3URHA

Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
461
structure length
461
Chain Sequence
YDLIVIGSGPGGYVCAIKAAQLGMKVAVVEKRSTYGGTCLNVGCIPSKALLHASEMFHQAQHGLEALGVEVANPKLNLQKMMAHKDATVKSNVDGVSFLFKKNKIDGFQGTGKVLGQGKVSVTNEKGEEQVLEAKNVVIATGSDVAGIPGVEVAFDEKTIVSSTGALALEKVPASMIVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVAKQLQRMLTKQGIDFKLGAKVTGAVKSGDGAKVTFEPVKGGEATTLDAEVVLIATGRKPSTDGLGLAKAGVVLDSRGRVEIDRHFQTSIAGVYAIGDVVRGPMLAHKAEDEGVAVAEIIAGQAGHVNYDVIPGVVYTQPEVASVGKTEEELKAAGVAYKIGKFPFTANGRARAMLQTDGFVKILADKETDRVLGGHIIGFGAGEMIHEIAVLMEFGGSSEDLGRTCHAHPTMSEAVKEAALSTFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyl dehydrogenase
publication title Crystal structure of a dihydrolipoamide dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 133
structure length 461
sequence length 461
chains with identical sequence B
ec nomenclature ec 1.8.1.4: Dihydrolipoyl dehydrogenase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 3urhA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3urhA02
2OLNA 4XWZA 3UKFA 3GRSA 4LIIA 3HZLA 3GD3A 1TYTA 1D5TA 2ACZA 2XFNA 4JY2A 4D03A 4BK3A 1JU2A 3AYJA 2WP9A 4H7UA 3RP7A 1CHUA 1F8RA 1TDFA 4OPIA 4REKA 3NKSA 3T37A 1BZLA 2QA1A 2Y6RA 3ICSA 4GCMA 4H4SA 1Q1WA 4I58A 5JCLA 3O0HA 3UP4A 3EF6A 1EL9A 1REOA 2GQFA 2VRMA 2GAHB 3P4RA 3P1WA 2V61A 4EQSA 1B8SA 2C67A 1W4XA 4Z24A 1Y56A 5CQFA 4JN9A 2V5ZA 4OPLA 4K22A 1ZOYA 4AP3A 3SQPA 1OJDA 3ALLA 3D1CA 4O5UA 3UCLA 1ZMCA 1MXTA 2A87A 1OJ9A 4X9MA 5KOWA 3DH9A 1FOHA 4K8DA 3EAOA 1RP0A 3KPFA 4GDEA 2XLUA 3I3LA 1DJQA 1S2QA 1ZY8A 4H4TA 3AE4A 4H2QA 3AE2A 4OVIA 4U8LA 4GUVA 1B5QA 2CULA 1PBDA 2BK4A 1GRTA 2YQUA 5M10A 1LQUA 2BACA 3UKLA 1KNRA 1CF3A 3GWFA 3AEDA 3SM8A 1H7WA 4H4RA 3AEFA 3C4AA 4HA6A 1FCDA 4AOXA 2JB3A 3FBSA 1OJCA 4EQRA 2XLPA 3NT6A 2AR8A 4K2XA 3LJPA 5U1OA 3UKHA 4JQ9A 2NVKX 2FJDA 3CNPA 4RG3A 3NIXA 1PJ6A 3DK4A 3QSSA 4CNKA 2Z5XA 1GTEA 3LB8A 3KKJA 4HB9A 3Q6JA 4K5RA 4A5LA 3K30A 2WOIA 2B7SA 2QA2A 1TDKA 5BVAA 4U2LA 3AEBA 3AD7B 1O95A 3UP5A 3AE9A 2GB0A 1NDAA 2X8HA 3FMWA 3P4QA 4PABA 2V60A 4BK1A 1F8WA 3K7TA 1P2HA 3CNSA 1PBCA 3B3RA 1YY5A 2YLSA 2PYXA 3C4NA 3CPIG 3OC4A 1QO8A 5JCKA 1MOKA 5EB5A 1GEUA 4OCGA 4J57A 1L9DA 3CGBA 2RGHA 1H6VA 3KVEA 4BJZA 1D7YA 4BV6A 4C3YA 4J56A 2ZZBA 3F8RA 1B4VA 1GERA 2R45A 2GEWA 1JNZA 3UKPA 2JAEA 3UOXA 1P2EA 4A6NA 3QVPA 1DOCA 3GMBA 3P4SA 4TM1A 5BULA 1E1KA 2J3NA 1TDOA 2YLXA 2WPCA 3V76A 2H89A 4YSYA 2WU5A 2X50A 1VG0A 3CPHG 5JCMA 4DGKA 1NHRA 1ZDLA 3BI2A 3AXBA 4NTEA 3UKQA 4M52A 4ECHA 1JOAA 1NG4A 2JB2A 2RGOA 2Q7VA 2WOWA 2BXSA 3EANA 4B1BA 3BI4A 2A89A 1EL7A 2CDUA 1E6EA 5FS7A 5IQ1A 4U8IA 5KOXA 4EM4A 1S3EA 1PDHA 2BCPA 2C66A 1DOEA 1FEAA 2X3NA 2R46A 5U63A 4B64A 4UDPA 5KRQA 1CJ3A 1N1PA 3EPTA 1H83A 5FS9A 1K0LA 2XFPA 4Z2UA 4H50A 1IUTA 1KSSA 2WS3A 3UTHA 4C74A 5GSNA 4NEVA 4APNA 1XPQA 4X4JA 4XXGA 2Q6UA 4U8MA 2WU2A 2XCGA 2BA9A 2XFOA 4H2NA 1QJDA 2EQ9A 1EBDA 2IVDA 2EQ7A 4U8PA 3UKAA 5C3JA 1X31B 2YR6A 1GSNA 3GDPA 4YSXA 4CRTA 1CC4A 1KDGA 1S3BA 2XFUA 4U2TA 3QSMA 2JB1A 2YR5A 2XLTA 1K0JA 3IHMA 3QJ4A 1LTXR 2VVLA 1Z6LA 3GWDA 4H4ZA 2BABA 3V3NA 1ELIA 3AB1A 4EM3A 2OAMA 1LVLA 4Y4MA 2C64A 4NTDA 3R9UA 3VRAA 1TRBA 2ZBWA 1OJTA 2B9YA 3DJEA 3AECA 4K5SA 1TDEA 4C3XA 2C65A 4FK1A 5CKUA 3LADA 2Q0LA 4J33A 4H4XA 3ZDNA 2XLSA 2WBAA 4IA6A 4BJYA 3KU9A 1YQZA 3P4PA 2I0ZA 3NRNA 3GDNA 2XDOA 2YM2A 3G5QA 2YG4A 2YVJA 2WDVA 3H8LA 5TR3A 4USRA 1YQ4A 3CIRA 2JKCA 4Z25A 2YVFA 1E39A 2X99A 3UTFA 3AE5A 3AE3A 4OPCA 1NHPA 1EL8A 2EQ8A 3FPZA 2BYBA 3GD4A 5IQ4A 4YKFA 2A8XA 2GF3A 4U8OA 5EB4A 2R4JA 2YR4A 4GRTA 1V59A 3NN6X 5FS6A 4YTPA 1JRZA 3CGDA 5DBJA 4OPTA 1GESA 4NEWA 2UZZA 1BKWA 4B63A 3BHFA 2OALA 3LZXA 3ADAB 3LZWA 1DNCA 3BNUA 1CC2A 2R0GA 1D7LA 1NG3A 2YG7A 4GDPA 3BHKA 1TDNA 4IV9A 1PBFA 1IUXA 4DSHA 2C3CA 1DOBA 2Y6QA 1OJAA 1E1MA 2BCGG 3M13A 3S5WA 4A79A 4YKGA 5KWFA 3NHOX 1K0IA 2GMJA 1CBOA 1VG9A 1CC6A 2VZ2A 3AWIA 1ZKQA 2Q0KA 3NYEA 4IA5A 2VRLA 3URHA 1GRFA 1LJ1A 1K4QA 2GR1A 1GALA 1YKJA 2IVEA 3CN8A 2E4GA 3DK9A 3ALJA 1GETA 4CCRA 5BUKA 3AEEA 2C3DA 3AE8A 3NK2X 4YSHA 4D04A 3GYIA 1ZOVA 1FL2A 2X8GA 4DNAA 3S61A 5FMHA 4Y4LA 3VQRA 5L46A 1COYA 2XVEA 1KNPA 4J34A 1GTHA 4AT0A 3NLCA 4Z43A 2E5VA 3NTDA 4YTMA 2BC0A 4H2PA 1D4CA 1L0VA 3NGCX 4U8KA 4LA1A 1D4EA 1PN0A 3AEGA 3LOVA 4IVMB 2O9ZA 3DJDA 3ITJA 4BURA 1PXAA 3BNMA 1B37A 1ZP0A 4H4PA 2WEUA 3CPJG 2XYOA 2XVFA 4TLXA 3CNJA 2R9ZA 1DJNA 1TYPA 1ZX9A 1H7XA 3AE7A 3G5SA 4RG4A 3SFEA 1NEKA 2E1MA 4OPUA 2GR3A 3AD9B 3KD9A 2YLTA 4AOSA 1KFYA 1PXCA 2C72A 1LV0A 2FJBA 2GAGB 4A9WA 1NENA 1VDCA 3GYJA 2WP5A 2GV8A 2C7GA 4H4QA 2B7RA 2YLRA 3REDA 4B65A 2YLZA 4N9XA 4YTNA 3OZ2A 2VVMA 2RGJA 1FEBA 1VQWA 3NYFA 1O5WA 2YG6A 4J31A 1IUUA 1GRBA 4NZHA 4PAAA 2ZZCA 3VR9A 4E0VA 2AQJA 3C96A 4LU6A 5U25A 2BXRA 2IIDA 1BWCA 2TPRA 1PHHA 3M12A 3RP8A 4B67A 4GR1A 2GVCA 1JRYA 2VVLG 3UTEA 2VOUA 2QCUA 2GR0A 1N4VA 1Q9IA 1CL0A 1O94A 2Z5YA 4JNAA 4MJWA 2JBVA 4H4YA 3AE6A 2JK6A 3II4A 2BS2A 1ZK7A 4J2WA 3IF9A 4J36A 1E1NA 1M6IA 3CNDA 4P9SA 1PJ7A 1PXBA 2XVHA 4H2RA 2YG5A 5C2TA 3NK0X 2R0CA 2WQYA 2WP6A 3DA1A 3COXA 4FK1C 3UKKA 1PS9A 2FBWA 3UOYA 4ZN0A 5HHFA 1L9CA 2YVGA 3GRTA 1LPFA 4KX6A 3ALMA 1Y0PA 3AD8B 4FDCB 4GF7A 2BK3A 4ZCDA 1CJ4A 2B9WA 5KVHA 1FECA 2B9XA 3WE0A 4JY3A 1GNDA 5J7XA 3LXDA 1M64A 1CJ2A 1GOSA 2ARDA 4OPGA 2WETA 1F6MA 3UOVA 4EIQA 1RYIA 1H81A 2WDQA 1KSUA 1GRAA 5EBKA 4Z2TA 3IWAA 3NN0X 3ICRA 4ZCCA 4Z44A 2F5ZA 1CJCA 1RSGA 4JDRA 3JSKA 3VRDB 1Q1RA 3VR8A 1AOGA 3AYLA 1S2YA 1ONFA 2ZZ0A 4K7ZA 3NTAA 4TLZA 3E1TA 4EMJA 4KPRA 1GT8A 1GRHA 4EQWA 2DKIA 3F8DA 3RHAA 1SEZA 4YSZA 2GQWA 2WPEA 5HY5A 2QAEA 3UOZA 3ISHA 4OPDA 4CNJA 3KA7A 4H4VA 4EMIA 3DJJA 1F3PA 4B66A 2GR2A 1Y56B 1E7PA 2V6OA 3FG2P 2APGA 2V3AA 3RP6A 4ADWA 1H84A 2YAUA 3DGZA 1JEHA 2XVJA 2XVIA 5EOWA 5M0ZA 3QFAA 2XLRA 2C75A 2BK5A 3QVRA 2VQBA 2BS3A 4FX9A 1YQ3A 3H4KA 2B76A 1GREA 4B68A 2WPFA 3DJGX 1ZMDA 3CNTA 3ATQA 1GXFA 3Q9TA 4O5QA 4NTCA 4WCTA 2XFQA 3I6DA 3F8PA 2DKHA 4XWRA 5JCNA 3V3OA 4TM0A 3M0OA 1IJHA 4A65A 1XHCA 2GH5A 2OLOA 4UDRA 3NNEA 1MO9A 1NAAA 2YWLA 5FS8A 5GRTA 4CCQA 5KVIA 4DSGA 1HYUA 1IUVA 1KF6A 3DK8A 2OA1A 1GRGA 3RNMA 4C5OA 3IC9A 3NG7X 3SGLA 4I59A 4CBQA 2WDRA 1XDIA 2R4EA 1BGNA 1N4UA 3PVCA 1PJ5A 2H88A 2C76A 3ABVA 3BI5A 2WHDA 4A7AA 3SFDA 4A99A 5J60A 2VQ7A 2C73A 2YG3A 4U2SA 3AYIA 1IUSA 2TMDA 4U8JA 3CTYA 2W0HA 2CFYA 2C70A 3DMEA 1PBBA 3GMCA 4YXDA 4Z26A 3DGHA 5IPYA 3VRBA 4U8NA 2V3BA 1NHSA 3FIMB 2BC1A 3PS9A 1PBEA 2X8CA 4CY8A 4H4UA 3IHGA 3QSEA 4B69A 4ICYA 1BF3A 1BGJA 1JRXA 1NHQA 1D4DA 3AEAA 1N4WA 4RSLA 3KLJA 2HQMA 3ICTA 1LQTA 4TM3A 4YWOA 4UP3A 3L8KA 1DXLA 1E1LA 3K7MX 1GV4A 4WX1A 2WOVA 3CGEA 3ZYXA 2R0PA 4A6NB 2NPXA 4BK2A 1DODA 3GSIA 3K7QX 5HYMA 2WESA 5LV9A 4EIPA 4UDQA 1VRQB 2BS4A 2GMHA 4EQXA 1H86A 3G5RA 2FJAA 3NK1X 3QFBA 1EL5A 4EMWA 3H8IA 1L9EA 1NPXA 2FJEA 4H4WA 1QLBA 4X9NA 4Z2RA 2AAQA 3NH3X 5HXIA 4AP1A 1GPEA 4TM4A 1UKVG 3CGCA 5BRTA 5JCIA 3L1RA 3UTGA 2EQ6A 3PO7A 2YLWA 1JNRA 1H82A 2GRTA 2RABA 3ATRA 3D8XA 4JNQA 3NYCA 4AT2A 2PHHA 3B6DA 5ER0A 4YT0A 1IUWA 1XANA 3P9UA 5KXJA 2CVJA 2YM1A 4USQA 4Y4NA 4IVOB 4CY6A 1F8SA 3AE1A 4C77A
chains in the Genus database with same CATH superfamily
3UKFA 2QVHA 3OPSA 4LIIA 3RCYA 3I4KA 3FVDA 2ACZA 3UJSA 4BK3A 5IDZA 1JU2A 4IP4A 3RP7A 4GAPA 1BZLA 2Y6RA 2MNRA 3SY4A 4I58A 1JPDX 1REOA 2GQFA 3P1WA 1W4XA 3V5CA 4JN9A 1KCZA 4O5UA 1OJ9A 4K8DA 3EAOA 3EEZA 3KPFA 4GDEA 2GGEA 2XLUA 1DJQA 4U8LA 1B5QA 2OG9A 3HYXA 2BACA 1KNRA 3GWFA 3AEDA 4H4RA 3AEFA 3C4AA 1JPMA 4EQRA 1TE6A 3NT6A 2AR8A 3PWIA 3LJPA 3NIXA 4HB9A 3LB8A 3Q6JA 3Q45A 4KT2A 4A5LA 4GGHA 3FXGA 2QA2A 5BVAA 2OQHA 3RR1A 5FJOA 2V60A 1P2HA 3GC2A 3CPIG 5JCKA 4A6GA 5EB5A 1L9DA 3R07C 3KVEA 4C3YA 2ZZBA 1B4VA 3UOXA 1DOCA 4TM1A 3DERA 1ZDLA 3BI2A 2PU0A 2RGOA 2Q7VA 3BI4A 1R6WA 5IQ1A 4EM4A 2C66A 1PDHA 2PTYA 2E5AA 3TTEA 4NNJA 3B9JB 3BOXA 3EPTA 4C74A 1KKRA 5GSNA 2GGJA 2XFOA 2IVDA 3NVZB 1X31B 1CC4A 4G73A 2XLTA 3GWDA 1KN0A 3NRZB 1LVLA 3R9UA 2C64A 4NTDA 3VRAA 1TRBA 2B9YA 1TDEA 4EWJA 4H4XA 1W6TA 2WBAA 2XH0A 3P4PA 3GDNA 2QGYA 3D46A 2YG4A 3H12A 4HCLA 2WDVA 2W54A 1YQ4A 3CIRA 2JKCA 4Z25A 1E39A 2X99A 1NHPA 4MKSA 1EL8A 2DW7A 3NN6X 3HPFA 4OPTA 3H70A 1GESA 2UZZA 4B63A 2OALA 3ADAB 1DNCA 1FIQB 1CC2A 1TDNA 4DSHA 2C3CA 1E1MA 3S5WA 4IT1A 3CXOA 3NHOX 2GMJA 1CBOA 1VG9A 1YKJA 2IVEA 4DXKA 4H83A 5BUKA 3AEEA 3AE8A 2W3RA 3S5SA 6ENLA 5FMHA 2OPJA 2AKMA 1GTHA 4AT0A 3NLCA 2E5VA 3NTDA 4YTMA 4H2PA 4GIRA 4U8KA 3AEGA 1PN0A 2O9ZA 3DJDA 4BURA 1PXAA 2WEUA 4TLXA 5BOFA 1ZX9A 1H7XA 1EBGA 1N61C 3RITA 3AE7A 3G5SA 3NO1A 3KD9A 1KFYA 2FJBA 1NENA 1VDCA 4K2SA 2WP5A 2C7GA 3MSYA 4GMEA 2YG6A 1IUUA 2ZZCA 2QJNA 4HN8A 3L5OA 1JRYA 2Z5YA 5FJRA 4GISA 5C2TA 2WQYA 3R11A 3UKKA 1ELSA 3TOYA 5HHFA 1NU5A 3GRTA 1LPFA 1Y0PA 5FJPA 3MKCA 2QDEA 4HCDA 4E5TA 5J7XA 1M64A 1CJ2A 1GOSA 3SZFA 2ARDA 1GRAA 5EBKA 3BSMA 3NN0X 3EKGA 3KUMA 4ZCCA 2F5ZA 3JSKA 2P88A 1AOGA 2QJJA 1ONFA 4K7ZA 3NTAA 2PPGA 4TLZA 4YWSA 3E1TA 1WUEA 1GT8A 1GRHA 2DKIA 2GQWA 3VCNA 2PGWA 2QAEA 3T6CA 1X2HA 2PCEA 4OPDA 4CNJA 3KA7A 4EMIA 4B66A 1Y56B 2PU1A 2YAUA 5M0ZA 4ROPA 1P43A 2XLRA 2C75A 2BS3A 4FX9A 2PTWA 4HYRA 3F8PA 2DKHA 4XWRA 3V3OA 3GY1A 2W3SA 3VDGA 2OZ3A 2GH5A 4UDRA 3RGTA 5GRTA 3DK8A 3CB3A 1GRGA 1SJDA 3DDMA 3SGLA 4CBQA 1XDIA 3R1ZA 3JVAA 3NFUA 3SFDA 2VQ7A 2C73A 4U8JA 2CFYA 4U8NA 2O56A 1NHSA 2QQ6A 1MDLA 5FJTA 3IHGA 4B69A 1TZZA 1JRXA 1D4DA 1N4WA 3UCDA 2HQMA 3SN1A 1LQTA 4G74A 1GV4A 3U9IA 1STZA 2WOVA 3T2ZA 4UDQA 1H86A 2FJAA 3QFBA 1MNSA 1EL5A 4EMWA 1MDRA 5HXIA 3NH3X 4TM4A 5BRTA 3H8AA 4HNLA 2EQ6A 3D8XA 3P0WA 5KXJA 4USQA 3SR6B 4IVOB 4CY6A 1F8SA 2XFNA 4JY2A 4D03A 3AYJA 1CHUA 1TDFA 3NKSA 3T37A 3ZVIA 4JN8A 3ICSA 4G6GA 4GCMA 2P8BA 2HXTA 2AL2A 2VRMA 2V61A 4EQSA 1B8SA 3JW7A 1Y56A 5CQFA 2V5ZA 3D1CA 3UCLA 1MXTA 2A87A 4X9MA 1FOHA 3I3LA 4H4TA 4H2QA 4OVIA 2BK4A 1GRTA 4Z17A 4E4UA 3DIPA 5M10A 3SN0A 1FCDA 5U1OA 4JQ9A 2NVKX 2FJDA 2GL5A 1H2IA 3KKJA 3K30A 1FHUA 4U2LA 3UP5A 2X8HA 1F8WA 3K7TA 3NVVB 5JRBA 3CNSA 1PBCA 1YY5A 2PYXA 1MUCA 3QPEA 1H6VA 4J56A 3UKPA 3THUA 5BULA 1E1KA 1TDOA 2YLXA 3V76A 2WU5A 2X50A 3CPHG 4DGKA 3UKQA 4NTEA 4A3RA 4ECHA 4II2A 4IHCA 2I5QA 2BXSA 2XH4A 5FS7A 2AL1A 1DOEA 1FEAA 4B64A 2R46A 2PGEA 2PP1A 1H83A 5FS9A 3QN3A 1IUTA 1KSSA 4NEVA 3VCCA 4APNA 2PA6A 4XXGA 4H2NA 1EBDA 3UKAA 2EQ7A 4U8PA 5C3JA 3NXLA 3GDPA 1EC7A 1S3BA 4CRTA 2XFUA 4U2TA 3QJ4A 1Z6LA 2BABA 3V3NA 1ELIA 2P3ZA 4G6HA 1X2GA 3AECA 4FP1A 2OFJA 4FK1A 3LADA 2Q0LA 4J1OA 1E9IA 2XLSA 3KU9A 3NRNA 2XDOA 2PP3A 4ZA0A 3G5QA 5TR3A 4USRA 1VQZA 2YVFA 3P3BA 5ENLA 2EQ8A 2BYBA 5IQ4A 2GSHA 2OZTA 4GAVA 4YKFA 4GRTA 1V59A 4YTPA 3MWCA 4KWSA 3NVWB 3BHFA 2OVLA 1D7LA 3U4FA 1IUXA 2Y6QA 2FKPA 3PK7A 1OJAA 4YKGA 4ZCWA 2VZ2A 3AWIA 3SZWA 2VRLA 3URHA 1K4QA 2GR1A 1LJ1A 3CN8A 3PFRA 1JDFA 3DK9A 3T8QA 3ALJA 3MQTA 4DN1A 5J04A 4CCRA 3IJLA 3NK2X 1N5XA 4YSHA 4D04A 2X8GA 3S61A 5L46A 1JRPA 2XH2A 1D4CA 3TW9A 4LA1A 3LOVA 3IJIA 3I6TA 1ZP0A 3CPJG 3JZUA 2R9ZA 4H2HA 4F4RA 4RG4A 4OPUA 2NQLA 2C72A 2GAGB 3PWGA 2B7RA 2YLRA 3CXBA 3REDA 4B65A 2RGJA 1VQWA 3RO6A 4FI4A 3NYFA 4J31A 1GRBA 4PAAA 2IIDA 2TPRA 1PHHA 3RP8A 4GR1A 3SSZA 1CL0A 2JBVA 3AE6A 3SX6A 2JK6A 2BS2A 1ZK7A 4J36A 1E1NA 1M6IA 4H2RA 4IP5A 2WP6A 3COXA 4FK1C 3UOYA 1KD0A 3T9PA 4KX6A 3AD8B 1CJ4A 5KVHA 1FECA 2B9XA 3WE0A 1GNDA 4OPGA 3UOVA 2WETA 1F6MA 3SBFA 1KSUA 3SXIA 3ICRA 1RSGA 3VRDB 3VR8A 2DW6A 2ZZ0A 4GGBA 4EMJA 3RHAA 4YSZA 2WPEA 3UOZA 2GR2A 1E7PA 1XPYA 3FG2P 3DGZA 3PG6A 3CK5A 2BK5A 3DESA 2QDDA 3DJGX 1ZMDA 1FFVC 3ATQA 1GXFA 3V3WA 4O5QA 3I6DA 3GO2A 2HZGA 4JN7A 2OLOA 3NNEA 1MRAA 5FS8A 4CCQA 1KF6A 3RNMA 3RRAA 4C5OA 3IC9A 5BOEA 4I59A 2OZ8A 2R4EA 3UXKA 1PJ5A 3B97A 3BI5A 2WHDA 1R0MA 5J60A 4H19A 3CTYA 3GMCA 4Z26A 3DGHA 5IPYA 2QJMA 3T2KA 3VRBA 3QTPA 3UXLA 4CY8A 1BF3A 1BGJA 3T4WA 3AEAA 4RSLA 3ICTA 1ONEA 3AMZA 3ZVHA 1N60C 4J3ZA 3ZYXA 2R0PA 3K7QX 5HYMA 4EIPA 3NK1X 3AN1A 4E4FA 2W55A 2FJEA 1QLBA 2AAQA 3QKEA 5JCIA 3UTGA 3PO7A 1JNRA 1H82A 1PDZA 3NYCA 5ER0A 2CVJA 2YM1A 4Y4NA 3STPA 3UP4A 3AE1A 2OLNA 4XWZA 3CT2A 3UCCA 3GD3A 1TYTA 2OLAA 3VA8A 3S47A 2WP9A 1F8RA 4OPIA 4REKA 4K8GA 1Q1WA 3EF6A 1EL9A 2GAHB 4OPLA 4K22A 4AP3A 2AL2B 1OJDA 3ALLA 1S2QA 3AE2A 4GUVA 2CULA 4E8GA 2HXUA 1LQUA 3UKLA 3BJSA 3DEQA 3SM8A 1H7WA 4HA6A 4AOXA 2JB3A 1OJCA 1JROA 3UKHA 1P48A 3CNPA 4RG3A 1PJ6A 3DK4A 3QSSA 3D9XA 4CNKA 2Z5XA 2E3TA 2B7SA 3AEBA 3AD7B 4HPNA 1O95A 4X2PA 4KPLA 2GB0A 1NDAA 4BK1A 2MUCA 3MY9A 3SJNA 1MOKA 1GEUA 4OCGA 4J57A 4BJZA 1D7YA 4BV6A 4DX3A 2R45A 2JAEA 1P2EA 3UJRA 3QVPA 3GMBA 3P4SA 2J3NA 1PDYA 5KMPA 3NS1B 1VG0A 5JCMA 1NHRA 3AXBA 4M52A 1JCTA 2JB2A 4GYPA 2WOWA 4G7FA 3EANA 4B1BA 2A89A 1EL7A 1ECQA 2CDUA 1BKHA 4U8IA 3A7AA 1S3EA 2BCPA 1CJ3A 3R25A 4H50A 3OW1A 1SJAA 1XPQA 1OEPA 2PS2A 2WU2A 2BA9A 1QJDA 2EQ9A 4IL2A 1TKKA 2YR6A 3MZNA 2XH7A 3QSMA 2JB1A 2YR5A 3HYVA 1K0JA 3IHMA 1LTXR 2VVLA 3ZLHA 4E6MA 4EM3A 1SJBA 2ZBWA 1OJTA 3DJEA 4C3XA 3KPKA 4J33A 1YQZA 2I0ZA 3ETRB 3K1GA 3V4BA 3AE5A 4OPCA 4IZGA 3VC6A 2OQYA 2GF3A 5EB4A 2R4JA 2YR4A 4DYEA 5FS6A 4HCHA 1RVKA 3CGDA 3FJ4A 4NEWA 3HYWA 2PP0A 3LZXA 3UJFA 3LZWA 4GDPA 3ES7A 3I6EA 1PBFA 1DOBA 2BCGG 1K0IA 1CC6A 1ZKQA 4IA5A 3NYEA 1KKOA 2HNEA 1GETA 4HNCA 1T3QC 2C3DA 2RDXA 3GYIA 1ZOVA 1V97A 3VQRA 4A35A 1COYA 3UJEA 3FV9A 2XVEA 1KNPA 5G5HB 3NGCX 1L0VA 3ENLA 1D4EA 3BNMA 1B37A 4H4PA 2XYOA 1DJNA 1TYPA 5KNLA 3SFEA 1NEKA 4GYPC 4AOSA 4DHGA 2GV8A 2YLZA 2VVMA 1O5WA 1BQGA 4NZHA 2XSXA 3VR9A 3R0UA 2AQJA 4LU6A 5U25A 3HRDC 2BXRA 1BWCA 4B67A 2GVCA 3OTRA 2AKZA 2GR0A 1N4VA 1Q9IA 1N62C 4JNAA 4MJWA 3DG6A 4MGGA 3CNDA 3DG7A 1PXBA 2YG5A 3NK0X 1PS9A 2FBWA 1L9CA 4ENLA 4FDCB 4GF7A 2BK3A 4ZCDA 2B9WA 1S7MA 3LXDA 4Z2TA 3TJIA 3IWAA 1WUFA 4JDRA 1Q1RA 2GGIA 3AYLA 3CAWA 3VC5A 4DWDA 1SEZA 3SQSA 3FYYA 2ONEA 1N5WC 3DGBA 3DJJA 1F3PA 7ENLA 2V6OA 2V3AA 3RP6A 4ADWA 1H84A 1JEHA 2XVJA 5EOWA 3QFAA 1YQ3A 1FHVA 3H4KA 1RM6B 2WPFA 3SN4A 4WCTA 4NTCA 2XFQA 5JCNA 3M0OA 1IJHA 4A65A 1MO9A 1NAAA 2YWLA 2POZA 5KVIA 4G8TA 1HYUA 1IUVA 2OA1A 3T0KA 4G9KA 3NG7X 3T2YA 2WDRA 1BGNA 3ES8A 3ABVA 3OZMA 4A7AA 4U2SA 2YG3A 1IUSA 2TMDA 2C70A 4YXDA 5KMQA 4IL0A 4ZOHB 1NELA 2BC1A 3QSEA 3KLJA 2OO6A 4TM3A 4YWOA 4UP3A 1DXLA 1EBHA 3QLDA 2P0IA 4WX1A 4A6NB 2NPXA 1VRQB 1VDVA 2BS4A 2GMHA 3ZVHB 3H8IA 1L9EA 1NPXA 5KMRA 4X9NA 4Z2RA 4NWZA 1UKVG 3L1RA 2GRTA 2RABA 4JNQA 4YT0A 1IUWA 1XANA 3ZLGA 4C77A 3GRSA 3HZLA 1D5TA 4KEMA 4H7UA 2QA1A 1FFUC 4H4SA 5JCLA 3DFYA 3O0HA 3ZLFA 3N4EA 4II3A 3P4RA 2C67A 4Z24A 1ZOYA 3SQPA 2XGZA 2OX4A 1IYXA 1ZMCA 1SJCA 5KOWA 3DH9A 3TCSA 1RP0A 1ZY8A 3AE4A 3DFHA 1PBDA 2YQUA 1CF3A 3IK4A 2XLPA 3SZ0A 4K2XA 2PSNA 1GTEA 4K5RA 2BRAA 2WOIA 1TDKA 3TWAA 3AE9A 3FMWA 3IJQA 3P4QA 4PABA 4H1ZA 3B3RA 3C4NA 2YLSA 3OC4A 1QO8A 3GD6A 3CGBA 2RGHA 3CYJA 3F8RA 1GERA 1YEYA 2GEWA 1JNZA 4A6NA 2WPCA 3P93A 2H89A 4YSYA 2OKTA 1JOAA 1NG4A 3SYIA 2PMQA 3EUB3 1E6EA 5KOXA 2X3NA 5U63A 4UDPA 5KRQA 1N1PA 2XFPA 1K0LA 4Z2UA 2WS3A 3A7UA 3UTHA 4X4JA 2Q6UA 4U8MA 2XCGA 3T14A 3MUCA 1GSNA 4YSXA 2GDQA 1KDGA 4H4ZA 1L8PA 3AB1A 2OAMA 2ZC8A 4Y4MA 4Z1YA 4K5SA 2C65A 5CKUA 3TQPA 4M6UA 1FO4A 3ZDNA 4BJYA 4IA6A 2YM2A 2YVJA 1N63C 3H8LA 3N4FA 3UTFA 3AE3A 1WYGA 3FPZA 3GD4A 2A8XA 4U8OA 1JRZA 2CHRA 5DBJA 1BKWA 3BNUA 2R0GA 1NG3A 2YG7A 4IV9A 3BHKA 3D47A 4K1WA 3M13A 4A79A 5KWFA 3HW2A 3UGVA 3NVYB 3N6HA 4JHMA 2Q0KA 1GRFA 3Q4DA 1GALA 1SB3B 4M0XA 2E4GA 3UJ2A 1FL2A 3V5FA 3SZCA 4DNAA 4Y4LA 3VFCA 4J34A 4Z43A 2BC0A 4IVMB 2PTZA 3N6JA 3ITJA 2XVFA 3CNJA 2PTXA 3R10A 2E1MA 2GR3A 3AD9B 2YLTA 1PXCA 1LV0A 4A9WA 3GYJA 4H4QA 4N9XA 4YTNA 3OZ2A 1FEBA 1EC8A 2BRYA 4E0VA 3C96A 1XS2A 3M12A 5G5GB 2VVLG 3UTEA 2VOUA 2QCUA 5EU9A 1O94A 4H4YA 4GFIA 3II4A 4J2WA 3IF9A 4P9SA 1PJ7A 2XVHA 2R0CA 3DA1A 4ZN0A 2YVGA 5FJUA 3ALMA 4JY3A 3OZYA 4EIQA 1RYIA 1H81A 2WDQA 2PODA 3A7RA 4Z44A 1CJCA 2GGHA 1S2YA 3NZGA 4KPRA 4EQWA 3F8DA 5HY5A 3ISHA 4TVWA 4H4VA 2APGA 2GGGA 2XVIA 3QVRA 2VQBA 1EC9A 2B76A 1GREA 4B68A 2P8CA 3CNTA 3Q9TA 3T31A 3GYXA 2ZADA 4TM0A 1XHCA 4DSGA 4TVYA 1ZXIC 1N4UA 3PVCA 2H88A 2C76A 4A99A 3AYIA 2W0HA 3DMEA 1PBBA 1F9CA 5KMSA 2V3BA 3OP2A 3FIMB 3PS9A 1PBEA 2X8CA 4H4UA 4ICYA 1NHQA 1DTNA 2FYMA 3L8KA 3DG3A 1E1LA 3K7MX 3CGEA 4BK2A 1DODA 3GSIA 2WESA 5LV9A 3FCPA 2C4CA 4EQXA 3AM9A 3G5RA 4MMWA 3TJ4A 4H4WA 3H7VA 4AP1A 1GPEA 3CGCA 2YLWA 3ATRA 4AT2A 2PHHA 3TWBA 3B6DA 3P9UA 3R0KA 3CMMA 3FBSA
chains in the Genus database with same CATH topology
2OLNA 4XWZA 3UKFA 3GRSA 4LIIA 3HZLA 3GD3A 1TYTA 1D5TA 2ACZA 2XFNA 4JY2A 4D03A 4BK3A 1JU2A 3AYJA 2WP9A 4H7UA 3RP7A 1CHUA 1F8RA 1TDFA 4GAPA 4OPIA 4REKA 3NKSA 3T37A 1BZLA 2QA1A 2Y6RA 3ICSA 4G6GA 4GCMA 4H4SA 1Q1WA 3SY4A 4I58A 5JCLA 3O0HA 3UP4A 3EF6A 1EL9A 1REOA 2GQFA 2VRMA 2GAHB 4II3A 3P4RA 3P1WA 2V61A 4EQSA 1B8SA 2C67A 1W4XA 4Z24A 1Y56A 5CQFA 4JN9A 2V5ZA 4OPLA 4K22A 1ZOYA 4AP3A 3SQPA 1OJDA 3ALLA 3D1CA 4O5UA 3UCLA 1ZMCA 1MXTA 2A87A 1OJ9A 4X9MA 5KOWA 3DH9A 1FOHA 4K8DA 3EAOA 1RP0A 3KPFA 4GDEA 2XLUA 3I3LA 1DJQA 1S2QA 1ZY8A 4H4TA 3AE4A 4H2QA 3AE2A 4OVIA 4U8LA 4GUVA 1B5QA 2CULA 1PBDA 2BK4A 1GRTA 2YQUA 3HYXA 5M10A 1LQUA 2BACA 3UKLA 1KNRA 1CF3A 3GWFA 3AEDA 3SM8A 1H7WA 4H4RA 3AEFA 3C4AA 4HA6A 1FCDA 4AOXA 2JB3A 3FBSA 1OJCA 4EQRA 2XLPA 3NT6A 3SZ0A 2AR8A 4K2XA 3LJPA 5U1OA 3UKHA 4JQ9A 2NVKX 2FJDA 3CNPA 4RG3A 3NIXA 1PJ6A 3DK4A 3QSSA 1H2IA 3D9XA 4CNKA 2Z5XA 1GTEA 3LB8A 3KKJA 4HB9A 3Q6JA 4K5RA 2BRAA 4A5LA 3K30A 2WOIA 2B7SA 2QA2A 1TDKA 5BVAA 4U2LA 3AEBA 3AD7B 1O95A 3UP5A 3AE9A 2GB0A 1NDAA 2X8HA 3FMWA 3P4QA 4PABA 2V60A 4BK1A 1F8WA 3K7TA 1P2HA 5JRBA 3CNSA 1PBCA 3B3RA 1YY5A 2YLSA 2PYXA 3C4NA 3CPIG 3OC4A 1QO8A 5JCKA 1MOKA 5EB5A 1GEUA 4OCGA 4J57A 1L9DA 3CGBA 2RGHA 1H6VA 3KVEA 4BJZA 1D7YA 4BV6A 4C3YA 4J56A 2ZZBA 3F8RA 1B4VA 1GERA 2R45A 2GEWA 1JNZA 3UKPA 2JAEA 3UOXA 1P2EA 4A6NA 3QVPA 1DOCA 3GMBA 3P4SA 4TM1A 5BULA 1E1KA 2J3NA 1TDOA 2YLXA 2WPCA 3V76A 5KMPA 2H89A 4YSYA 2WU5A 2X50A 1VG0A 3CPHG 5JCMA 4DGKA 1NHRA 1ZDLA 3BI2A 3AXBA 4NTEA 3UKQA 4M52A 4ECHA 1JOAA 1NG4A 3SYIA 2JB2A 4II2A 2RGOA 2Q7VA 2WOWA 2BXSA 3EANA 4B1BA 3BI4A 2A89A 1EL7A 2CDUA 1E6EA 5FS7A 5IQ1A 4U8IA 5KOXA 4EM4A 1S3EA 1PDHA 2BCPA 2C66A 1DOEA 1FEAA 2X3NA 2R46A 5U63A 4B64A 4UDPA 5KRQA 4NNJA 1CJ3A 1N1PA 3EPTA 1H83A 5FS9A 1K0LA 2XFPA 4Z2UA 4H50A 1IUTA 1KSSA 2WS3A 3UTHA 4C74A 5GSNA 4NEVA 4APNA 1XPQA 4X4JA 4XXGA 2Q6UA 4U8MA 2WU2A 2XCGA 2BA9A 2XFOA 3T14A 4H2NA 1QJDA 2EQ9A 1EBDA 2IVDA 2EQ7A 4U8PA 3UKAA 5C3JA 1X31B 2YR6A 1GSNA 3GDPA 4YSXA 4CRTA 1CC4A 1KDGA 1S3BA 4G73A 2XFUA 4U2TA 3QSMA 2JB1A 2YR5A 2XLTA 1K0JA 3HYVA 3IHMA 3QJ4A 1LTXR 2VVLA 1Z6LA 3GWDA 4H4ZA 1KN0A 2BABA 3V3NA 1ELIA 3AB1A 4EM3A 2OAMA 4G6HA 1LVLA 4Y4MA 2C64A 4NTDA 3R9UA 3VRAA 1TRBA 2ZBWA 1OJTA 2B9YA 3DJEA 3AECA 4K5SA 1TDEA 4C3XA 2C65A 4FK1A 5CKUA 3LADA 2Q0LA 3KPKA 4J33A 4H4XA 3ZDNA 2XLSA 2WBAA 4IA6A 4BJYA 3KU9A 1YQZA 3P4PA 2I0ZA 3NRNA 3GDNA 2XDOA 2YM2A 3G5QA 2YG4A 2YVJA 2WDVA 3H8LA 5TR3A 4USRA 1YQ4A 3CIRA 2JKCA 4Z25A 2YVFA 1E39A 2X99A 3UTFA 3AE5A 3AE3A 4OPCA 1NHPA 1EL8A 2EQ8A 3FPZA 2BYBA 3GD4A 5IQ4A 4GAVA 4YKFA 2A8XA 2GF3A 4U8OA 5EB4A 2R4JA 2YR4A 4GRTA 1V59A 3NN6X 5FS6A 4YTPA 1JRZA 3CGDA 5DBJA 4OPTA 1GESA 4NEWA 2UZZA 1BKWA 3HYWA 4B63A 3BHFA 2OALA 3LZXA 3ADAB 3LZWA 1DNCA 3BNUA 1CC2A 2R0GA 1D7LA 1NG3A 2YG7A 4GDPA 3BHKA 1TDNA 4IV9A 1PBFA 1IUXA 4DSHA 2C3CA 1DOBA 2Y6QA 1OJAA 1E1MA 2BCGG 3M13A 3S5WA 4A79A 4YKGA 5KWFA 3NHOX 1K0IA 2GMJA 1CBOA 1VG9A 1CC6A 2VZ2A 3AWIA 3SZWA 1ZKQA 2Q0KA 3NYEA 4IA5A 2VRLA 3URHA 1GRFA 1K4QA 2GR1A 1GALA 1LJ1A 1YKJA 2IVEA 3CN8A 2E4GA 3DK9A 3ALJA 1GETA 4CCRA 5BUKA 3AEEA 2C3DA 3AE8A 3NK2X 4YSHA 4D04A 3GYIA 1ZOVA 1FL2A 2X8GA 3SZCA 4DNAA 3S61A 5FMHA 4Y4LA 3VQRA 5L46A 1COYA 2XVEA 1KNPA 4J34A 1GTHA 4AT0A 3NLCA 4Z43A 2E5VA 3NTDA 4YTMA 2BC0A 4H2PA 1D4CA 1L0VA 3NGCX 4U8KA 4LA1A 1D4EA 1PN0A 3AEGA 3LOVA 4IVMB 2O9ZA 3DJDA 3ITJA 4BURA 1PXAA 3BNMA 1B37A 1ZP0A 4H4PA 2WEUA 3CPJG 2XYOA 2XVFA 4TLXA 3CNJA 2R9ZA 1DJNA 1TYPA 1ZX9A 1H7XA 3AE7A 5KNLA 3G5SA 4RG4A 3SFEA 1NEKA 2E1MA 4OPUA 2GR3A 3AD9B 3KD9A 2YLTA 4AOSA 1KFYA 1PXCA 2C72A 1LV0A 2FJBA 2GAGB 4A9WA 1NENA 1VDCA 3GYJA 2WP5A 2GV8A 2C7GA 4H4QA 2B7RA 2YLRA 3REDA 4B65A 2YLZA 4N9XA 4YTNA 3OZ2A 2VVMA 2RGJA 1FEBA 1VQWA 3NYFA 1O5WA 2YG6A 4J31A 1IUUA 1GRBA 4NZHA 4PAAA 2ZZCA 2BRYA 3VR9A 4E0VA 2AQJA 3C96A 4LU6A 5U25A 2BXRA 2IIDA 1BWCA 2TPRA 1PHHA 3M12A 3RP8A 4B67A 4GR1A 2GVCA 3L5OA 1JRYA 2VVLG 3UTEA 2VOUA 2QCUA 2GR0A 1N4VA 1Q9IA 1CL0A 1O94A 2Z5YA 4JNAA 4MJWA 2JBVA 4H4YA 3AE6A 3SX6A 2JK6A 3II4A 2BS2A 1ZK7A 4J2WA 3IF9A 4J36A 1E1NA 1M6IA 3CNDA 4P9SA 1PJ7A 1PXBA 2XVHA 4H2RA 2YG5A 5C2TA 3NK0X 2R0CA 2WQYA 2WP6A 3DA1A 3COXA 4FK1C 3UKKA 1PS9A 2FBWA 3UOYA 4ZN0A 5HHFA 1L9CA 2YVGA 3GRTA 1LPFA 4KX6A 3ALMA 1Y0PA 3AD8B 4FDCB 4GF7A 2BK3A 4ZCDA 1CJ4A 2B9WA 5KVHA 1FECA 2B9XA 3WE0A 1S7MA 1GNDA 4JY3A 5J7XA 3LXDA 1M64A 1CJ2A 1GOSA 3SZFA 2ARDA 4OPGA 2WETA 1F6MA 3UOVA 4EIQA 1RYIA 1H81A 2WDQA 1KSUA 1GRAA 5EBKA 4Z2TA 3SXIA 3IWAA 3NN0X 3ICRA 4ZCCA 4Z44A 2F5ZA 1CJCA 1RSGA 4JDRA 3JSKA 3VRDB 1Q1RA 3VR8A 1AOGA 3AYLA 1S2YA 1ONFA 2ZZ0A 4K7ZA 3NTAA 4TLZA 3E1TA 4EMJA 4KPRA 1GT8A 1GRHA 4EQWA 2DKIA 3F8DA 3RHAA 1SEZA 4YSZA 2GQWA 2WPEA 5HY5A 2QAEA 3UOZA 3ISHA 4OPDA 4CNJA 3KA7A 4H4VA 4EMIA 3DJJA 1F3PA 4B66A 2GR2A 1Y56B 1E7PA 2V6OA 3FG2P 2APGA 2V3AA 3RP6A 4ADWA 1H84A 2YAUA 3DGZA 1JEHA 3PG6A 2XVJA 2XVIA 5EOWA 5M0ZA 3QFAA 2XLRA 2C75A 2BK5A 3QVRA 2VQBA 2BS3A 4FX9A 1YQ3A 3H4KA 2B76A 1GREA 4B68A 2WPFA 3DJGX 1ZMDA 3CNTA 3ATQA 1GXFA 3Q9TA 4O5QA 4NTCA 4WCTA 2XFQA 3I6DA 3T31A 3F8PA 2DKHA 4XWRA 3GYXA 5JCNA 3V3OA 4TM0A 3M0OA 1IJHA 4A65A 1XHCA 2GH5A 2OLOA 4UDRA 3NNEA 1MO9A 1NAAA 2YWLA 5FS8A 5GRTA 4CCQA 5KVIA 4DSGA 1HYUA 1IUVA 1KF6A 3DK8A 2OA1A 4G9KA 3T0KA 1GRGA 3RNMA 4C5OA 3IC9A 3NG7X 3SGLA 3T2YA 4I59A 4CBQA 2WDRA 1XDIA 2R4EA 1BGNA 1N4UA 3PVCA 1PJ5A 2H88A 2C76A 3ABVA 3BI5A 2WHDA 4A7AA 3SFDA 4A99A 5J60A 2VQ7A 2C73A 2YG3A 4U2SA 3AYIA 1IUSA 2TMDA 4U8JA 3CTYA 2W0HA 2CFYA 2C70A 3DMEA 1PBBA 3GMCA 4YXDA 5KMQA 4Z26A 3DGHA 5IPYA 3T2KA 3VRBA 4U8NA 5KMSA 2V3BA 1NHSA 3FIMB 2BC1A 3PS9A 1PBEA 2X8CA 4CY8A 4H4UA 3IHGA 3QSEA 4B69A 4ICYA 1BF3A 1BGJA 1JRXA 1NHQA 1D4DA 3AEAA 1N4WA 4RSLA 3KLJA 2HQMA 3ICTA 1LQTA 4TM3A 4YWOA 4UP3A 3L8KA 1DXLA 4G74A 1E1LA 3K7MX 1GV4A 4WX1A 2WOVA 3CGEA 3ZYXA 2R0PA 4A6NB 2NPXA 4BK2A 1DODA 3GSIA 3K7QX 3T2ZA 2WESA 5HYMA 5LV9A 4EIPA 4UDQA 1VRQB 2C4CA 2BS4A 2GMHA 4EQXA 1H86A 3G5RA 2FJAA 3NK1X 3QFBA 1EL5A 4EMWA 3H8IA 1L9EA 1NPXA 2FJEA 5KMRA 4H4WA 1QLBA 4X9NA 4Z2RA 2AAQA 3NH3X 5HXIA 4AP1A 1GPEA 4TM4A 4NWZA 1UKVG 3CGCA 5BRTA 5JCIA 3L1RA 3UTGA 2EQ6A 3PO7A 2YLWA 1JNRA 1H82A 2GRTA 2RABA 3ATRA 3D8XA 4JNQA 3NYCA 4AT2A 2PHHA 3B6DA 5ER0A 4YT0A 1IUWA 1XANA 3P9UA 5KXJA 2CVJA 2YM1A 4USQA 4Y4NA 4IVOB 4CY6A 3CMMA 1F8SA 3AE1A 4C77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OLN A;  4XWZ A;  3UKF A;  3GRS A;  4LII A;  3HZL A;  3GD3 A;  1TYT A;  1D5T A;  2ACZ A;  2XFN A;  4JY2 A;  4D03 A;  4BK3 A;  1JU2 A;  3AYJ A;  2WP9 A;  4H7U A;  3RP7 A;  1CHU A;  1F8R A;  1TDF A;  4OPI A;  4REK A;  3NKS A;  3T37 A;  1BZL A;  2QA1 A;  2Y6R A;  3ICS A;  4GCM A;  4H4S A;  1Q1W A;  4I58 A;  5JCL A;  3O0H A;  3UP4 A;  3EF6 A;  1EL9 A;  1REO A;  2GQF A;  2VRM A;  2GAH B;  3P4R A;  3P1W A;  2V61 A;  4EQS A;  1B8S A;  2C67 A;  1W4X A;  4Z24 A;  1Y56 A;  5CQF A;  4JN9 A;  2V5Z A;  4OPL A;  4K22 A;  1ZOY A;  4AP3 A;  3SQP A;  1OJD A;  3ALL A;  3D1C A;  4O5U A;  3UCL A;  1ZMC A;  1MXT A;  2A87 A;  1OJ9 A;  4X9M A;  5KOW A;  3DH9 A;  1FOH A;  4K8D A;  3EAO A;  1RP0 A;  3KPF A;  4GDE A;  2XLU A;  3I3L A;  1DJQ A;  1S2Q A;  1ZY8 A;  4H4T A;  3AE4 A;  4H2Q A;  3AE2 A;  4OVI A;  4U8L A;  4GUV A;  1B5Q A;  2CUL A;  1PBD A;  2BK4 A;  1GRT A;  2YQU A;  5M10 A;  1LQU A;  2BAC A;  3UKL A;  1KNR A;  1CF3 A;  3GWF A;  3AED A;  3SM8 A;  1H7W A;  4H4R A;  3AEF A;  3C4A A;  4HA6 A;  1FCD A;  4AOX A;  2JB3 A;  3FBS A;  1OJC A;  4EQR A;  2XLP A;  3NT6 A;  2AR8 A;  4K2X A;  3LJP A;  5U1O A;  3UKH A;  4JQ9 A;  2NVK X;  2FJD A;  3CNP A;  4RG3 A;  3NIX A;  1PJ6 A;  3DK4 A;  3QSS A;  4CNK A;  2Z5X A;  1GTE A;  3LB8 A;  3KKJ A;  4HB9 A;  3Q6J A;  4K5R A;  4A5L A;  3K30 A;  2WOI A;  2B7S A;  2QA2 A;  1TDK A;  5BVA A;  4U2L A;  3AEB A;  3AD7 B;  1O95 A;  3UP5 A;  3AE9 A;  2GB0 A;  1NDA A;  2X8H A;  3FMW A;  3P4Q A;  4PAB A;  2V60 A;  4BK1 A;  1F8W A;  3K7T A;  1P2H A;  3CNS A;  1PBC A;  3B3R A;  1YY5 A;  2YLS A;  2PYX A;  3C4N A;  3CPI G;  3OC4 A;  1QO8 A;  5JCK A;  1MOK A;  5EB5 A;  1GEU A;  4OCG A;  4J57 A;  1L9D A;  3CGB A;  2RGH A;  1H6V A;  3KVE A;  4BJZ A;  1D7Y A;  4BV6 A;  4C3Y A;  4J56 A;  2ZZB A;  3F8R A;  1B4V A;  1GER A;  2R45 A;  2GEW A;  1JNZ A;  3UKP A;  2JAE A;  3UOX A;  1P2E A;  4A6N A;  3QVP A;  1DOC A;  3GMB A;  3P4S A;  4TM1 A;  5BUL A;  1E1K A;  2J3N A;  1TDO A;  2YLX A;  2WPC A;  3V76 A;  2H89 A;  4YSY A;  2WU5 A;  2X50 A;  1VG0 A;  3CPH G;  5JCM A;  4DGK A;  1NHR A;  1ZDL A;  3BI2 A;  3AXB A;  4NTE A;  3UKQ A;  4M52 A;  4ECH A;  1JOA A;  1NG4 A;  2JB2 A;  2RGO A;  2Q7V A;  2WOW A;  2BXS A;  3EAN A;  4B1B A;  3BI4 A;  2A89 A;  1EL7 A;  2CDU A;  1E6E A;  5FS7 A;  5IQ1 A;  4U8I A;  5KOX A;  4EM4 A;  1S3E A;  1PDH A;  2BCP A;  2C66 A;  1DOE A;  1FEA A;  2X3N A;  2R46 A;  5U63 A;  4B64 A;  4UDP A;  5KRQ A;  1CJ3 A;  1N1P A;  3EPT A;  1H83 A;  5FS9 A;  1K0L A;  2XFP A;  4Z2U A;  4H50 A;  1IUT A;  1KSS A;  2WS3 A;  3UTH A;  4C74 A;  5GSN A;  4NEV A;  4APN A;  1XPQ A;  4X4J A;  4XXG A;  2Q6U A;  4U8M A;  2WU2 A;  2XCG A;  2BA9 A;  2XFO A;  4H2N A;  1QJD A;  2EQ9 A;  1EBD A;  2IVD A;  2EQ7 A;  4U8P A;  3UKA A;  5C3J A;  1X31 B;  2YR6 A;  1GSN A;  3GDP A;  4YSX A;  4CRT A;  1CC4 A;  1KDG A;  1S3B A;  2XFU A;  4U2T A;  3QSM A;  2JB1 A;  2YR5 A;  2XLT A;  1K0J A;  3IHM A;  3QJ4 A;  1LTX R;  2VVL A;  1Z6L A;  3GWD A;  4H4Z A;  2BAB A;  3V3N A;  1ELI A;  3AB1 A;  4EM3 A;  2OAM A;  1LVL A;  4Y4M A;  2C64 A;  4NTD A;  3R9U A;  3VRA A;  1TRB A;  2ZBW A;  1OJT A;  2B9Y A;  3DJE A;  3AEC A;  4K5S A;  1TDE A;  4C3X A;  2C65 A;  4FK1 A;  5CKU A;  3LAD A;  2Q0L A;  4J33 A;  4H4X A;  3ZDN A;  2XLS A;  2WBA A;  4IA6 A;  4BJY A;  3KU9 A;  1YQZ A;  3P4P A;  2I0Z A;  3NRN A;  3GDN A;  2XDO A;  2YM2 A;  3G5Q A;  2YG4 A;  2YVJ A;  2WDV A;  3H8L A;  5TR3 A;  4USR A;  1YQ4 A;  3CIR A;  2JKC A;  4Z25 A;  2YVF A;  1E39 A;  2X99 A;  3UTF A;  3AE5 A;  3AE3 A;  4OPC A;  1NHP A;  1EL8 A;  2EQ8 A;  3FPZ A;  2BYB A;  3GD4 A;  5IQ4 A;  4YKF A;  2A8X A;  2GF3 A;  4U8O A;  5EB4 A;  2R4J A;  2YR4 A;  4GRT A;  1V59 A;  3NN6 X;  5FS6 A;  4YTP A;  1JRZ A;  3CGD A;  5DBJ A;  4OPT A;  1GES A;  4NEW A;  2UZZ A;  1BKW A;  4B63 A;  3BHF A;  2OAL A;  3LZX A;  3ADA B;  3LZW A;  1DNC A;  3BNU A;  1CC2 A;  2R0G A;  1D7L A;  1NG3 A;  2YG7 A;  4GDP A;  3BHK A;  1TDN A;  4IV9 A;  1PBF A;  1IUX A;  4DSH A;  2C3C A;  1DOB A;  2Y6Q A;  1OJA A;  1E1M A;  2BCG G;  3M13 A;  3S5W A;  4A79 A;  4YKG A;  5KWF A;  3NHO X;  1K0I A;  2GMJ A;  1CBO A;  1VG9 A;  1CC6 A;  2VZ2 A;  3AWI A;  1ZKQ A;  2Q0K A;  3NYE A;  4IA5 A;  2VRL A;  3URH A;  1GRF A;  1LJ1 A;  1K4Q A;  2GR1 A;  1GAL A;  1YKJ A;  2IVE A;  3CN8 A;  2E4G A;  3DK9 A;  3ALJ A;  1GET A;  4CCR A;  5BUK A;  3AEE A;  2C3D A;  3AE8 A;  3NK2 X;  4YSH A;  4D04 A;  3GYI A;  1ZOV A;  1FL2 A;  2X8G A;  4DNA A;  3S61 A;  5FMH A;  4Y4L A;  3VQR A;  5L46 A;  1COY A;  2XVE A;  1KNP A;  4J34 A;  1GTH A;  4AT0 A;  3NLC A;  4Z43 A;  2E5V A;  3NTD A;  4YTM A;  2BC0 A;  4H2P A;  1D4C A;  1L0V A;  3NGC X;  4U8K A;  4LA1 A;  1D4E A;  1PN0 A;  3AEG A;  3LOV A;  4IVM B;  2O9Z A;  3DJD A;  3ITJ A;  4BUR A;  1PXA A;  3BNM A;  1B37 A;  1ZP0 A;  4H4P A;  2WEU A;  3CPJ G;  2XYO A;  2XVF A;  4TLX A;  3CNJ A;  2R9Z A;  1DJN A;  1TYP A;  1ZX9 A;  1H7X A;  3AE7 A;  3G5S A;  4RG4 A;  3SFE A;  1NEK A;  2E1M A;  4OPU A;  2GR3 A;  3AD9 B;  3KD9 A;  2YLT A;  4AOS A;  1KFY A;  1PXC A;  2C72 A;  1LV0 A;  2FJB A;  2GAG B;  4A9W A;  1NEN A;  1VDC A;  3GYJ A;  2WP5 A;  2GV8 A;  2C7G A;  4H4Q A;  2B7R A;  2YLR A;  3RED A;  4B65 A;  2YLZ A;  4N9X A;  4YTN A;  3OZ2 A;  2VVM A;  2RGJ A;  1FEB A;  1VQW A;  3NYF A;  1O5W A;  2YG6 A;  4J31 A;  1IUU A;  1GRB A;  4NZH A;  4PAA A;  2ZZC A;  3VR9 A;  4E0V A;  2AQJ A;  3C96 A;  4LU6 A;  5U25 A;  2BXR A;  2IID A;  1BWC A;  2TPR A;  1PHH A;  3M12 A;  3RP8 A;  4B67 A;  4GR1 A;  2GVC A;  1JRY A;  2VVL G;  3UTE A;  2VOU A;  2QCU A;  2GR0 A;  1N4V A;  1Q9I A;  1CL0 A;  1O94 A;  2Z5Y A;  4JNA A;  4MJW A;  2JBV A;  4H4Y A;  3AE6 A;  2JK6 A;  3II4 A;  2BS2 A;  1ZK7 A;  4J2W A;  3IF9 A;  4J36 A;  1E1N A;  1M6I A;  3CND A;  4P9S A;  1PJ7 A;  1PXB A;  2XVH A;  4H2R A;  2YG5 A;  5C2T A;  3NK0 X;  2R0C A;  2WQY A;  2WP6 A;  3DA1 A;  3COX A;  4FK1 C;  3UKK A;  1PS9 A;  2FBW A;  3UOY A;  4ZN0 A;  5HHF A;  1L9C A;  2YVG A;  3GRT A;  1LPF A;  4KX6 A;  3ALM A;  1Y0P A;  3AD8 B;  4FDC B;  4GF7 A;  2BK3 A;  4ZCD A;  1CJ4 A;  2B9W A;  5KVH A;  1FEC A;  2B9X A;  3WE0 A;  4JY3 A;  1GND A;  5J7X A;  3LXD A;  1M64 A;  1CJ2 A;  1GOS A;  2ARD A;  4OPG A;  2WET A;  1F6M A;  3UOV A;  4EIQ A;  1RYI A;  1H81 A;  2WDQ A;  1KSU A;  1GRA A;  5EBK A;  4Z2T A;  3IWA A;  3NN0 X;  3ICR A;  4ZCC A;  4Z44 A;  2F5Z A;  1CJC A;  1RSG A;  4JDR A;  3JSK A;  3VRD B;  1Q1R A;  3VR8 A;  1AOG A;  3AYL A;  1S2Y A;  1ONF A;  2ZZ0 A;  4K7Z A;  3NTA A;  4TLZ A;  3E1T A;  4EMJ A;  4KPR A;  1GT8 A;  1GRH A;  4EQW A;  2DKI A;  3F8D A;  3RHA A;  1SEZ A;  4YSZ A;  2GQW A;  2WPE A;  5HY5 A;  2QAE A;  3UOZ A;  3ISH A;  4OPD A;  4CNJ A;  3KA7 A;  4H4V A;  4EMI A;  3DJJ A;  1F3P A;  4B66 A;  2GR2 A;  1Y56 B;  1E7P A;  2V6O A;  3FG2 P;  2APG A;  2V3A A;  3RP6 A;  4ADW A;  1H84 A;  2YAU A;  3DGZ A;  1JEH A;  2XVJ A;  2XVI A;  5EOW A;  5M0Z A;  3QFA A;  2XLR A;  2C75 A;  2BK5 A;  3QVR A;  2VQB A;  2BS3 A;  4FX9 A;  1YQ3 A;  3H4K A;  2B76 A;  1GRE A;  4B68 A;  2WPF A;  3DJG X;  1ZMD A;  3CNT A;  3ATQ A;  1GXF A;  3Q9T A;  4O5Q A;  4NTC A;  4WCT A;  2XFQ A;  3I6D A;  3F8P A;  2DKH A;  4XWR A;  5JCN A;  3V3O A;  4TM0 A;  3M0O A;  1IJH A;  4A65 A;  1XHC A;  2GH5 A;  2OLO A;  4UDR A;  3NNE A;  1MO9 A;  1NAA A;  2YWL A;  5FS8 A;  5GRT A;  4CCQ A;  5KVI A;  4DSG A;  1HYU A;  1IUV A;  1KF6 A;  3DK8 A;  2OA1 A;  1GRG A;  3RNM A;  4C5O A;  3IC9 A;  3NG7 X;  3SGL A;  4I59 A;  4CBQ A;  2WDR A;  1XDI A;  2R4E A;  1BGN A;  1N4U A;  3PVC A;  1PJ5 A;  2H88 A;  2C76 A;  3ABV A;  3BI5 A;  2WHD A;  4A7A A;  3SFD A;  4A99 A;  5J60 A;  2VQ7 A;  2C73 A;  2YG3 A;  4U2S A;  3AYI A;  1IUS A;  2TMD A;  4U8J A;  3CTY A;  2W0H A;  2CFY A;  2C70 A;  3DME A;  1PBB A;  3GMC A;  4YXD A;  4Z26 A;  3DGH A;  5IPY A;  3VRB A;  4U8N A;  2V3B A;  1NHS A;  3FIM B;  2BC1 A;  3PS9 A;  1PBE A;  2X8C A;  4CY8 A;  4H4U A;  3IHG A;  3QSE A;  4B69 A;  4ICY A;  1BF3 A;  1BGJ A;  1JRX A;  1NHQ A;  1D4D A;  3AEA A;  1N4W A;  4RSL A;  3KLJ A;  2HQM A;  3ICT A;  1LQT A;  4TM3 A;  4YWO A;  4UP3 A;  3L8K A;  1DXL A;  1E1L A;  3K7M X;  1GV4 A;  4WX1 A;  2WOV A;  3CGE A;  3ZYX A;  2R0P A;  4A6N B;  2NPX A;  4BK2 A;  1DOD A;  3GSI A;  3K7Q X;  5HYM A;  2WES A;  5LV9 A;  4EIP A;  4UDQ A;  1VRQ B;  2BS4 A;  2GMH A;  4EQX A;  1H86 A;  3G5R A;  2FJA A;  3NK1 X;  3QFB A;  1EL5 A;  4EMW A;  3H8I A;  1L9E A;  1NPX A;  2FJE A;  4H4W A;  1QLB A;  4X9N A;  4Z2R A;  2AAQ A;  3NH3 X;  5HXI A;  4AP1 A;  1GPE A;  4TM4 A;  1UKV G;  3CGC A;  5BRT A;  5JCI A;  3L1R A;  3UTG A;  2EQ6 A;  3PO7 A;  2YLW A;  1JNR A;  1H82 A;  2GRT A;  2RAB A;  3ATR A;  3D8X A;  4JNQ A;  3NYC A;  4AT2 A;  2PHH A;  3B6D A;  5ER0 A;  4YT0 A;  1IUW A;  1XAN A;  3P9U A;  5KXJ A;  2CVJ A;  2YM1 A;  4USQ A;  4Y4N A;  4IVO B;  4CY6 A;  1F8S A;  3AE1 A;  4C77 A; 
#chains in the Genus database with same CATH topology
 3UKF A;  2QVH A;  3OPS A;  4LII A;  3RCY A;  3I4K A;  3FVD A;  2ACZ A;  3UJS A;  4BK3 A;  5IDZ A;  1JU2 A;  4IP4 A;  3RP7 A;  4GAP A;  1BZL A;  2Y6R A;  2MNR A;  3SY4 A;  4I58 A;  1JPD X;  1REO A;  2GQF A;  3P1W A;  1W4X A;  3V5C A;  4JN9 A;  1KCZ A;  4O5U A;  1OJ9 A;  4K8D A;  3EAO A;  3EEZ A;  3KPF A;  4GDE A;  2GGE A;  2XLU A;  1DJQ A;  4U8L A;  1B5Q A;  2OG9 A;  3HYX A;  2BAC A;  1KNR A;  3GWF A;  3AED A;  4H4R A;  3AEF A;  3C4A A;  1JPM A;  4EQR A;  1TE6 A;  3NT6 A;  2AR8 A;  3PWI A;  3LJP A;  3NIX A;  4HB9 A;  3LB8 A;  3Q6J A;  3Q45 A;  4KT2 A;  4A5L A;  4GGH A;  3FXG A;  2QA2 A;  5BVA A;  2OQH A;  3RR1 A;  5FJO A;  2V60 A;  1P2H A;  3GC2 A;  3CPI G;  5JCK A;  4A6G A;  5EB5 A;  1L9D A;  3R07 C;  3KVE A;  4C3Y A;  2ZZB A;  1B4V A;  3UOX A;  1DOC A;  4TM1 A;  3DER A;  1ZDL A;  3BI2 A;  2PU0 A;  2RGO A;  2Q7V A;  3BI4 A;  1R6W A;  5IQ1 A;  4EM4 A;  2C66 A;  1PDH A;  2PTY A;  2E5A A;  3TTE A;  4NNJ A;  3B9J B;  3BOX A;  3EPT A;  4C74 A;  1KKR A;  5GSN A;  2GGJ A;  2XFO A;  2IVD A;  3NVZ B;  1X31 B;  1CC4 A;  4G73 A;  2XLT A;  3GWD A;  1KN0 A;  3NRZ B;  1LVL A;  3R9U A;  2C64 A;  4NTD A;  3VRA A;  1TRB A;  2B9Y A;  1TDE A;  4EWJ A;  4H4X A;  1W6T A;  2WBA A;  2XH0 A;  3P4P A;  3GDN A;  2QGY A;  3D46 A;  2YG4 A;  3H12 A;  4HCL A;  2WDV A;  2W54 A;  1YQ4 A;  3CIR A;  2JKC A;  4Z25 A;  1E39 A;  2X99 A;  1NHP A;  4MKS A;  1EL8 A;  2DW7 A;  3NN6 X;  3HPF A;  4OPT A;  3H70 A;  1GES A;  2UZZ A;  4B63 A;  2OAL A;  3ADA B;  1DNC A;  1FIQ B;  1CC2 A;  1TDN A;  4DSH A;  2C3C A;  1E1M A;  3S5W A;  4IT1 A;  3CXO A;  3NHO X;  2GMJ A;  1CBO A;  1VG9 A;  1YKJ A;  2IVE A;  4DXK A;  4H83 A;  5BUK A;  3AEE A;  3AE8 A;  2W3R A;  3S5S A;  6ENL A;  5FMH A;  2OPJ A;  2AKM A;  1GTH A;  4AT0 A;  3NLC A;  2E5V A;  3NTD A;  4YTM A;  4H2P A;  4GIR A;  4U8K A;  3AEG A;  1PN0 A;  2O9Z A;  3DJD A;  4BUR A;  1PXA A;  2WEU A;  4TLX A;  5BOF A;  1ZX9 A;  1H7X A;  1EBG A;  1N61 C;  3RIT A;  3AE7 A;  3G5S A;  3NO1 A;  3KD9 A;  1KFY A;  2FJB A;  1NEN A;  1VDC A;  4K2S A;  2WP5 A;  2C7G A;  3MSY A;  4GME A;  2YG6 A;  1IUU A;  2ZZC A;  2QJN A;  4HN8 A;  3L5O A;  1JRY A;  2Z5Y A;  5FJR A;  4GIS A;  5C2T A;  2WQY A;  3R11 A;  3UKK A;  1ELS A;  3TOY A;  5HHF A;  1NU5 A;  3GRT A;  1LPF A;  1Y0P A;  5FJP A;  3MKC A;  2QDE A;  4HCD A;  4E5T A;  5J7X A;  1M64 A;  1CJ2 A;  1GOS A;  3SZF A;  2ARD A;  1GRA A;  5EBK A;  3BSM A;  3NN0 X;  3EKG A;  3KUM A;  4ZCC A;  2F5Z A;  3JSK A;  2P88 A;  1AOG A;  2QJJ A;  1ONF A;  4K7Z A;  3NTA A;  2PPG A;  4TLZ A;  4YWS A;  3E1T A;  1WUE A;  1GT8 A;  1GRH A;  2DKI A;  2GQW A;  3VCN A;  2PGW A;  2QAE A;  3T6C A;  1X2H A;  2PCE A;  4OPD A;  4CNJ A;  3KA7 A;  4EMI A;  4B66 A;  1Y56 B;  2PU1 A;  2YAU A;  5M0Z A;  4ROP A;  1P43 A;  2XLR A;  2C75 A;  2BS3 A;  4FX9 A;  2PTW A;  4HYR A;  3F8P A;  2DKH A;  4XWR A;  3V3O A;  3GY1 A;  2W3S A;  3VDG A;  2OZ3 A;  2GH5 A;  4UDR A;  3RGT A;  5GRT A;  3DK8 A;  3CB3 A;  1GRG A;  1SJD A;  3DDM A;  3SGL A;  4CBQ A;  1XDI A;  3R1Z A;  3JVA A;  3NFU A;  3SFD A;  2VQ7 A;  2C73 A;  4U8J A;  2CFY A;  4U8N A;  2O56 A;  1NHS A;  2QQ6 A;  1MDL A;  5FJT A;  3IHG A;  4B69 A;  1TZZ A;  1JRX A;  1D4D A;  1N4W A;  3UCD A;  2HQM A;  3SN1 A;  1LQT A;  4G74 A;  1GV4 A;  3U9I A;  1STZ A;  2WOV A;  3T2Z A;  4UDQ A;  1H86 A;  2FJA A;  3QFB A;  1MNS A;  1EL5 A;  4EMW A;  1MDR A;  5HXI A;  3NH3 X;  4TM4 A;  5BRT A;  3H8A A;  4HNL A;  2EQ6 A;  3D8X A;  3P0W A;  5KXJ A;  4USQ A;  3SR6 B;  4IVO B;  4CY6 A;  1F8S A;  2XFN A;  4JY2 A;  4D03 A;  3AYJ A;  1CHU A;  1TDF A;  3NKS A;  3T37 A;  3ZVI A;  4JN8 A;  3ICS A;  4G6G A;  4GCM A;  2P8B A;  2HXT A;  2AL2 A;  2VRM A;  2V61 A;  4EQS A;  1B8S A;  3JW7 A;  1Y56 A;  5CQF A;  2V5Z A;  3D1C A;  3UCL A;  1MXT A;  2A87 A;  4X9M A;  1FOH A;  3I3L A;  4H4T A;  4H2Q A;  4OVI A;  2BK4 A;  1GRT A;  4Z17 A;  4E4U A;  3DIP A;  5M10 A;  3SN0 A;  1FCD A;  5U1O A;  4JQ9 A;  2NVK X;  2FJD A;  2GL5 A;  1H2I A;  3KKJ A;  3K30 A;  1FHU A;  4U2L A;  3UP5 A;  2X8H A;  1F8W A;  3K7T A;  3NVV B;  5JRB A;  3CNS A;  1PBC A;  1YY5 A;  2PYX A;  1MUC A;  3QPE A;  1H6V A;  4J56 A;  3UKP A;  3THU A;  5BUL A;  1E1K A;  1TDO A;  2YLX A;  3V76 A;  2WU5 A;  2X50 A;  3CPH G;  4DGK A;  3UKQ A;  4NTE A;  4A3R A;  4ECH A;  4II2 A;  4IHC A;  2I5Q A;  2BXS A;  2XH4 A;  5FS7 A;  2AL1 A;  1DOE A;  1FEA A;  4B64 A;  2R46 A;  2PGE A;  2PP1 A;  1H83 A;  5FS9 A;  3QN3 A;  1IUT A;  1KSS A;  4NEV A;  3VCC A;  4APN A;  2PA6 A;  4XXG A;  4H2N A;  1EBD A;  3UKA A;  2EQ7 A;  4U8P A;  5C3J A;  3NXL A;  3GDP A;  1EC7 A;  1S3B A;  4CRT A;  2XFU A;  4U2T A;  3QJ4 A;  1Z6L A;  2BAB A;  3V3N A;  1ELI A;  2P3Z A;  4G6H A;  1X2G A;  3AEC A;  4FP1 A;  2OFJ A;  4FK1 A;  3LAD A;  2Q0L A;  4J1O A;  1E9I A;  2XLS A;  3KU9 A;  3NRN A;  2XDO A;  2PP3 A;  4ZA0 A;  3G5Q A;  5TR3 A;  4USR A;  1VQZ A;  2YVF A;  3P3B A;  5ENL A;  2EQ8 A;  2BYB A;  5IQ4 A;  2GSH A;  2OZT A;  4GAV A;  4YKF A;  4GRT A;  1V59 A;  4YTP A;  3MWC A;  4KWS A;  3NVW B;  3BHF A;  2OVL A;  1D7L A;  3U4F A;  1IUX A;  2Y6Q A;  2FKP A;  3PK7 A;  1OJA A;  4YKG A;  4ZCW A;  2VZ2 A;  3AWI A;  3SZW A;  2VRL A;  3URH A;  1K4Q A;  2GR1 A;  1LJ1 A;  3CN8 A;  3PFR A;  1JDF A;  3DK9 A;  3T8Q A;  3ALJ A;  3MQT A;  4DN1 A;  5J04 A;  4CCR A;  3IJL A;  3NK2 X;  1N5X A;  4YSH A;  4D04 A;  2X8G A;  3S61 A;  5L46 A;  1JRP A;  2XH2 A;  1D4C A;  3TW9 A;  4LA1 A;  3LOV A;  3IJI A;  3I6T A;  1ZP0 A;  3CPJ G;  3JZU A;  2R9Z A;  4H2H A;  4F4R A;  4RG4 A;  4OPU A;  2NQL A;  2C72 A;  2GAG B;  3PWG A;  2B7R A;  2YLR A;  3CXB A;  3RED A;  4B65 A;  2RGJ A;  1VQW A;  3RO6 A;  4FI4 A;  3NYF A;  4J31 A;  1GRB A;  4PAA A;  2IID A;  2TPR A;  1PHH A;  3RP8 A;  4GR1 A;  3SSZ A;  1CL0 A;  2JBV A;  3AE6 A;  3SX6 A;  2JK6 A;  2BS2 A;  1ZK7 A;  4J36 A;  1E1N A;  1M6I A;  4H2R A;  4IP5 A;  2WP6 A;  3COX A;  4FK1 C;  3UOY A;  1KD0 A;  3T9P A;  4KX6 A;  3AD8 B;  1CJ4 A;  5KVH A;  1FEC A;  2B9X A;  3WE0 A;  1GND A;  4OPG A;  3UOV A;  2WET A;  1F6M A;  3SBF A;  1KSU A;  3SXI A;  3ICR A;  1RSG A;  3VRD B;  3VR8 A;  2DW6 A;  2ZZ0 A;  4GGB A;  4EMJ A;  3RHA A;  4YSZ A;  2WPE A;  3UOZ A;  2GR2 A;  1E7P A;  1XPY A;  3FG2 P;  3DGZ A;  3PG6 A;  3CK5 A;  2BK5 A;  3DES A;  2QDD A;  3DJG X;  1ZMD A;  1FFV C;  3ATQ A;  1GXF A;  3V3W A;  4O5Q A;  3I6D A;  3GO2 A;  2HZG A;  4JN7 A;  2OLO A;  3NNE A;  1MRA A;  5FS8 A;  4CCQ A;  1KF6 A;  3RNM A;  3RRA A;  4C5O A;  3IC9 A;  5BOE A;  4I59 A;  2OZ8 A;  2R4E A;  3UXK A;  1PJ5 A;  3B97 A;  3BI5 A;  2WHD A;  1R0M A;  5J60 A;  4H19 A;  3CTY A;  3GMC A;  4Z26 A;  3DGH A;  5IPY A;  2QJM A;  3T2K A;  3VRB A;  3QTP A;  3UXL A;  4CY8 A;  1BF3 A;  1BGJ A;  3T4W A;  3AEA A;  4RSL A;  3ICT A;  1ONE A;  3AMZ A;  3ZVH A;  1N60 C;  4J3Z A;  3ZYX A;  2R0P A;  3K7Q X;  5HYM A;  4EIP A;  3NK1 X;  3AN1 A;  4E4F A;  2W55 A;  2FJE A;  1QLB A;  2AAQ A;  3QKE A;  5JCI A;  3UTG A;  3PO7 A;  1JNR A;  1H82 A;  1PDZ A;  3NYC A;  5ER0 A;  2CVJ A;  2YM1 A;  4Y4N A;  3STP A;  3UP4 A;  3AE1 A;  2OLN A;  4XWZ A;  3CT2 A;  3UCC A;  3GD3 A;  1TYT A;  2OLA A;  3VA8 A;  3S47 A;  2WP9 A;  1F8R A;  4OPI A;  4REK A;  4K8G A;  1Q1W A;  3EF6 A;  1EL9 A;  2GAH B;  4OPL A;  4K22 A;  4AP3 A;  2AL2 B;  1OJD A;  3ALL A;  1S2Q A;  3AE2 A;  4GUV A;  2CUL A;  4E8G A;  2HXU A;  1LQU A;  3UKL A;  3BJS A;  3DEQ A;  3SM8 A;  1H7W A;  4HA6 A;  4AOX A;  2JB3 A;  1OJC A;  1JRO A;  3UKH A;  1P48 A;  3CNP A;  4RG3 A;  1PJ6 A;  3DK4 A;  3QSS A;  3D9X A;  4CNK A;  2Z5X A;  2E3T A;  2B7S A;  3AEB A;  3AD7 B;  4HPN A;  1O95 A;  4X2P A;  4KPL A;  2GB0 A;  1NDA A;  4BK1 A;  2MUC A;  3MY9 A;  3SJN A;  1MOK A;  1GEU A;  4OCG A;  4J57 A;  4BJZ A;  1D7Y A;  4BV6 A;  4DX3 A;  2R45 A;  2JAE A;  1P2E A;  3UJR A;  3QVP A;  3GMB A;  3P4S A;  2J3N A;  1PDY A;  5KMP A;  3NS1 B;  1VG0 A;  5JCM A;  1NHR A;  3AXB A;  4M52 A;  1JCT A;  2JB2 A;  4GYP A;  2WOW A;  4G7F A;  3EAN A;  4B1B A;  2A89 A;  1EL7 A;  1ECQ A;  2CDU A;  1BKH A;  4U8I A;  3A7A A;  1S3E A;  2BCP A;  1CJ3 A;  3R25 A;  4H50 A;  3OW1 A;  1SJA A;  1XPQ A;  1OEP A;  2PS2 A;  2WU2 A;  2BA9 A;  1QJD A;  2EQ9 A;  4IL2 A;  1TKK A;  2YR6 A;  3MZN A;  2XH7 A;  3QSM A;  2JB1 A;  2YR5 A;  3HYV A;  1K0J A;  3IHM A;  1LTX R;  2VVL A;  3ZLH A;  4E6M A;  4EM3 A;  1SJB A;  2ZBW A;  1OJT A;  3DJE A;  4C3X A;  3KPK A;  4J33 A;  1YQZ A;  2I0Z A;  3ETR B;  3K1G A;  3V4B A;  3AE5 A;  4OPC A;  4IZG A;  3VC6 A;  2OQY A;  2GF3 A;  5EB4 A;  2R4J A;  2YR4 A;  4DYE A;  5FS6 A;  4HCH A;  1RVK A;  3CGD A;  3FJ4 A;  4NEW A;  3HYW A;  2PP0 A;  3LZX A;  3UJF A;  3LZW A;  4GDP A;  3ES7 A;  3I6E A;  1PBF A;  1DOB A;  2BCG G;  1K0I A;  1CC6 A;  1ZKQ A;  4IA5 A;  3NYE A;  1KKO A;  2HNE A;  1GET A;  4HNC A;  1T3Q C;  2C3D A;  2RDX A;  3GYI A;  1ZOV A;  1V97 A;  3VQR A;  4A35 A;  1COY A;  3UJE A;  3FV9 A;  2XVE A;  1KNP A;  5G5H B;  3NGC X;  1L0V A;  3ENL A;  1D4E A;  3BNM A;  1B37 A;  4H4P A;  2XYO A;  1DJN A;  1TYP A;  5KNL A;  3SFE A;  1NEK A;  4GYP C;  4AOS A;  4DHG A;  2GV8 A;  2YLZ A;  2VVM A;  1O5W A;  1BQG A;  4NZH A;  2XSX A;  3VR9 A;  3R0U A;  2AQJ A;  4LU6 A;  5U25 A;  3HRD C;  2BXR A;  1BWC A;  4B67 A;  2GVC A;  3OTR A;  2AKZ A;  2GR0 A;  1N4V A;  1Q9I A;  1N62 C;  4JNA A;  4MJW A;  3DG6 A;  4MGG A;  3CND A;  3DG7 A;  1PXB A;  2YG5 A;  3NK0 X;  1PS9 A;  2FBW A;  1L9C A;  4ENL A;  4FDC B;  4GF7 A;  2BK3 A;  4ZCD A;  2B9W A;  1S7M A;  3LXD A;  4Z2T A;  3TJI A;  3IWA A;  1WUF A;  4JDR A;  1Q1R A;  2GGI A;  3AYL A;  3CAW A;  3VC5 A;  4DWD A;  1SEZ A;  3SQS A;  3FYY A;  2ONE A;  1N5W C;  3DGB A;  3DJJ A;  1F3P A;  7ENL A;  2V6O A;  2V3A A;  3RP6 A;  4ADW A;  1H84 A;  1JEH A;  2XVJ A;  5EOW A;  3QFA A;  1YQ3 A;  1FHV A;  3H4K A;  1RM6 B;  2WPF A;  3SN4 A;  4WCT A;  4NTC A;  2XFQ A;  5JCN A;  3M0O A;  1IJH A;  4A65 A;  1MO9 A;  1NAA A;  2YWL A;  2POZ A;  5KVI A;  4G8T A;  1HYU A;  1IUV A;  2OA1 A;  3T0K A;  4G9K A;  3NG7 X;  3T2Y A;  2WDR A;  1BGN A;  3ES8 A;  3ABV A;  3OZM A;  4A7A A;  4U2S A;  2YG3 A;  1IUS A;  2TMD A;  2C70 A;  4YXD A;  5KMQ A;  4IL0 A;  4ZOH B;  1NEL A;  2BC1 A;  3QSE A;  3KLJ A;  2OO6 A;  4TM3 A;  4YWO A;  4UP3 A;  1DXL A;  1EBH A;  3QLD A;  2P0I A;  4WX1 A;  4A6N B;  2NPX A;  1VRQ B;  1VDV A;  2BS4 A;  2GMH A;  3ZVH B;  3H8I A;  1L9E A;  1NPX A;  5KMR A;  4X9N A;  4Z2R A;  4NWZ A;  1UKV G;  3L1R A;  2GRT A;  2RAB A;  4JNQ A;  4YT0 A;  1IUW A;  1XAN A;  3ZLG A;  4C77 A;  3GRS A;  3HZL A;  1D5T A;  4KEM A;  4H7U A;  2QA1 A;  1FFU C;  4H4S A;  5JCL A;  3DFY A;  3O0H A;  3ZLF A;  3N4E A;  4II3 A;  3P4R A;  2C67 A;  4Z24 A;  1ZOY A;  3SQP A;  2XGZ A;  2OX4 A;  1IYX A;  1ZMC A;  1SJC A;  5KOW A;  3DH9 A;  3TCS A;  1RP0 A;  1ZY8 A;  3AE4 A;  3DFH A;  1PBD A;  2YQU A;  1CF3 A;  3IK4 A;  2XLP A;  3SZ0 A;  4K2X A;  2PSN A;  1GTE A;  4K5R A;  2BRA A;  2WOI A;  1TDK A;  3TWA A;  3AE9 A;  3FMW A;  3IJQ A;  3P4Q A;  4PAB A;  4H1Z A;  3B3R A;  3C4N A;  2YLS A;  3OC4 A;  1QO8 A;  3GD6 A;  3CGB A;  2RGH A;  3CYJ A;  3F8R A;  1GER A;  1YEY A;  2GEW A;  1JNZ A;  4A6N A;  2WPC A;  3P93 A;  2H89 A;  4YSY A;  2OKT A;  1JOA A;  1NG4 A;  3SYI A;  2PMQ A;  3EUB 3;  1E6E A;  5KOX A;  2X3N A;  5U63 A;  4UDP A;  5KRQ A;  1N1P A;  2XFP A;  1K0L A;  4Z2U A;  2WS3 A;  3A7U A;  3UTH A;  4X4J A;  2Q6U A;  4U8M A;  2XCG A;  3T14 A;  3MUC A;  1GSN A;  4YSX A;  2GDQ A;  1KDG A;  4H4Z A;  1L8P A;  3AB1 A;  2OAM A;  2ZC8 A;  4Y4M A;  4Z1Y A;  4K5S A;  2C65 A;  5CKU A;  3TQP A;  4M6U A;  1FO4 A;  3ZDN A;  4BJY A;  4IA6 A;  2YM2 A;  2YVJ A;  1N63 C;  3H8L A;  3N4F A;  3UTF A;  3AE3 A;  1WYG A;  3FPZ A;  3GD4 A;  2A8X A;  4U8O A;  1JRZ A;  2CHR A;  5DBJ A;  1BKW A;  3BNU A;  2R0G A;  1NG3 A;  2YG7 A;  4IV9 A;  3BHK A;  3D47 A;  4K1W A;  3M13 A;  4A79 A;  5KWF A;  3HW2 A;  3UGV A;  3NVY B;  3N6H A;  4JHM A;  2Q0K A;  1GRF A;  3Q4D A;  1GAL A;  1SB3 B;  4M0X A;  2E4G A;  3UJ2 A;  1FL2 A;  3V5F A;  3SZC A;  4DNA A;  4Y4L A;  3VFC A;  4J34 A;  4Z43 A;  2BC0 A;  4IVM B;  2PTZ A;  3N6J A;  3ITJ A;  2XVF A;  3CNJ A;  2PTX A;  3R10 A;  2E1M A;  2GR3 A;  3AD9 B;  2YLT A;  1PXC A;  1LV0 A;  4A9W A;  3GYJ A;  4H4Q A;  4N9X A;  4YTN A;  3OZ2 A;  1FEB A;  1EC8 A;  2BRY A;  4E0V A;  3C96 A;  1XS2 A;  3M12 A;  5G5G B;  2VVL G;  3UTE A;  2VOU A;  2QCU A;  5EU9 A;  1O94 A;  4H4Y A;  4GFI A;  3II4 A;  4J2W A;  3IF9 A;  4P9S A;  1PJ7 A;  2XVH A;  2R0C A;  3DA1 A;  4ZN0 A;  2YVG A;  5FJU A;  3ALM A;  4JY3 A;  3OZY A;  4EIQ A;  1RYI A;  1H81 A;  2WDQ A;  2POD A;  3A7R A;  4Z44 A;  1CJC A;  2GGH A;  1S2Y A;  3NZG A;  4KPR A;  4EQW A;  3F8D A;  5HY5 A;  3ISH A;  4TVW A;  4H4V A;  2APG A;  2GGG A;  2XVI A;  3QVR A;  2VQB A;  1EC9 A;  2B76 A;  1GRE A;  4B68 A;  2P8C A;  3CNT A;  3Q9T A;  3T31 A;  3GYX A;  2ZAD A;  4TM0 A;  1XHC A;  4DSG A;  4TVY A;  1ZXI C;  1N4U A;  3PVC A;  2H88 A;  2C76 A;  4A99 A;  3AYI A;  2W0H A;  3DME A;  1PBB A;  1F9C A;  5KMS A;  2V3B A;  3OP2 A;  3FIM B;  3PS9 A;  1PBE A;  2X8C A;  4H4U A;  4ICY A;  1NHQ A;  1DTN A;  2FYM A;  3L8K A;  3DG3 A;  1E1L A;  3K7M X;  3CGE A;  4BK2 A;  1DOD A;  3GSI A;  2WES A;  5LV9 A;  3FCP A;  2C4C A;  4EQX A;  3AM9 A;  3G5R A;  4MMW A;  3TJ4 A;  4H4W A;  3H7V A;  4AP1 A;  1GPE A;  3CGC A;  2YLW A;  3ATR A;  4AT2 A;  2PHH A;  3TWB A;  3B6D A;  3P9U A;  3R0K A;  3CMM A;  3FBS A; 
#chains in the Genus database with same CATH homology
 2OLN A;  4XWZ A;  3UKF A;  3GRS A;  4LII A;  3HZL A;  3GD3 A;  1TYT A;  1D5T A;  2ACZ A;  2XFN A;  4JY2 A;  4D03 A;  4BK3 A;  1JU2 A;  3AYJ A;  2WP9 A;  4H7U A;  3RP7 A;  1CHU A;  1F8R A;  1TDF A;  4GAP A;  4OPI A;  4REK A;  3NKS A;  3T37 A;  1BZL A;  2QA1 A;  2Y6R A;  3ICS A;  4G6G A;  4GCM A;  4H4S A;  1Q1W A;  3SY4 A;  4I58 A;  5JCL A;  3O0H A;  3UP4 A;  3EF6 A;  1EL9 A;  1REO A;  2GQF A;  2VRM A;  2GAH B;  4II3 A;  3P4R A;  3P1W A;  2V61 A;  4EQS A;  1B8S A;  2C67 A;  1W4X A;  4Z24 A;  1Y56 A;  5CQF A;  4JN9 A;  2V5Z A;  4OPL A;  4K22 A;  1ZOY A;  4AP3 A;  3SQP A;  1OJD A;  3ALL A;  3D1C A;  4O5U A;  3UCL A;  1ZMC A;  1MXT A;  2A87 A;  1OJ9 A;  4X9M A;  5KOW A;  3DH9 A;  1FOH A;  4K8D A;  3EAO A;  1RP0 A;  3KPF A;  4GDE A;  2XLU A;  3I3L A;  1DJQ A;  1S2Q A;  1ZY8 A;  4H4T A;  3AE4 A;  4H2Q A;  3AE2 A;  4OVI A;  4U8L A;  4GUV A;  1B5Q A;  2CUL A;  1PBD A;  2BK4 A;  1GRT A;  2YQU A;  3HYX A;  5M10 A;  1LQU A;  2BAC A;  3UKL A;  1KNR A;  1CF3 A;  3GWF A;  3AED A;  3SM8 A;  1H7W A;  4H4R A;  3AEF A;  3C4A A;  4HA6 A;  1FCD A;  4AOX A;  2JB3 A;  3FBS A;  1OJC A;  4EQR A;  2XLP A;  3NT6 A;  3SZ0 A;  2AR8 A;  4K2X A;  3LJP A;  5U1O A;  3UKH A;  4JQ9 A;  2NVK X;  2FJD A;  3CNP A;  4RG3 A;  3NIX A;  1PJ6 A;  3DK4 A;  3QSS A;  1H2I A;  3D9X A;  4CNK A;  2Z5X A;  1GTE A;  3LB8 A;  3KKJ A;  4HB9 A;  3Q6J A;  4K5R A;  2BRA A;  4A5L A;  3K30 A;  2WOI A;  2B7S A;  2QA2 A;  1TDK A;  5BVA A;  4U2L A;  3AEB A;  3AD7 B;  1O95 A;  3UP5 A;  3AE9 A;  2GB0 A;  1NDA A;  2X8H A;  3FMW A;  3P4Q A;  4PAB A;  2V60 A;  4BK1 A;  1F8W A;  3K7T A;  1P2H A;  5JRB A;  3CNS A;  1PBC A;  3B3R A;  1YY5 A;  2YLS A;  2PYX A;  3C4N A;  3CPI G;  3OC4 A;  1QO8 A;  5JCK A;  1MOK A;  5EB5 A;  1GEU A;  4OCG A;  4J57 A;  1L9D A;  3CGB A;  2RGH A;  1H6V A;  3KVE A;  4BJZ A;  1D7Y A;  4BV6 A;  4C3Y A;  4J56 A;  2ZZB A;  3F8R A;  1B4V A;  1GER A;  2R45 A;  2GEW A;  1JNZ A;  3UKP A;  2JAE A;  3UOX A;  1P2E A;  4A6N A;  3QVP A;  1DOC A;  3GMB A;  3P4S A;  4TM1 A;  5BUL A;  1E1K A;  2J3N A;  1TDO A;  2YLX A;  2WPC A;  3V76 A;  5KMP A;  2H89 A;  4YSY A;  2WU5 A;  2X50 A;  1VG0 A;  3CPH G;  5JCM A;  4DGK A;  1NHR A;  1ZDL A;  3BI2 A;  3AXB A;  4NTE A;  3UKQ A;  4M52 A;  4ECH A;  1JOA A;  1NG4 A;  3SYI A;  2JB2 A;  4II2 A;  2RGO A;  2Q7V A;  2WOW A;  2BXS A;  3EAN A;  4B1B A;  3BI4 A;  2A89 A;  1EL7 A;  2CDU A;  1E6E A;  5FS7 A;  5IQ1 A;  4U8I A;  5KOX A;  4EM4 A;  1S3E A;  1PDH A;  2BCP A;  2C66 A;  1DOE A;  1FEA A;  2X3N A;  2R46 A;  5U63 A;  4B64 A;  4UDP A;  5KRQ A;  4NNJ A;  1CJ3 A;  1N1P A;  3EPT A;  1H83 A;  5FS9 A;  1K0L A;  2XFP A;  4Z2U A;  4H50 A;  1IUT A;  1KSS A;  2WS3 A;  3UTH A;  4C74 A;  5GSN A;  4NEV A;  4APN A;  1XPQ A;  4X4J A;  4XXG A;  2Q6U A;  4U8M A;  2WU2 A;  2XCG A;  2BA9 A;  2XFO A;  3T14 A;  4H2N A;  1QJD A;  2EQ9 A;  1EBD A;  2IVD A;  2EQ7 A;  4U8P A;  3UKA A;  5C3J A;  1X31 B;  2YR6 A;  1GSN A;  3GDP A;  4YSX A;  4CRT A;  1CC4 A;  1KDG A;  1S3B A;  4G73 A;  2XFU A;  4U2T A;  3QSM A;  2JB1 A;  2YR5 A;  2XLT A;  1K0J A;  3HYV A;  3IHM A;  3QJ4 A;  1LTX R;  2VVL A;  1Z6L A;  3GWD A;  4H4Z A;  1KN0 A;  2BAB A;  3V3N A;  1ELI A;  3AB1 A;  4EM3 A;  2OAM A;  4G6H A;  1LVL A;  4Y4M A;  2C64 A;  4NTD A;  3R9U A;  3VRA A;  1TRB A;  2ZBW A;  1OJT A;  2B9Y A;  3DJE A;  3AEC A;  4K5S A;  1TDE A;  4C3X A;  2C65 A;  4FK1 A;  5CKU A;  3LAD A;  2Q0L A;  3KPK A;  4J33 A;  4H4X A;  3ZDN A;  2XLS A;  2WBA A;  4IA6 A;  4BJY A;  3KU9 A;  1YQZ A;  3P4P A;  2I0Z A;  3NRN A;  3GDN A;  2XDO A;  2YM2 A;  3G5Q A;  2YG4 A;  2YVJ A;  2WDV A;  3H8L A;  5TR3 A;  4USR A;  1YQ4 A;  3CIR A;  2JKC A;  4Z25 A;  2YVF A;  1E39 A;  2X99 A;  3UTF A;  3AE5 A;  3AE3 A;  4OPC A;  1NHP A;  1EL8 A;  2EQ8 A;  3FPZ A;  2BYB A;  3GD4 A;  5IQ4 A;  4GAV A;  4YKF A;  2A8X A;  2GF3 A;  4U8O A;  5EB4 A;  2R4J A;  2YR4 A;  4GRT A;  1V59 A;  3NN6 X;  5FS6 A;  4YTP A;  1JRZ A;  3CGD A;  5DBJ A;  4OPT A;  1GES A;  4NEW A;  2UZZ A;  1BKW A;  3HYW A;  4B63 A;  3BHF A;  2OAL A;  3LZX A;  3ADA B;  3LZW A;  1DNC A;  3BNU A;  1CC2 A;  2R0G A;  1D7L A;  1NG3 A;  2YG7 A;  4GDP A;  3BHK A;  1TDN A;  4IV9 A;  1PBF A;  1IUX A;  4DSH A;  2C3C A;  1DOB A;  2Y6Q A;  1OJA A;  1E1M A;  2BCG G;  3M13 A;  3S5W A;  4A79 A;  4YKG A;  5KWF A;  3NHO X;  1K0I A;  2GMJ A;  1CBO A;  1VG9 A;  1CC6 A;  2VZ2 A;  3AWI A;  3SZW A;  1ZKQ A;  2Q0K A;  3NYE A;  4IA5 A;  2VRL A;  3URH A;  1GRF A;  1K4Q A;  2GR1 A;  1GAL A;  1LJ1 A;  1YKJ A;  2IVE A;  3CN8 A;  2E4G A;  3DK9 A;  3ALJ A;  1GET A;  4CCR A;  5BUK A;  3AEE A;  2C3D A;  3AE8 A;  3NK2 X;  4YSH A;  4D04 A;  3GYI A;  1ZOV A;  1FL2 A;  2X8G A;  3SZC A;  4DNA A;  3S61 A;  5FMH A;  4Y4L A;  3VQR A;  5L46 A;  1COY A;  2XVE A;  1KNP A;  4J34 A;  1GTH A;  4AT0 A;  3NLC A;  4Z43 A;  2E5V A;  3NTD A;  4YTM A;  2BC0 A;  4H2P A;  1D4C A;  1L0V A;  3NGC X;  4U8K A;  4LA1 A;  1D4E A;  1PN0 A;  3AEG A;  3LOV A;  4IVM B;  2O9Z A;  3DJD A;  3ITJ A;  4BUR A;  1PXA A;  3BNM A;  1B37 A;  1ZP0 A;  4H4P A;  2WEU A;  3CPJ G;  2XYO A;  2XVF A;  4TLX A;  3CNJ A;  2R9Z A;  1DJN A;  1TYP A;  1ZX9 A;  1H7X A;  3AE7 A;  5KNL A;  3G5S A;  4RG4 A;  3SFE A;  1NEK A;  2E1M A;  4OPU A;  2GR3 A;  3AD9 B;  3KD9 A;  2YLT A;  4AOS A;  1KFY A;  1PXC A;  2C72 A;  1LV0 A;  2FJB A;  2GAG B;  4A9W A;  1NEN A;  1VDC A;  3GYJ A;  2WP5 A;  2GV8 A;  2C7G A;  4H4Q A;  2B7R A;  2YLR A;  3RED A;  4B65 A;  2YLZ A;  4N9X A;  4YTN A;  3OZ2 A;  2VVM A;  2RGJ A;  1FEB A;  1VQW A;  3NYF A;  1O5W A;  2YG6 A;  4J31 A;  1IUU A;  1GRB A;  4NZH A;  4PAA A;  2ZZC A;  2BRY A;  3VR9 A;  4E0V A;  2AQJ A;  3C96 A;  4LU6 A;  5U25 A;  2BXR A;  2IID A;  1BWC A;  2TPR A;  1PHH A;  3M12 A;  3RP8 A;  4B67 A;  4GR1 A;  2GVC A;  3L5O A;  1JRY A;  2VVL G;  3UTE A;  2VOU A;  2QCU A;  2GR0 A;  1N4V A;  1Q9I A;  1CL0 A;  1O94 A;  2Z5Y A;  4JNA A;  4MJW A;  2JBV A;  4H4Y A;  3AE6 A;  3SX6 A;  2JK6 A;  3II4 A;  2BS2 A;  1ZK7 A;  4J2W A;  3IF9 A;  4J36 A;  1E1N A;  1M6I A;  3CND A;  4P9S A;  1PJ7 A;  1PXB A;  2XVH A;  4H2R A;  2YG5 A;  5C2T A;  3NK0 X;  2R0C A;  2WQY A;  2WP6 A;  3DA1 A;  3COX A;  4FK1 C;  3UKK A;  1PS9 A;  2FBW A;  3UOY A;  4ZN0 A;  5HHF A;  1L9C A;  2YVG A;  3GRT A;  1LPF A;  4KX6 A;  3ALM A;  1Y0P A;  3AD8 B;  4FDC B;  4GF7 A;  2BK3 A;  4ZCD A;  1CJ4 A;  2B9W A;  5KVH A;  1FEC A;  2B9X A;  3WE0 A;  1S7M A;  1GND A;  4JY3 A;  5J7X A;  3LXD A;  1M64 A;  1CJ2 A;  1GOS A;  3SZF A;  2ARD A;  4OPG A;  2WET A;  1F6M A;  3UOV A;  4EIQ A;  1RYI A;  1H81 A;  2WDQ A;  1KSU A;  1GRA A;  5EBK A;  4Z2T A;  3SXI A;  3IWA A;  3NN0 X;  3ICR A;  4ZCC A;  4Z44 A;  2F5Z A;  1CJC A;  1RSG A;  4JDR A;  3JSK A;  3VRD B;  1Q1R A;  3VR8 A;  1AOG A;  3AYL A;  1S2Y A;  1ONF A;  2ZZ0 A;  4K7Z A;  3NTA A;  4TLZ A;  3E1T A;  4EMJ A;  4KPR A;  1GT8 A;  1GRH A;  4EQW A;  2DKI A;  3F8D A;  3RHA A;  1SEZ A;  4YSZ A;  2GQW A;  2WPE A;  5HY5 A;  2QAE A;  3UOZ A;  3ISH A;  4OPD A;  4CNJ A;  3KA7 A;  4H4V A;  4EMI A;  3DJJ A;  1F3P A;  4B66 A;  2GR2 A;  1Y56 B;  1E7P A;  2V6O A;  3FG2 P;  2APG A;  2V3A A;  3RP6 A;  4ADW A;  1H84 A;  2YAU A;  3DGZ A;  1JEH A;  3PG6 A;  2XVJ A;  2XVI A;  5EOW A;  5M0Z A;  3QFA A;  2XLR A;  2C75 A;  2BK5 A;  3QVR A;  2VQB A;  2BS3 A;  4FX9 A;  1YQ3 A;  3H4K A;  2B76 A;  1GRE A;  4B68 A;  2WPF A;  3DJG X;  1ZMD A;  3CNT A;  3ATQ A;  1GXF A;  3Q9T A;  4O5Q A;  4NTC A;  4WCT A;  2XFQ A;  3I6D A;  3T31 A;  3F8P A;  2DKH A;  4XWR A;  3GYX A;  5JCN A;  3V3O A;  4TM0 A;  3M0O A;  1IJH A;  4A65 A;  1XHC A;  2GH5 A;  2OLO A;  4UDR A;  3NNE A;  1MO9 A;  1NAA A;  2YWL A;  5FS8 A;  5GRT A;  4CCQ A;  5KVI A;  4DSG A;  1HYU A;  1IUV A;  1KF6 A;  3DK8 A;  2OA1 A;  4G9K A;  3T0K A;  1GRG A;  3RNM A;  4C5O A;  3IC9 A;  3NG7 X;  3SGL A;  3T2Y A;  4I59 A;  4CBQ A;  2WDR A;  1XDI A;  2R4E A;  1BGN A;  1N4U A;  3PVC A;  1PJ5 A;  2H88 A;  2C76 A;  3ABV A;  3BI5 A;  2WHD A;  4A7A A;  3SFD A;  4A99 A;  5J60 A;  2VQ7 A;  2C73 A;  2YG3 A;  4U2S A;  3AYI A;  1IUS A;  2TMD A;  4U8J A;  3CTY A;  2W0H A;  2CFY A;  2C70 A;  3DME A;  1PBB A;  3GMC A;  4YXD A;  5KMQ A;  4Z26 A;  3DGH A;  5IPY A;  3T2K A;  3VRB A;  4U8N A;  5KMS A;  2V3B A;  1NHS A;  3FIM B;  2BC1 A;  3PS9 A;  1PBE A;  2X8C A;  4CY8 A;  4H4U A;  3IHG A;  3QSE A;  4B69 A;  4ICY A;  1BF3 A;  1BGJ A;  1JRX A;  1NHQ A;  1D4D A;  3AEA A;  1N4W A;  4RSL A;  3KLJ A;  2HQM A;  3ICT A;  1LQT A;  4TM3 A;  4YWO A;  4UP3 A;  3L8K A;  1DXL A;  4G74 A;  1E1L A;  3K7M X;  1GV4 A;  4WX1 A;  2WOV A;  3CGE A;  3ZYX A;  2R0P A;  4A6N B;  2NPX A;  4BK2 A;  1DOD A;  3GSI A;  3K7Q X;  3T2Z A;  2WES A;  5HYM A;  5LV9 A;  4EIP A;  4UDQ A;  1VRQ B;  2C4C A;  2BS4 A;  2GMH A;  4EQX A;  1H86 A;  3G5R A;  2FJA A;  3NK1 X;  3QFB A;  1EL5 A;  4EMW A;  3H8I A;  1L9E A;  1NPX A;  2FJE A;  5KMR A;  4H4W A;  1QLB A;  4X9N A;  4Z2R A;  2AAQ A;  3NH3 X;  5HXI A;  4AP1 A;  1GPE A;  4TM4 A;  4NWZ A;  1UKV G;  3CGC A;  5BRT A;  5JCI A;  3L1R A;  3UTG A;  2EQ6 A;  3PO7 A;  2YLW A;  1JNR A;  1H82 A;  2GRT A;  2RAB A;  3ATR A;  3D8X A;  4JNQ A;  3NYC A;  4AT2 A;  2PHH A;  3B6D A;  5ER0 A;  4YT0 A;  1IUW A;  1XAN A;  3P9U A;  5KXJ A;  2CVJ A;  2YM1 A;  4USQ A;  4Y4N A;  4IVO B;  4CY6 A;  3CMM A;  1F8S A;  3AE1 A;  4C77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...