3URHA

Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
461
structure length
461
Chain Sequence
YDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHQAQHGLEALGVEVANPKLNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKGEEQVLEAKNVVIATGSDVAGIPGVEVAFDEKTIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAKQLQRMLTKQGIDFKLGAKVTGAVKSGDGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyl dehydrogenase
publication title Crystal structure of a dihydrolipoamide dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 133
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3urhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA02
1F8WA 2C65A 4H4YA 1H7WA 3AEEA 4C74A 3V3NA 1Q1RA 1P2EA 2BK5A 3ITJA 1KSSA 2YLWA 1CC4A 3E1TA 3BI4A 2R4JA 2E5VA 3UOXA 1ZMCA 3DGHA 1NG3A 2X3NA 3AE2A 4U8JA 3P1WA 1L0VA 2QAEA 1ZK7A 1XHCA 5JCNA 3ADAB 5M10A 3OC4A 1LQTA 2A89A 2OAMA 3VQRA 3AYLA 3K30A 4XWRA 3L8KA 4H50A 5FS9A 2OLOA 3NHOX 2CFYA 3CIRA 4HA6A 1GTEA 1VDCA 3DJGX 2B9WA 1VQWA 1S2QA 2BCGG 2ZZCA 1YKJA 3UKQA 4K7ZA 2YLTA 2ACZA 5HY5A 4NTEA 2WP6A 2XFUA 3NN6X 3PS9A 4UDRA 1CJ2A 1YQ4A 2WBAA 3KU9A 1ZDLA 2GAGB 1IUUA 4K5RA 1FCDA 4DNAA 1B8SA 1N4VA 2V6OA 2YWLA 1OJ9A 3F8RA 3AE9A 2JB1A 3I3LA 1GERA 4K22A 1TDNA 4AP1A 2FJEA 3VRDB 3GSIA 4XWZA 3C4AA 4YXDA 2O9ZA 2Z5YA 3UP5A 2WEUA 5EOWA 5HYMA 4EQXA 3GMBA 1CC6A 1OJTA 4EIPA 1DNCA 1YQZA 4M52A 2GRTA 2OLNA 2YG3A 4N9XA 1H86A 3AE8A 3ICSA 3REDA 3UOVA 1CF3A 1KF6A 3AEGA 4YKGA 3AE7A 1K0JA 3QJ4A 5KRQA 4ECHA 3IF9A 5HXIA 1JNZA 4A6NB 5BVAA 1PXBA 3CNSA 1FEBA 2BA9A 4HB9A 5GSNA 4GDEA 2F5ZA 1KDGA 1F6MA 4H4TA 2IVEA 2R45A 3UTGA 2BXRA 4IV9A 3O0HA 2AQJA 2YLRA 1E1NA 2YVGA 5FS7A 1B4VA 2Q0LA 2R0CA 5BRTA 5KXJA 1L9EA 1JRXA 1NHSA 4C3YA 3R9UA 1PJ7A 1CBOA 3BHKA 3K7MX 1H81A 4EM3A 1K0IA 1GT8A 3SFEA 5FMHA 1PN0A 5IQ4A 4OVIA 2VVMA 2WU2A 4AT2A 1E6EA 5LV9A 2DKIA 3ZDNA 5EBKA 2YG5A 4CCQA 3I6DA 4Y4LA 3NNEA 3LJPA 2X8HA 4C3XA 1CJ4A 5JCIA 4BK3A 4Z2TA 1GRTA 2XVJA 3AXBA 3V3OA 2R9ZA 1D5TA 2C73A 4OPGA 1F8SA 2FBWA 2WDRA 2H89A 4AT0A 2BS2A 4H2RA 4OPTA 1GRBA 1PXCA 1ZOVA 1D4CA 1IJHA 3P4PA 3CGEA 1NAAA 4Z25A 4A65A 4OPDA 2OA1A 4WCTA 2RGHA 3BNMA 4P9SA 4OPCA 4YTNA 2XYOA 4JNQA 2GMHA 3GRTA 1Z6LA 3AWIA 3LZXA 3RP7A 1EL8A 2YM2A 3BNUA 4USRA 3ABVA 2YG7A 2JB3A 2TPRA 5JCMA 2GV8A 1ZKQA 2RGJA 5FS8A 1E1KA 2OALA 4USQA 1KSUA 3CN8A 4FX9A 1H83A 1MOKA 1UKVG 1FECA 1W4XA 2V5ZA 2C76A 2WQYA 4GUVA 3GDPA 2I0ZA 3EANA 2VOUA 4Z44A 1ZOYA 3LADA 1Q9IA 3ATQA 3CGDA 3ICTA 1IUWA 2XDOA 3CTYA 4H4ZA 1SEZA 4NEWA 3DK4A 3FG2P 2YAUA 4H4VA 2WPEA 4CBQA 2XVEA 2GR2A 2XFOA 2RABA 2GF3A 4H4WA 3B6DA 2BS4A 4EIQA 4TM1A 4UDPA 3T37A 2VRLA 1DJNA 1K0LA 2Z5XA 2AR8A 4AP3A 2WS3A 1ZY8A 1LJ1A 3CPJG 2C3CA 3GD3A 4U2LA 2C64A 1TDKA 3UKHA 3P9UA 3AE3A 3NT6A 1IUXA 1D7LA 2J3NA 1PJ5A 3NKSA 4B69A 4UP3A 4TM0A 1NDAA 5L46A 2GQFA 4KPRA 2V3BA 1XANA 3CNTA 4U8OA 4U8IA 5IQ1A 5KWFA 3GYJA 1MXTA 4OPUA 4EQSA 3AD8B 1F8RA 2DKHA 3KD9A 2WPFA 1AOGA 4ZCDA 3CPHG 4K2XA 4YKFA 2X8GA 3AE4A 1BF3A 1GRAA 1OJAA 1HYUA 3KKJA 3IWAA 4B67A 2Q0KA 2WHDA 1PBBA 2YR6A 4KX6A 1JNRA 3DJDA 3SGLA 4IVOB 1DJQA 2ZBWA 3WE0A 1D4DA 2XFNA 2XFQA 4RG4A 3UKPA 2VVLG 3NK1X 4C5OA 2WESA 2EQ9A 3RP6A 4AOXA 4J56A 4NZHA 4WX1A 2XVIA 5J7XA 1O95A 2R0GA 5HHFA 1ZMDA 2V3AA 4EQRA 2XLRA 5KVHA 4A6NA 2JB2A 4H4SA 2WETA 3CPIG 2ZZ0A 2YG4A 1GRGA 2VVLA 4YWOA 4RSLA 3EF6A 4TLXA 4X9NA 3DJJA 2C67A 1PDHA 2YG6A 2C7GA 1LV0A 3ATRA 1Q1WA 2GAHB 2B9XA 3DMEA 4K8DA 4NEVA 4Z43A 4YSXA 1GALA 2BC1A 2JBVA 4UDQA 4A7AA 3L1RA 4YTPA 3QSMA 1D4EA 2YLSA 5U63A 4EM4A 2C66A 4K5SA 4RG3A 1BKWA 3C96A 3PVCA 3G5SA 5BUKA 3NYEA 3NLCA 3V76A 3RNMA 3DA1A 3IHMA 3NRNA 1OJCA 4JY3A 4TLZA 4U2TA 1GETA 5GRTA 3UTEA 1XPQA 3GD4A 1XDIA 2BK3A 3URHA 5U1OA 1BGJA 2H88A 3AECA 3QFAA 3ALJA 1CJ3A 2XLUA 1EL5A 1M6IA 3AEBA 3SM8A 1TDOA 1BGNA 2YR5A 3ICRA 4A5LA 1LVLA 3D8XA 1O94A 2R4EA 2BCPA 4GF7A 1JOAA 2BXSA 2HQMA 1IUTA 1CC2A 1NG4A 4JN9A 2YQUA 3CNDA 4JQ9A 4X9MA 1Y56A 3VRBA 3EAOA 4D03A 1FOHA 4U2SA 2CDUA 3FIMB 3AEFA 1EBDA 3EPTA 4H4XA 4BV6A 1DOBA 3GDNA 4H2QA 4JDRA 4MJWA 2VZ2A 5ER0A 2NVKX 4Y4NA 2TMDA 4FK1C 2Y6QA 1KNRA 3NGCX 4YSYA 2FJAA 3PO7A 4Y4MA 4D04A 4Z24A 2APGA 3UOYA 4U8MA 3AYIA 2B7SA 4YSZA 4XXGA 1JRYA 1N1PA 1RSGA 2QCUA 2BACA 2BS3A 1B37A 3II4A 1NENA 2B9YA 2XVFA 2C72A 3IC9A 4GRTA 4EMIA 1RYIA 4GDPA 2XLPA 5KOWA 4ADWA 4U8LA 4H4QA 3DK8A 3H4KA 4B64A 1TRBA 5EB5A 2C75A 3Q9TA 4H2PA 2IVDA 3DJEA 1GNDA 1F3PA 1PS9A 2PHHA 3KPFA 3UTFA 2W0HA 2YVFA 3GYIA 1E1LA 1PBFA 2VQ7A 1DXLA 3Q6JA 3P4QA 1EL9A 1E39A 1PHHA 4BK1A 1NHQA 4I59A 4GCMA 2Q6UA 1PBEA 3S61A 3VRAA 1PJ6A 2R0PA 2GB0A 3AEAA 3SFDA 1BWCA 2RGOA 5M0ZA 4J2WA 4OPIA 2EQ6A 1EL7A 2PYXA 4CRTA 2X99A 3VR8A 3DK9A 4B66A 1DODA 4FK1A 1FEAA 4H4RA 2A87A 3NTAA 1M64A 4LU6A 3H8LA 3QVPA 3S5WA 4A99A 5KOXA 2BABA 1TYTA 2E4GA 3IHGA 1LPFA 3AYJA 1JU2A 2FJDA 4J57A 4O5QA 2XLTA 2AAQA 1DOEA 1NHRA 1H84A 1RP0A 3RHAA 3M0OA 1E1MA 4ZCCA 3ALLA 1JRZA 2WP9A 2GQWA 3QFBA 4ZN0A 1GRHA 3UOZA 2YLZA 3B3RA 4E0VA 1E7PA 5C2TA 1BZLA 1TYPA 1JEHA 3AB1A 1ZX9A 3GMCA 4H7UA 1GOSA 2WDQA 4TM3A 4U8PA 2Q7VA 1REOA 4TM4A 4B63A 4J34A 4LIIA 4APNA 4Z2UA 5JCKA 4BURA 3RP8A 3OZ2A 1COYA 3LXDA 4A9WA 1O5WA 3QSSA 4J36A 4O5UA 2IIDA 3UP4A 2A8XA 3UKFA 2WU5A 2FJBA 5IPYA 2X8CA 1QLBA 1CHUA 2GH5A 1VG9A 4EMWA 2QA1A 1GREA 3NK0X 1FL2A 3KVEA 2YR4A 3F8PA 2BC0A 1P2HA 4NTDA 3P4RA 3UKLA 2V60A 3NIXA 5KVIA 1L9CA 1S3BA 4IA5A 4J31A 2BK4A 1GTHA 1DOCA 1PXAA 2UZZA 3AE1A 3AD9B 5J60A 4H4PA 4I58A 4H2NA 4EQWA 2VQBA 3AEDA 4JY2A 4NTCA 3GWDA 2CULA 1GV4A 4BJYA 1H82A 4IVMB 3NH3X 1YY5A 2JK6A 3C4NA 1TDEA 2WOVA 2ARDA 5C3JA 5JCLA 1YQ3A 2XFPA 3BHFA 1V59A 3NTDA 3QSEA 1KNPA 1S2YA 3JSKA 3UCLA 1VG0A 3UKKA 4Z2RA 2WDVA 4GR1A 2XCGA 3M12A 4BJZA 4AOSA 1ELIA 2GMJA 3GWFA 1CL0A 2QA2A 3K7TA 3G5RA 2YLXA 3G5QA 5CQFA 2EQ8A 2B76A 2JKCA 2YVJA 4LA1A 1K4QA 5TR3A 3DGZA 3NN0X 4C77A 3FPZA 2GR1A 4REKA 3SQPA 4CNKA 1GRFA 3DH9A 2E1MA 4U8KA 1VRQB 4PABA 2C3DA 4U8NA 3M13A 2GVCA 4PAAA 3HZLA 3QVRA 3COXA 2B7RA 2WOWA 3CNPA 1GSNA 3LOVA 5U25A 3UKAA 4X4JA 1GXFA 5FS6A 4DSGA 4DSHA 2GR0A 3FBSA 1QO8A 2GR3A 4ICYA 1OJDA 1D7YA 1CJCA 2WP5A 3FMWA 3NK2X 2V61A 2R46A 4J33A 5EB4A 1ZP0A 1NPXA 1PBCA 1QJDA 1Y0PA 2VRMA 2WPCA 4JNAA 4OCGA 4YTMA 3LB8A 1S3EA 4FDCB 1IUVA 3NYFA 4B1BA 4BK2A 1H7XA 1NEKA 3K7QX 3NG7X 3CGBA 1LTXR 5CKUA 1GPEA 3BI2A 3F8DA 4CNJA 3NYCA 1GEUA 3ZYXA 4CY6A 5DBJA 2ZZBA 3KA7A 3KLJA 2YM1A 1X31B 2WOIA 3GRSA 1N4UA 4DGKA 3CGCA 1KFYA 1Y56B 1L9DA 2JAEA 2XLSA 3CNJA 1H6VA 4A79A 1ONFA 3ALMA 1TDFA 5BULA 2XVHA 2NPXA 1MO9A 1N4WA 3P4SA 3AD7B 3VR9A 2BYBA 1PBDA 4YSHA 4OPLA 4CCRA 1LQUA 2EQ7A 2C70A 3LZWA 1B5QA 1NHPA 3ISHA 3UTHA 4B65A 4H4UA 2GEWA 2X50A 4Z26A 4CY8A 1IUSA 3BI5A 4EMJA 3AE5A 1GESA 3AE6A 3H8IA 2Y6RA 3D1CA 4YT0A 4B68A 2CVJA 4IA6A
chains in the Genus database with same CATH superfamily
4C74A 1Q1RA 3ITJA 3HRDC 1CC4A 3E1TA 4H2HA 2QJJA 2R4JA 2CHRA 4A6GA 5JCNA 3EKGA 4AOSA 4XWRA 3NHOX 1TZZA 1VDCA 3N4FA 1VQWA 3CB3A 3QKEA 2ACZA 2WP6A 3T6CA 1CJ2A 1ZDLA 4DNAA 2V6OA 3F8RA 3AE9A 1GERA 4AP1A 2FJEA 2Z5YA 3CXBA 4EQXA 3GMBA 1OJTA 1DNCA 2OQHA 3UOVA 1CF3A 1KF6A 3AEGA 1K0JA 3QJ4A 3HPFA 5BVAA 3STPA 1PXBA 4HB9A 2R45A 3TWAA 2BXRA 5FJUA 3O0HA 3V5CA 2Q0LA 5KXJA 2R0CA 1NELA 3VA8A 1PN0A 4AT2A 1ELSA 3I6DA 3NNEA 1ECQA 2PS2A 4C3XA 4BK3A 5JCIA 3T2YA 2XVJA 3AXBA 3ES8A 1D5TA 2WDRA 3QN3A 4AT0A 1PXCA 2NQLA 1NAAA 4OPDA 3R10A 4HNCA 3MWCA 1EC8A 4OPCA 2GMHA 3GRTA 3ABVA 1STZA 5JCMA 5FS8A 1KSUA 4ROPA 1FECA 2C76A 2WQYA 1RM6B 4Z44A 3ATQA 2XDOA 3DK4A 3OP2A 2RABA 2MNRA 2BS4A 4EIQA 2ZC8A 1DJNA 3T9PA 2C3CA 1JPDX 3OZMA 5L46A 4KPRA 4OPUA 4EQSA 3ZLHA 1F8RA 2DKHA 3KD9A 2WPFA 3A7AA 4FI4A 3CPHG 4YKFA 1GRAA 2QQ6A 3U9IA 4IVOB 1DJQA 2ZBWA 1D4DA 2XFQA 3VCCA 3RP6A 2XVIA 3VC6A 4IP5A 1ZMDA 4EQRA 2XLRA 3MY9A 2ZZ0A 4YWOA 4RSLA 4TLXA 3DJJA 2GGJA 1MRAA 1BQGA 2C7GA 3ATRA 3IJIA 1MUCA 4FP1A 3DMEA 1EBHA 1D4EA 5EU9A 2YLSA 4EM4A 1BKWA 2DW6A 3T4WA 3RNMA 3DA1A 3IHMA 3NRNA 1OJCA 4TLZA 3IJQA 4U2TA 1XPQA 3RP7A 3ALJA 3QFAA 3AEBA 3SM8A 1TDOA 2OKTA 4GGBA 1OEPA 4DYEA 4GAVA 1FO4A 2BXSA 3DEQA 3FVDA 1EBDA 3EPTA 4BV6A 1DOBA 4H2QA 4MJWA 3TW9A 3V5FA 2Y6QA 4YSYA 3PO7A 2GGIA 3UOYA 3TJIA 2B7SA 2RDXA 1B37A 3UCDA 3IC9A 2OO6A 4EMIA 2W55A 4GDPA 5KOWA 3JW7A 5EB5A 3Q9TA 2AL1A 2PHHA 3GYIA 4BK1A 4GCMA 2Q6UA 3TOYA 1PBEA 1PJ6A 2R0PA 3U4FA 4CRTA 2X99A 3DK9A 1FEAA 1M64A 5KOXA 1TYTA 1VQZA 2FJDA 4J57A 2GL5A 1H84A 1RP0A 4G74A 3ALLA 1KD0A 3GC2A 1JRZA 1RVKA 2PTZA 3UOZA 2YLZA 1BZLA 1TYPA 1ZX9A 4U8PA 1GOSA 2WDQA 3DFYA 4LIIA 3NVYB 4BURA 1COYA 3UP4A 2A8XA 4II3A 2WU5A 3UKFA 5IPYA 3SZCA 1VG9A 3NK0X 1GREA 3KVEA 3F8PA 2HXUA 1GTHA 3AE1A 3H12A 4EQWA 3AEDA 4NTCA 2CULA 4E6MA 1H82A 2ARDA 2XFPA 3NTDA 3NVVB 3UKKA 1VG0A 3RCYA 4Z2RA 2POZA 4GR1A 2P88A 2B76A 2XH0A 1K4QA 5TR3A 3FPZA 4REKA 1GRFA 3HYVA 2BRYA 3M13A 4PAAA 3QVRA 3COXA 4KEMA 4DSGA 4DSHA 3FBSA 1ONEA 3ZVHB 4DHGA 2P8BA 4J33A 5EB4A 1N5XA 2PU1A 1QJDA 2VRMA 2WPCA 1IUVA 4BK2A 3NO1A 1H7XA 1LTXR 5IDZA 2OX4A 1GPEA 3ZYXA 5DBJA 2C4CA 3K1GA 4J1OA 4JN7A 2WOIA 1N4UA 5G5HB 1L9DA 2XLSA 1ONFA 3ALMA 5BULA 2NPXA 1F9CA 1N4WA 3NS1B 3D9XA 1PBDA 2PODA 3ZLFA 2EQ7A 4ZA0A 3LZWA 1B5QA 1NHPA 3CMMA 3UTHA 4B65A 1XPYA 4EMJA 4A3RA 3AE6A 3H8IA 2Y6RA 4YT0A 2W3SA 4B68A 4U8JA 1F8WA 2C65A 4H4YA 3AEEA 3V3NA 3A7RA 3DESA 2BK5A 2GGGA 3HYXA 1FHUA 3UOXA 3DFHA 1L0VA 4IT1A 5M10A 3OC4A 3VQRA 2CFYA 1N60C 3CIRA 3DJGX 1S2QA 2ZZCA 3CT2A 1YKJA 4IHCA 3KU9A 4K5RA 1B8SA 4K22A 3GSIA 4XWZA 3UP5A 5HYMA 3I6TA 1R6WA 2FKPA 3UXKA 3QLDA 3NFUA 3SQSA 3ICSA 3REDA 3AE7A 4ECHA 3SZ0A 5HXIA 4A6NB 4GMEA 3CNSA 1FEBA 2BA9A 2PTXA 4GDEA 2F5ZA 3UTGA 4H4TA 4E5TA 2XGZA 3CK5A 2PP0A 2YVGA 5FS7A 1L9EA 3R07C 4C3YA 1CBOA 3K7MX 1JDFA 1GT8A 5FMHA 2MUCA 4OVIA 2WU2A 2DKIA 3ZDNA 4K2SA 1N5WC 2X8HA 5BOEA 4OPGA 2FBWA 3THUA 3H7VA 3TJ4A 2BS2A 1ZOVA 3P4PA 1IJHA 3CGEA 4WCTA 3SN0A 2XH7A 3DERA 3BNMA 1N62C 2XH2A 3D46A 1Z6LA 4GFIA 3BNUA 2YM2A 3OZYA 2JB3A 2TPRA 2OZTA 1ZKQA 2RGJA 3HYWA 1E1KA 2PGEA 4USQA 1PDZA 3ZVIA 1MOKA 3OW1A 1FIQB 4Z17A 2I0ZA 3EANA 5G5GB 1ZOYA 1Q9IA 2GSHA 4H4ZA 3NVZB 2YAUA 4CBQA 2XVEA 4K8GA 2GF3A 1P43A 4TM1A 4UDPA 3T37A 2VRLA 2Z5XA 3UJSA 3NXLA 3I4KA 1LJ1A 4U2LA 2AKMA 3GD3A 4IL0A 2C64A 1TDKA 3UKHA 3SX6A 3NT6A 4TM0A 1NDAA 4U8OA 2O56A 3GYJA 4ZCDA 3KKJA 4B67A 4KX6A 1JNRA 3CAWA 3WE0A 2XFNA 3QTPA 3UKPA 2VVLG 2WESA 5J7XA 2PMQA 5HHFA 1KN0A 1YEYA 2WETA 1GRGA 3EF6A 3SXIA 3GY1A 2C67A 1PDHA 1Q1WA 3UGVA 2GAHB 4K8DA 4NEVA 3ES7A 3L1RA 3QSMA 2C66A 4K5SA 4RG3A 3C96A 5BUKA 2AL2B 3AECA 3GD4A 2BK3A 2H88A 2XLUA 1EL5A 2AKZA 1BGNA 2YR5A 1O94A 2R4EA 3PG6A 3MKCA 4JN9A 4JQ9A 4X9MA 1Y56A 3KPKA 4GISA 1N61C 3AEFA 3GDNA 4JDRA 1WYGA 3VDGA 2FJAA 4D04A 1N63C 4XXGA 2QCUA 2B9YA 2C72A 2XLPA 4U8LA 2C75A 4H2PA 2OPJA 3SSZA 2YVFA 1EL9A 1PHHA 1NHQA 1FFUC 3SFDA 2RGOA 4J2WA 3VR8A 1FFVC 4A99A 2BABA 2E4GA 1JU2A 4O5QA 1DOEA 3RHAA 3RRAA 4ZN0A 2W3RA 3AB1A 1X2HA 2OZ3A 4TM4A 4APNA 5JCKA 3QSSA 4J36A 2FJBA 2X8CA 2V60A 5KVIA 1S3BA 4IA5A 1DOCA 2GDQA 5J60A 4I58A 1EC7A 2QJMA 2VQBA 5FJRA 3GWDA 4BJYA 3MUCA 3NH3X 3OPSA 5JCLA 2PTYA 1S2YA 3UCLA 4Z1YA 2WDVA 4BJZA 1ELIA 3K7TA 5KMRA 5KNLA 2XSXA 3T8QA 3G5QA 2JKCA 3NN0X 3DGZA 4IL2A 2GR1A 3PWIA 3BOXA 3SQPA 4CNKA 4E4FA 4U8NA 2P0IA 3CNPA 5U25A 5FS6A 1OJDA 2V61A 1ZP0A 4YTMA 4JNAA 3AMZA 2XH4A 1NEKA 3AN1A 2ZZBA 3KA7A 1BKHA 4DGKA 3CGCA 4TVWA 2JAEA 3FV9A 3P4SA 2P3ZA 4E8GA 4H4UA 2X50A 4Z26A 4CY8A 4M0XA 3SBFA 4IA6A 1H7WA 3P0WA 1SJDA 1P2EA 4HNLA 2QDDA 3HW2A 3TWBA 3H8AA 2E5VA 3DGHA 3AE2A 4YWSA 3ADAB 2A89A 3AYLA 4H50A 4HA6A 3D47A 1GTEA 3SYIA 4HN8A 2BCGG 2YLTA 2P8CA 3QPEA 5HY5A 4NTEA 2PSNA 3NN6X 4UDRA 1YQ4A 2GAGB 1IUUA 1OJ9A 3VRDB 4YXDA 1CC6A 1EBGA 1YQZA 4M52A 2YG3A 1H86A 3Q45A 4YKGA 2OVLA 1JNZA 2I5QA 5GSNA 1KDGA 3CXOA 4J3ZA 3JVAA 4ZCWA 5KMQA 1B4VA 3ZVHA 1JRXA 1NHSA 1PJ7A 3BHKA 1H81A 1K0IA 5IQ4A 2VVMA 4DN1A 1E6EA 2GGHA 5J04A 2YG5A 4ZOHB 3LJPA 1CJ4A 4Z2TA 1GRTA 2C73A 4H2RA 4OPTA 4G8TA 4GIRA 4G73A 4Z25A 4A65A 2OA1A 2RGHA 4YTNA 2XYOA 4G9KA 3TQPA 2GV8A 2OALA 3CN8A 1H83A 4GUVA 3GDPA 3CGDA 2PTWA 3FG2P 2WPEA 1T3QC 3B6DA 1H2IA 1W6TA 1K0LA 4AP3A 2WS3A 3GD6A 3R0KA 3NKSA 5FJOA 1JCTA 2V3BA 3CNTA 5KWFA 5IQ1A 3DDMA 3AM9A 3V3WA 1AOGA 2X8GA 3KUMA 1HYUA 2WHDA 3SGLA 3NK1X 4C5OA 4AOXA 4J56A 2V3AA 1MDRA 4JN8A 5KVHA 4A6NA 4H4SA 3VFCA 3T2ZA 3NZGA 4YSXA 4UDQA 2W54A 4A7AA 2PP1A 5U63A 4H19A 3NYEA 3B97A 4JY3A 3T14A 5GRTA 4GYPC 3URHA 5U1OA 1BGJA 3V4BA 3NVWB 1M6IA 3ICRA 3TCSA 3D8XA 4GF7A 2HQMA 4X2PA 1IUTA 2YQUA 2E3TA 3IJLA 3EAOA 1FOHA 4H4XA 2VZ2A 4M6UA 4MMWA 4Y4NA 2TMDA 4KPLA 4FK1C 1KNRA 3ETRB 4Z24A 3R25A 4U8MA 3UCCA 3AYIA 4HPNA 4YSZA 1JRYA 4GYPA 1JROA 1RSGA 4G6GA 3II4A 3SY4A 4GRTA 4JHMA 1TKKA 3DK8A 3H4KA 2IVDA 1F3PA 4H1ZA 1PS9A 3KPFA 1PDYA 1E1LA 3PFRA 1DXLA 2VQ7A 2OQYA 3MSYA 3RR1A 4I59A 3VRAA 2GB0A 1BWCA 3R1ZA 5M0ZA 4OPIA 1EL7A 2PYXA 4B66A 4FK1A 4H4RA 3UXLA 3S5WA 1LPFA 3AYJA 3TTEA 3RO6A 2AAQA 3M0OA 1E1MA 3RGTA 4ZCCA 2WP9A 1GRHA 4H7UA 3GMCA 4TM3A 2Q7VA 1REOA 4J34A 3LXDA 4A9WA 4EMWA 4NTDA 4HCLA 2YR4A 2BC0A 3UKLA 1SJCA 3UJ2A 2UZZA 1PXAA 4GAPA 3AD9B 4H4PA 2GGEA 2PPGA 4JY2A 4IVMB 2AL2A 1TDEA 2WOVA 5C3JA 3BHFA 3QSEA 1KNPA 1S7MA 2XCGA 3M12A 4HCDA 2QDEA 2GMJA 3GWFA 2QA2A 3R0UA 3G5RA 1SB3B 2YVJA 3DH9A 2E1MA 1MDLA 2GVCA 3HZLA 2B7RA 3LOVA 3B9JB 1GXFA 2GR0A 3N6JA 1QO8A 2GR3A 2PGWA 1CJCA 3FMWA 2DW7A 3NK2X 2R46A 1PBCA 1Y0PA 3LB8A 1S3EA 3NYFA 5CKUA 3NG7X 3CGBA 1KKRA 5BOFA 4MGGA 3BI2A 2QGYA 3FXGA 1X31B 4DX3A 3P3BA 1KFYA 1Y56B 3CNJA 1H6VA 4A79A 1TDFA 2XVHA 3AD7B 3SZFA 4OPLA 4CCRA 3JZUA 1LQUA 4IP4A 3ISHA 4K1WA 3SN4A 3EUB3 1GESA 1L8PA 2FYMA 2CVJA 1KSSA 2YLWA 3BI4A 3N4EA 2PU0A 1ZMCA 1NG3A 2HXTA 2X3NA 3P1WA 2QAEA 1ZK7A 3PWGA 1XHCA 1LQTA 2OAMA 4G7FA 3K30A 2ONEA 3L8KA 5FS9A 2OLOA 1P48A 2B9WA 3P93A 1ZXIC 3UKQA 4K7ZA 3NRZB 2XFUA 6ENLA 3PS9A 2OZ8A 2WBAA 1FCDA 1N4VA 2YWLA 3DG3A 3R11A 2JB1A 3I3LA 1TDNA 3VC5A 3C4AA 2O9ZA 2WEUA 5EOWA 3I6EA 2HNEA 4EIPA 3UJEA 2GRTA 5FJPA 2OLNA 4N9XA 3AE8A 1SJAA 3ENLA 5KRQA 3IF9A 5JRBA 2PA6A 1JRPA 3EEZA 1F6MA 2IVEA 4IV9A 3DG6A 2AQJA 2YLRA 1E1NA 5BRTA 2HZGA 3R9UA 1XS2A 4EM3A 3SFEA 4G6HA 5LV9A 5EBKA 4CCQA 4Y4LA 4H83A 1IYXA 5FJTA 3V3OA 2R9ZA 1F8SA 2H89A 3T31A 1GRBA 1VDVA 1D4CA 4P9SA 4JNQA 3IK4A 3AWIA 3LZXA 3UJRA 1EL8A 4USRA 2YG7A 3PK7A 1E9IA 4EWJA 1NU5A 4HYRA 1KKOA 3Q4DA 4FX9A 2V5ZA 1UKVG 1W4XA 2ZADA 2VOUA 3DGBA 3LADA 3GYXA 1X2GA 3ICTA 1IUWA 3ZLGA 3CTYA 1SEZA 4NEWA 4H4VA 7ENLA 2GR2A 2XFOA 4H4WA 2AR8A 2QJNA 1ZY8A 3CPJG 3UJFA 1WUFA 3P9UA 3AE3A 1IUXA 1D7LA 2J3NA 1PJ5A 4B69A 4UP3A 2GQFA 1XANA 4U8IA 1MXTA 3T0KA 3AD8B 4K2XA 3AE4A 1BF3A 1OJAA 3L5OA 3IWAA 2Q0KA 2YR6A 1PBBA 2OFJA 3DJDA 3SJNA 3FCPA 4RG4A 1TE6A 2EQ9A 4NZHA 4WX1A 1O95A 2R0GA 2JB2A 4IZGA 3CPIG 2YG4A 2VVLA 1SJBA 4X9NA 3SN1A 2YG6A 1LV0A 2OLAA 2B9XA 4Z43A 1GALA 2BC1A 2JBVA 4YTPA 3PVCA 3G5SA 3NLCA 3V76A 3UTEA 1GETA 1XDIA 1CJ3A 2OG9A 3GO2A 4HCHA 1MNSA 4A5LA 1LVLA 2BCPA 3RITA 1JOAA 1CC2A 1NG4A 3CNDA 3VRBA 4D03A 4U2SA 2CDUA 3FIMB 3N6HA 4A35A 5ER0A 2NVKX 3NGCX 4Y4MA 2APGA 4KWSA 5KMPA 2PCEA 1N1PA 2BACA 2BS3A 3DIPA 1JPMA 3FYYA 1NENA 2XVFA 1RYIA 4ADWA 4H4QA 4B64A 1TRBA 2QVHA 1V97A 3DJEA 1GNDA 3T2KA 3UTFA 2W0HA 1PBFA 3Q6JA 3P4QA 1EC9A 1E39A 1R0MA 3S61A 3AEAA 2EQ6A 1DODA 2A87A 3NTAA 4LU6A 3H8LA 3QVPA 3IHGA 2XLTA 3DG7A 1NHRA 3MZNA 2GQWA 3QFBA 3VCNA 4TVYA 3B3RA 4E0VA 1E7PA 5C2TA 1JEHA 4B63A 2PP3A 4NWZA 4Z2UA 3OZ2A 4KT2A 3BJSA 1O5WA 4O5UA 2IIDA 1WUEA 1QLBA 1CHUA 2GH5A 2QA1A 1FL2A 1P2HA 3P4RA 3NIXA 1L9CA 4J31A 2BK4A 3MQTA 3CYJA 4H2NA 4E4UA 3A7UA 1GV4A 1KCZA 3OTRA 1YY5A 2JK6A 3C4NA 3H70A 1YQ3A 1V59A 3JSKA 2E5AA 3SZWA 1CL0A 2YLXA 5CQFA 2EQ8A 4LA1A 3S5SA 4C77A 4U8KA 1VRQB 4PABA 2C3DA 3FJ4A 3SR6B 2WOWA 1GSNA 4F4RA 3UKAA 4X4JA 4ICYA 1D7YA 2WP5A 1NPXA 4OCGA 4B1BA 4FDCB 5ENLA 3K7QX 4II2A 3F8DA 4CNJA 3NYCA 1GEUA 4CY6A 4DXKA 3KLJA 2YM1A 3GRSA 3BSMA 4GGHA 4ENLA 2BRAA 1MO9A 3VR9A 3S47A 2BYBA 1FHVA 4YSHA 4NNJA 5KMSA 1DTNA 2C70A 2GEWA 1IUSA 3BI5A 3AE5A 3D1CA 4DWDA 4MKSA 3RP8A
chains in the Genus database with same CATH topology
1F8WA 2C65A 4H4YA 1H7WA 3AEEA 4C74A 3V3NA 1Q1RA 1P2EA 2BK5A 3ITJA 1KSSA 2YLWA 1CC4A 3HYXA 3E1TA 3BI4A 2R4JA 2E5VA 3UOXA 1ZMCA 3DGHA 1NG3A 2X3NA 3AE2A 4U8JA 3P1WA 1L0VA 2QAEA 1ZK7A 1XHCA 5JCNA 3ADAB 5M10A 3OC4A 1LQTA 2A89A 2OAMA 3VQRA 3AYLA 3K30A 4XWRA 3L8KA 4H50A 5FS9A 2OLOA 3NHOX 2CFYA 3CIRA 4HA6A 1GTEA 1VDCA 3DJGX 2B9WA 1VQWA 3SYIA 1S2QA 2BCGG 2ZZCA 1YKJA 3UKQA 4K7ZA 2YLTA 2ACZA 5HY5A 4NTEA 2WP6A 2XFUA 3NN6X 3PS9A 4UDRA 1CJ2A 1YQ4A 2WBAA 3KU9A 1ZDLA 2GAGB 1IUUA 4K5RA 1FCDA 4DNAA 1B8SA 1N4VA 2V6OA 2YWLA 1OJ9A 3F8RA 3AE9A 2JB1A 3I3LA 1GERA 4K22A 1TDNA 4AP1A 2FJEA 3VRDB 3GSIA 4XWZA 3C4AA 4YXDA 2O9ZA 2Z5YA 3UP5A 2WEUA 5EOWA 5HYMA 4EQXA 3GMBA 1CC6A 1OJTA 4EIPA 1DNCA 1YQZA 4M52A 2GRTA 2OLNA 2YG3A 4N9XA 1H86A 3AE8A 3ICSA 3REDA 3UOVA 1CF3A 1KF6A 3AEGA 4YKGA 3AE7A 1K0JA 3QJ4A 5KRQA 4ECHA 3SZ0A 3IF9A 5HXIA 1JNZA 5JRBA 4A6NB 5BVAA 1PXBA 3CNSA 1FEBA 2BA9A 4HB9A 5GSNA 4GDEA 2F5ZA 1KDGA 1F6MA 4H4TA 2IVEA 2R45A 3UTGA 2BXRA 4IV9A 3O0HA 2AQJA 2YLRA 1E1NA 2YVGA 5FS7A 1B4VA 2Q0LA 2R0CA 5KMQA 5BRTA 5KXJA 1L9EA 1JRXA 1NHSA 4C3YA 3R9UA 1PJ7A 1CBOA 3BHKA 3K7MX 1H81A 4EM3A 1K0IA 1GT8A 3SFEA 5FMHA 1PN0A 4G6HA 5IQ4A 4OVIA 2VVMA 2WU2A 4AT2A 1E6EA 5LV9A 2DKIA 3ZDNA 5EBKA 2YG5A 4CCQA 3I6DA 4Y4LA 3NNEA 3LJPA 2X8HA 4C3XA 1CJ4A 5JCIA 4BK3A 3T2YA 4Z2TA 1GRTA 2XVJA 3AXBA 3V3OA 2R9ZA 1D5TA 2C73A 4OPGA 1F8SA 2FBWA 2WDRA 2H89A 4AT0A 2BS2A 4H2RA 4OPTA 3T31A 1GRBA 1PXCA 1ZOVA 4G73A 1D4CA 1IJHA 3P4PA 3CGEA 1NAAA 4Z25A 4A65A 4OPDA 2OA1A 4WCTA 2RGHA 3BNMA 4P9SA 4OPCA 4YTNA 2XYOA 4JNQA 4G9KA 2GMHA 3GRTA 1Z6LA 3AWIA 3LZXA 3RP7A 1EL8A 2YM2A 3BNUA 4USRA 3ABVA 2YG7A 2JB3A 2TPRA 5JCMA 2GV8A 1ZKQA 2RGJA 5FS8A 1E1KA 3HYWA 2OALA 4USQA 1KSUA 3CN8A 4FX9A 1H83A 1MOKA 1UKVG 1FECA 1W4XA 2V5ZA 2C76A 2WQYA 4GUVA 3GDPA 2I0ZA 3EANA 2VOUA 4Z44A 1ZOYA 3LADA 1Q9IA 3ATQA 3GYXA 3CGDA 3ICTA 1IUWA 2XDOA 3CTYA 4H4ZA 1SEZA 4NEWA 3DK4A 3FG2P 2YAUA 4H4VA 2WPEA 4CBQA 2XVEA 2GR2A 2XFOA 2RABA 2GF3A 4H4WA 3B6DA 2BS4A 4EIQA 4TM1A 4UDPA 3T37A 1H2IA 1DJNA 1K0LA 2VRLA 2Z5XA 2AR8A 4AP3A 2WS3A 1ZY8A 1LJ1A 3CPJG 2C3CA 3GD3A 4U2LA 2C64A 1TDKA 3UKHA 3P9UA 3SX6A 3AE3A 3NT6A 1IUXA 1D7LA 2J3NA 1PJ5A 3NKSA 4B69A 4UP3A 4TM0A 1NDAA 5L46A 2GQFA 4KPRA 2V3BA 1XANA 3CNTA 4U8OA 4U8IA 5IQ1A 5KWFA 3GYJA 1MXTA 4OPUA 4EQSA 3T0KA 3AD8B 1F8RA 2DKHA 3KD9A 2WPFA 1AOGA 4ZCDA 3CPHG 4K2XA 4YKFA 2X8GA 3AE4A 1BF3A 1GRAA 1OJAA 3L5OA 1HYUA 3KKJA 3IWAA 4B67A 2Q0KA 2WHDA 1PBBA 2YR6A 4KX6A 1JNRA 3DJDA 3SGLA 4IVOB 1DJQA 2ZBWA 3WE0A 1D4DA 2XFNA 2XFQA 4RG4A 3UKPA 2VVLG 3NK1X 4C5OA 2WESA 2EQ9A 3RP6A 4AOXA 4J56A 4NZHA 4WX1A 2XVIA 5J7XA 1O95A 2R0GA 5HHFA 1KN0A 1ZMDA 2V3AA 4EQRA 2XLRA 5KVHA 4A6NA 2JB2A 4H4SA 2WETA 3CPIG 2ZZ0A 2YG4A 1GRGA 2VVLA 4YWOA 4RSLA 3EF6A 4TLXA 4X9NA 3DJJA 2C67A 3SXIA 1PDHA 2YG6A 2C7GA 1LV0A 3ATRA 1Q1WA 2GAHB 3T2ZA 2B9XA 3DMEA 4K8DA 4NEVA 4Z43A 4YSXA 1GALA 2BC1A 2JBVA 4UDQA 4A7AA 3L1RA 4YTPA 3QSMA 1D4EA 2YLSA 5U63A 4EM4A 2C66A 4K5SA 4RG3A 1BKWA 3C96A 3PVCA 3G5SA 5BUKA 3NYEA 3NLCA 3V76A 3RNMA 3DA1A 3IHMA 3NRNA 1OJCA 4JY3A 4TLZA 4U2TA 1GETA 5GRTA 3T14A 3UTEA 1XPQA 3GD4A 1XDIA 2BK3A 3URHA 5U1OA 1BGJA 2H88A 3AECA 3QFAA 3ALJA 1CJ3A 2XLUA 1EL5A 1M6IA 3AEBA 3SM8A 1TDOA 1BGNA 2YR5A 3ICRA 4A5LA 1LVLA 3D8XA 1O94A 2R4EA 2BCPA 4GF7A 1JOAA 4GAVA 3PG6A 2BXSA 2HQMA 1IUTA 1CC2A 1NG4A 4JN9A 2YQUA 3CNDA 4JQ9A 4X9MA 1Y56A 3VRBA 3EAOA 3KPKA 4D03A 1FOHA 4U2SA 2CDUA 3FIMB 3AEFA 1EBDA 3EPTA 4H4XA 4BV6A 1DOBA 3GDNA 4H2QA 4JDRA 4MJWA 2VZ2A 5ER0A 2NVKX 4Y4NA 2TMDA 4FK1C 2Y6QA 1KNRA 3NGCX 4YSYA 2FJAA 3PO7A 4Y4MA 4D04A 4Z24A 2APGA 3UOYA 4U8MA 3AYIA 2B7SA 4YSZA 5KMPA 4XXGA 1JRYA 1N1PA 1RSGA 2QCUA 2BACA 2BS3A 1B37A 4G6GA 3II4A 3SY4A 1NENA 2B9YA 2XVFA 2C72A 3IC9A 4GRTA 4EMIA 1RYIA 4GDPA 2XLPA 5KOWA 4ADWA 4U8LA 4H4QA 3DK8A 3H4KA 4B64A 1TRBA 5EB5A 2C75A 3Q9TA 4H2PA 2IVDA 3DJEA 1GNDA 1F3PA 1PS9A 3T2KA 2PHHA 3KPFA 3UTFA 2W0HA 2YVFA 3GYIA 1E1LA 1PBFA 2VQ7A 1DXLA 3Q6JA 3P4QA 1EL9A 1E39A 1PHHA 4BK1A 1NHQA 4I59A 4GCMA 2Q6UA 1PBEA 3S61A 3VRAA 1PJ6A 2R0PA 2GB0A 3AEAA 3SFDA 1BWCA 2RGOA 5M0ZA 4J2WA 4OPIA 2EQ6A 1EL7A 2PYXA 4CRTA 2X99A 3VR8A 3DK9A 4B66A 1DODA 4FK1A 1FEAA 4H4RA 2A87A 3NTAA 1M64A 4LU6A 3H8LA 3QVPA 3S5WA 4A99A 5KOXA 2BABA 1TYTA 2E4GA 3IHGA 1LPFA 3AYJA 1JU2A 2FJDA 4J57A 4O5QA 2XLTA 2AAQA 1DOEA 1NHRA 1H84A 1RP0A 3RHAA 3M0OA 4G74A 1E1MA 4ZCCA 3ALLA 1JRZA 2WP9A 2GQWA 3QFBA 4ZN0A 1GRHA 3UOZA 2YLZA 3B3RA 4E0VA 1E7PA 5C2TA 1BZLA 1TYPA 1JEHA 3AB1A 1ZX9A 3GMCA 4H7UA 1GOSA 2WDQA 4TM3A 4U8PA 2Q7VA 1REOA 4TM4A 4B63A 4J34A 4NWZA 4LIIA 4APNA 4Z2UA 5JCKA 4BURA 3RP8A 3OZ2A 1COYA 3LXDA 4A9WA 1O5WA 3QSSA 4J36A 4O5UA 2IIDA 3UP4A 2A8XA 4II3A 2WU5A 3UKFA 2FJBA 5IPYA 3SZCA 2X8CA 1QLBA 1CHUA 2GH5A 1VG9A 4EMWA 2QA1A 1GREA 3NK0X 1FL2A 3KVEA 2YR4A 3F8PA 2BC0A 1P2HA 4NTDA 3P4RA 3UKLA 2V60A 3NIXA 5KVIA 1L9CA 1S3BA 4IA5A 4J31A 2BK4A 1GTHA 1DOCA 1PXAA 2UZZA 3AE1A 3AD9B 4GAPA 5J60A 4H4PA 4I58A 4H2NA 4EQWA 2VQBA 3AEDA 4JY2A 4NTCA 3GWDA 2CULA 1GV4A 4BJYA 1H82A 4IVMB 3NH3X 1YY5A 2JK6A 3C4NA 1TDEA 2WOVA 2ARDA 5C3JA 5JCLA 1YQ3A 2XFPA 3BHFA 1V59A 3NTDA 3QSEA 1KNPA 1S2YA 3JSKA 3UCLA 1VG0A 3UKKA 4Z2RA 2WDVA 1S7MA 4GR1A 2XCGA 3M12A 4BJZA 3SZWA 1ELIA 2GMJA 3GWFA 1CL0A 2QA2A 3K7TA 4AOSA 5KMRA 5KNLA 3G5RA 2YLXA 3G5QA 5CQFA 2EQ8A 2B76A 2JKCA 2YVJA 4LA1A 1K4QA 5TR3A 3DGZA 3NN0X 4C77A 3FPZA 2GR1A 4REKA 3SQPA 4CNKA 1GRFA 3DH9A 2E1MA 3HYVA 4U8KA 1VRQB 2BRYA 4PABA 2C3DA 4U8NA 3M13A 2GVCA 4PAAA 3HZLA 3QVRA 3COXA 2B7RA 2WOWA 3CNPA 1GSNA 3LOVA 5U25A 3UKAA 4X4JA 1GXFA 5FS6A 4DSGA 4DSHA 2GR0A 3FBSA 1QO8A 2GR3A 4ICYA 1OJDA 1D7YA 1CJCA 2WP5A 3FMWA 3NK2X 2V61A 2R46A 4J33A 5EB4A 1ZP0A 1NPXA 1PBCA 1QJDA 1Y0PA 2VRMA 2WPCA 4JNAA 4OCGA 4YTMA 3LB8A 1S3EA 4FDCB 1IUVA 3NYFA 4B1BA 4BK2A 1H7XA 1NEKA 3K7QX 3NG7X 3CGBA 1LTXR 4II2A 5CKUA 1GPEA 3BI2A 3F8DA 4CNJA 3NYCA 1GEUA 3ZYXA 4CY6A 5DBJA 2ZZBA 3KA7A 2C4CA 3KLJA 2YM1A 1X31B 2WOIA 3GRSA 1N4UA 4DGKA 3CGCA 1KFYA 1Y56B 1L9DA 2JAEA 2XLSA 3CNJA 1H6VA 4A79A 1ONFA 3ALMA 2BRAA 1TDFA 5BULA 2XVHA 2NPXA 1MO9A 1N4WA 3P4SA 3AD7B 3VR9A 3SZFA 3D9XA 1PBDA 2BYBA 4YSHA 4OPLA 4NNJA 4CCRA 5KMSA 2EQ7A 1LQUA 2C70A 3LZWA 1B5QA 1NHPA 3CMMA 3ISHA 3UTHA 4B65A 4H4UA 2GEWA 2X50A 4Z26A 4CY8A 1IUSA 3BI5A 4EMJA 3AE5A 1GESA 3AE6A 3H8IA 2Y6RA 3D1CA 4YT0A 4B68A 2CVJA 4IA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8W A;  2C65 A;  4H4Y A;  1H7W A;  3AEE A;  4C74 A;  3V3N A;  1Q1R A;  1P2E A;  2BK5 A;  3ITJ A;  1KSS A;  2YLW A;  1CC4 A;  3E1T A;  3BI4 A;  2R4J A;  2E5V A;  3UOX A;  1ZMC A;  3DGH A;  1NG3 A;  2X3N A;  3AE2 A;  4U8J A;  3P1W A;  1L0V A;  2QAE A;  1ZK7 A;  1XHC A;  5JCN A;  3ADA B;  5M10 A;  3OC4 A;  1LQT A;  2A89 A;  2OAM A;  3VQR A;  3AYL A;  3K30 A;  4XWR A;  3L8K A;  4H50 A;  5FS9 A;  2OLO A;  3NHO X;  2CFY A;  3CIR A;  4HA6 A;  1GTE A;  1VDC A;  3DJG X;  2B9W A;  1VQW A;  1S2Q A;  2BCG G;  2ZZC A;  1YKJ A;  3UKQ A;  4K7Z A;  2YLT A;  2ACZ A;  5HY5 A;  4NTE A;  2WP6 A;  2XFU A;  3NN6 X;  3PS9 A;  4UDR A;  1CJ2 A;  1YQ4 A;  2WBA A;  3KU9 A;  1ZDL A;  2GAG B;  1IUU A;  4K5R A;  1FCD A;  4DNA A;  1B8S A;  1N4V A;  2V6O A;  2YWL A;  1OJ9 A;  3F8R A;  3AE9 A;  2JB1 A;  3I3L A;  1GER A;  4K22 A;  1TDN A;  4AP1 A;  2FJE A;  3VRD B;  3GSI A;  4XWZ A;  3C4A A;  4YXD A;  2O9Z A;  2Z5Y A;  3UP5 A;  2WEU A;  5EOW A;  5HYM A;  4EQX A;  3GMB A;  1CC6 A;  1OJT A;  4EIP A;  1DNC A;  1YQZ A;  4M52 A;  2GRT A;  2OLN A;  2YG3 A;  4N9X A;  1H86 A;  3AE8 A;  3ICS A;  3RED A;  3UOV A;  1CF3 A;  1KF6 A;  3AEG A;  4YKG A;  3AE7 A;  1K0J A;  3QJ4 A;  5KRQ A;  4ECH A;  3IF9 A;  5HXI A;  1JNZ A;  4A6N B;  5BVA A;  1PXB A;  3CNS A;  1FEB A;  2BA9 A;  4HB9 A;  5GSN A;  4GDE A;  2F5Z A;  1KDG A;  1F6M A;  4H4T A;  2IVE A;  2R45 A;  3UTG A;  2BXR A;  4IV9 A;  3O0H A;  2AQJ A;  2YLR A;  1E1N A;  2YVG A;  5FS7 A;  1B4V A;  2Q0L A;  2R0C A;  5BRT A;  5KXJ A;  1L9E A;  1JRX A;  1NHS A;  4C3Y A;  3R9U A;  1PJ7 A;  1CBO A;  3BHK A;  3K7M X;  1H81 A;  4EM3 A;  1K0I A;  1GT8 A;  3SFE A;  5FMH A;  1PN0 A;  5IQ4 A;  4OVI A;  2VVM A;  2WU2 A;  4AT2 A;  1E6E A;  5LV9 A;  2DKI A;  3ZDN A;  5EBK A;  2YG5 A;  4CCQ A;  3I6D A;  4Y4L A;  3NNE A;  3LJP A;  2X8H A;  4C3X A;  1CJ4 A;  5JCI A;  4BK3 A;  4Z2T A;  1GRT A;  2XVJ A;  3AXB A;  3V3O A;  2R9Z A;  1D5T A;  2C73 A;  4OPG A;  1F8S A;  2FBW A;  2WDR A;  2H89 A;  4AT0 A;  2BS2 A;  4H2R A;  4OPT A;  1GRB A;  1PXC A;  1ZOV A;  1D4C A;  1IJH A;  3P4P A;  3CGE A;  1NAA A;  4Z25 A;  4A65 A;  4OPD A;  2OA1 A;  4WCT A;  2RGH A;  3BNM A;  4P9S A;  4OPC A;  4YTN A;  2XYO A;  4JNQ A;  2GMH A;  3GRT A;  1Z6L A;  3AWI A;  3LZX A;  3RP7 A;  1EL8 A;  2YM2 A;  3BNU A;  4USR A;  3ABV A;  2YG7 A;  2JB3 A;  2TPR A;  5JCM A;  2GV8 A;  1ZKQ A;  2RGJ A;  5FS8 A;  1E1K A;  2OAL A;  4USQ A;  1KSU A;  3CN8 A;  4FX9 A;  1H83 A;  1MOK A;  1UKV G;  1FEC A;  1W4X A;  2V5Z A;  2C76 A;  2WQY A;  4GUV A;  3GDP A;  2I0Z A;  3EAN A;  2VOU A;  4Z44 A;  1ZOY A;  3LAD A;  1Q9I A;  3ATQ A;  3CGD A;  3ICT A;  1IUW A;  2XDO A;  3CTY A;  4H4Z A;  1SEZ A;  4NEW A;  3DK4 A;  3FG2 P;  2YAU A;  4H4V A;  2WPE A;  4CBQ A;  2XVE A;  2GR2 A;  2XFO A;  2RAB A;  2GF3 A;  4H4W A;  3B6D A;  2BS4 A;  4EIQ A;  4TM1 A;  4UDP A;  3T37 A;  2VRL A;  1DJN A;  1K0L A;  2Z5X A;  2AR8 A;  4AP3 A;  2WS3 A;  1ZY8 A;  1LJ1 A;  3CPJ G;  2C3C A;  3GD3 A;  4U2L A;  2C64 A;  1TDK A;  3UKH A;  3P9U A;  3AE3 A;  3NT6 A;  1IUX A;  1D7L A;  2J3N A;  1PJ5 A;  3NKS A;  4B69 A;  4UP3 A;  4TM0 A;  1NDA A;  5L46 A;  2GQF A;  4KPR A;  2V3B A;  1XAN A;  3CNT A;  4U8O A;  4U8I A;  5IQ1 A;  5KWF A;  3GYJ A;  1MXT A;  4OPU A;  4EQS A;  3AD8 B;  1F8R A;  2DKH A;  3KD9 A;  2WPF A;  1AOG A;  4ZCD A;  3CPH G;  4K2X A;  4YKF A;  2X8G A;  3AE4 A;  1BF3 A;  1GRA A;  1OJA A;  1HYU A;  3KKJ A;  3IWA A;  4B67 A;  2Q0K A;  2WHD A;  1PBB A;  2YR6 A;  4KX6 A;  1JNR A;  3DJD A;  3SGL A;  4IVO B;  1DJQ A;  2ZBW A;  3WE0 A;  1D4D A;  2XFN A;  2XFQ A;  4RG4 A;  3UKP A;  2VVL G;  3NK1 X;  4C5O A;  2WES A;  2EQ9 A;  3RP6 A;  4AOX A;  4J56 A;  4NZH A;  4WX1 A;  2XVI A;  5J7X A;  1O95 A;  2R0G A;  5HHF A;  1ZMD A;  2V3A A;  4EQR A;  2XLR A;  5KVH A;  4A6N A;  2JB2 A;  4H4S A;  2WET A;  3CPI G;  2ZZ0 A;  2YG4 A;  1GRG A;  2VVL A;  4YWO A;  4RSL A;  3EF6 A;  4TLX A;  4X9N A;  3DJJ A;  2C67 A;  1PDH A;  2YG6 A;  2C7G A;  1LV0 A;  3ATR A;  1Q1W A;  2GAH B;  2B9X A;  3DME A;  4K8D A;  4NEV A;  4Z43 A;  4YSX A;  1GAL A;  2BC1 A;  2JBV A;  4UDQ A;  4A7A A;  3L1R A;  4YTP A;  3QSM A;  1D4E A;  2YLS A;  5U63 A;  4EM4 A;  2C66 A;  4K5S A;  4RG3 A;  1BKW A;  3C96 A;  3PVC A;  3G5S A;  5BUK A;  3NYE A;  3NLC A;  3V76 A;  3RNM A;  3DA1 A;  3IHM A;  3NRN A;  1OJC A;  4JY3 A;  4TLZ A;  4U2T A;  1GET A;  5GRT A;  3UTE A;  1XPQ A;  3GD4 A;  1XDI A;  2BK3 A;  3URH A;  5U1O A;  1BGJ A;  2H88 A;  3AEC A;  3QFA A;  3ALJ A;  1CJ3 A;  2XLU A;  1EL5 A;  1M6I A;  3AEB A;  3SM8 A;  1TDO A;  1BGN A;  2YR5 A;  3ICR A;  4A5L A;  1LVL A;  3D8X A;  1O94 A;  2R4E A;  2BCP A;  4GF7 A;  1JOA A;  2BXS A;  2HQM A;  1IUT A;  1CC2 A;  1NG4 A;  4JN9 A;  2YQU A;  3CND A;  4JQ9 A;  4X9M A;  1Y56 A;  3VRB A;  3EAO A;  4D03 A;  1FOH A;  4U2S A;  2CDU A;  3FIM B;  3AEF A;  1EBD A;  3EPT A;  4H4X A;  4BV6 A;  1DOB A;  3GDN A;  4H2Q A;  4JDR A;  4MJW A;  2VZ2 A;  5ER0 A;  2NVK X;  4Y4N A;  2TMD A;  4FK1 C;  2Y6Q A;  1KNR A;  3NGC X;  4YSY A;  2FJA A;  3PO7 A;  4Y4M A;  4D04 A;  4Z24 A;  2APG A;  3UOY A;  4U8M A;  3AYI A;  2B7S A;  4YSZ A;  4XXG A;  1JRY A;  1N1P A;  1RSG A;  2QCU A;  2BAC A;  2BS3 A;  1B37 A;  3II4 A;  1NEN A;  2B9Y A;  2XVF A;  2C72 A;  3IC9 A;  4GRT A;  4EMI A;  1RYI A;  4GDP A;  2XLP A;  5KOW A;  4ADW A;  4U8L A;  4H4Q A;  3DK8 A;  3H4K A;  4B64 A;  1TRB A;  5EB5 A;  2C75 A;  3Q9T A;  4H2P A;  2IVD A;  3DJE A;  1GND A;  1F3P A;  1PS9 A;  2PHH A;  3KPF A;  3UTF A;  2W0H A;  2YVF A;  3GYI A;  1E1L A;  1PBF A;  2VQ7 A;  1DXL A;  3Q6J A;  3P4Q A;  1EL9 A;  1E39 A;  1PHH A;  4BK1 A;  1NHQ A;  4I59 A;  4GCM A;  2Q6U A;  1PBE A;  3S61 A;  3VRA A;  1PJ6 A;  2R0P A;  2GB0 A;  3AEA A;  3SFD A;  1BWC A;  2RGO A;  5M0Z A;  4J2W A;  4OPI A;  2EQ6 A;  1EL7 A;  2PYX A;  4CRT A;  2X99 A;  3VR8 A;  3DK9 A;  4B66 A;  1DOD A;  4FK1 A;  1FEA A;  4H4R A;  2A87 A;  3NTA A;  1M64 A;  4LU6 A;  3H8L A;  3QVP A;  3S5W A;  4A99 A;  5KOX A;  2BAB A;  1TYT A;  2E4G A;  3IHG A;  1LPF A;  3AYJ A;  1JU2 A;  2FJD A;  4J57 A;  4O5Q A;  2XLT A;  2AAQ A;  1DOE A;  1NHR A;  1H84 A;  1RP0 A;  3RHA A;  3M0O A;  1E1M A;  4ZCC A;  3ALL A;  1JRZ A;  2WP9 A;  2GQW A;  3QFB A;  4ZN0 A;  1GRH A;  3UOZ A;  2YLZ A;  3B3R A;  4E0V A;  1E7P A;  5C2T A;  1BZL A;  1TYP A;  1JEH A;  3AB1 A;  1ZX9 A;  3GMC A;  4H7U A;  1GOS A;  2WDQ A;  4TM3 A;  4U8P A;  2Q7V A;  1REO A;  4TM4 A;  4B63 A;  4J34 A;  4LII A;  4APN A;  4Z2U A;  5JCK A;  4BUR A;  3RP8 A;  3OZ2 A;  1COY A;  3LXD A;  4A9W A;  1O5W A;  3QSS A;  4J36 A;  4O5U A;  2IID A;  3UP4 A;  2A8X A;  3UKF A;  2WU5 A;  2FJB A;  5IPY A;  2X8C A;  1QLB A;  1CHU A;  2GH5 A;  1VG9 A;  4EMW A;  2QA1 A;  1GRE A;  3NK0 X;  1FL2 A;  3KVE A;  2YR4 A;  3F8P A;  2BC0 A;  1P2H A;  4NTD A;  3P4R A;  3UKL A;  2V60 A;  3NIX A;  5KVI A;  1L9C A;  1S3B A;  4IA5 A;  4J31 A;  2BK4 A;  1GTH A;  1DOC A;  1PXA A;  2UZZ A;  3AE1 A;  3AD9 B;  5J60 A;  4H4P A;  4I58 A;  4H2N A;  4EQW A;  2VQB A;  3AED A;  4JY2 A;  4NTC A;  3GWD A;  2CUL A;  1GV4 A;  4BJY A;  1H82 A;  4IVM B;  3NH3 X;  1YY5 A;  2JK6 A;  3C4N A;  1TDE A;  2WOV A;  2ARD A;  5C3J A;  5JCL A;  1YQ3 A;  2XFP A;  3BHF A;  1V59 A;  3NTD A;  3QSE A;  1KNP A;  1S2Y A;  3JSK A;  3UCL A;  1VG0 A;  3UKK A;  4Z2R A;  2WDV A;  4GR1 A;  2XCG A;  3M12 A;  4BJZ A;  4AOS A;  1ELI A;  2GMJ A;  3GWF A;  1CL0 A;  2QA2 A;  3K7T A;  3G5R A;  2YLX A;  3G5Q A;  5CQF A;  2EQ8 A;  2B76 A;  2JKC A;  2YVJ A;  4LA1 A;  1K4Q A;  5TR3 A;  3DGZ A;  3NN0 X;  4C77 A;  3FPZ A;  2GR1 A;  4REK A;  3SQP A;  4CNK A;  1GRF A;  3DH9 A;  2E1M A;  4U8K A;  1VRQ B;  4PAB A;  2C3D A;  4U8N A;  3M13 A;  2GVC A;  4PAA A;  3HZL A;  3QVR A;  3COX A;  2B7R A;  2WOW A;  3CNP A;  1GSN A;  3LOV A;  5U25 A;  3UKA A;  4X4J A;  1GXF A;  5FS6 A;  4DSG A;  4DSH A;  2GR0 A;  3FBS A;  1QO8 A;  2GR3 A;  4ICY A;  1OJD A;  1D7Y A;  1CJC A;  2WP5 A;  3FMW A;  3NK2 X;  2V61 A;  2R46 A;  4J33 A;  5EB4 A;  1ZP0 A;  1NPX A;  1PBC A;  1QJD A;  1Y0P A;  2VRM A;  2WPC A;  4JNA A;  4OCG A;  4YTM A;  3LB8 A;  1S3E A;  4FDC B;  1IUV A;  3NYF A;  4B1B A;  4BK2 A;  1H7X A;  1NEK A;  3K7Q X;  3NG7 X;  3CGB A;  1LTX R;  5CKU A;  1GPE A;  3BI2 A;  3F8D A;  4CNJ A;  3NYC A;  1GEU A;  3ZYX A;  4CY6 A;  5DBJ A;  2ZZB A;  3KA7 A;  3KLJ A;  2YM1 A;  1X31 B;  2WOI A;  3GRS A;  1N4U A;  4DGK A;  3CGC A;  1KFY A;  1Y56 B;  1L9D A;  2JAE A;  2XLS A;  3CNJ A;  1H6V A;  4A79 A;  1ONF A;  3ALM A;  1TDF A;  5BUL A;  2XVH A;  2NPX A;  1MO9 A;  1N4W A;  3P4S A;  3AD7 B;  3VR9 A;  2BYB A;  1PBD A;  4YSH A;  4OPL A;  4CCR A;  1LQU A;  2EQ7 A;  2C70 A;  3LZW A;  1B5Q A;  1NHP A;  3ISH A;  3UTH A;  4B65 A;  4H4U A;  2GEW A;  2X50 A;  4Z26 A;  4CY8 A;  1IUS A;  3BI5 A;  4EMJ A;  3AE5 A;  1GES A;  3AE6 A;  3H8I A;  2Y6R A;  3D1C A;  4YT0 A;  4B68 A;  2CVJ A;  4IA6 A; 
#chains in the Genus database with same CATH topology
 4C74 A;  1Q1R A;  3ITJ A;  3HRD C;  1CC4 A;  3E1T A;  4H2H A;  2QJJ A;  2R4J A;  2CHR A;  4A6G A;  5JCN A;  3EKG A;  4AOS A;  4XWR A;  3NHO X;  1TZZ A;  1VDC A;  3N4F A;  1VQW A;  3CB3 A;  3QKE A;  2ACZ A;  2WP6 A;  3T6C A;  1CJ2 A;  1ZDL A;  4DNA A;  2V6O A;  3F8R A;  3AE9 A;  1GER A;  4AP1 A;  2FJE A;  2Z5Y A;  3CXB A;  4EQX A;  3GMB A;  1OJT A;  1DNC A;  2OQH A;  3UOV A;  1CF3 A;  1KF6 A;  3AEG A;  1K0J A;  3QJ4 A;  3HPF A;  5BVA A;  3STP A;  1PXB A;  4HB9 A;  2R45 A;  3TWA A;  2BXR A;  5FJU A;  3O0H A;  3V5C A;  2Q0L A;  5KXJ A;  2R0C A;  1NEL A;  3VA8 A;  1PN0 A;  4AT2 A;  1ELS A;  3I6D A;  3NNE A;  1ECQ A;  2PS2 A;  4C3X A;  4BK3 A;  5JCI A;  3T2Y A;  2XVJ A;  3AXB A;  3ES8 A;  1D5T A;  2WDR A;  3QN3 A;  4AT0 A;  1PXC A;  2NQL A;  1NAA A;  4OPD A;  3R10 A;  4HNC A;  3MWC A;  1EC8 A;  4OPC A;  2GMH A;  3GRT A;  3ABV A;  1STZ A;  5JCM A;  5FS8 A;  1KSU A;  4ROP A;  1FEC A;  2C76 A;  2WQY A;  1RM6 B;  4Z44 A;  3ATQ A;  2XDO A;  3DK4 A;  3OP2 A;  2RAB A;  2MNR A;  2BS4 A;  4EIQ A;  2ZC8 A;  1DJN A;  3T9P A;  2C3C A;  1JPD X;  3OZM A;  5L46 A;  4KPR A;  4OPU A;  4EQS A;  3ZLH A;  1F8R A;  2DKH A;  3KD9 A;  2WPF A;  3A7A A;  4FI4 A;  3CPH G;  4YKF A;  1GRA A;  2QQ6 A;  3U9I A;  4IVO B;  1DJQ A;  2ZBW A;  1D4D A;  2XFQ A;  3VCC A;  3RP6 A;  2XVI A;  3VC6 A;  4IP5 A;  1ZMD A;  4EQR A;  2XLR A;  3MY9 A;  2ZZ0 A;  4YWO A;  4RSL A;  4TLX A;  3DJJ A;  2GGJ A;  1MRA A;  1BQG A;  2C7G A;  3ATR A;  3IJI A;  1MUC A;  4FP1 A;  3DME A;  1EBH A;  1D4E A;  5EU9 A;  2YLS A;  4EM4 A;  1BKW A;  2DW6 A;  3T4W A;  3RNM A;  3DA1 A;  3IHM A;  3NRN A;  1OJC A;  4TLZ A;  3IJQ A;  4U2T A;  1XPQ A;  3RP7 A;  3ALJ A;  3QFA A;  3AEB A;  3SM8 A;  1TDO A;  2OKT A;  4GGB A;  1OEP A;  4DYE A;  4GAV A;  1FO4 A;  2BXS A;  3DEQ A;  3FVD A;  1EBD A;  3EPT A;  4BV6 A;  1DOB A;  4H2Q A;  4MJW A;  3TW9 A;  3V5F A;  2Y6Q A;  4YSY A;  3PO7 A;  2GGI A;  3UOY A;  3TJI A;  2B7S A;  2RDX A;  1B37 A;  3UCD A;  3IC9 A;  2OO6 A;  4EMI A;  2W55 A;  4GDP A;  5KOW A;  3JW7 A;  5EB5 A;  3Q9T A;  2AL1 A;  2PHH A;  3GYI A;  4BK1 A;  4GCM A;  2Q6U A;  3TOY A;  1PBE A;  1PJ6 A;  2R0P A;  3U4F A;  4CRT A;  2X99 A;  3DK9 A;  1FEA A;  1M64 A;  5KOX A;  1TYT A;  1VQZ A;  2FJD A;  4J57 A;  2GL5 A;  1H84 A;  1RP0 A;  4G74 A;  3ALL A;  1KD0 A;  3GC2 A;  1JRZ A;  1RVK A;  2PTZ A;  3UOZ A;  2YLZ A;  1BZL A;  1TYP A;  1ZX9 A;  4U8P A;  1GOS A;  2WDQ A;  3DFY A;  4LII A;  3NVY B;  4BUR A;  1COY A;  3UP4 A;  2A8X A;  4II3 A;  2WU5 A;  3UKF A;  5IPY A;  3SZC A;  1VG9 A;  3NK0 X;  1GRE A;  3KVE A;  3F8P A;  2HXU A;  1GTH A;  3AE1 A;  3H12 A;  4EQW A;  3AED A;  4NTC A;  2CUL A;  4E6M A;  1H82 A;  2ARD A;  2XFP A;  3NTD A;  3NVV B;  3UKK A;  1VG0 A;  3RCY A;  4Z2R A;  2POZ A;  4GR1 A;  2P88 A;  2B76 A;  2XH0 A;  1K4Q A;  5TR3 A;  3FPZ A;  4REK A;  1GRF A;  3HYV A;  2BRY A;  3M13 A;  4PAA A;  3QVR A;  3COX A;  4KEM A;  4DSG A;  4DSH A;  3FBS A;  1ONE A;  3ZVH B;  4DHG A;  2P8B A;  4J33 A;  5EB4 A;  1N5X A;  2PU1 A;  1QJD A;  2VRM A;  2WPC A;  1IUV A;  4BK2 A;  3NO1 A;  1H7X A;  1LTX R;  5IDZ A;  2OX4 A;  1GPE A;  3ZYX A;  5DBJ A;  2C4C A;  3K1G A;  4J1O A;  4JN7 A;  2WOI A;  1N4U A;  5G5H B;  1L9D A;  2XLS A;  1ONF A;  3ALM A;  5BUL A;  2NPX A;  1F9C A;  1N4W A;  3NS1 B;  3D9X A;  1PBD A;  2POD A;  3ZLF A;  2EQ7 A;  4ZA0 A;  3LZW A;  1B5Q A;  1NHP A;  3CMM A;  3UTH A;  4B65 A;  1XPY A;  4EMJ A;  4A3R A;  3AE6 A;  3H8I A;  2Y6R A;  4YT0 A;  2W3S A;  4B68 A;  4U8J A;  1F8W A;  2C65 A;  4H4Y A;  3AEE A;  3V3N A;  3A7R A;  3DES A;  2BK5 A;  2GGG A;  3HYX A;  1FHU A;  3UOX A;  3DFH A;  1L0V A;  4IT1 A;  5M10 A;  3OC4 A;  3VQR A;  2CFY A;  1N60 C;  3CIR A;  3DJG X;  1S2Q A;  2ZZC A;  3CT2 A;  1YKJ A;  4IHC A;  3KU9 A;  4K5R A;  1B8S A;  4K22 A;  3GSI A;  4XWZ A;  3UP5 A;  5HYM A;  3I6T A;  1R6W A;  2FKP A;  3UXK A;  3QLD A;  3NFU A;  3SQS A;  3ICS A;  3RED A;  3AE7 A;  4ECH A;  3SZ0 A;  5HXI A;  4A6N B;  4GME A;  3CNS A;  1FEB A;  2BA9 A;  2PTX A;  4GDE A;  2F5Z A;  3UTG A;  4H4T A;  4E5T A;  2XGZ A;  3CK5 A;  2PP0 A;  2YVG A;  5FS7 A;  1L9E A;  3R07 C;  4C3Y A;  1CBO A;  3K7M X;  1JDF A;  1GT8 A;  5FMH A;  2MUC A;  4OVI A;  2WU2 A;  2DKI A;  3ZDN A;  4K2S A;  1N5W C;  2X8H A;  5BOE A;  4OPG A;  2FBW A;  3THU A;  3H7V A;  3TJ4 A;  2BS2 A;  1ZOV A;  3P4P A;  1IJH A;  3CGE A;  4WCT A;  3SN0 A;  2XH7 A;  3DER A;  3BNM A;  1N62 C;  2XH2 A;  3D46 A;  1Z6L A;  4GFI A;  3BNU A;  2YM2 A;  3OZY A;  2JB3 A;  2TPR A;  2OZT A;  1ZKQ A;  2RGJ A;  3HYW A;  1E1K A;  2PGE A;  4USQ A;  1PDZ A;  3ZVI A;  1MOK A;  3OW1 A;  1FIQ B;  4Z17 A;  2I0Z A;  3EAN A;  5G5G B;  1ZOY A;  1Q9I A;  2GSH A;  4H4Z A;  3NVZ B;  2YAU A;  4CBQ A;  2XVE A;  4K8G A;  2GF3 A;  1P43 A;  4TM1 A;  4UDP A;  3T37 A;  2VRL A;  2Z5X A;  3UJS A;  3NXL A;  3I4K A;  1LJ1 A;  4U2L A;  2AKM A;  3GD3 A;  4IL0 A;  2C64 A;  1TDK A;  3UKH A;  3SX6 A;  3NT6 A;  4TM0 A;  1NDA A;  4U8O A;  2O56 A;  3GYJ A;  4ZCD A;  3KKJ A;  4B67 A;  4KX6 A;  1JNR A;  3CAW A;  3WE0 A;  2XFN A;  3QTP A;  3UKP A;  2VVL G;  2WES A;  5J7X A;  2PMQ A;  5HHF A;  1KN0 A;  1YEY A;  2WET A;  1GRG A;  3EF6 A;  3SXI A;  3GY1 A;  2C67 A;  1PDH A;  1Q1W A;  3UGV A;  2GAH B;  4K8D A;  4NEV A;  3ES7 A;  3L1R A;  3QSM A;  2C66 A;  4K5S A;  4RG3 A;  3C96 A;  5BUK A;  2AL2 B;  3AEC A;  3GD4 A;  2BK3 A;  2H88 A;  2XLU A;  1EL5 A;  2AKZ A;  1BGN A;  2YR5 A;  1O94 A;  2R4E A;  3PG6 A;  3MKC A;  4JN9 A;  4JQ9 A;  4X9M A;  1Y56 A;  3KPK A;  4GIS A;  1N61 C;  3AEF A;  3GDN A;  4JDR A;  1WYG A;  3VDG A;  2FJA A;  4D04 A;  1N63 C;  4XXG A;  2QCU A;  2B9Y A;  2C72 A;  2XLP A;  4U8L A;  2C75 A;  4H2P A;  2OPJ A;  3SSZ A;  2YVF A;  1EL9 A;  1PHH A;  1NHQ A;  1FFU C;  3SFD A;  2RGO A;  4J2W A;  3VR8 A;  1FFV C;  4A99 A;  2BAB A;  2E4G A;  1JU2 A;  4O5Q A;  1DOE A;  3RHA A;  3RRA A;  4ZN0 A;  2W3R A;  3AB1 A;  1X2H A;  2OZ3 A;  4TM4 A;  4APN A;  5JCK A;  3QSS A;  4J36 A;  2FJB A;  2X8C A;  2V60 A;  5KVI A;  1S3B A;  4IA5 A;  1DOC A;  2GDQ A;  5J60 A;  4I58 A;  1EC7 A;  2QJM A;  2VQB A;  5FJR A;  3GWD A;  4BJY A;  3MUC A;  3NH3 X;  3OPS A;  5JCL A;  2PTY A;  1S2Y A;  3UCL A;  4Z1Y A;  2WDV A;  4BJZ A;  1ELI A;  3K7T A;  5KMR A;  5KNL A;  2XSX A;  3T8Q A;  3G5Q A;  2JKC A;  3NN0 X;  3DGZ A;  4IL2 A;  2GR1 A;  3PWI A;  3BOX A;  3SQP A;  4CNK A;  4E4F A;  4U8N A;  2P0I A;  3CNP A;  5U25 A;  5FS6 A;  1OJD A;  2V61 A;  1ZP0 A;  4YTM A;  4JNA A;  3AMZ A;  2XH4 A;  1NEK A;  3AN1 A;  2ZZB A;  3KA7 A;  1BKH A;  4DGK A;  3CGC A;  4TVW A;  2JAE A;  3FV9 A;  3P4S A;  2P3Z A;  4E8G A;  4H4U A;  2X50 A;  4Z26 A;  4CY8 A;  4M0X A;  3SBF A;  4IA6 A;  1H7W A;  3P0W A;  1SJD A;  1P2E A;  4HNL A;  2QDD A;  3HW2 A;  3TWB A;  3H8A A;  2E5V A;  3DGH A;  3AE2 A;  4YWS A;  3ADA B;  2A89 A;  3AYL A;  4H50 A;  4HA6 A;  3D47 A;  1GTE A;  3SYI A;  4HN8 A;  2BCG G;  2YLT A;  2P8C A;  3QPE A;  5HY5 A;  4NTE A;  2PSN A;  3NN6 X;  4UDR A;  1YQ4 A;  2GAG B;  1IUU A;  1OJ9 A;  3VRD B;  4YXD A;  1CC6 A;  1EBG A;  1YQZ A;  4M52 A;  2YG3 A;  1H86 A;  3Q45 A;  4YKG A;  2OVL A;  1JNZ A;  2I5Q A;  5GSN A;  1KDG A;  3CXO A;  4J3Z A;  3JVA A;  4ZCW A;  5KMQ A;  1B4V A;  3ZVH A;  1JRX A;  1NHS A;  1PJ7 A;  3BHK A;  1H81 A;  1K0I A;  5IQ4 A;  2VVM A;  4DN1 A;  1E6E A;  2GGH A;  5J04 A;  2YG5 A;  4ZOH B;  3LJP A;  1CJ4 A;  4Z2T A;  1GRT A;  2C73 A;  4H2R A;  4OPT A;  4G8T A;  4GIR A;  4G73 A;  4Z25 A;  4A65 A;  2OA1 A;  2RGH A;  4YTN A;  2XYO A;  4G9K A;  3TQP A;  2GV8 A;  2OAL A;  3CN8 A;  1H83 A;  4GUV A;  3GDP A;  3CGD A;  2PTW A;  3FG2 P;  2WPE A;  1T3Q C;  3B6D A;  1H2I A;  1W6T A;  1K0L A;  4AP3 A;  2WS3 A;  3GD6 A;  3R0K A;  3NKS A;  5FJO A;  1JCT A;  2V3B A;  3CNT A;  5KWF A;  5IQ1 A;  3DDM A;  3AM9 A;  3V3W A;  1AOG A;  2X8G A;  3KUM A;  1HYU A;  2WHD A;  3SGL A;  3NK1 X;  4C5O A;  4AOX A;  4J56 A;  2V3A A;  1MDR A;  4JN8 A;  5KVH A;  4A6N A;  4H4S A;  3VFC A;  3T2Z A;  3NZG A;  4YSX A;  4UDQ A;  2W54 A;  4A7A A;  2PP1 A;  5U63 A;  4H19 A;  3NYE A;  3B97 A;  4JY3 A;  3T14 A;  5GRT A;  4GYP C;  3URH A;  5U1O A;  1BGJ A;  3V4B A;  3NVW B;  1M6I A;  3ICR A;  3TCS A;  3D8X A;  4GF7 A;  2HQM A;  4X2P A;  1IUT A;  2YQU A;  2E3T A;  3IJL A;  3EAO A;  1FOH A;  4H4X A;  2VZ2 A;  4M6U A;  4MMW A;  4Y4N A;  2TMD A;  4KPL A;  4FK1 C;  1KNR A;  3ETR B;  4Z24 A;  3R25 A;  4U8M A;  3UCC A;  3AYI A;  4HPN A;  4YSZ A;  1JRY A;  4GYP A;  1JRO A;  1RSG A;  4G6G A;  3II4 A;  3SY4 A;  4GRT A;  4JHM A;  1TKK A;  3DK8 A;  3H4K A;  2IVD A;  1F3P A;  4H1Z A;  1PS9 A;  3KPF A;  1PDY A;  1E1L A;  3PFR A;  1DXL A;  2VQ7 A;  2OQY A;  3MSY A;  3RR1 A;  4I59 A;  3VRA A;  2GB0 A;  1BWC A;  3R1Z A;  5M0Z A;  4OPI A;  1EL7 A;  2PYX A;  4B66 A;  4FK1 A;  4H4R A;  3UXL A;  3S5W A;  1LPF A;  3AYJ A;  3TTE A;  3RO6 A;  2AAQ A;  3M0O A;  1E1M A;  3RGT A;  4ZCC A;  2WP9 A;  1GRH A;  4H7U A;  3GMC A;  4TM3 A;  2Q7V A;  1REO A;  4J34 A;  3LXD A;  4A9W A;  4EMW A;  4NTD A;  4HCL A;  2YR4 A;  2BC0 A;  3UKL A;  1SJC A;  3UJ2 A;  2UZZ A;  1PXA A;  4GAP A;  3AD9 B;  4H4P A;  2GGE A;  2PPG A;  4JY2 A;  4IVM B;  2AL2 A;  1TDE A;  2WOV A;  5C3J A;  3BHF A;  3QSE A;  1KNP A;  1S7M A;  2XCG A;  3M12 A;  4HCD A;  2QDE A;  2GMJ A;  3GWF A;  2QA2 A;  3R0U A;  3G5R A;  1SB3 B;  2YVJ A;  3DH9 A;  2E1M A;  1MDL A;  2GVC A;  3HZL A;  2B7R A;  3LOV A;  3B9J B;  1GXF A;  2GR0 A;  3N6J A;  1QO8 A;  2GR3 A;  2PGW A;  1CJC A;  3FMW A;  2DW7 A;  3NK2 X;  2R46 A;  1PBC A;  1Y0P A;  3LB8 A;  1S3E A;  3NYF A;  5CKU A;  3NG7 X;  3CGB A;  1KKR A;  5BOF A;  4MGG A;  3BI2 A;  2QGY A;  3FXG A;  1X31 B;  4DX3 A;  3P3B A;  1KFY A;  1Y56 B;  3CNJ A;  1H6V A;  4A79 A;  1TDF A;  2XVH A;  3AD7 B;  3SZF A;  4OPL A;  4CCR A;  3JZU A;  1LQU A;  4IP4 A;  3ISH A;  4K1W A;  3SN4 A;  3EUB 3;  1GES A;  1L8P A;  2FYM A;  2CVJ A;  1KSS A;  2YLW A;  3BI4 A;  3N4E A;  2PU0 A;  1ZMC A;  1NG3 A;  2HXT A;  2X3N A;  3P1W A;  2QAE A;  1ZK7 A;  3PWG A;  1XHC A;  1LQT A;  2OAM A;  4G7F A;  3K30 A;  2ONE A;  3L8K A;  5FS9 A;  2OLO A;  1P48 A;  2B9W A;  3P93 A;  1ZXI C;  3UKQ A;  4K7Z A;  3NRZ B;  2XFU A;  6ENL A;  3PS9 A;  2OZ8 A;  2WBA A;  1FCD A;  1N4V A;  2YWL A;  3DG3 A;  3R11 A;  2JB1 A;  3I3L A;  1TDN A;  3VC5 A;  3C4A A;  2O9Z A;  2WEU A;  5EOW A;  3I6E A;  2HNE A;  4EIP A;  3UJE A;  2GRT A;  5FJP A;  2OLN A;  4N9X A;  3AE8 A;  1SJA A;  3ENL A;  5KRQ A;  3IF9 A;  5JRB A;  2PA6 A;  1JRP A;  3EEZ A;  1F6M A;  2IVE A;  4IV9 A;  3DG6 A;  2AQJ A;  2YLR A;  1E1N A;  5BRT A;  2HZG A;  3R9U A;  1XS2 A;  4EM3 A;  3SFE A;  4G6H A;  5LV9 A;  5EBK A;  4CCQ A;  4Y4L A;  4H83 A;  1IYX A;  5FJT A;  3V3O A;  2R9Z A;  1F8S A;  2H89 A;  3T31 A;  1GRB A;  1VDV A;  1D4C A;  4P9S A;  4JNQ A;  3IK4 A;  3AWI A;  3LZX A;  3UJR A;  1EL8 A;  4USR A;  2YG7 A;  3PK7 A;  1E9I A;  4EWJ A;  1NU5 A;  4HYR A;  1KKO A;  3Q4D A;  4FX9 A;  2V5Z A;  1UKV G;  1W4X A;  2ZAD A;  2VOU A;  3DGB A;  3LAD A;  3GYX A;  1X2G A;  3ICT A;  1IUW A;  3ZLG A;  3CTY A;  1SEZ A;  4NEW A;  4H4V A;  7ENL A;  2GR2 A;  2XFO A;  4H4W A;  2AR8 A;  2QJN A;  1ZY8 A;  3CPJ G;  3UJF A;  1WUF A;  3P9U A;  3AE3 A;  1IUX A;  1D7L A;  2J3N A;  1PJ5 A;  4B69 A;  4UP3 A;  2GQF A;  1XAN A;  4U8I A;  1MXT A;  3T0K A;  3AD8 B;  4K2X A;  3AE4 A;  1BF3 A;  1OJA A;  3L5O A;  3IWA A;  2Q0K A;  2YR6 A;  1PBB A;  2OFJ A;  3DJD A;  3SJN A;  3FCP A;  4RG4 A;  1TE6 A;  2EQ9 A;  4NZH A;  4WX1 A;  1O95 A;  2R0G A;  2JB2 A;  4IZG A;  3CPI G;  2YG4 A;  2VVL A;  1SJB A;  4X9N A;  3SN1 A;  2YG6 A;  1LV0 A;  2OLA A;  2B9X A;  4Z43 A;  1GAL A;  2BC1 A;  2JBV A;  4YTP A;  3PVC A;  3G5S A;  3NLC A;  3V76 A;  3UTE A;  1GET A;  1XDI A;  1CJ3 A;  2OG9 A;  3GO2 A;  4HCH A;  1MNS A;  4A5L A;  1LVL A;  2BCP A;  3RIT A;  1JOA A;  1CC2 A;  1NG4 A;  3CND A;  3VRB A;  4D03 A;  4U2S A;  2CDU A;  3FIM B;  3N6H A;  4A35 A;  5ER0 A;  2NVK X;  3NGC X;  4Y4M A;  2APG A;  4KWS A;  5KMP A;  2PCE A;  1N1P A;  2BAC A;  2BS3 A;  3DIP A;  1JPM A;  3FYY A;  1NEN A;  2XVF A;  1RYI A;  4ADW A;  4H4Q A;  4B64 A;  1TRB A;  2QVH A;  1V97 A;  3DJE A;  1GND A;  3T2K A;  3UTF A;  2W0H A;  1PBF A;  3Q6J A;  3P4Q A;  1EC9 A;  1E39 A;  1R0M A;  3S61 A;  3AEA A;  2EQ6 A;  1DOD A;  2A87 A;  3NTA A;  4LU6 A;  3H8L A;  3QVP A;  3IHG A;  2XLT A;  3DG7 A;  1NHR A;  3MZN A;  2GQW A;  3QFB A;  3VCN A;  4TVY A;  3B3R A;  4E0V A;  1E7P A;  5C2T A;  1JEH A;  4B63 A;  2PP3 A;  4NWZ A;  4Z2U A;  3OZ2 A;  4KT2 A;  3BJS A;  1O5W A;  4O5U A;  2IID A;  1WUE A;  1QLB A;  1CHU A;  2GH5 A;  2QA1 A;  1FL2 A;  1P2H A;  3P4R A;  3NIX A;  1L9C A;  4J31 A;  2BK4 A;  3MQT A;  3CYJ A;  4H2N A;  4E4U A;  3A7U A;  1GV4 A;  1KCZ A;  3OTR A;  1YY5 A;  2JK6 A;  3C4N A;  3H70 A;  1YQ3 A;  1V59 A;  3JSK A;  2E5A A;  3SZW A;  1CL0 A;  2YLX A;  5CQF A;  2EQ8 A;  4LA1 A;  3S5S A;  4C77 A;  4U8K A;  1VRQ B;  4PAB A;  2C3D A;  3FJ4 A;  3SR6 B;  2WOW A;  1GSN A;  4F4R A;  3UKA A;  4X4J A;  4ICY A;  1D7Y A;  2WP5 A;  1NPX A;  4OCG A;  4B1B A;  4FDC B;  5ENL A;  3K7Q X;  4II2 A;  3F8D A;  4CNJ A;  3NYC A;  1GEU A;  4CY6 A;  4DXK A;  3KLJ A;  2YM1 A;  3GRS A;  3BSM A;  4GGH A;  4ENL A;  2BRA A;  1MO9 A;  3VR9 A;  3S47 A;  2BYB A;  1FHV A;  4YSH A;  4NNJ A;  5KMS A;  1DTN A;  2C70 A;  2GEW A;  1IUS A;  3BI5 A;  3AE5 A;  3D1C A;  4DWD A;  4MKS A;  3RP8 A; 
#chains in the Genus database with same CATH homology
 1F8W A;  2C65 A;  4H4Y A;  1H7W A;  3AEE A;  4C74 A;  3V3N A;  1Q1R A;  1P2E A;  2BK5 A;  3ITJ A;  1KSS A;  2YLW A;  1CC4 A;  3HYX A;  3E1T A;  3BI4 A;  2R4J A;  2E5V A;  3UOX A;  1ZMC A;  3DGH A;  1NG3 A;  2X3N A;  3AE2 A;  4U8J A;  3P1W A;  1L0V A;  2QAE A;  1ZK7 A;  1XHC A;  5JCN A;  3ADA B;  5M10 A;  3OC4 A;  1LQT A;  2A89 A;  2OAM A;  3VQR A;  3AYL A;  3K30 A;  4XWR A;  3L8K A;  4H50 A;  5FS9 A;  2OLO A;  3NHO X;  2CFY A;  3CIR A;  4HA6 A;  1GTE A;  1VDC A;  3DJG X;  2B9W A;  1VQW A;  3SYI A;  1S2Q A;  2BCG G;  2ZZC A;  1YKJ A;  3UKQ A;  4K7Z A;  2YLT A;  2ACZ A;  5HY5 A;  4NTE A;  2WP6 A;  2XFU A;  3NN6 X;  3PS9 A;  4UDR A;  1CJ2 A;  1YQ4 A;  2WBA A;  3KU9 A;  1ZDL A;  2GAG B;  1IUU A;  4K5R A;  1FCD A;  4DNA A;  1B8S A;  1N4V A;  2V6O A;  2YWL A;  1OJ9 A;  3F8R A;  3AE9 A;  2JB1 A;  3I3L A;  1GER A;  4K22 A;  1TDN A;  4AP1 A;  2FJE A;  3VRD B;  3GSI A;  4XWZ A;  3C4A A;  4YXD A;  2O9Z A;  2Z5Y A;  3UP5 A;  2WEU A;  5EOW A;  5HYM A;  4EQX A;  3GMB A;  1CC6 A;  1OJT A;  4EIP A;  1DNC A;  1YQZ A;  4M52 A;  2GRT A;  2OLN A;  2YG3 A;  4N9X A;  1H86 A;  3AE8 A;  3ICS A;  3RED A;  3UOV A;  1CF3 A;  1KF6 A;  3AEG A;  4YKG A;  3AE7 A;  1K0J A;  3QJ4 A;  5KRQ A;  4ECH A;  3SZ0 A;  3IF9 A;  5HXI A;  1JNZ A;  5JRB A;  4A6N B;  5BVA A;  1PXB A;  3CNS A;  1FEB A;  2BA9 A;  4HB9 A;  5GSN A;  4GDE A;  2F5Z A;  1KDG A;  1F6M A;  4H4T A;  2IVE A;  2R45 A;  3UTG A;  2BXR A;  4IV9 A;  3O0H A;  2AQJ A;  2YLR A;  1E1N A;  2YVG A;  5FS7 A;  1B4V A;  2Q0L A;  2R0C A;  5KMQ A;  5BRT A;  5KXJ A;  1L9E A;  1JRX A;  1NHS A;  4C3Y A;  3R9U A;  1PJ7 A;  1CBO A;  3BHK A;  3K7M X;  1H81 A;  4EM3 A;  1K0I A;  1GT8 A;  3SFE A;  5FMH A;  1PN0 A;  4G6H A;  5IQ4 A;  4OVI A;  2VVM A;  2WU2 A;  4AT2 A;  1E6E A;  5LV9 A;  2DKI A;  3ZDN A;  5EBK A;  2YG5 A;  4CCQ A;  3I6D A;  4Y4L A;  3NNE A;  3LJP A;  2X8H A;  4C3X A;  1CJ4 A;  5JCI A;  4BK3 A;  3T2Y A;  4Z2T A;  1GRT A;  2XVJ A;  3AXB A;  3V3O A;  2R9Z A;  1D5T A;  2C73 A;  4OPG A;  1F8S A;  2FBW A;  2WDR A;  2H89 A;  4AT0 A;  2BS2 A;  4H2R A;  4OPT A;  3T31 A;  1GRB A;  1PXC A;  1ZOV A;  4G73 A;  1D4C A;  1IJH A;  3P4P A;  3CGE A;  1NAA A;  4Z25 A;  4A65 A;  4OPD A;  2OA1 A;  4WCT A;  2RGH A;  3BNM A;  4P9S A;  4OPC A;  4YTN A;  2XYO A;  4JNQ A;  4G9K A;  2GMH A;  3GRT A;  1Z6L A;  3AWI A;  3LZX A;  3RP7 A;  1EL8 A;  2YM2 A;  3BNU A;  4USR A;  3ABV A;  2YG7 A;  2JB3 A;  2TPR A;  5JCM A;  2GV8 A;  1ZKQ A;  2RGJ A;  5FS8 A;  1E1K A;  3HYW A;  2OAL A;  4USQ A;  1KSU A;  3CN8 A;  4FX9 A;  1H83 A;  1MOK A;  1UKV G;  1FEC A;  1W4X A;  2V5Z A;  2C76 A;  2WQY A;  4GUV A;  3GDP A;  2I0Z A;  3EAN A;  2VOU A;  4Z44 A;  1ZOY A;  3LAD A;  1Q9I A;  3ATQ A;  3GYX A;  3CGD A;  3ICT A;  1IUW A;  2XDO A;  3CTY A;  4H4Z A;  1SEZ A;  4NEW A;  3DK4 A;  3FG2 P;  2YAU A;  4H4V A;  2WPE A;  4CBQ A;  2XVE A;  2GR2 A;  2XFO A;  2RAB A;  2GF3 A;  4H4W A;  3B6D A;  2BS4 A;  4EIQ A;  4TM1 A;  4UDP A;  3T37 A;  1H2I A;  1DJN A;  1K0L A;  2VRL A;  2Z5X A;  2AR8 A;  4AP3 A;  2WS3 A;  1ZY8 A;  1LJ1 A;  3CPJ G;  2C3C A;  3GD3 A;  4U2L A;  2C64 A;  1TDK A;  3UKH A;  3P9U A;  3SX6 A;  3AE3 A;  3NT6 A;  1IUX A;  1D7L A;  2J3N A;  1PJ5 A;  3NKS A;  4B69 A;  4UP3 A;  4TM0 A;  1NDA A;  5L46 A;  2GQF A;  4KPR A;  2V3B A;  1XAN A;  3CNT A;  4U8O A;  4U8I A;  5IQ1 A;  5KWF A;  3GYJ A;  1MXT A;  4OPU A;  4EQS A;  3T0K A;  3AD8 B;  1F8R A;  2DKH A;  3KD9 A;  2WPF A;  1AOG A;  4ZCD A;  3CPH G;  4K2X A;  4YKF A;  2X8G A;  3AE4 A;  1BF3 A;  1GRA A;  1OJA A;  3L5O A;  1HYU A;  3KKJ A;  3IWA A;  4B67 A;  2Q0K A;  2WHD A;  1PBB A;  2YR6 A;  4KX6 A;  1JNR A;  3DJD A;  3SGL A;  4IVO B;  1DJQ A;  2ZBW A;  3WE0 A;  1D4D A;  2XFN A;  2XFQ A;  4RG4 A;  3UKP A;  2VVL G;  3NK1 X;  4C5O A;  2WES A;  2EQ9 A;  3RP6 A;  4AOX A;  4J56 A;  4NZH A;  4WX1 A;  2XVI A;  5J7X A;  1O95 A;  2R0G A;  5HHF A;  1KN0 A;  1ZMD A;  2V3A A;  4EQR A;  2XLR A;  5KVH A;  4A6N A;  2JB2 A;  4H4S A;  2WET A;  3CPI G;  2ZZ0 A;  2YG4 A;  1GRG A;  2VVL A;  4YWO A;  4RSL A;  3EF6 A;  4TLX A;  4X9N A;  3DJJ A;  2C67 A;  3SXI A;  1PDH A;  2YG6 A;  2C7G A;  1LV0 A;  3ATR A;  1Q1W A;  2GAH B;  3T2Z A;  2B9X A;  3DME A;  4K8D A;  4NEV A;  4Z43 A;  4YSX A;  1GAL A;  2BC1 A;  2JBV A;  4UDQ A;  4A7A A;  3L1R A;  4YTP A;  3QSM A;  1D4E A;  2YLS A;  5U63 A;  4EM4 A;  2C66 A;  4K5S A;  4RG3 A;  1BKW A;  3C96 A;  3PVC A;  3G5S A;  5BUK A;  3NYE A;  3NLC A;  3V76 A;  3RNM A;  3DA1 A;  3IHM A;  3NRN A;  1OJC A;  4JY3 A;  4TLZ A;  4U2T A;  1GET A;  5GRT A;  3T14 A;  3UTE A;  1XPQ A;  3GD4 A;  1XDI A;  2BK3 A;  3URH A;  5U1O A;  1BGJ A;  2H88 A;  3AEC A;  3QFA A;  3ALJ A;  1CJ3 A;  2XLU A;  1EL5 A;  1M6I A;  3AEB A;  3SM8 A;  1TDO A;  1BGN A;  2YR5 A;  3ICR A;  4A5L A;  1LVL A;  3D8X A;  1O94 A;  2R4E A;  2BCP A;  4GF7 A;  1JOA A;  4GAV A;  3PG6 A;  2BXS A;  2HQM A;  1IUT A;  1CC2 A;  1NG4 A;  4JN9 A;  2YQU A;  3CND A;  4JQ9 A;  4X9M A;  1Y56 A;  3VRB A;  3EAO A;  3KPK A;  4D03 A;  1FOH A;  4U2S A;  2CDU A;  3FIM B;  3AEF A;  1EBD A;  3EPT A;  4H4X A;  4BV6 A;  1DOB A;  3GDN A;  4H2Q A;  4JDR A;  4MJW A;  2VZ2 A;  5ER0 A;  2NVK X;  4Y4N A;  2TMD A;  4FK1 C;  2Y6Q A;  1KNR A;  3NGC X;  4YSY A;  2FJA A;  3PO7 A;  4Y4M A;  4D04 A;  4Z24 A;  2APG A;  3UOY A;  4U8M A;  3AYI A;  2B7S A;  4YSZ A;  5KMP A;  4XXG A;  1JRY A;  1N1P A;  1RSG A;  2QCU A;  2BAC A;  2BS3 A;  1B37 A;  4G6G A;  3II4 A;  3SY4 A;  1NEN A;  2B9Y A;  2XVF A;  2C72 A;  3IC9 A;  4GRT A;  4EMI A;  1RYI A;  4GDP A;  2XLP A;  5KOW A;  4ADW A;  4U8L A;  4H4Q A;  3DK8 A;  3H4K A;  4B64 A;  1TRB A;  5EB5 A;  2C75 A;  3Q9T A;  4H2P A;  2IVD A;  3DJE A;  1GND A;  1F3P A;  1PS9 A;  3T2K A;  2PHH A;  3KPF A;  3UTF A;  2W0H A;  2YVF A;  3GYI A;  1E1L A;  1PBF A;  2VQ7 A;  1DXL A;  3Q6J A;  3P4Q A;  1EL9 A;  1E39 A;  1PHH A;  4BK1 A;  1NHQ A;  4I59 A;  4GCM A;  2Q6U A;  1PBE A;  3S61 A;  3VRA A;  1PJ6 A;  2R0P A;  2GB0 A;  3AEA A;  3SFD A;  1BWC A;  2RGO A;  5M0Z A;  4J2W A;  4OPI A;  2EQ6 A;  1EL7 A;  2PYX A;  4CRT A;  2X99 A;  3VR8 A;  3DK9 A;  4B66 A;  1DOD A;  4FK1 A;  1FEA A;  4H4R A;  2A87 A;  3NTA A;  1M64 A;  4LU6 A;  3H8L A;  3QVP A;  3S5W A;  4A99 A;  5KOX A;  2BAB A;  1TYT A;  2E4G A;  3IHG A;  1LPF A;  3AYJ A;  1JU2 A;  2FJD A;  4J57 A;  4O5Q A;  2XLT A;  2AAQ A;  1DOE A;  1NHR A;  1H84 A;  1RP0 A;  3RHA A;  3M0O A;  4G74 A;  1E1M A;  4ZCC A;  3ALL A;  1JRZ A;  2WP9 A;  2GQW A;  3QFB A;  4ZN0 A;  1GRH A;  3UOZ A;  2YLZ A;  3B3R A;  4E0V A;  1E7P A;  5C2T A;  1BZL A;  1TYP A;  1JEH A;  3AB1 A;  1ZX9 A;  3GMC A;  4H7U A;  1GOS A;  2WDQ A;  4TM3 A;  4U8P A;  2Q7V A;  1REO A;  4TM4 A;  4B63 A;  4J34 A;  4NWZ A;  4LII A;  4APN A;  4Z2U A;  5JCK A;  4BUR A;  3RP8 A;  3OZ2 A;  1COY A;  3LXD A;  4A9W A;  1O5W A;  3QSS A;  4J36 A;  4O5U A;  2IID A;  3UP4 A;  2A8X A;  4II3 A;  2WU5 A;  3UKF A;  2FJB A;  5IPY A;  3SZC A;  2X8C A;  1QLB A;  1CHU A;  2GH5 A;  1VG9 A;  4EMW A;  2QA1 A;  1GRE A;  3NK0 X;  1FL2 A;  3KVE A;  2YR4 A;  3F8P A;  2BC0 A;  1P2H A;  4NTD A;  3P4R A;  3UKL A;  2V60 A;  3NIX A;  5KVI A;  1L9C A;  1S3B A;  4IA5 A;  4J31 A;  2BK4 A;  1GTH A;  1DOC A;  1PXA A;  2UZZ A;  3AE1 A;  3AD9 B;  4GAP A;  5J60 A;  4H4P A;  4I58 A;  4H2N A;  4EQW A;  2VQB A;  3AED A;  4JY2 A;  4NTC A;  3GWD A;  2CUL A;  1GV4 A;  4BJY A;  1H82 A;  4IVM B;  3NH3 X;  1YY5 A;  2JK6 A;  3C4N A;  1TDE A;  2WOV A;  2ARD A;  5C3J A;  5JCL A;  1YQ3 A;  2XFP A;  3BHF A;  1V59 A;  3NTD A;  3QSE A;  1KNP A;  1S2Y A;  3JSK A;  3UCL A;  1VG0 A;  3UKK A;  4Z2R A;  2WDV A;  1S7M A;  4GR1 A;  2XCG A;  3M12 A;  4BJZ A;  3SZW A;  1ELI A;  2GMJ A;  3GWF A;  1CL0 A;  2QA2 A;  3K7T A;  4AOS A;  5KMR A;  5KNL A;  3G5R A;  2YLX A;  3G5Q A;  5CQF A;  2EQ8 A;  2B76 A;  2JKC A;  2YVJ A;  4LA1 A;  1K4Q A;  5TR3 A;  3DGZ A;  3NN0 X;  4C77 A;  3FPZ A;  2GR1 A;  4REK A;  3SQP A;  4CNK A;  1GRF A;  3DH9 A;  2E1M A;  3HYV A;  4U8K A;  1VRQ B;  2BRY A;  4PAB A;  2C3D A;  4U8N A;  3M13 A;  2GVC A;  4PAA A;  3HZL A;  3QVR A;  3COX A;  2B7R A;  2WOW A;  3CNP A;  1GSN A;  3LOV A;  5U25 A;  3UKA A;  4X4J A;  1GXF A;  5FS6 A;  4DSG A;  4DSH A;  2GR0 A;  3FBS A;  1QO8 A;  2GR3 A;  4ICY A;  1OJD A;  1D7Y A;  1CJC A;  2WP5 A;  3FMW A;  3NK2 X;  2V61 A;  2R46 A;  4J33 A;  5EB4 A;  1ZP0 A;  1NPX A;  1PBC A;  1QJD A;  1Y0P A;  2VRM A;  2WPC A;  4JNA A;  4OCG A;  4YTM A;  3LB8 A;  1S3E A;  4FDC B;  1IUV A;  3NYF A;  4B1B A;  4BK2 A;  1H7X A;  1NEK A;  3K7Q X;  3NG7 X;  3CGB A;  1LTX R;  4II2 A;  5CKU A;  1GPE A;  3BI2 A;  3F8D A;  4CNJ A;  3NYC A;  1GEU A;  3ZYX A;  4CY6 A;  5DBJ A;  2ZZB A;  3KA7 A;  2C4C A;  3KLJ A;  2YM1 A;  1X31 B;  2WOI A;  3GRS A;  1N4U A;  4DGK A;  3CGC A;  1KFY A;  1Y56 B;  1L9D A;  2JAE A;  2XLS A;  3CNJ A;  1H6V A;  4A79 A;  1ONF A;  3ALM A;  2BRA A;  1TDF A;  5BUL A;  2XVH A;  2NPX A;  1MO9 A;  1N4W A;  3P4S A;  3AD7 B;  3VR9 A;  3SZF A;  3D9X A;  1PBD A;  2BYB A;  4YSH A;  4OPL A;  4NNJ A;  4CCR A;  5KMS A;  2EQ7 A;  1LQU A;  2C70 A;  3LZW A;  1B5Q A;  1NHP A;  3CMM A;  3ISH A;  3UTH A;  4B65 A;  4H4U A;  2GEW A;  2X50 A;  4Z26 A;  4CY8 A;  1IUS A;  3BI5 A;  4EMJ A;  3AE5 A;  1GES A;  3AE6 A;  3H8I A;  2Y6R A;  3D1C A;  4YT0 A;  4B68 A;  2CVJ A;  4IA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...