA 3BIVH 1XKBC 4NA8A 2G51A 4U2WA 1P9UA 3ZVGA 5LPRA 1ANBA 1YPEH 3BTME 2BDYA 2F9BH 4UFEH 1MCTA 6GCHG 1SHHB 2UUYA 5GWZA 1O3FA 3ATKA 2TIOA 3HGNA 4LXBH 1GI5A 1L4ZA 1ETSH 2C8ZB 1O33A 1ARCA 4BAOB 1HCGA 2QAAA 2OTVA 4XBDA 2AEIH 3M3TA 1P57B 1P05A 3GCNA 1AZZA 1DWBH 3PMHB 2ZP0H 5HGGA 1DE7H 3GDVA 4Q2KA 1G3CA 3ZZCA 1BTHH 6ESTA 3VPKA 5EW2H 2BD7A 4ABAA 1S85A 2GV6A 1Z8GA 3GYMA 2ZDNA 2BQ6B 1GBHA 4I31A 2KAIB 2ILNA 4BTUB 1A2CH 1Y3UA 1GCDA 1EX3A 1F5RA 2J92A 3EYDA 3A83A 4YT7H 1TIOA 1GJAB 4HFPB 1V2NT 2ZGBH 1K1NA 4IS5A 1KXBA 1XMNB 4WH6A 4JYTA 1GI3A 1D4PB 1O30A 4K3JA 1BRCE 1NFUA 1ZPCA 2SGEE 1B7XB 3EA7A 4Q7XA 2J34A 4IBLH 4VGCC 4OS6A 2BVRH 5A8YA 1DLEA 3LGTA 3VFEA 1L0ZA 4YLUA 1DY9A 1KLJH 1L1JA 4CH8B 2BX4A 2BY8X 1TPOA 3RXCA 4M7GA 1O3CA 4R0IA 1A3BH 4IN2A 1MU8B 2FTLE 4LK4A 1HAOH 3RC5A 1MKWH 3MH4A 1JOUB 1RGQA 1VITH 1BB0B 3DA9B 1ESTA 4WWYA 4NSVA 1BQYA 2Z3DA 3RXOA 1P2OA 2H2ZA 1UCYH 2UUKB 2F9PA 1SGYE 3LGUA 2JH6D 5EODA 3QO6A 3A7TA 3V0XA 3ATIA 2O8MA 1LVYA 2XC0A 2QGRA 2Z9IA 1THPB 3V3MA 3TH2H 2BVSH 1H4WA 2Z9GA 2ODPA 2VWMA 1JMOH 1CU1A 1P01A 2BD2A 1GJ4H 5C5OA 1RS0A 1GHBF 2XRCA 1O5EH 1TONA 4O3UA 1ELGA 3ZVAA 2ZO3H 2ZHEH 2F3CE 2RG3A 4YOJA 4ASHA 1S0RA 2PW8H 2ZEBA 1ZLRA 1IQJA 2FOFA 1ETTH 1S6FA 1NT1A 3PMBB 4CRBA 4GAWA 6CHAC 4FUGA 1ELTA 4B74A 3LOXA 5A0BA 1O34A 2VWOA 2BY5X 4AN7A 2R0KA 1P2KA 3MU5A 1J8AA 1QQUA 1ZZZA 5DGJA 1ZGIA 3BN9A 2ZIQH 1SFIA 3MFJA 1D9IA 1J17T 2QXHA 2FMJA 2V3OH 5EXMA 3RXMA 1NFXA 1BMMH 1GBJA 4ZHMU 4Q80A 1XUFA 1EPTA 3MO9A 4DIHH 4TPYA 1RTKA 1A0HB 1RTLA 1TMUH 4D7GA 2OC7A 1A5IA 2ALPA 1GG6C 1ZHMA 3PO1C 4AYVB 1BTZA 1QHRB 1LVMA 2STAE 1W2KH 2P94A 1RXPA 1DX5M 1O5GH 1C5SA 1GHXH 2FESH 2W7UA 1GBTA 4ZUHA 2ZCLP 1C5MD 1CHGA 1WQVH 1ZSKA 2FPZA 2XWAA 5JBTA 2GCHG 2ZQ1A 2BXTH 2AGGX 3FVFB 2OQ5A 4IC6A 5FPSA 1QIXB 4XE4A 1EB1H 2ZG0H 1NRRH 1SI5H 4TWYA 4U32A 5F8ZA 4Y0YE 3RU4D 4B1TA 1AN1E 1J16A 2SGFE 1QA7A 4GLYA 1AY6H 2WYGA 3UR9A 2FI4E 1GJ8B 3TVJB 3BTWE 2OBOA 5LPFA 1VCWA 3BEUA 3T28A 1G36A 3FP8E 2AIPA 1C5RA 1W7XH 1C9PA 1OWEA 1HBTH 1PFXC 2VB0A 1ANCA 1TX8A 3UQVA 1PYTD 3L6PA 1QJ7B 2PKSC 4MVNA 1D3TB 2BXUH 2JETC 1Z6EA 3RXRA 3JZ1B 5C5NA 3A7XA 3KCGH 2RA0A 1ZTKA 1GBDA 2WPHS 1G32B 3N7OA 4BAKB 1YM0A 4SGBE 4DG4A 4BXSA 1JBUH 1RFNA 3PTBA 3TH4H 2OQUA 2VJ1A 2CHAC 1MTNB 1ARBA 1TGNA 1RTFB 2XXLA 5GDSH 3RXLA 2BD5A 2LPRA 1O2NA 1ZPZA 1T4VH 1O3HA 4OS4A 1O3KA 1C5TA 1GJBB 3T27A 2A1DB 3VXEH 4AFUA 1O3IA 1C9TA 1UTKA 1C1VH 1V2MT 5A2MH 4FVDA 4WF8A 1P09A 3RXKA 4MTBA 3BTEE 2OP9A 1NESE 1FLEE 1UVUH 1SFQB 3TJVA 3QX5H 3SNDA 2PLXA 1AE8H 1TRMA 1TOMH 1TNHA 2YOLA 5IDKA 2KAIA 3SUGA 1SLUB 5EU8A 2A7CA 2HVXA 1V2KT 1A5GH 1BCUH 1FI8A 2NU0E 1G3BA 4WMFA 2SGPE 2A2XH 1MQ5A 1DANH 1MTNC 1ZR0A 3RXBA 3TJOA 1ELCA 1OWKA 3TK6A 1C2JA 4BAMB 1W12U 2DE8A 3OU0A 1DLKB 4MPUA 1O2TA 1DWDH 4DVAU 5JBAS 3A84A 3E91A 4TY6A 1HAXB 2P3FH 5GXPA 1LHEH 4F49A 1O2JA 2PKSB 2PUXB 3ATMA 1EZSC 1C2EA 3H7OA 5DP4A 4NZLA 3VEQB 4XOJA 1EJMA 1O2RA 1DFPA 4K69A 1YYY1 5CE1A 1SB1H 3RC4A 1LO6A 5DG6A 4UONA 3A7VA 1PPFE 3AAVA 1G30B 2G5VA 1RJXB 2FTMA 4CHAC 3BG8A 1WTGH 3UIRA 3TITA 4UFGH 4X6NA 5DKMA 2OXSA 2ZDKA 1E37B 1SOZA 2QF0A 3BTTE 2FYQA 4A1XA 1MTWA 1UCYE 1AD8H 1VGCC 4AFSA 2B5TB 1MBMA 2AYWA 1EPTC 2ZFQH 3NCLA 1YLDA 1EOJA 3M61U 2P59A 7KMEH 3M7TA 1C2GA 1O2MA 1GJ5H 1MAYA 1GI9B 1C1MA 4FUCA 2ULLA 2ZQ2A 2ZFPH 1AVXA 1IQGA 3F9EA 1PPHE 1UTJA 2FI5E 4TY7A