3URHA

Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
461
structure length
461
Chain Sequence
YDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHQAQHGLEALGVEVANPKLNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKGEEQVLEAKNVVIATGSDVAGIPGVEVAFDEKTIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAKQLQRMLTKQGIDFKLGAKVTGAVKSGDGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dihydrolipoamide dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords Dihydrolipoyl dehydrogenase
total genus 133
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3urhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA02
2XYOA 1N1PA 4YTNA 3NYEA 2A87A 3D1CA 1Q1WA 1IUSA 4YKFA 3GDPA 1TDNA 4Z43A 2GRTA 2XLSA 1FOHA 4U8MA 2F5ZA 3AE5A 2DKHA 2OALA 2GMHA 4BK3A 1EL9A 2XVJA 1VG0A 4CY8A 5J60A 1NHSA 3FG2P 2VRLA 1OJAA 1KSUA 4A5LA 5BULA 3GWFA 4KX6A 3CIRA 2YG7A 1Y56B 4RSLA 1FEAA 4JY3A 3SFDA 4PAAA 5C2TA 1XPQA 2R0GA 1GREA 1W4XA 2BK5A 1H84A 2UZZA 3O0HA 3EANA 4IA5A 4PABA 4WCTA 4C77A 2VVMA 4H4RA 1D4EA 2AAQA 3Q6JA 3F8PA 3UOXA 4Z2TA 3IC9A 2APGA 1CBOA 3NN6X 3P4RA 4ECHA 4FDCB 1N4WA 2XFQA 4XWRA 5U63A 4EIPA 3CGEA 1ZY8A 1CC4A 1CJ3A 3DK4A 1GPEA 2GAHB 1YQ3A 2WBAA 1YKJA 3P4SA 3QVRA 1JNZA 3L8KA 3I3LA 4C3YA 1K0LA 5FMHA 5IQ4A 3K7QX 2XVFA 3F8DA 2GQFA 4JY2A 4B67A 2BS2A 3V3NA 4ZN0A 1TRBA 3T37A 1D4CA 3UTHA 1TYPA 2XLTA 3PVCA 1P2HA 4USQA 4CCQA 4H4PA 1GV4A 3IWAA 3K7TA 3RHAA 3RP6A 3UTGA 4B63A 4K2XA 4A9WA 4U8PA 2VRMA 3BI5A 4D04A 4EM4A 1COYA 1Y56A 4LA1A 1NG3A 1VQWA 4EQRA 2OLOA 3NYFA 4U8OA 2PHHA 5EB4A 2X8GA 4EMIA 2AR8A 3BI2A 2BC0A 4REKA 1GERA 1KNRA 4USRA 3VRDB 5KXJA 1PBFA 4Z25A 4GDPA 5FS6A 3E1TA 2GV8A 1KNPA 2C64A 4M52A 4XXGA 2FJDA 3BNUA 1E39A 2C65A 3C4AA 3AEFA 1S3BA 4H4ZA 2FJBA 1GTHA 4LIIA 2WU2A 1TDEA 1GTEA 2IVDA 4YSZA 5J7XA 1IUUA 1ZOYA 3FBSA 3DJJA 2GR2A 1FCDA 2AQJA 3LZWA 2GR3A 1TYTA 1F3PA 4H4TA 1PXBA 2B9YA 2GVCA 3NKSA 3LXDA 4YKGA 3AE1A 1QJDA 2X3NA 3BI4A 3P1WA 4BURA 1GALA 3UOVA 1MO9A 2QA1A 3VRAA 2BA9A 1Q9IA 5U1OA 3PO7A 2JB3A 2X50A 3ICTA 2WOVA 1GRTA 4OPCA 4MJWA 2YVFA 3UKFA 3AEEA 2DKIA 1DJQA 3IHMA 3SFEA 4CNJA 4CCRA 2CVJA 4EQXA 2ZZ0A 2B7RA 2RGJA 3AE6A 3VRBA 2FJAA 1K4QA 2C76A 1H86A 4AT2A 2BCGG 3SQPA 3WE0A 3AEBA 1GXFA 4JNQA 4A79A 1GOSA 3FIMB 4H2NA 5HHFA 1L9CA 1Z6LA 3GRTA 2Q0LA 1DJNA 5TR3A 4X9NA 5FS8A 4OPUA 2YM2A 3KU9A 4U2LA 3UKAA 3KKJA 4NEWA 2JK6A 3EAOA 4J2WA 3ICRA 1EL7A 2R9ZA 2V3BA 4J36A 4GF7A 3KD9A 1DOEA 1NHRA 3REDA 1IUXA 3QVPA 4B65A 4GCMA 1PHHA 2H89A 4UDQA 3LJPA 3UTFA 4IVOB 1JNRA 1K0IA 3UP5A 1M64A 4B66A 3BHFA 3UTEA 3KA7A 4AOSA 3ITJA 5HY5A 4K5RA 4H4VA 1BKWA 1FECA 4B68A 4U8JA 2GR1A 2C66A 2YG6A 1ZMCA 3CGBA 1CL0A 4DGKA 3D8XA 2C3DA 3JSKA 4J56A 3DA1A 1EL5A 1P2EA 4UDRA 3M13A 1PS9A 1B5QA 1VRQB 2VQBA 2BK3A 1PJ7A 1EL8A 1ZK7A 3CNDA 4GDEA 2VZ2A 1KFYA 1B8SA 1D5TA 4OPLA 3UKQA 1E6EA 1ZX9A 1V59A 2GAGB 3K7MX 1FEBA 2B9XA 3M12A 2WOIA 4BJYA 3KLJA 5ER0A 4OPIA 4YSHA 5KOWA 2JAEA 3I6DA 1OJTA 1BGNA 1B4VA 2YR6A 4NTCA 2WP9A 4GRTA 4C74A 3DJGX 4A6NA 5CQFA 2YVGA 2BACA 5KVHA 1GT8A 4J33A 5DBJA 1NDAA 1OJCA 3UKHA 3SGLA 1PN0A 4NEVA 4C3XA 1REOA 3NLCA 2WP5A 3KVEA 3NH3X 4EMWA 3OC4A 1O5WA 2OA1A 4TLZA 1F8RA 4JN9A 4RG4A 3CPIG 2GF3A 2WP6A 1RSGA 1O95A 1GESA 3P9UA 3K30A 4NZHA 1KSSA 4BK2A 4K5SA 4OPTA 4DNAA 3H8LA 4TM1A 3NTDA 1ZMDA 3CGDA 4FK1C 2O9ZA 1DODA 4GR1A 1E7PA 4J34A 2BS3A 3UOYA 4BJZA 3AECA 4A65A 4D03A 3EF6A 3LOVA 1KDGA 2V3AA 3C96A 4RG3A 1GNDA 1F6MA 3IHGA 2R45A 1X31B 1YY5A 3S61A 5FS7A 1JRZA 1JU2A 1SEZA 2WEUA 3AD8B 3AEAA 3GMBA 1NEKA 1L0VA 4UDPA 4AOXA 1B37A 1ZP0A 3F8RA 4U2TA 3H4KA 2VOUA 1E1MA 4EIQA 2B76A 1BWCA 1GRFA 2V6OA 2B7SA 4H4XA 4WX1A 4Y4MA 4H4UA 3ATQA 4HB9A 2Y6QA 3DGZA 3AE2A 2W0HA 3DGHA 3CNTA 4B64A 4B69A 2BXRA 4UP3A 5GRTA 5M0ZA 1CF3A 4AT0A 1N4VA 1E1NA 3NK1X 4AP3A 4Z2UA 3RP7A 1GRAA 2YG5A 4JQ9A 2XLPA 3NNEA 1Q1RA 1VDCA 4YSYA 1ELIA 5KWFA 3AYIA 2YG4A 2YM1A 3ICSA 3NRNA 2WPFA 4TM3A 3AE7A 1ZKQA 1TDFA 4ICYA 5JCIA 4N9XA 1QLBA 2IIDA 1IUTA 2EQ7A 2FBWA 1LPFA 1H81A 4CY6A 2ACZA 2XCGA 2EQ6A 4I58A 3HZLA 3QJ4A 1PBBA 4Z44A 3AEGA 2WOWA 1RP0A 3BHKA 3H8IA 4Y4LA 3V3OA 1F8SA 3NK0X 2YR4A 1NHPA 3GMCA 3KPFA 5JCKA 4O5UA 1LVLA 5EBKA 2XVEA 1YQ4A 2R4EA 4BV6A 5JCNA 1XHCA 1DOBA 4TLXA 5U25A 4APNA 2JKCA 2YR5A 2V60A 4HA6A 4O5QA 2CDUA 4H50A 4JDRA 1NPXA 1GRHA 2X99A 2RGOA 3VR9A 2YLZA 1ZDLA 1H7WA 2H88A 3ADAB 1MXTA 4GUVA 1E1KA 4LU6A 4U8KA 2ZZCA 1KF6A 3P4PA 4BK1A 3C4NA 1F8WA 2QAEA 2NPXA 1CC2A 1PBCA 5KRQA 1S3EA 2XVIA 2GB0A 1LV0A 4J57A 2I0ZA 5M10A 1QO8A 2GH5A 5KOXA 1CJ4A 4E0VA 1XANA 3GWDA 1GEUA 1H6VA 2EQ8A 2BABA 2YLRA 3CNSA 2TPRA 2GEWA 4OPDA 5GSNA 3AE3A 5IQ1A 2WHDA 4A6NB 2YLTA 2VVLA 3NGCX 3DH9A 1RYIA 2PYXA 4TM4A 5IPYA 4H7UA 5C3JA 3DJEA 5EOWA 1H7XA 3NTAA 4IV9A 3GYIA 3BNMA 3GDNA 1VG9A 1S2YA 1EBDA 3LB8A 4EMJA 3AE8A 3V76A 3ALLA 4CRTA 2YQUA 2XLRA 2FJEA 2XVHA 4I59A 2GQWA 4Z26A 1PXAA 4H2RA 1JRXA 2A8XA 4TM0A 4AP1A 4P9SA 4A7AA 4EQSA 1DNCA 3QSSA 3AWIA 2BXSA 2C7GA 1GRGA 3LADA 3ATRA 4DSHA 1NG4A 1AOGA 1GSNA 2J3NA 1LTXR 5BUKA 1Y0PA 3CN8A 4OCGA 4X4JA 4DSGA 5BRTA 4EQWA 1OJ9A 4YT0A 1PJ6A 3GRSA 4A99A 1TDKA 2CFYA 3DK9A 3FMWA 5HYMA 2C73A 3GYJA 3COXA 2WPEA 3GD3A 1NENA 3ALMA 2E4GA 2X8CA 1OJDA 4XWZA 4Z24A 4IA6A 4Y4NA 2C75A 3CNJA 2A89A 4CNKA 2WPCA 1H83A 4YSXA 4U8LA 2Q7VA 4OPGA 4NTDA 1S2QA 1L9DA 2Q0KA 1D7LA 3G5QA 2XFUA 2XDOA 3NT6A 2YLWA 2HQMA 4K8DA 3GSIA 3OZ2A 2R0PA 1CHUA 4YWOA 4C5OA 3UKPA 4YXDA 1PBEA 2BC1A 1DOCA 3M0OA 1HYUA 1PXCA 4Z2RA 2ZZBA 3AE4A 4EM3A 1IJHA 2R0CA 2TMDA 2RABA 3AXBA 1D4DA 3B3RA 2IVEA 3CPHG 3NN0X 2OLNA 2VVLG 4B1BA 1IUWA 4U2SA 3UKLA 2X8HA 5L46A 3Q9TA 3AD7B 3NYCA 3QFBA 2Q6UA 4H4SA 3AYJA 2QCUA 2C67A 3LZXA 3UKKA 1M6IA 1IUVA 5FS9A 1CJ2A 1DXLA 1TDOA 2CULA 3VQRA 2WDRA 2Y6RA 2OAMA 3AD9B 4IVMB 3ISHA 1PBDA 1N4UA 3IF9A 5HXIA 3RP8A 2JBVA 2ARDA 3ALJA 5KVIA 3UP4A 3GD4A 1PDHA 2YLSA 1PJ5A 4X9MA 4H4WA 4FX9A 3VR8A 3NG7X 2BYBA 1BZLA 1MOKA 2C3CA 2RGHA 1ZOVA 3DMEA 3R9UA 2JB1A 1LJ1A 2WS3A 4U8NA 2WDVA 1D7YA 2Z5YA 1ONFA 4YTMA 4CBQA 4K22A 2B9WA 2R4JA 3NK2X 2NVKX 2BS4A 3FPZA 5JCLA 3NIXA 3AB1A 3CTYA 2YVJA 4NTEA 4JNAA 3AYLA 1GRBA 1XDIA 2WU5A 5BVAA 1E1LA 2XFOA 4ZCDA 4FK1A 2EQ9A 1L9EA 2C72A 2BCPA 2YWLA 2Z5XA 1JOAA 4ADWA 3UOZA 1FL2A 1NHQA 2XFNA 3G5RA 1YQZA 2WQYA 3QSEA 5LV9A 2E5VA 2WDQA 3NHOX 1LQTA 2YG3A 3II4A 4K7ZA 3DJDA 4KPRA 2XFPA 2JB2A 4OVIA 2ZBWA 3EPTA 5EB5A 1K0JA 3ZYXA 2GR0A 2E1MA 3B6DA 4ZCCA 5JCMA 2YAUA 2V61A 5CKUA 3AE9A 1JEHA 1O94A 2V5ZA 2WESA 1JRYA 3S5WA 2XLUA 1CJCA 1H82A 3CNPA 1CC6A 2BK4A 3CGCA 2QA2A 2GMJA 4YTPA 2C70A 3UCLA 2WETA 1UKVG 4H2PA 4H4YA 3ABVA 3CPJG 4U8IA 2VQ7A 3PS9A 3AEDA 3QFAA 3URHA 1GETA 3RNMA 1BF3A 3P4QA 3QSMA 1NAAA 2YLXA 4H2QA 1LQUA 3G5SA 4H4QA 4J31A 3ZDNA 3DK8A 3SM8A 1BGJA 2R46A 3L1RA
chains in the Genus database with same CATH superfamily
2XYOA 1N1PA 3FV9A 2A87A 3DG7A 3GDPA 1ONEA 2PODA 2XLSA 4BK3A 2GMHA 1EL9A 1VG0A 5KNLA 5J60A 2YG7A 1Y56B 1FEAA 4IA5A 3Q6JA 4GAVA 4Z17A 1N4WA 2XFQA 3NZGA 3CGEA 3FYYA 1CJ3A 2GAHB 3P4SA 3B9JB 4KEMA 1JNZA 5IQ4A 3CK5A 3K7QX 3ZVIA 4CCQA 4USQA 4H4PA 3RP6A 3K7TA 4EQRA 4U8OA 2PHHA 5EB4A 2X8GA 2P8CA 4REKA 2BC0A 2MNRA 2FYMA 3VRDB 4MKSA 4IHCA 5FS6A 4KPLA 2GV8A 2C65A 3C4AA 3OZMA 4LIIA 1TDEA 3ZLHA 3HW2A 1IUUA 5J7XA 3FBSA 4MMWA 3DJJA 1N62C 2W3SA 1F3PA 3SN4A 2B9YA 2X3NA 3P1WA 4BURA 1GALA 3VRAA 2BA9A 3S5SA 3MQTA 1N61C 4MJWA 4TVWA 1DJQA 2ZZ0A 2B7RA 2RGJA 3SQSA 1XS2A 3WE0A 3MKCA 4A79A 2PU1A 3S47A 1L9CA 1Z6LA 3GRTA 4X9NA 2YM2A 4NEWA 4J36A 3CT2A 2ZADA 2H89A 3LJPA 3OTRA 1M64A 3BHFA 4AOSA 4H4VA 4B68A 1ZMCA 3CGBA 3D8XA 1JPMA 5KMPA 1PS9A 4H2HA 1EL8A 1D5TA 1V59A 4HYRA 2B9XA 3SN0A 3T2YA 1BGNA 1B4VA 2WP9A 1P48A 3EKGA 3MSYA 2QDDA 2GL5A 1GT8A 5DBJA 3OP2A 1REOA 3DFYA 2WP5A 3NH3X 3OC4A 4TLZA 4HNCA 3T2KA 3NRZB 3Q4DA 3V4BA 2OZ3A 1KSSA 3H8LA 3EUB3 4TM1A 3NTDA 1ZMDA 4FK1C 3UOYA 4G6HA 4D03A 2AL2B 1S7MA 3LOVA 3T14A 3C96A 3VA8A 4RG3A 3VCCA 2R45A 4FP1A 1RVKA 3AEAA 3T9PA 2VOUA 1E1MA 2B7SA 2Y6QA 2W0HA 1IYXA 4B64A 4HNLA 4B69A 1PDYA 4Z2UA 2XLPA 3D46A 1VDCA 3AYIA 3ICSA 2WPFA 3HPFA 3AE7A 4ICYA 3N4EA 1W6TA 1BKHA 3SZFA 3HZLA 2WOWA 1RP0A 3BHKA 3H8IA 4Y4LA 4DWDA 1EC9A 1FFUC 2YR4A 3KPFA 4O5UA 3ES7A 2XVEA 5JCNA 1XHCA 4APNA 1JDFA 1GRHA 2CHRA 3ADAB 4LU6A 4U8KA 3P4PA 3T6CA 1F8WA 4GIRA 1PBCA 5KRQA 2XVIA 2DW6A 3UXLA 4DX3A 4J57A 3HYWA 1X2GA 3THUA 3GYXA 5KMSA 5IPYA 2W54A 5BOEA 1KCZA 1VG9A 1S2YA 3LB8A 3U9IA 3ALLA 2YQUA 4I59A 2GQWA 3SJNA 4K8GA 4DYEA 1JRXA 1DNCA 3ATRA 4DSHA 3TWBA 5IDZA 4EQWA 1OJ9A 1NU5A 2PA6A 3GYJA 3COXA 3GD3A 5ENLA 3RRAA 2C75A 3CNJA 2WPCA 3I6EA 4NTDA 4NWZA 1L9DA 2Q0KA 3G5QA 2QJMA 1CHUA 3H8AA 4YWOA 4C5OA 4YXDA 1PBEA 2BC1A 4Z2RA 4HPNA 4EM3A 2R0CA 2TMDA 3CPHG 2RABA 3RCYA 4U2SA 3UKLA 2X8HA 5L46A 2C67A 1M6IA 2GGGA 1TDOA 2CULA 1DXLA 4NNJA 3AD9B 1N4UA 1PDHA 4FX9A 1FIQB 2BYBA 1BZLA 1MOKA 2RGHA 3DMEA 2WS3A 2Z5YA 3AM9A 2R4JA 3NK2X 3NVVB 5JCLA 2OZ8A 3T8QA 2OVLA 3SBFA 3VC5A 1EBHA 4TVYA 1JOAA 3JZUA 4J3ZA 2Z5XA 1YQZA 2WQYA 3QSEA 3NHOX 3DJDA 2XFPA 2O56A 2GR0A 4H83A 5CKUA 2PCEA 2WESA 3S5WA 3CNPA 4G7FA 1JRPA 2GMJA 4H2PA 3A7UA 2VQ7A 2YLXA 3SN1A 3STPA 4J31A 3DK8A 3SM8A 3A7RA 3L1RA 2NQLA 2QJJA 3D1CA 1IUSA 1TDNA 3NXLA 4Z43A 2GRTA 3SZCA 3TQPA 1JCTA 4CY8A 2XH0A 3FG2P 1OJAA 1KSUA 4A5LA 2PMQA 3GWFA 3IJLA 4A3RA 4HN8A 3HYVA 1JPDX 4PABA 4WCTA 4Z2TA 3F8PA 3IC9A 1CBOA 3NN6X 4ECHA 4EIPA 1GPEA 1YQ3A 1YKJA 3QVRA 3L8KA 2PGWA 3I3LA 1K0LA 4JY2A 1TRBA 3UTHA 1D4CA 1TYPA 3PK7A 3RHAA 2HNEA 4B63A 4A9WA 3VDGA 2OLOA 1NG3A 3PFRA 1GERA 1KNRA 2GSHA 1FO4A 1EC7A 3E1TA 1KNPA 2C64A 4M52A 3DDMA 2FJBA 2GGEA 2PP3A 2IVDA 2QDEA 1ZOYA 2GR3A 1TYTA 2XH4A 4H4TA 2GVCA 4YKGA 1QJDA 3BI4A 1MO9A 5U1OA 3PO7A 2JB3A 2WOVA 1GRTA 4OPCA 3UKFA 2YVFA 3UCCA 2DKIA 3H7VA 4CNJA 1ZXIC 2CVJA 4EQXA 2C76A 2P88A 1GXFA 1GOSA 3FIMB 2Q0LA 3TJ4A 3UKAA 1EC8A 4U2LA 3KKJA 1NELA 1ECQA 4GF7A 4IZGA 1DOEA 1NHRA 3RGTA 4B65A 1PHHA 1JNRA 2AL1A 3H70A 3SSZA 4K5RA 1FECA 5FJTA 4DXKA 2GR1A 1N63C 2YG6A 1CL0A 4KWSA 1ZK7A 2GGJA 2GGHA 4GDEA 3SR6B 1ZX9A 3K7MX 1FEBA 3M12A 4BJYA 4DN1A 2WOIA 3UCDA 5ER0A 4OPIA 2JAEA 2YR6A 3CMMA 4GRTA 4C74A 2PP0A 2RDXA 3UKHA 3R10A 1STZA 3P0WA 1WUFA 2E3TA 2WP6A 1RSGA 4G74A 1O95A 1GESA 3HRDC 2OKTA 4NZHA 4K5SA 3CGDA 2O9ZA 1DODA 4GR1A 3AECA 2V3AA 1F6MA 3ETRB 2PTXA 1X31B 1YY5A 1SEZA 2WEUA 3GMBA 1NEKA 1L0VA 2HZGA 1WUEA 1SB3B 3RR1A 4EIQA 1BWCA 1GRFA 4WX1A 1SJDA 4H4UA 3ATQA 4GMEA 2BXRA 3ENLA 5M0ZA 2P0IA 4AT0A 1N4VA 1E1NA 3NK1X 2OQHA 3OPSA 1XPYA 2YG5A 3NVYB 1TZZA 4E6MA 3NNEA 4YSYA 4IL2A 2YG4A 3NRNA 4TM3A 1SJCA 1QLBA 1IUTA 2EQ7A 1LPFA 4CY6A 2EQ6A 4I58A 3QJ4A 3QN3A 4Z44A 3AEGA 7ENLA 3GD6A 2OO6A 3V3OA 2PTZA 5EBKA 1YQ4A 5U25A 2YR5A 4HA6A 2X99A 1H7WA 1T3QC 4GUVA 1E1KA 2ZZCA 1KF6A 4BK1A 5G5GB 2QAEA 2NPXA 1CC2A 5M10A 4E0VA 1YEYA 1XANA 3HYXA 1GEUA 2BABA 2PS2A 3R11A 2VVLA 3NGCX 3DH9A 1RYIA 4IP4A 5EOWA 3UGVA 4IV9A 3BNMA 3DESA 4CRTA 3QPEA 3TW9A 3UJ2A 4Z26A 4H2RA 4TM0A 4AP1A 4EQSA 2C7GA 1GRGA 1DTNA 3IJIA 1FHUA 4YT0A 3I6TA 3GRSA 4K1WA 4A99A 2CFYA 3A7AA 3ALMA 2X8CA 4XWZA 4Y4NA 2OLAA 4YSXA 4U8LA 3AN1A 3GSIA 3OZ2A 2R0PA 2PP1A 3M0OA 3AE4A 3B3RA 1D4DA 2OLNA 2VVLG 4B1BA 1IUWA 3Q9TA 3AD7B 3QFBA 3AYJA 4G73A 1JROA 5HXIA 3RP8A 3GD4A 3NG7X 4YTMA 2B9WA 1R0MA 4NTEA 3AYLA 1XDIA 1E1LA 1PDZA 2EQ9A 2YWLA 1NHQA 2XFNA 3G5RA 5LV9A 2WDQA 1LQTA 3II4A 3ZYXA 1K0JA 2E1MA 4ZCCA 5JCMA 1MRAA 1JRYA 3R1ZA 1CJCA 4YTPA 2BK4A 3CGCA 2QA2A 4H1ZA 2C70A 3V5FA 3TCSA 3PS9A 5KMRA 3QSMA 3RNMA 3SY4A 1NAAA 5FJOA 4H2QA 3G5SA 4Z1YA 1FHVA 3N6HA 3N6JA 1N5XA 3P93A 1FOHA 2XVJA 2VRLA 3FCPA 5BULA 3CIRA 4RSLA 4JY3A 3SFDA 4PAAA 5C2TA 1XPQA 2R0GA 1W4XA 2UZZA 3O0HA 4ZCWA 3UOXA 1D4EA 6ENLA 2APGA 3P4RA 4JHMA 4FDCB 4XWRA 5U63A 1CC4A 2I5QA 1VDVA 2XVFA 4ZN0A 2GQFA 2BS2A 3V3NA 3T37A 4GYPC 2XLTA 3ZVHA 3PVCA 1P2HA 1GV4A 3NS1B 4G9KA 4U8PA 4D04A 4EM4A 1COYA 4LA1A 1MNSA 1VQWA 4EMIA 3BI2A 3SXIA 3ZLGA 3B97A 3GC2A 2DW7A 5KXJA 4Z25A 4XXGA 1E39A 3AEFA 3NFUA 4H4ZA 1GTEA 5J04A 4YSZA 1FCDA 3LZWA 1PXBA 3NKSA 3AE1A 3UOVA 4GAPA 3DFHA 1H2IA 4HCHA 2X50A 3ICTA 3AEEA 3IHMA 3SFEA 4CCRA 3AE6A 4A6GA 3VRBA 2FJAA 1KKRA 3CXBA 5KMQA 3FXGA 3BOXA 1H86A 2BCGG 3AEBA 4JNQA 4IL0A 5HHFA 5TR3A 4OPUA 3KU9A 3EAOA 2V3BA 2R9ZA 3KD9A 3QVPA 4GCMA 4UDQA 4IVOB 3SZ0A 1K0IA 3UP5A 3DG6A 4B66A 4K2SA 5HY5A 2C66A 2C3DA 2E5AA 4J56A 1EL5A 4UDRA 1VRQB 3CNDA 2VZ2A 1B8SA 3UKQA 3KLJA 1KKOA 5KOWA 4G6GA 2OQYA 4II3A 3DJGX 2ZC8A 5JRBA 2YVGA 4GFIA 5KVHA 2P8BA 3NO1A 3SGLA 4KT2A 4NEVA 4C3XA 3NLCA 3KVEA 3FVDA 3MWCA 1F8RA 4JN9A 4RG4A 3CPIG 2GF3A 3DEQA 3K30A 1E7PA 4J34A 4BJZA 4A65A 4E8GA 1KDGA 3IHGA 5FS7A 1JRZA 1JU2A 3AD8B 4AOXA 4UDPA 1ZP0A 3F8RA 2B76A 3AE2A 3DGZA 5BOFA 3DGHA 3CNTA 4UP3A 5GRTA 1CF3A 3GY1A 4AP3A 1MDRA 3RP7A 1GRAA 4JQ9A 2QQ6A 1Q1RA 3JW7A 2P3ZA 3KUMA 2YM1A 1ZKQA 1TDFA 5JCIA 4N9XA 2IIDA 1BQGA 3RO6A 2FBWA 3OW1A 1H81A 2ACZA 2XCGA 1PBBA 4II2A 3NK0X 1NHPA 5EU9A 2OG9A 4BV6A 1DOBA 4TLXA 2JKCA 4HCDA 2V60A 4H50A 1NPXA 2RGOA 2XGZA 3VR9A 2YLZA 1ZDLA 1S3EA 1VQZA 2GB0A 1QO8A 1CJ4A 3I4KA 3GWDA 2YLRA 3AMZA 2GEWA 3ZVHB 5IQ1A 4A6NB 2YLTA 4TM4A 4H7UA 5C3JA 1H7XA 3D47A 1EBDA 3V76A 4X2PA 2XLRA 4JN8A 4ZOHB 3BJSA 2A8XA 3QSSA 3AWIA 2XH2A 1NG4A 2AL2A 1AOGA 2J3NA 1LTXR 5BUKA 1Y0PA 4OCGA 1PJ6A 1TDKA 3DK9A 1NENA 1OJDA 2XSXA 4CNKA 2A89A 1H83A 2Q7VA 4OPGA 3VFCA 1S2QA 3R0UA 2XDOA 4E4UA 3UKPA 1DOCA 3AXBA 3NN0X 2IVEA 4H4SA 2QCUA 3UKKA 1IUVA 2PPGA 2Y6RA 2OAMA 3ISHA 3ALJA 3TTEA 5KVIA 3UP4A 2YLSA 4H4WA 3T2ZA 1E9IA 2JB1A 1LJ1A 4U8NA 1D7YA 4CBQA 2NVKX 2BS4A 3AB1A 3CTYA 2YVJA 2OFJA 4JNAA 1GRBA 2WU5A 5BVAA 2XFOA 3DGBA 3MY9A 1L9EA 4A35A 3UOZA 4ADWA 3QLDA 4H19A 2BRYA 2PSNA 2JB2A 3EPTA 2W3RA 1SJBA 2V61A 3AE9A 1JEHA 2V5ZA 2XLUA 1H82A 1SJAA 3UCLA 1V97A 3CYJA 4U8IA 3P4QA 1GETA 1BF3A 3IK4A 2OX4A 2PTWA 4ENLA 1BGJA 2R46A 3PG6A 4YTNA 3NYEA 2FKPA 1Q1WA 3R25A 4YKFA 4GGBA 4G8TA 4U8MA 2F5ZA 5G5HB 3AE5A 2DKHA 2OALA 1NHSA 3RITA 2PTYA 3IJQA 4KX6A 1RM6B 1GREA 2BK5A 1H84A 3EANA 3QKEA 3SX6A 4C77A 2VVMA 4H4RA 2AAQA 1F9CA 1ZY8A 3DK4A 2WBAA 3QTPA 4C3YA 5FMHA 4B67A 3F8DA 3IWAA 3VC6A 3N4FA 4M6UA 2GGIA 3UTGA 4K2XA 2VRMA 3BI5A 1Y56A 3NYFA 2MUCA 2AR8A 4E5TA 3UJRA 4USRA 3TWAA 1PBFA 4GDPA 4DHGA 2FJDA 3BNUA 1S3BA 1TE6A 1GTHA 2WU2A 2GR2A 2AQJA 3LXDA 3T0KA 2QA1A 1Q9IA 1KN0A 4HCLA 1WYGA 4MGGA 4YWSA 1K4QA 4GYPA 3CB3A 3Q45A 4AT2A 4GGHA 3SQPA 2POZA 3UJSA 4H2NA 1DJNA 5FS8A 3NVWB 3V5CA 2JK6A 4J2WA 3ICRA 1EL7A 1N5WC 2ONEA 3REDA 1IUXA 1MUCA 3KPKA 3UTFA 3UTEA 3V3WA 3KA7A 3ITJA 1BKWA 4U8JA 3JVAA 4DGKA 3ES8A 3JSKA 3DA1A 3UJEA 1P2EA 3M13A 1B5QA 2VQBA 2BK3A 1PJ7A 4OPLA 1KFYA 3EEZA 1E6EA 2GAGB 2W55A 4YSHA 3I6DA 1OJTA 1OEPA 4NTCA 4A6NA 5CQFA 2BACA 4J33A 1NDAA 3NVZB 1OJCA 1TKKA 3DG3A 1PN0A 4EMWA 1O5WA 2OA1A 3P9UA 3SYIA 4BK2A 4OPTA 4DNAA 3DERA 2BS3A 2QJNA 3EF6A 1GNDA 3S61A 3K1GA 5FJPA 4IP5A 3UJFA 1B37A 4U2TA 2AKZA 3H4KA 3TJIA 1EBGA 2V6OA 4H4XA 4Y4MA 4HB9A 4J1OA 2OZTA 3GO2A 1ELIA 5KWFA 3L5OA 3PWIA 4ROPA 4M0XA 2AKMA 2GDQA 3CAWA 4E4FA 1F8SA 3GMCA 5JCKA 3MUCA 1LVLA 3VCNA 1L8PA 4ZA0A 2R4EA 4IT1A 2OPJA 4O5QA 2CDUA 4GISA 4JDRA 5FJRA 2H88A 1MXTA 3C4NA 3FJ4A 3PWGA 2HXTA 3BSMA 1X2HA 1LV0A 2I0ZA 2GH5A 5KOXA 2PGEA 3CNSA 1H6VA 2EQ8A 4OPDA 2TPRA 3CXOA 5GSNA 3AE3A 2WHDA 1KD0A 2BRAA 2PYXA 3DJEA 3NTAA 4JN7A 3GYIA 3D9XA 4F4RA 3GDNA 2QVHA 4EMJA 3AE8A 2QGYA 2FJEA 2XVHA 1PXAA 3UXKA 4P9SA 4A7AA 1R6WA 2BXSA 3LADA 1GSNA 1N60C 3CN8A 4X4JA 4DSGA 5BRTA 3FMWA 5HYMA 3R0KA 3U4FA 2C73A 2WPEA 3DIPA 2E4GA 4Z24A 4IA6A 2C4CA 1D7LA 2XFUA 3H12A 3NT6A 2YLWA 2HQMA 1FFVC 3MZNA 4K8DA 3T4WA 1HYUA 1PXCA 2ZZBA 1IJHA 3P3BA 3NYCA 3TOYA 2Q6UA 3LZXA 3OZYA 5FS9A 3VQRA 1CJ2A 2WDRA 3R07C 4IVMB 1PBDA 3IF9A 2JBVA 3T31A 2ARDA 2PU0A 1PJ5A 4X9MA 3VR8A 1ELSA 2C3CA 1ZOVA 3R9UA 1P43A 2WDVA 1ONFA 4EWJA 4K22A 3FPZA 2XH7A 3NIXA 3SZWA 4ZCDA 4FK1A 2C72A 2BCPA 3ZLFA 1FL2A 2E5VA 2YG3A 4K7ZA 4OVIA 5EB5A 4KPRA 5FJUA 2ZBWA 3B6DA 2YAUA 1O94A 2HXUA 1CC6A 1MDLA 2WETA 1UKVG 4H4YA 3ABVA 3CPJG 4FI4A 3AEDA 3QFAA 3URHA 1LQUA 4H4QA 3ZDNA
chains in the Genus database with same CATH topology
2XYOA 1N1PA 4YTNA 3NYEA 2A87A 3D1CA 1Q1WA 1IUSA 4YKFA 3GDPA 1TDNA 4Z43A 2GRTA 3SZCA 2XLSA 1FOHA 4U8MA 2F5ZA 3AE5A 2DKHA 2OALA 2GMHA 4BK3A 1EL9A 2XVJA 1VG0A 4CY8A 5KNLA 5J60A 1NHSA 3FG2P 2VRLA 1OJAA 1KSUA 4A5LA 5BULA 3GWFA 4KX6A 3CIRA 2YG7A 1Y56B 4RSLA 1FEAA 4JY3A 3SFDA 4PAAA 5C2TA 1XPQA 2R0GA 1GREA 1W4XA 2BK5A 1H84A 2UZZA 3HYVA 3O0HA 3EANA 4IA5A 3SX6A 4PABA 4WCTA 4C77A 2VVMA 4H4RA 1D4EA 2AAQA 3Q6JA 3F8PA 3UOXA 4Z2TA 3IC9A 2APGA 1CBOA 3NN6X 3P4RA 4GAVA 4ECHA 4FDCB 1N4WA 2XFQA 4XWRA 5U63A 4EIPA 3CGEA 1ZY8A 1CC4A 1CJ3A 3DK4A 1GPEA 2GAHB 1YQ3A 2WBAA 1YKJA 3P4SA 3QVRA 1JNZA 3L8KA 3I3LA 4C3YA 1K0LA 5FMHA 5IQ4A 3K7QX 2XVFA 3F8DA 2GQFA 4JY2A 4B67A 2BS2A 3V3NA 4ZN0A 1TRBA 3T37A 1D4CA 3UTHA 1TYPA 2XLTA 3PVCA 1P2HA 4USQA 4CCQA 4H4PA 1GV4A 3IWAA 3K7TA 3RHAA 3RP6A 3UTGA 4G9KA 4B63A 4K2XA 4A9WA 4U8PA 2VRMA 3BI5A 4D04A 4EM4A 1COYA 1Y56A 4LA1A 1NG3A 1VQWA 4EQRA 2OLOA 3NYFA 4U8OA 2PHHA 5EB4A 2X8GA 4EMIA 2AR8A 3BI2A 2BC0A 4REKA 3SXIA 1GERA 1KNRA 4USRA 3VRDB 5KXJA 1PBFA 4Z25A 4GDPA 5FS6A 3E1TA 2GV8A 1KNPA 2C64A 4M52A 4XXGA 2FJDA 3BNUA 1E39A 2C65A 3C4AA 3AEFA 1S3BA 4H4ZA 2FJBA 1GTHA 4LIIA 2WU2A 1TDEA 1GTEA 2IVDA 4YSZA 5J7XA 1IUUA 1ZOYA 3FBSA 3DJJA 2GR2A 1FCDA 2AQJA 3LZWA 2GR3A 1TYTA 1F3PA 4H4TA 1PXBA 2B9YA 2GVCA 3NKSA 3LXDA 3T0KA 3AE1A 4YKGA 1QJDA 2X3NA 3BI4A 3P1WA 4BURA 1GALA 3UOVA 1MO9A 2QA1A 4GAPA 3VRAA 2BA9A 1Q9IA 5U1OA 3PO7A 1H2IA 2JB3A 2X50A 3ICTA 2WOVA 1KN0A 1GRTA 4OPCA 4MJWA 2YVFA 3UKFA 3AEEA 2DKIA 1DJQA 3IHMA 3SFEA 4CNJA 4CCRA 2CVJA 4EQXA 2ZZ0A 2B7RA 2RGJA 3AE6A 3VRBA 2FJAA 1K4QA 2C76A 5KMQA 1H86A 4AT2A 2BCGG 3SQPA 3WE0A 3AEBA 1GXFA 4JNQA 4A79A 1GOSA 3FIMB 4H2NA 5HHFA 1L9CA 1Z6LA 3GRTA 2Q0LA 1DJNA 5TR3A 4X9NA 5FS8A 4OPUA 2YM2A 3KU9A 4U2LA 3UKAA 3KKJA 4NEWA 2JK6A 3EAOA 4J2WA 3ICRA 2V3BA 2R9ZA 1EL7A 4J36A 4GF7A 3KD9A 1DOEA 1NHRA 3REDA 1IUXA 3QVPA 4B65A 4GCMA 1PHHA 2H89A 4UDQA 3KPKA 3LJPA 3UTFA 4IVOB 3SZ0A 1JNRA 1K0IA 3UP5A 1M64A 4B66A 3BHFA 3UTEA 3KA7A 4AOSA 3ITJA 5HY5A 4K5RA 4H4VA 1BKWA 1FECA 4B68A 4U8JA 2GR1A 2C66A 2YG6A 1ZMCA 3CGBA 1CL0A 4DGKA 3D8XA 2C3DA 3JSKA 4J56A 3DA1A 1EL5A 1P2EA 4UDRA 3M13A 5KMPA 1PS9A 1B5QA 1VRQB 2VQBA 2BK3A 1PJ7A 1EL8A 1ZK7A 3CNDA 4GDEA 2VZ2A 1KFYA 1B8SA 1D5TA 4OPLA 3UKQA 1E6EA 1ZX9A 1V59A 2GAGB 3K7MX 1FEBA 2B9XA 3M12A 2WOIA 4BJYA 3KLJA 5ER0A 4OPIA 4YSHA 5KOWA 2JAEA 3I6DA 4G6GA 3T2YA 1OJTA 1BGNA 1B4VA 2YR6A 3CMMA 4NTCA 4II3A 2WP9A 4GRTA 4C74A 3DJGX 4A6NA 5CQFA 5JRBA 2YVGA 2BACA 5KVHA 1GT8A 4J33A 5DBJA 1NDAA 1OJCA 3UKHA 3SGLA 1PN0A 4NEVA 4C3XA 1REOA 3NLCA 2WP5A 3KVEA 3NH3X 4EMWA 3OC4A 1O5WA 2OA1A 4TLZA 1F8RA 4JN9A 4RG4A 3CPIG 2GF3A 3T2KA 2WP6A 1RSGA 4G74A 1O95A 1GESA 3P9UA 3SYIA 3K30A 4NZHA 1KSSA 4BK2A 4K5SA 4OPTA 4DNAA 3H8LA 4TM1A 3NTDA 1ZMDA 3CGDA 4FK1C 2O9ZA 1DODA 4GR1A 1E7PA 4J34A 2BS3A 3UOYA 4BJZA 3AECA 4G6HA 4A65A 3EF6A 4D03A 1S7MA 3LOVA 3T14A 2V3AA 1KDGA 3C96A 4RG3A 1GNDA 1F6MA 3IHGA 2R45A 1X31B 1YY5A 3S61A 5FS7A 1JRZA 1JU2A 1SEZA 2WEUA 3AD8B 3AEAA 3GMBA 1NEKA 1L0VA 4UDPA 4AOXA 1B37A 1ZP0A 3F8RA 4U2TA 3H4KA 2VOUA 1E1MA 4EIQA 2B76A 1BWCA 1GRFA 2V6OA 2B7SA 4H4XA 4WX1A 4Y4MA 4H4UA 3ATQA 4HB9A 2Y6QA 3DGZA 3AE2A 2W0HA 3DGHA 3CNTA 4B64A 4B69A 2BXRA 4UP3A 5GRTA 5M0ZA 1CF3A 4AT0A 1N4VA 1E1NA 3NK1X 4AP3A 4Z2UA 3RP7A 1GRAA 2YG5A 4JQ9A 2XLPA 3NNEA 1Q1RA 1VDCA 4YSYA 1ELIA 5KWFA 3AYIA 2YG4A 2YM1A 3ICSA 3NRNA 2WPFA 3L5OA 4TM3A 3AE7A 1ZKQA 1TDFA 4ICYA 5JCIA 4N9XA 1QLBA 2IIDA 1IUTA 2EQ7A 2FBWA 1LPFA 1H81A 4CY6A 2ACZA 2XCGA 3SZFA 2EQ6A 4I58A 3HZLA 3QJ4A 1PBBA 4Z44A 3AEGA 2WOWA 1RP0A 3BHKA 3H8IA 4Y4LA 3V3OA 4II2A 1F8SA 3NK0X 2YR4A 1NHPA 3GMCA 3KPFA 5JCKA 4O5UA 1LVLA 5EBKA 2XVEA 1YQ4A 2R4EA 4BV6A 5JCNA 1XHCA 1DOBA 4TLXA 5U25A 4APNA 2JKCA 2YR5A 2V60A 4HA6A 4O5QA 2CDUA 4H50A 4JDRA 1NPXA 1GRHA 2X99A 2RGOA 3VR9A 2YLZA 1ZDLA 1H7WA 2H88A 3ADAB 1MXTA 4GUVA 1E1KA 4LU6A 4U8KA 2ZZCA 1KF6A 3P4PA 4BK1A 3C4NA 1F8WA 2QAEA 2NPXA 1CC2A 1PBCA 5KRQA 1S3EA 2XVIA 2GB0A 1LV0A 4J57A 2I0ZA 3HYWA 1QO8A 5M10A 2GH5A 5KOXA 1CJ4A 4E0VA 1XANA 3HYXA 3GYXA 3GWDA 1GEUA 1H6VA 2EQ8A 2BABA 2YLRA 3CNSA 2TPRA 2GEWA 4OPDA 5GSNA 3AE3A 5IQ1A 2WHDA 4A6NB 2YLTA 5KMSA 2VVLA 2BRAA 3DH9A 1RYIA 2PYXA 3NGCX 4TM4A 5IPYA 4H7UA 5C3JA 3DJEA 5EOWA 1H7XA 3NTAA 4IV9A 3GYIA 3D9XA 3BNMA 3GDNA 1VG9A 1S2YA 1EBDA 3LB8A 4EMJA 3AE8A 3V76A 3ALLA 4CRTA 2YQUA 2XLRA 2FJEA 2XVHA 4I59A 2GQWA 4Z26A 1PXAA 4H2RA 1JRXA 2A8XA 4TM0A 4AP1A 4P9SA 4A7AA 4EQSA 1DNCA 3QSSA 3AWIA 2BXSA 2C7GA 1GRGA 3LADA 3ATRA 4DSHA 1NG4A 1AOGA 1GSNA 2J3NA 1LTXR 5BUKA 1Y0PA 3CN8A 4OCGA 4X4JA 4DSGA 5BRTA 4EQWA 1OJ9A 4YT0A 1PJ6A 3GRSA 4A99A 1TDKA 2CFYA 3DK9A 3FMWA 5HYMA 2C73A 3GYJA 3COXA 2WPEA 3GD3A 1NENA 3ALMA 2E4GA 2X8CA 1OJDA 4XWZA 4Z24A 4IA6A 4Y4NA 2C4CA 2C75A 2A89A 3CNJA 2WPCA 1H83A 4CNKA 4YSXA 4U8LA 2Q7VA 4OPGA 4NTDA 1S2QA 4NWZA 1L9DA 2Q0KA 1D7LA 3G5QA 2XFUA 2XDOA 3NT6A 2YLWA 2HQMA 4K8DA 3GSIA 3OZ2A 2R0PA 1CHUA 4YWOA 4C5OA 3UKPA 4YXDA 1PBEA 2BC1A 1DOCA 3M0OA 1HYUA 1PXCA 4Z2RA 2ZZBA 3AE4A 4EM3A 1IJHA 2R0CA 2TMDA 2RABA 3AXBA 1D4DA 3B3RA 2IVEA 3CPHG 3NN0X 2OLNA 2VVLG 4B1BA 1IUWA 4U2SA 3UKLA 2X8HA 5L46A 3Q9TA 3AD7B 3NYCA 3QFBA 2Q6UA 4H4SA 3AYJA 2QCUA 2C67A 3LZXA 4G73A 1M6IA 3UKKA 1IUVA 5FS9A 1CJ2A 1DXLA 1TDOA 2CULA 3VQRA 2WDRA 2Y6RA 2OAMA 4NNJA 3AD9B 4IVMB 3ISHA 1PBDA 1N4UA 3IF9A 5HXIA 3RP8A 2JBVA 3T31A 2ARDA 3ALJA 5KVIA 3UP4A 3GD4A 1PDHA 2YLSA 1PJ5A 4X9MA 4H4WA 3T2ZA 4FX9A 3VR8A 3NG7X 2BYBA 1BZLA 1MOKA 2C3CA 2RGHA 1ZOVA 3DMEA 3R9UA 2JB1A 1LJ1A 2WS3A 4U8NA 2WDVA 1D7YA 2Z5YA 1ONFA 4YTMA 4CBQA 4K22A 2B9WA 2R4JA 3NK2X 2NVKX 2BS4A 3FPZA 5JCLA 3NIXA 3AB1A 3SZWA 3CTYA 2YVJA 4NTEA 4JNAA 3AYLA 1GRBA 1XDIA 2WU5A 5BVAA 1E1LA 2XFOA 4ZCDA 4FK1A 2EQ9A 1L9EA 2C72A 2BCPA 2YWLA 2Z5XA 1JOAA 4ADWA 3UOZA 1FL2A 1NHQA 2XFNA 3G5RA 1YQZA 2WQYA 3QSEA 5LV9A 2E5VA 2WDQA 3NHOX 1LQTA 2YG3A 3II4A 4K7ZA 2BRYA 4KPRA 2XFPA 2JB2A 3DJDA 2ZBWA 3EPTA 4OVIA 1K0JA 3ZYXA 2GR0A 2E1MA 3B6DA 4ZCCA 5JCMA 2YAUA 2V61A 5CKUA 3AE9A 1JEHA 1O94A 2V5ZA 2WESA 1JRYA 3S5WA 5EB5A 2XLUA 1CJCA 1H82A 3CNPA 1CC6A 2BK4A 3CGCA 2QA2A 2GMJA 4YTPA 2C70A 3UCLA 2WETA 1UKVG 4H2PA 4H4YA 3ABVA 3CPJG 4U8IA 2VQ7A 3PS9A 3AEDA 3QFAA 3URHA 1GETA 3RNMA 1BF3A 3P4QA 3QSMA 3SY4A 5KMRA 1NAAA 2YLXA 4H2QA 1LQUA 3G5SA 4H4QA 4J31A 3ZDNA 3DK8A 3SM8A 1BGJA 2R46A 3PG6A 3L1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XYO A;  1N1P A;  4YTN A;  3NYE A;  2A87 A;  3D1C A;  1Q1W A;  1IUS A;  4YKF A;  3GDP A;  1TDN A;  4Z43 A;  2GRT A;  2XLS A;  1FOH A;  4U8M A;  2F5Z A;  3AE5 A;  2DKH A;  2OAL A;  2GMH A;  4BK3 A;  1EL9 A;  2XVJ A;  1VG0 A;  4CY8 A;  5J60 A;  1NHS A;  3FG2 P;  2VRL A;  1OJA A;  1KSU A;  4A5L A;  5BUL A;  3GWF A;  4KX6 A;  3CIR A;  2YG7 A;  1Y56 B;  4RSL A;  1FEA A;  4JY3 A;  3SFD A;  4PAA A;  5C2T A;  1XPQ A;  2R0G A;  1GRE A;  1W4X A;  2BK5 A;  1H84 A;  2UZZ A;  3O0H A;  3EAN A;  4IA5 A;  4PAB A;  4WCT A;  4C77 A;  2VVM A;  4H4R A;  1D4E A;  2AAQ A;  3Q6J A;  3F8P A;  3UOX A;  4Z2T A;  3IC9 A;  2APG A;  1CBO A;  3NN6 X;  3P4R A;  4ECH A;  4FDC B;  1N4W A;  2XFQ A;  4XWR A;  5U63 A;  4EIP A;  3CGE A;  1ZY8 A;  1CC4 A;  1CJ3 A;  3DK4 A;  1GPE A;  2GAH B;  1YQ3 A;  2WBA A;  1YKJ A;  3P4S A;  3QVR A;  1JNZ A;  3L8K A;  3I3L A;  4C3Y A;  1K0L A;  5FMH A;  5IQ4 A;  3K7Q X;  2XVF A;  3F8D A;  2GQF A;  4JY2 A;  4B67 A;  2BS2 A;  3V3N A;  4ZN0 A;  1TRB A;  3T37 A;  1D4C A;  3UTH A;  1TYP A;  2XLT A;  3PVC A;  1P2H A;  4USQ A;  4CCQ A;  4H4P A;  1GV4 A;  3IWA A;  3K7T A;  3RHA A;  3RP6 A;  3UTG A;  4B63 A;  4K2X A;  4A9W A;  4U8P A;  2VRM A;  3BI5 A;  4D04 A;  4EM4 A;  1COY A;  1Y56 A;  4LA1 A;  1NG3 A;  1VQW A;  4EQR A;  2OLO A;  3NYF A;  4U8O A;  2PHH A;  5EB4 A;  2X8G A;  4EMI A;  2AR8 A;  3BI2 A;  2BC0 A;  4REK A;  1GER A;  1KNR A;  4USR A;  3VRD B;  5KXJ A;  1PBF A;  4Z25 A;  4GDP A;  5FS6 A;  3E1T A;  2GV8 A;  1KNP A;  2C64 A;  4M52 A;  4XXG A;  2FJD A;  3BNU A;  1E39 A;  2C65 A;  3C4A A;  3AEF A;  1S3B A;  4H4Z A;  2FJB A;  1GTH A;  4LII A;  2WU2 A;  1TDE A;  1GTE A;  2IVD A;  4YSZ A;  5J7X A;  1IUU A;  1ZOY A;  3FBS A;  3DJJ A;  2GR2 A;  1FCD A;  2AQJ A;  3LZW A;  2GR3 A;  1TYT A;  1F3P A;  4H4T A;  1PXB A;  2B9Y A;  2GVC A;  3NKS A;  3LXD A;  4YKG A;  3AE1 A;  1QJD A;  2X3N A;  3BI4 A;  3P1W A;  4BUR A;  1GAL A;  3UOV A;  1MO9 A;  2QA1 A;  3VRA A;  2BA9 A;  1Q9I A;  5U1O A;  3PO7 A;  2JB3 A;  2X50 A;  3ICT A;  2WOV A;  1GRT A;  4OPC A;  4MJW A;  2YVF A;  3UKF A;  3AEE A;  2DKI A;  1DJQ A;  3IHM A;  3SFE A;  4CNJ A;  4CCR A;  2CVJ A;  4EQX A;  2ZZ0 A;  2B7R A;  2RGJ A;  3AE6 A;  3VRB A;  2FJA A;  1K4Q A;  2C76 A;  1H86 A;  4AT2 A;  2BCG G;  3SQP A;  3WE0 A;  3AEB A;  1GXF A;  4JNQ A;  4A79 A;  1GOS A;  3FIM B;  4H2N A;  5HHF A;  1L9C A;  1Z6L A;  3GRT A;  2Q0L A;  1DJN A;  5TR3 A;  4X9N A;  5FS8 A;  4OPU A;  2YM2 A;  3KU9 A;  4U2L A;  3UKA A;  3KKJ A;  4NEW A;  2JK6 A;  3EAO A;  4J2W A;  3ICR A;  1EL7 A;  2R9Z A;  2V3B A;  4J36 A;  4GF7 A;  3KD9 A;  1DOE A;  1NHR A;  3RED A;  1IUX A;  3QVP A;  4B65 A;  4GCM A;  1PHH A;  2H89 A;  4UDQ A;  3LJP A;  3UTF A;  4IVO B;  1JNR A;  1K0I A;  3UP5 A;  1M64 A;  4B66 A;  3BHF A;  3UTE A;  3KA7 A;  4AOS A;  3ITJ A;  5HY5 A;  4K5R A;  4H4V A;  1BKW A;  1FEC A;  4B68 A;  4U8J A;  2GR1 A;  2C66 A;  2YG6 A;  1ZMC A;  3CGB A;  1CL0 A;  4DGK A;  3D8X A;  2C3D A;  3JSK A;  4J56 A;  3DA1 A;  1EL5 A;  1P2E A;  4UDR A;  3M13 A;  1PS9 A;  1B5Q A;  1VRQ B;  2VQB A;  2BK3 A;  1PJ7 A;  1EL8 A;  1ZK7 A;  3CND A;  4GDE A;  2VZ2 A;  1KFY A;  1B8S A;  1D5T A;  4OPL A;  3UKQ A;  1E6E A;  1ZX9 A;  1V59 A;  2GAG B;  3K7M X;  1FEB A;  2B9X A;  3M12 A;  2WOI A;  4BJY A;  3KLJ A;  5ER0 A;  4OPI A;  4YSH A;  5KOW A;  2JAE A;  3I6D A;  1OJT A;  1BGN A;  1B4V A;  2YR6 A;  4NTC A;  2WP9 A;  4GRT A;  4C74 A;  3DJG X;  4A6N A;  5CQF A;  2YVG A;  2BAC A;  5KVH A;  1GT8 A;  4J33 A;  5DBJ A;  1NDA A;  1OJC A;  3UKH A;  3SGL A;  1PN0 A;  4NEV A;  4C3X A;  1REO A;  3NLC A;  2WP5 A;  3KVE A;  3NH3 X;  4EMW A;  3OC4 A;  1O5W A;  2OA1 A;  4TLZ A;  1F8R A;  4JN9 A;  4RG4 A;  3CPI G;  2GF3 A;  2WP6 A;  1RSG A;  1O95 A;  1GES A;  3P9U A;  3K30 A;  4NZH A;  1KSS A;  4BK2 A;  4K5S A;  4OPT A;  4DNA A;  3H8L A;  4TM1 A;  3NTD A;  1ZMD A;  3CGD A;  4FK1 C;  2O9Z A;  1DOD A;  4GR1 A;  1E7P A;  4J34 A;  2BS3 A;  3UOY A;  4BJZ A;  3AEC A;  4A65 A;  4D03 A;  3EF6 A;  3LOV A;  1KDG A;  2V3A A;  3C96 A;  4RG3 A;  1GND A;  1F6M A;  3IHG A;  2R45 A;  1X31 B;  1YY5 A;  3S61 A;  5FS7 A;  1JRZ A;  1JU2 A;  1SEZ A;  2WEU A;  3AD8 B;  3AEA A;  3GMB A;  1NEK A;  1L0V A;  4UDP A;  4AOX A;  1B37 A;  1ZP0 A;  3F8R A;  4U2T A;  3H4K A;  2VOU A;  1E1M A;  4EIQ A;  2B76 A;  1BWC A;  1GRF A;  2V6O A;  2B7S A;  4H4X A;  4WX1 A;  4Y4M A;  4H4U A;  3ATQ A;  4HB9 A;  2Y6Q A;  3DGZ A;  3AE2 A;  2W0H A;  3DGH A;  3CNT A;  4B64 A;  4B69 A;  2BXR A;  4UP3 A;  5GRT A;  5M0Z A;  1CF3 A;  4AT0 A;  1N4V A;  1E1N A;  3NK1 X;  4AP3 A;  4Z2U A;  3RP7 A;  1GRA A;  2YG5 A;  4JQ9 A;  2XLP A;  3NNE A;  1Q1R A;  1VDC A;  4YSY A;  1ELI A;  5KWF A;  3AYI A;  2YG4 A;  2YM1 A;  3ICS A;  3NRN A;  2WPF A;  4TM3 A;  3AE7 A;  1ZKQ A;  1TDF A;  4ICY A;  5JCI A;  4N9X A;  1QLB A;  2IID A;  1IUT A;  2EQ7 A;  2FBW A;  1LPF A;  1H81 A;  4CY6 A;  2ACZ A;  2XCG A;  2EQ6 A;  4I58 A;  3HZL A;  3QJ4 A;  1PBB A;  4Z44 A;  3AEG A;  2WOW A;  1RP0 A;  3BHK A;  3H8I A;  4Y4L A;  3V3O A;  1F8S A;  3NK0 X;  2YR4 A;  1NHP A;  3GMC A;  3KPF A;  5JCK A;  4O5U A;  1LVL A;  5EBK A;  2XVE A;  1YQ4 A;  2R4E A;  4BV6 A;  5JCN A;  1XHC A;  1DOB A;  4TLX A;  5U25 A;  4APN A;  2JKC A;  2YR5 A;  2V60 A;  4HA6 A;  4O5Q A;  2CDU A;  4H50 A;  4JDR A;  1NPX A;  1GRH A;  2X99 A;  2RGO A;  3VR9 A;  2YLZ A;  1ZDL A;  1H7W A;  2H88 A;  3ADA B;  1MXT A;  4GUV A;  1E1K A;  4LU6 A;  4U8K A;  2ZZC A;  1KF6 A;  3P4P A;  4BK1 A;  3C4N A;  1F8W A;  2QAE A;  2NPX A;  1CC2 A;  1PBC A;  5KRQ A;  1S3E A;  2XVI A;  2GB0 A;  1LV0 A;  4J57 A;  2I0Z A;  5M10 A;  1QO8 A;  2GH5 A;  5KOX A;  1CJ4 A;  4E0V A;  1XAN A;  3GWD A;  1GEU A;  1H6V A;  2EQ8 A;  2BAB A;  2YLR A;  3CNS A;  2TPR A;  2GEW A;  4OPD A;  5GSN A;  3AE3 A;  5IQ1 A;  2WHD A;  4A6N B;  2YLT A;  2VVL A;  3NGC X;  3DH9 A;  1RYI A;  2PYX A;  4TM4 A;  5IPY A;  4H7U A;  5C3J A;  3DJE A;  5EOW A;  1H7X A;  3NTA A;  4IV9 A;  3GYI A;  3BNM A;  3GDN A;  1VG9 A;  1S2Y A;  1EBD A;  3LB8 A;  4EMJ A;  3AE8 A;  3V76 A;  3ALL A;  4CRT A;  2YQU A;  2XLR A;  2FJE A;  2XVH A;  4I59 A;  2GQW A;  4Z26 A;  1PXA A;  4H2R A;  1JRX A;  2A8X A;  4TM0 A;  4AP1 A;  4P9S A;  4A7A A;  4EQS A;  1DNC A;  3QSS A;  3AWI A;  2BXS A;  2C7G A;  1GRG A;  3LAD A;  3ATR A;  4DSH A;  1NG4 A;  1AOG A;  1GSN A;  2J3N A;  1LTX R;  5BUK A;  1Y0P A;  3CN8 A;  4OCG A;  4X4J A;  4DSG A;  5BRT A;  4EQW A;  1OJ9 A;  4YT0 A;  1PJ6 A;  3GRS A;  4A99 A;  1TDK A;  2CFY A;  3DK9 A;  3FMW A;  5HYM A;  2C73 A;  3GYJ A;  3COX A;  2WPE A;  3GD3 A;  1NEN A;  3ALM A;  2E4G A;  2X8C A;  1OJD A;  4XWZ A;  4Z24 A;  4IA6 A;  4Y4N A;  2C75 A;  3CNJ A;  2A89 A;  4CNK A;  2WPC A;  1H83 A;  4YSX A;  4U8L A;  2Q7V A;  4OPG A;  4NTD A;  1S2Q A;  1L9D A;  2Q0K A;  1D7L A;  3G5Q A;  2XFU A;  2XDO A;  3NT6 A;  2YLW A;  2HQM A;  4K8D A;  3GSI A;  3OZ2 A;  2R0P A;  1CHU A;  4YWO A;  4C5O A;  3UKP A;  4YXD A;  1PBE A;  2BC1 A;  1DOC A;  3M0O A;  1HYU A;  1PXC A;  4Z2R A;  2ZZB A;  3AE4 A;  4EM3 A;  1IJH A;  2R0C A;  2TMD A;  2RAB A;  3AXB A;  1D4D A;  3B3R A;  2IVE A;  3CPH G;  3NN0 X;  2OLN A;  2VVL G;  4B1B A;  1IUW A;  4U2S A;  3UKL A;  2X8H A;  5L46 A;  3Q9T A;  3AD7 B;  3NYC A;  3QFB A;  2Q6U A;  4H4S A;  3AYJ A;  2QCU A;  2C67 A;  3LZX A;  3UKK A;  1M6I A;  1IUV A;  5FS9 A;  1CJ2 A;  1DXL A;  1TDO A;  2CUL A;  3VQR A;  2WDR A;  2Y6R A;  2OAM A;  3AD9 B;  4IVM B;  3ISH A;  1PBD A;  1N4U A;  3IF9 A;  5HXI A;  3RP8 A;  2JBV A;  2ARD A;  3ALJ A;  5KVI A;  3UP4 A;  3GD4 A;  1PDH A;  2YLS A;  1PJ5 A;  4X9M A;  4H4W A;  4FX9 A;  3VR8 A;  3NG7 X;  2BYB A;  1BZL A;  1MOK A;  2C3C A;  2RGH A;  1ZOV A;  3DME A;  3R9U A;  2JB1 A;  1LJ1 A;  2WS3 A;  4U8N A;  2WDV A;  1D7Y A;  2Z5Y A;  1ONF A;  4YTM A;  4CBQ A;  4K22 A;  2B9W A;  2R4J A;  3NK2 X;  2NVK X;  2BS4 A;  3FPZ A;  5JCL A;  3NIX A;  3AB1 A;  3CTY A;  2YVJ A;  4NTE A;  4JNA A;  3AYL A;  1GRB A;  1XDI A;  2WU5 A;  5BVA A;  1E1L A;  2XFO A;  4ZCD A;  4FK1 A;  2EQ9 A;  1L9E A;  2C72 A;  2BCP A;  2YWL A;  2Z5X A;  1JOA A;  4ADW A;  3UOZ A;  1FL2 A;  1NHQ A;  2XFN A;  3G5R A;  1YQZ A;  2WQY A;  3QSE A;  5LV9 A;  2E5V A;  2WDQ A;  3NHO X;  1LQT A;  2YG3 A;  3II4 A;  4K7Z A;  3DJD A;  4KPR A;  2XFP A;  2JB2 A;  4OVI A;  2ZBW A;  3EPT A;  5EB5 A;  1K0J A;  3ZYX A;  2GR0 A;  2E1M A;  3B6D A;  4ZCC A;  5JCM A;  2YAU A;  2V61 A;  5CKU A;  3AE9 A;  1JEH A;  1O94 A;  2V5Z A;  2WES A;  1JRY A;  3S5W A;  2XLU A;  1CJC A;  1H82 A;  3CNP A;  1CC6 A;  2BK4 A;  3CGC A;  2QA2 A;  2GMJ A;  4YTP A;  2C70 A;  3UCL A;  2WET A;  1UKV G;  4H2P A;  4H4Y A;  3ABV A;  3CPJ G;  4U8I A;  2VQ7 A;  3PS9 A;  3AED A;  3QFA A;  3URH A;  1GET A;  3RNM A;  1BF3 A;  3P4Q A;  3QSM A;  1NAA A;  2YLX A;  4H2Q A;  1LQU A;  3G5S A;  4H4Q A;  4J31 A;  3ZDN A;  3DK8 A;  3SM8 A;  1BGJ A;  2R46 A;  3L1R A; 
#chains in the Genus database with same CATH topology
 2XYO A;  1N1P A;  3FV9 A;  2A87 A;  3DG7 A;  3GDP A;  1ONE A;  2POD A;  2XLS A;  4BK3 A;  2GMH A;  1EL9 A;  1VG0 A;  5KNL A;  5J60 A;  2YG7 A;  1Y56 B;  1FEA A;  4IA5 A;  3Q6J A;  4GAV A;  4Z17 A;  1N4W A;  2XFQ A;  3NZG A;  3CGE A;  3FYY A;  1CJ3 A;  2GAH B;  3P4S A;  3B9J B;  4KEM A;  1JNZ A;  5IQ4 A;  3CK5 A;  3K7Q X;  3ZVI A;  4CCQ A;  4USQ A;  4H4P A;  3RP6 A;  3K7T A;  4EQR A;  4U8O A;  2PHH A;  5EB4 A;  2X8G A;  2P8C A;  4REK A;  2BC0 A;  2MNR A;  2FYM A;  3VRD B;  4MKS A;  4IHC A;  5FS6 A;  4KPL A;  2GV8 A;  2C65 A;  3C4A A;  3OZM A;  4LII A;  1TDE A;  3ZLH A;  3HW2 A;  1IUU A;  5J7X A;  3FBS A;  4MMW A;  3DJJ A;  1N62 C;  2W3S A;  1F3P A;  3SN4 A;  2B9Y A;  2X3N A;  3P1W A;  4BUR A;  1GAL A;  3VRA A;  2BA9 A;  3S5S A;  3MQT A;  1N61 C;  4MJW A;  4TVW A;  1DJQ A;  2ZZ0 A;  2B7R A;  2RGJ A;  3SQS A;  1XS2 A;  3WE0 A;  3MKC A;  4A79 A;  2PU1 A;  3S47 A;  1L9C A;  1Z6L A;  3GRT A;  4X9N A;  2YM2 A;  4NEW A;  4J36 A;  3CT2 A;  2ZAD A;  2H89 A;  3LJP A;  3OTR A;  1M64 A;  3BHF A;  4AOS A;  4H4V A;  4B68 A;  1ZMC A;  3CGB A;  3D8X A;  1JPM A;  5KMP A;  1PS9 A;  4H2H A;  1EL8 A;  1D5T A;  1V59 A;  4HYR A;  2B9X A;  3SN0 A;  3T2Y A;  1BGN A;  1B4V A;  2WP9 A;  1P48 A;  3EKG A;  3MSY A;  2QDD A;  2GL5 A;  1GT8 A;  5DBJ A;  3OP2 A;  1REO A;  3DFY A;  2WP5 A;  3NH3 X;  3OC4 A;  4TLZ A;  4HNC A;  3T2K A;  3NRZ B;  3Q4D A;  3V4B A;  2OZ3 A;  1KSS A;  3H8L A;  3EUB 3;  4TM1 A;  3NTD A;  1ZMD A;  4FK1 C;  3UOY A;  4G6H A;  4D03 A;  2AL2 B;  1S7M A;  3LOV A;  3T14 A;  3C96 A;  3VA8 A;  4RG3 A;  3VCC A;  2R45 A;  4FP1 A;  1RVK A;  3AEA A;  3T9P A;  2VOU A;  1E1M A;  2B7S A;  2Y6Q A;  2W0H A;  1IYX A;  4B64 A;  4HNL A;  4B69 A;  1PDY A;  4Z2U A;  2XLP A;  3D46 A;  1VDC A;  3AYI A;  3ICS A;  2WPF A;  3HPF A;  3AE7 A;  4ICY A;  3N4E A;  1W6T A;  1BKH A;  3SZF A;  3HZL A;  2WOW A;  1RP0 A;  3BHK A;  3H8I A;  4Y4L A;  4DWD A;  1EC9 A;  1FFU C;  2YR4 A;  3KPF A;  4O5U A;  3ES7 A;  2XVE A;  5JCN A;  1XHC A;  4APN A;  1JDF A;  1GRH A;  2CHR A;  3ADA B;  4LU6 A;  4U8K A;  3P4P A;  3T6C A;  1F8W A;  4GIR A;  1PBC A;  5KRQ A;  2XVI A;  2DW6 A;  3UXL A;  4DX3 A;  4J57 A;  3HYW A;  1X2G A;  3THU A;  3GYX A;  5KMS A;  5IPY A;  2W54 A;  5BOE A;  1KCZ A;  1VG9 A;  1S2Y A;  3LB8 A;  3U9I A;  3ALL A;  2YQU A;  4I59 A;  2GQW A;  3SJN A;  4K8G A;  4DYE A;  1JRX A;  1DNC A;  3ATR A;  4DSH A;  3TWB A;  5IDZ A;  4EQW A;  1OJ9 A;  1NU5 A;  2PA6 A;  3GYJ A;  3COX A;  3GD3 A;  5ENL A;  3RRA A;  2C75 A;  3CNJ A;  2WPC A;  3I6E A;  4NTD A;  4NWZ A;  1L9D A;  2Q0K A;  3G5Q A;  2QJM A;  1CHU A;  3H8A A;  4YWO A;  4C5O A;  4YXD A;  1PBE A;  2BC1 A;  4Z2R A;  4HPN A;  4EM3 A;  2R0C A;  2TMD A;  3CPH G;  2RAB A;  3RCY A;  4U2S A;  3UKL A;  2X8H A;  5L46 A;  2C67 A;  1M6I A;  2GGG A;  1TDO A;  2CUL A;  1DXL A;  4NNJ A;  3AD9 B;  1N4U A;  1PDH A;  4FX9 A;  1FIQ B;  2BYB A;  1BZL A;  1MOK A;  2RGH A;  3DME A;  2WS3 A;  2Z5Y A;  3AM9 A;  2R4J A;  3NK2 X;  3NVV B;  5JCL A;  2OZ8 A;  3T8Q A;  2OVL A;  3SBF A;  3VC5 A;  1EBH A;  4TVY A;  1JOA A;  3JZU A;  4J3Z A;  2Z5X A;  1YQZ A;  2WQY A;  3QSE A;  3NHO X;  3DJD A;  2XFP A;  2O56 A;  2GR0 A;  4H83 A;  5CKU A;  2PCE A;  2WES A;  3S5W A;  3CNP A;  4G7F A;  1JRP A;  2GMJ A;  4H2P A;  3A7U A;  2VQ7 A;  2YLX A;  3SN1 A;  3STP A;  4J31 A;  3DK8 A;  3SM8 A;  3A7R A;  3L1R A;  2NQL A;  2QJJ A;  3D1C A;  1IUS A;  1TDN A;  3NXL A;  4Z43 A;  2GRT A;  3SZC A;  3TQP A;  1JCT A;  4CY8 A;  2XH0 A;  3FG2 P;  1OJA A;  1KSU A;  4A5L A;  2PMQ A;  3GWF A;  3IJL A;  4A3R A;  4HN8 A;  3HYV A;  1JPD X;  4PAB A;  4WCT A;  4Z2T A;  3F8P A;  3IC9 A;  1CBO A;  3NN6 X;  4ECH A;  4EIP A;  1GPE A;  1YQ3 A;  1YKJ A;  3QVR A;  3L8K A;  2PGW A;  3I3L A;  1K0L A;  4JY2 A;  1TRB A;  3UTH A;  1D4C A;  1TYP A;  3PK7 A;  3RHA A;  2HNE A;  4B63 A;  4A9W A;  3VDG A;  2OLO A;  1NG3 A;  3PFR A;  1GER A;  1KNR A;  2GSH A;  1FO4 A;  1EC7 A;  3E1T A;  1KNP A;  2C64 A;  4M52 A;  3DDM A;  2FJB A;  2GGE A;  2PP3 A;  2IVD A;  2QDE A;  1ZOY A;  2GR3 A;  1TYT A;  2XH4 A;  4H4T A;  2GVC A;  4YKG A;  1QJD A;  3BI4 A;  1MO9 A;  5U1O A;  3PO7 A;  2JB3 A;  2WOV A;  1GRT A;  4OPC A;  3UKF A;  2YVF A;  3UCC A;  2DKI A;  3H7V A;  4CNJ A;  1ZXI C;  2CVJ A;  4EQX A;  2C76 A;  2P88 A;  1GXF A;  1GOS A;  3FIM B;  2Q0L A;  3TJ4 A;  3UKA A;  1EC8 A;  4U2L A;  3KKJ A;  1NEL A;  1ECQ A;  4GF7 A;  4IZG A;  1DOE A;  1NHR A;  3RGT A;  4B65 A;  1PHH A;  1JNR A;  2AL1 A;  3H70 A;  3SSZ A;  4K5R A;  1FEC A;  5FJT A;  4DXK A;  2GR1 A;  1N63 C;  2YG6 A;  1CL0 A;  4KWS A;  1ZK7 A;  2GGJ A;  2GGH A;  4GDE A;  3SR6 B;  1ZX9 A;  3K7M X;  1FEB A;  3M12 A;  4BJY A;  4DN1 A;  2WOI A;  3UCD A;  5ER0 A;  4OPI A;  2JAE A;  2YR6 A;  3CMM A;  4GRT A;  4C74 A;  2PP0 A;  2RDX A;  3UKH A;  3R10 A;  1STZ A;  3P0W A;  1WUF A;  2E3T A;  2WP6 A;  1RSG A;  4G74 A;  1O95 A;  1GES A;  3HRD C;  2OKT A;  4NZH A;  4K5S A;  3CGD A;  2O9Z A;  1DOD A;  4GR1 A;  3AEC A;  2V3A A;  1F6M A;  3ETR B;  2PTX A;  1X31 B;  1YY5 A;  1SEZ A;  2WEU A;  3GMB A;  1NEK A;  1L0V A;  2HZG A;  1WUE A;  1SB3 B;  3RR1 A;  4EIQ A;  1BWC A;  1GRF A;  4WX1 A;  1SJD A;  4H4U A;  3ATQ A;  4GME A;  2BXR A;  3ENL A;  5M0Z A;  2P0I A;  4AT0 A;  1N4V A;  1E1N A;  3NK1 X;  2OQH A;  3OPS A;  1XPY A;  2YG5 A;  3NVY B;  1TZZ A;  4E6M A;  3NNE A;  4YSY A;  4IL2 A;  2YG4 A;  3NRN A;  4TM3 A;  1SJC A;  1QLB A;  1IUT A;  2EQ7 A;  1LPF A;  4CY6 A;  2EQ6 A;  4I58 A;  3QJ4 A;  3QN3 A;  4Z44 A;  3AEG A;  7ENL A;  3GD6 A;  2OO6 A;  3V3O A;  2PTZ A;  5EBK A;  1YQ4 A;  5U25 A;  2YR5 A;  4HA6 A;  2X99 A;  1H7W A;  1T3Q C;  4GUV A;  1E1K A;  2ZZC A;  1KF6 A;  4BK1 A;  5G5G B;  2QAE A;  2NPX A;  1CC2 A;  5M10 A;  4E0V A;  1YEY A;  1XAN A;  3HYX A;  1GEU A;  2BAB A;  2PS2 A;  3R11 A;  2VVL A;  3NGC X;  3DH9 A;  1RYI A;  4IP4 A;  5EOW A;  3UGV A;  4IV9 A;  3BNM A;  3DES A;  4CRT A;  3QPE A;  3TW9 A;  3UJ2 A;  4Z26 A;  4H2R A;  4TM0 A;  4AP1 A;  4EQS A;  2C7G A;  1GRG A;  1DTN A;  3IJI A;  1FHU A;  4YT0 A;  3I6T A;  3GRS A;  4K1W A;  4A99 A;  2CFY A;  3A7A A;  3ALM A;  2X8C A;  4XWZ A;  4Y4N A;  2OLA A;  4YSX A;  4U8L A;  3AN1 A;  3GSI A;  3OZ2 A;  2R0P A;  2PP1 A;  3M0O A;  3AE4 A;  3B3R A;  1D4D A;  2OLN A;  2VVL G;  4B1B A;  1IUW A;  3Q9T A;  3AD7 B;  3QFB A;  3AYJ A;  4G73 A;  1JRO A;  5HXI A;  3RP8 A;  3GD4 A;  3NG7 X;  4YTM A;  2B9W A;  1R0M A;  4NTE A;  3AYL A;  1XDI A;  1E1L A;  1PDZ A;  2EQ9 A;  2YWL A;  1NHQ A;  2XFN A;  3G5R A;  5LV9 A;  2WDQ A;  1LQT A;  3II4 A;  3ZYX A;  1K0J A;  2E1M A;  4ZCC A;  5JCM A;  1MRA A;  1JRY A;  3R1Z A;  1CJC A;  4YTP A;  2BK4 A;  3CGC A;  2QA2 A;  4H1Z A;  2C70 A;  3V5F A;  3TCS A;  3PS9 A;  5KMR A;  3QSM A;  3RNM A;  3SY4 A;  1NAA A;  5FJO A;  4H2Q A;  3G5S A;  4Z1Y A;  1FHV A;  3N6H A;  3N6J A;  1N5X A;  3P93 A;  1FOH A;  2XVJ A;  2VRL A;  3FCP A;  5BUL A;  3CIR A;  4RSL A;  4JY3 A;  3SFD A;  4PAA A;  5C2T A;  1XPQ A;  2R0G A;  1W4X A;  2UZZ A;  3O0H A;  4ZCW A;  3UOX A;  1D4E A;  6ENL A;  2APG A;  3P4R A;  4JHM A;  4FDC B;  4XWR A;  5U63 A;  1CC4 A;  2I5Q A;  1VDV A;  2XVF A;  4ZN0 A;  2GQF A;  2BS2 A;  3V3N A;  3T37 A;  4GYP C;  2XLT A;  3ZVH A;  3PVC A;  1P2H A;  1GV4 A;  3NS1 B;  4G9K A;  4U8P A;  4D04 A;  4EM4 A;  1COY A;  4LA1 A;  1MNS A;  1VQW A;  4EMI A;  3BI2 A;  3SXI A;  3ZLG A;  3B97 A;  3GC2 A;  2DW7 A;  5KXJ A;  4Z25 A;  4XXG A;  1E39 A;  3AEF A;  3NFU A;  4H4Z A;  1GTE A;  5J04 A;  4YSZ A;  1FCD A;  3LZW A;  1PXB A;  3NKS A;  3AE1 A;  3UOV A;  4GAP A;  3DFH A;  1H2I A;  4HCH A;  2X50 A;  3ICT A;  3AEE A;  3IHM A;  3SFE A;  4CCR A;  3AE6 A;  4A6G A;  3VRB A;  2FJA A;  1KKR A;  3CXB A;  5KMQ A;  3FXG A;  3BOX A;  1H86 A;  2BCG G;  3AEB A;  4JNQ A;  4IL0 A;  5HHF A;  5TR3 A;  4OPU A;  3KU9 A;  3EAO A;  2V3B A;  2R9Z A;  3KD9 A;  3QVP A;  4GCM A;  4UDQ A;  4IVO B;  3SZ0 A;  1K0I A;  3UP5 A;  3DG6 A;  4B66 A;  4K2S A;  5HY5 A;  2C66 A;  2C3D A;  2E5A A;  4J56 A;  1EL5 A;  4UDR A;  1VRQ B;  3CND A;  2VZ2 A;  1B8S A;  3UKQ A;  3KLJ A;  1KKO A;  5KOW A;  4G6G A;  2OQY A;  4II3 A;  3DJG X;  2ZC8 A;  5JRB A;  2YVG A;  4GFI A;  5KVH A;  2P8B A;  3NO1 A;  3SGL A;  4KT2 A;  4NEV A;  4C3X A;  3NLC A;  3KVE A;  3FVD A;  3MWC A;  1F8R A;  4JN9 A;  4RG4 A;  3CPI G;  2GF3 A;  3DEQ A;  3K30 A;  1E7P A;  4J34 A;  4BJZ A;  4A65 A;  4E8G A;  1KDG A;  3IHG A;  5FS7 A;  1JRZ A;  1JU2 A;  3AD8 B;  4AOX A;  4UDP A;  1ZP0 A;  3F8R A;  2B76 A;  3AE2 A;  3DGZ A;  5BOF A;  3DGH A;  3CNT A;  4UP3 A;  5GRT A;  1CF3 A;  3GY1 A;  4AP3 A;  1MDR A;  3RP7 A;  1GRA A;  4JQ9 A;  2QQ6 A;  1Q1R A;  3JW7 A;  2P3Z A;  3KUM A;  2YM1 A;  1ZKQ A;  1TDF A;  5JCI A;  4N9X A;  2IID A;  1BQG A;  3RO6 A;  2FBW A;  3OW1 A;  1H81 A;  2ACZ A;  2XCG A;  1PBB A;  4II2 A;  3NK0 X;  1NHP A;  5EU9 A;  2OG9 A;  4BV6 A;  1DOB A;  4TLX A;  2JKC A;  4HCD A;  2V60 A;  4H50 A;  1NPX A;  2RGO A;  2XGZ A;  3VR9 A;  2YLZ A;  1ZDL A;  1S3E A;  1VQZ A;  2GB0 A;  1QO8 A;  1CJ4 A;  3I4K A;  3GWD A;  2YLR A;  3AMZ A;  2GEW A;  3ZVH B;  5IQ1 A;  4A6N B;  2YLT A;  4TM4 A;  4H7U A;  5C3J A;  1H7X A;  3D47 A;  1EBD A;  3V76 A;  4X2P A;  2XLR A;  4JN8 A;  4ZOH B;  3BJS A;  2A8X A;  3QSS A;  3AWI A;  2XH2 A;  1NG4 A;  2AL2 A;  1AOG A;  2J3N A;  1LTX R;  5BUK A;  1Y0P A;  4OCG A;  1PJ6 A;  1TDK A;  3DK9 A;  1NEN A;  1OJD A;  2XSX A;  4CNK A;  2A89 A;  1H83 A;  2Q7V A;  4OPG A;  3VFC A;  1S2Q A;  3R0U A;  2XDO A;  4E4U A;  3UKP A;  1DOC A;  3AXB A;  3NN0 X;  2IVE A;  4H4S A;  2QCU A;  3UKK A;  1IUV A;  2PPG A;  2Y6R A;  2OAM A;  3ISH A;  3ALJ A;  3TTE A;  5KVI A;  3UP4 A;  2YLS A;  4H4W A;  3T2Z A;  1E9I A;  2JB1 A;  1LJ1 A;  4U8N A;  1D7Y A;  4CBQ A;  2NVK X;  2BS4 A;  3AB1 A;  3CTY A;  2YVJ A;  2OFJ A;  4JNA A;  1GRB A;  2WU5 A;  5BVA A;  2XFO A;  3DGB A;  3MY9 A;  1L9E A;  4A35 A;  3UOZ A;  4ADW A;  3QLD A;  4H19 A;  2BRY A;  2PSN A;  2JB2 A;  3EPT A;  2W3R A;  1SJB A;  2V61 A;  3AE9 A;  1JEH A;  2V5Z A;  2XLU A;  1H82 A;  1SJA A;  3UCL A;  1V97 A;  3CYJ A;  4U8I A;  3P4Q A;  1GET A;  1BF3 A;  3IK4 A;  2OX4 A;  2PTW A;  4ENL A;  1BGJ A;  2R46 A;  3PG6 A;  4YTN A;  3NYE A;  2FKP A;  1Q1W A;  3R25 A;  4YKF A;  4GGB A;  4G8T A;  4U8M A;  2F5Z A;  5G5H B;  3AE5 A;  2DKH A;  2OAL A;  1NHS A;  3RIT A;  2PTY A;  3IJQ A;  4KX6 A;  1RM6 B;  1GRE A;  2BK5 A;  1H84 A;  3EAN A;  3QKE A;  3SX6 A;  4C77 A;  2VVM A;  4H4R A;  2AAQ A;  1F9C A;  1ZY8 A;  3DK4 A;  2WBA A;  3QTP A;  4C3Y A;  5FMH A;  4B67 A;  3F8D A;  3IWA A;  3VC6 A;  3N4F A;  4M6U A;  2GGI A;  3UTG A;  4K2X A;  2VRM A;  3BI5 A;  1Y56 A;  3NYF A;  2MUC A;  2AR8 A;  4E5T A;  3UJR A;  4USR A;  3TWA A;  1PBF A;  4GDP A;  4DHG A;  2FJD A;  3BNU A;  1S3B A;  1TE6 A;  1GTH A;  2WU2 A;  2GR2 A;  2AQJ A;  3LXD A;  3T0K A;  2QA1 A;  1Q9I A;  1KN0 A;  4HCL A;  1WYG A;  4MGG A;  4YWS A;  1K4Q A;  4GYP A;  3CB3 A;  3Q45 A;  4AT2 A;  4GGH A;  3SQP A;  2POZ A;  3UJS A;  4H2N A;  1DJN A;  5FS8 A;  3NVW B;  3V5C A;  2JK6 A;  4J2W A;  3ICR A;  1EL7 A;  1N5W C;  2ONE A;  3RED A;  1IUX A;  1MUC A;  3KPK A;  3UTF A;  3UTE A;  3V3W A;  3KA7 A;  3ITJ A;  1BKW A;  4U8J A;  3JVA A;  4DGK A;  3ES8 A;  3JSK A;  3DA1 A;  3UJE A;  1P2E A;  3M13 A;  1B5Q A;  2VQB A;  2BK3 A;  1PJ7 A;  4OPL A;  1KFY A;  3EEZ A;  1E6E A;  2GAG B;  2W55 A;  4YSH A;  3I6D A;  1OJT A;  1OEP A;  4NTC A;  4A6N A;  5CQF A;  2BAC A;  4J33 A;  1NDA A;  3NVZ B;  1OJC A;  1TKK A;  3DG3 A;  1PN0 A;  4EMW A;  1O5W A;  2OA1 A;  3P9U A;  3SYI A;  4BK2 A;  4OPT A;  4DNA A;  3DER A;  2BS3 A;  2QJN A;  3EF6 A;  1GND A;  3S61 A;  3K1G A;  5FJP A;  4IP5 A;  3UJF A;  1B37 A;  4U2T A;  2AKZ A;  3H4K A;  3TJI A;  1EBG A;  2V6O A;  4H4X A;  4Y4M A;  4HB9 A;  4J1O A;  2OZT A;  3GO2 A;  1ELI A;  5KWF A;  3L5O A;  3PWI A;  4ROP A;  4M0X A;  2AKM A;  2GDQ A;  3CAW A;  4E4F A;  1F8S A;  3GMC A;  5JCK A;  3MUC A;  1LVL A;  3VCN A;  1L8P A;  4ZA0 A;  2R4E A;  4IT1 A;  2OPJ A;  4O5Q A;  2CDU A;  4GIS A;  4JDR A;  5FJR A;  2H88 A;  1MXT A;  3C4N A;  3FJ4 A;  3PWG A;  2HXT A;  3BSM A;  1X2H A;  1LV0 A;  2I0Z A;  2GH5 A;  5KOX A;  2PGE A;  3CNS A;  1H6V A;  2EQ8 A;  4OPD A;  2TPR A;  3CXO A;  5GSN A;  3AE3 A;  2WHD A;  1KD0 A;  2BRA A;  2PYX A;  3DJE A;  3NTA A;  4JN7 A;  3GYI A;  3D9X A;  4F4R A;  3GDN A;  2QVH A;  4EMJ A;  3AE8 A;  2QGY A;  2FJE A;  2XVH A;  1PXA A;  3UXK A;  4P9S A;  4A7A A;  1R6W A;  2BXS A;  3LAD A;  1GSN A;  1N60 C;  3CN8 A;  4X4J A;  4DSG A;  5BRT A;  3FMW A;  5HYM A;  3R0K A;  3U4F A;  2C73 A;  2WPE A;  3DIP A;  2E4G A;  4Z24 A;  4IA6 A;  2C4C A;  1D7L A;  2XFU A;  3H12 A;  3NT6 A;  2YLW A;  2HQM A;  1FFV C;  3MZN A;  4K8D A;  3T4W A;  1HYU A;  1PXC A;  2ZZB A;  1IJH A;  3P3B A;  3NYC A;  3TOY A;  2Q6U A;  3LZX A;  3OZY A;  5FS9 A;  3VQR A;  1CJ2 A;  2WDR A;  3R07 C;  4IVM B;  1PBD A;  3IF9 A;  2JBV A;  3T31 A;  2ARD A;  2PU0 A;  1PJ5 A;  4X9M A;  3VR8 A;  1ELS A;  2C3C A;  1ZOV A;  3R9U A;  1P43 A;  2WDV A;  1ONF A;  4EWJ A;  4K22 A;  3FPZ A;  2XH7 A;  3NIX A;  3SZW A;  4ZCD A;  4FK1 A;  2C72 A;  2BCP A;  3ZLF A;  1FL2 A;  2E5V A;  2YG3 A;  4K7Z A;  4OVI A;  5EB5 A;  4KPR A;  5FJU A;  2ZBW A;  3B6D A;  2YAU A;  1O94 A;  2HXU A;  1CC6 A;  1MDL A;  2WET A;  1UKV G;  4H4Y A;  3ABV A;  3CPJ G;  4FI4 A;  3AED A;  3QFA A;  3URH A;  1LQU A;  4H4Q A;  3ZDN A; 
#chains in the Genus database with same CATH homology
 2XYO A;  1N1P A;  4YTN A;  3NYE A;  2A87 A;  3D1C A;  1Q1W A;  1IUS A;  4YKF A;  3GDP A;  1TDN A;  4Z43 A;  2GRT A;  3SZC A;  2XLS A;  1FOH A;  4U8M A;  2F5Z A;  3AE5 A;  2DKH A;  2OAL A;  2GMH A;  4BK3 A;  1EL9 A;  2XVJ A;  1VG0 A;  4CY8 A;  5KNL A;  5J60 A;  1NHS A;  3FG2 P;  2VRL A;  1OJA A;  1KSU A;  4A5L A;  5BUL A;  3GWF A;  4KX6 A;  3CIR A;  2YG7 A;  1Y56 B;  4RSL A;  1FEA A;  4JY3 A;  3SFD A;  4PAA A;  5C2T A;  1XPQ A;  2R0G A;  1GRE A;  1W4X A;  2BK5 A;  1H84 A;  2UZZ A;  3HYV A;  3O0H A;  3EAN A;  4IA5 A;  3SX6 A;  4PAB A;  4WCT A;  4C77 A;  2VVM A;  4H4R A;  1D4E A;  2AAQ A;  3Q6J A;  3F8P A;  3UOX A;  4Z2T A;  3IC9 A;  2APG A;  1CBO A;  3NN6 X;  3P4R A;  4GAV A;  4ECH A;  4FDC B;  1N4W A;  2XFQ A;  4XWR A;  5U63 A;  4EIP A;  3CGE A;  1ZY8 A;  1CC4 A;  1CJ3 A;  3DK4 A;  1GPE A;  2GAH B;  1YQ3 A;  2WBA A;  1YKJ A;  3P4S A;  3QVR A;  1JNZ A;  3L8K A;  3I3L A;  4C3Y A;  1K0L A;  5FMH A;  5IQ4 A;  3K7Q X;  2XVF A;  3F8D A;  2GQF A;  4JY2 A;  4B67 A;  2BS2 A;  3V3N A;  4ZN0 A;  1TRB A;  3T37 A;  1D4C A;  3UTH A;  1TYP A;  2XLT A;  3PVC A;  1P2H A;  4USQ A;  4CCQ A;  4H4P A;  1GV4 A;  3IWA A;  3K7T A;  3RHA A;  3RP6 A;  3UTG A;  4G9K A;  4B63 A;  4K2X A;  4A9W A;  4U8P A;  2VRM A;  3BI5 A;  4D04 A;  4EM4 A;  1COY A;  1Y56 A;  4LA1 A;  1NG3 A;  1VQW A;  4EQR A;  2OLO A;  3NYF A;  4U8O A;  2PHH A;  5EB4 A;  2X8G A;  4EMI A;  2AR8 A;  3BI2 A;  2BC0 A;  4REK A;  3SXI A;  1GER A;  1KNR A;  4USR A;  3VRD B;  5KXJ A;  1PBF A;  4Z25 A;  4GDP A;  5FS6 A;  3E1T A;  2GV8 A;  1KNP A;  2C64 A;  4M52 A;  4XXG A;  2FJD A;  3BNU A;  1E39 A;  2C65 A;  3C4A A;  3AEF A;  1S3B A;  4H4Z A;  2FJB A;  1GTH A;  4LII A;  2WU2 A;  1TDE A;  1GTE A;  2IVD A;  4YSZ A;  5J7X A;  1IUU A;  1ZOY A;  3FBS A;  3DJJ A;  2GR2 A;  1FCD A;  2AQJ A;  3LZW A;  2GR3 A;  1TYT A;  1F3P A;  4H4T A;  1PXB A;  2B9Y A;  2GVC A;  3NKS A;  3LXD A;  3T0K A;  3AE1 A;  4YKG A;  1QJD A;  2X3N A;  3BI4 A;  3P1W A;  4BUR A;  1GAL A;  3UOV A;  1MO9 A;  2QA1 A;  4GAP A;  3VRA A;  2BA9 A;  1Q9I A;  5U1O A;  3PO7 A;  1H2I A;  2JB3 A;  2X50 A;  3ICT A;  2WOV A;  1KN0 A;  1GRT A;  4OPC A;  4MJW A;  2YVF A;  3UKF A;  3AEE A;  2DKI A;  1DJQ A;  3IHM A;  3SFE A;  4CNJ A;  4CCR A;  2CVJ A;  4EQX A;  2ZZ0 A;  2B7R A;  2RGJ A;  3AE6 A;  3VRB A;  2FJA A;  1K4Q A;  2C76 A;  5KMQ A;  1H86 A;  4AT2 A;  2BCG G;  3SQP A;  3WE0 A;  3AEB A;  1GXF A;  4JNQ A;  4A79 A;  1GOS A;  3FIM B;  4H2N A;  5HHF A;  1L9C A;  1Z6L A;  3GRT A;  2Q0L A;  1DJN A;  5TR3 A;  4X9N A;  5FS8 A;  4OPU A;  2YM2 A;  3KU9 A;  4U2L A;  3UKA A;  3KKJ A;  4NEW A;  2JK6 A;  3EAO A;  4J2W A;  3ICR A;  2V3B A;  2R9Z A;  1EL7 A;  4J36 A;  4GF7 A;  3KD9 A;  1DOE A;  1NHR A;  3RED A;  1IUX A;  3QVP A;  4B65 A;  4GCM A;  1PHH A;  2H89 A;  4UDQ A;  3KPK A;  3LJP A;  3UTF A;  4IVO B;  3SZ0 A;  1JNR A;  1K0I A;  3UP5 A;  1M64 A;  4B66 A;  3BHF A;  3UTE A;  3KA7 A;  4AOS A;  3ITJ A;  5HY5 A;  4K5R A;  4H4V A;  1BKW A;  1FEC A;  4B68 A;  4U8J A;  2GR1 A;  2C66 A;  2YG6 A;  1ZMC A;  3CGB A;  1CL0 A;  4DGK A;  3D8X A;  2C3D A;  3JSK A;  4J56 A;  3DA1 A;  1EL5 A;  1P2E A;  4UDR A;  3M13 A;  5KMP A;  1PS9 A;  1B5Q A;  1VRQ B;  2VQB A;  2BK3 A;  1PJ7 A;  1EL8 A;  1ZK7 A;  3CND A;  4GDE A;  2VZ2 A;  1KFY A;  1B8S A;  1D5T A;  4OPL A;  3UKQ A;  1E6E A;  1ZX9 A;  1V59 A;  2GAG B;  3K7M X;  1FEB A;  2B9X A;  3M12 A;  2WOI A;  4BJY A;  3KLJ A;  5ER0 A;  4OPI A;  4YSH A;  5KOW A;  2JAE A;  3I6D A;  4G6G A;  3T2Y A;  1OJT A;  1BGN A;  1B4V A;  2YR6 A;  3CMM A;  4NTC A;  4II3 A;  2WP9 A;  4GRT A;  4C74 A;  3DJG X;  4A6N A;  5CQF A;  5JRB A;  2YVG A;  2BAC A;  5KVH A;  1GT8 A;  4J33 A;  5DBJ A;  1NDA A;  1OJC A;  3UKH A;  3SGL A;  1PN0 A;  4NEV A;  4C3X A;  1REO A;  3NLC A;  2WP5 A;  3KVE A;  3NH3 X;  4EMW A;  3OC4 A;  1O5W A;  2OA1 A;  4TLZ A;  1F8R A;  4JN9 A;  4RG4 A;  3CPI G;  2GF3 A;  3T2K A;  2WP6 A;  1RSG A;  4G74 A;  1O95 A;  1GES A;  3P9U A;  3SYI A;  3K30 A;  4NZH A;  1KSS A;  4BK2 A;  4K5S A;  4OPT A;  4DNA A;  3H8L A;  4TM1 A;  3NTD A;  1ZMD A;  3CGD A;  4FK1 C;  2O9Z A;  1DOD A;  4GR1 A;  1E7P A;  4J34 A;  2BS3 A;  3UOY A;  4BJZ A;  3AEC A;  4G6H A;  4A65 A;  3EF6 A;  4D03 A;  1S7M A;  3LOV A;  3T14 A;  2V3A A;  1KDG A;  3C96 A;  4RG3 A;  1GND A;  1F6M A;  3IHG A;  2R45 A;  1X31 B;  1YY5 A;  3S61 A;  5FS7 A;  1JRZ A;  1JU2 A;  1SEZ A;  2WEU A;  3AD8 B;  3AEA A;  3GMB A;  1NEK A;  1L0V A;  4UDP A;  4AOX A;  1B37 A;  1ZP0 A;  3F8R A;  4U2T A;  3H4K A;  2VOU A;  1E1M A;  4EIQ A;  2B76 A;  1BWC A;  1GRF A;  2V6O A;  2B7S A;  4H4X A;  4WX1 A;  4Y4M A;  4H4U A;  3ATQ A;  4HB9 A;  2Y6Q A;  3DGZ A;  3AE2 A;  2W0H A;  3DGH A;  3CNT A;  4B64 A;  4B69 A;  2BXR A;  4UP3 A;  5GRT A;  5M0Z A;  1CF3 A;  4AT0 A;  1N4V A;  1E1N A;  3NK1 X;  4AP3 A;  4Z2U A;  3RP7 A;  1GRA A;  2YG5 A;  4JQ9 A;  2XLP A;  3NNE A;  1Q1R A;  1VDC A;  4YSY A;  1ELI A;  5KWF A;  3AYI A;  2YG4 A;  2YM1 A;  3ICS A;  3NRN A;  2WPF A;  3L5O A;  4TM3 A;  3AE7 A;  1ZKQ A;  1TDF A;  4ICY A;  5JCI A;  4N9X A;  1QLB A;  2IID A;  1IUT A;  2EQ7 A;  2FBW A;  1LPF A;  1H81 A;  4CY6 A;  2ACZ A;  2XCG A;  3SZF A;  2EQ6 A;  4I58 A;  3HZL A;  3QJ4 A;  1PBB A;  4Z44 A;  3AEG A;  2WOW A;  1RP0 A;  3BHK A;  3H8I A;  4Y4L A;  3V3O A;  4II2 A;  1F8S A;  3NK0 X;  2YR4 A;  1NHP A;  3GMC A;  3KPF A;  5JCK A;  4O5U A;  1LVL A;  5EBK A;  2XVE A;  1YQ4 A;  2R4E A;  4BV6 A;  5JCN A;  1XHC A;  1DOB A;  4TLX A;  5U25 A;  4APN A;  2JKC A;  2YR5 A;  2V60 A;  4HA6 A;  4O5Q A;  2CDU A;  4H50 A;  4JDR A;  1NPX A;  1GRH A;  2X99 A;  2RGO A;  3VR9 A;  2YLZ A;  1ZDL A;  1H7W A;  2H88 A;  3ADA B;  1MXT A;  4GUV A;  1E1K A;  4LU6 A;  4U8K A;  2ZZC A;  1KF6 A;  3P4P A;  4BK1 A;  3C4N A;  1F8W A;  2QAE A;  2NPX A;  1CC2 A;  1PBC A;  5KRQ A;  1S3E A;  2XVI A;  2GB0 A;  1LV0 A;  4J57 A;  2I0Z A;  3HYW A;  1QO8 A;  5M10 A;  2GH5 A;  5KOX A;  1CJ4 A;  4E0V A;  1XAN A;  3HYX A;  3GYX A;  3GWD A;  1GEU A;  1H6V A;  2EQ8 A;  2BAB A;  2YLR A;  3CNS A;  2TPR A;  2GEW A;  4OPD A;  5GSN A;  3AE3 A;  5IQ1 A;  2WHD A;  4A6N B;  2YLT A;  5KMS A;  2VVL A;  2BRA A;  3DH9 A;  1RYI A;  2PYX A;  3NGC X;  4TM4 A;  5IPY A;  4H7U A;  5C3J A;  3DJE A;  5EOW A;  1H7X A;  3NTA A;  4IV9 A;  3GYI A;  3D9X A;  3BNM A;  3GDN A;  1VG9 A;  1S2Y A;  1EBD A;  3LB8 A;  4EMJ A;  3AE8 A;  3V76 A;  3ALL A;  4CRT A;  2YQU A;  2XLR A;  2FJE A;  2XVH A;  4I59 A;  2GQW A;  4Z26 A;  1PXA A;  4H2R A;  1JRX A;  2A8X A;  4TM0 A;  4AP1 A;  4P9S A;  4A7A A;  4EQS A;  1DNC A;  3QSS A;  3AWI A;  2BXS A;  2C7G A;  1GRG A;  3LAD A;  3ATR A;  4DSH A;  1NG4 A;  1AOG A;  1GSN A;  2J3N A;  1LTX R;  5BUK A;  1Y0P A;  3CN8 A;  4OCG A;  4X4J A;  4DSG A;  5BRT A;  4EQW A;  1OJ9 A;  4YT0 A;  1PJ6 A;  3GRS A;  4A99 A;  1TDK A;  2CFY A;  3DK9 A;  3FMW A;  5HYM A;  2C73 A;  3GYJ A;  3COX A;  2WPE A;  3GD3 A;  1NEN A;  3ALM A;  2E4G A;  2X8C A;  1OJD A;  4XWZ A;  4Z24 A;  4IA6 A;  4Y4N A;  2C4C A;  2C75 A;  2A89 A;  3CNJ A;  2WPC A;  1H83 A;  4CNK A;  4YSX A;  4U8L A;  2Q7V A;  4OPG A;  4NTD A;  1S2Q A;  4NWZ A;  1L9D A;  2Q0K A;  1D7L A;  3G5Q A;  2XFU A;  2XDO A;  3NT6 A;  2YLW A;  2HQM A;  4K8D A;  3GSI A;  3OZ2 A;  2R0P A;  1CHU A;  4YWO A;  4C5O A;  3UKP A;  4YXD A;  1PBE A;  2BC1 A;  1DOC A;  3M0O A;  1HYU A;  1PXC A;  4Z2R A;  2ZZB A;  3AE4 A;  4EM3 A;  1IJH A;  2R0C A;  2TMD A;  2RAB A;  3AXB A;  1D4D A;  3B3R A;  2IVE A;  3CPH G;  3NN0 X;  2OLN A;  2VVL G;  4B1B A;  1IUW A;  4U2S A;  3UKL A;  2X8H A;  5L46 A;  3Q9T A;  3AD7 B;  3NYC A;  3QFB A;  2Q6U A;  4H4S A;  3AYJ A;  2QCU A;  2C67 A;  3LZX A;  4G73 A;  1M6I A;  3UKK A;  1IUV A;  5FS9 A;  1CJ2 A;  1DXL A;  1TDO A;  2CUL A;  3VQR A;  2WDR A;  2Y6R A;  2OAM A;  4NNJ A;  3AD9 B;  4IVM B;  3ISH A;  1PBD A;  1N4U A;  3IF9 A;  5HXI A;  3RP8 A;  2JBV A;  3T31 A;  2ARD A;  3ALJ A;  5KVI A;  3UP4 A;  3GD4 A;  1PDH A;  2YLS A;  1PJ5 A;  4X9M A;  4H4W A;  3T2Z A;  4FX9 A;  3VR8 A;  3NG7 X;  2BYB A;  1BZL A;  1MOK A;  2C3C A;  2RGH A;  1ZOV A;  3DME A;  3R9U A;  2JB1 A;  1LJ1 A;  2WS3 A;  4U8N A;  2WDV A;  1D7Y A;  2Z5Y A;  1ONF A;  4YTM A;  4CBQ A;  4K22 A;  2B9W A;  2R4J A;  3NK2 X;  2NVK X;  2BS4 A;  3FPZ A;  5JCL A;  3NIX A;  3AB1 A;  3SZW A;  3CTY A;  2YVJ A;  4NTE A;  4JNA A;  3AYL A;  1GRB A;  1XDI A;  2WU5 A;  5BVA A;  1E1L A;  2XFO A;  4ZCD A;  4FK1 A;  2EQ9 A;  1L9E A;  2C72 A;  2BCP A;  2YWL A;  2Z5X A;  1JOA A;  4ADW A;  3UOZ A;  1FL2 A;  1NHQ A;  2XFN A;  3G5R A;  1YQZ A;  2WQY A;  3QSE A;  5LV9 A;  2E5V A;  2WDQ A;  3NHO X;  1LQT A;  2YG3 A;  3II4 A;  4K7Z A;  2BRY A;  4KPR A;  2XFP A;  2JB2 A;  3DJD A;  2ZBW A;  3EPT A;  4OVI A;  1K0J A;  3ZYX A;  2GR0 A;  2E1M A;  3B6D A;  4ZCC A;  5JCM A;  2YAU A;  2V61 A;  5CKU A;  3AE9 A;  1JEH A;  1O94 A;  2V5Z A;  2WES A;  1JRY A;  3S5W A;  5EB5 A;  2XLU A;  1CJC A;  1H82 A;  3CNP A;  1CC6 A;  2BK4 A;  3CGC A;  2QA2 A;  2GMJ A;  4YTP A;  2C70 A;  3UCL A;  2WET A;  1UKV G;  4H2P A;  4H4Y A;  3ABV A;  3CPJ G;  4U8I A;  2VQ7 A;  3PS9 A;  3AED A;  3QFA A;  3URH A;  1GET A;  3RNM A;  1BF3 A;  3P4Q A;  3QSM A;  3SY4 A;  5KMR A;  1NAA A;  2YLX A;  4H2Q A;  1LQU A;  3G5S A;  4H4Q A;  4J31 A;  3ZDN A;  3DK8 A;  3SM8 A;  1BGJ A;  2R46 A;  3PG6 A;  3L1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...