3USES

Crystal structure of e. coli hydrogenase-1 in its as-isolated form
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
268
structure length
268
Chain Sequence
b'KPRIPVVWIHGLECTCCTESFIRSAHPLAKDVILSLISLDYDDTLMAAAGTQAEEVFEDIITQYNGKYILAVEGNPPLGEQGMFCISSGRPFIEKLKRAAAGASAIIAWGTCASWGCVQAARPNPTQATPIDKVITDKPIIKVPGCPPIPDVMSAIITYMVTFDRLPDVDRMGRPLMFYGQRIHDKCYRRAHFDAGEFVQSWDDDAARKGYCLYKMGCKGPTTYNACSSTRWNDGVSFPIQSGHGCLGCAENGFWDRGSFYSRVVDIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase-1 small chain
publication title X-ray crystallographic and computational studies of the O2-tolerant [NiFe]-hydrogenase 1 from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 81
structure length 268
sequence length 268
chains with identical sequence T
ec nomenclature ec 1.12.99.6: Hydrogenase (acceptor).
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
S PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 3useS01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 3useS02
4UPEA 1YQWA 1UBOS 4UE2A 3ZE9A 1WULS 4KN9S 1WUHS 4KO4S 4IUCS 4U9HS 4UQPA 1H2RS 4CI0B 4UE3S 4UD6A 3UQYS 3ZEAA 4KO2S 3AYXB 4IUDS 1WUIS 3ZE7A 5JT1A 1UBTS 1UBUS 1UBHS 4UCQA 5D51S 4UCWA 5A4IS 4UPVA 4KO1S 3USES 3RGWS 4UEWA 5JSYA 1UBMS 3H3XA 5JSHA 4OMFG 1UBJS 5JSKA 3ZE6A 5JRDS 5A4MS 5JSUA 1UBLS 5ADUS 1YRQA 2FRVA 1UBRS 4UE6A 3AYZB 3ZE8A 1E3DA 1UBKS 1H2AS 4IUBS 4UEQA 4UQLA 1YQ9A 4TTTS 2WPNA 4KO3S 1FRVA 3MYRA 4C3OB 3CUSA 4URHA 1CC1S 5A4FS 1FRFS 1WUKS 3CURA 4KL8S 1WUJS 4UCXA 4GD3Q 4UD2A 3USCS 4U9IS
chains in the Genus database with same CATH superfamily
1A0OA 1NUTA 4ZWNA 1EU1A 4UPEA 3BIXA 4EDHA 1CUAA 2Y1EA 5KU1A 2D7JA 1YRYE 5MDHA 4ZQCB 3I6YA 3TNJA 4Z4GA 3SEFA 1U4SA 3ZY5A 5K0CA 4FIZA 1Y8RA 1KQNA 5E6SB 1DEHA 2JK1A 4CLEA 1HQYE 4LYYA 1TZ2A 2FSUA 4KN8A 2GSDA 3ZLUA 1APBA 1QH8A 2HKIA 3N70A 4UQPA 1YV9A 1FFXB 5C1PA 1P2UA 2VT3A 4Q7MB 5BT8A 2C99A 3HZOA 1NLFA 3DO6A 4YALA 3PRYA 4HT3B 2VHUA 3EGCA 3U7QA 1WX1A 3HYNA 3JYQA 1E6UA 4EYOA 1CUXA 5F51A 2WDZA 5E6SA 4DA6A 1J0AA 5JMWA 2VQEB 5ARDA 1TCAA 4JLVA 5BPHA 4CWAA 1KVTA 1D1TA 4LPSA 2ECOA 2H52A 2QRJA 3GH3A 2DHDA 1NX6A 4BMPB 1FFXA 2WIJA 4GX1A 4U0JA 3AFHA 1T2NA 5FYQA 1EGMB 3TCKA 4BWYA 1PV4A 2RK3A 3K9NA 4REQA 4TV8F 5JT1A 5T7BA 1LB1B 2QUKA 3ZBQA 3N28A 5CCXA 1QYRA 2PD4A 2ZROA 2QE7D 1U0HC 3EG9B 1AGRA 1YR8A 2LWIA 3B3GA 1J6UA 4K2AA 4NESA 4S3MA 5DOVA 5CG2A 5F3RA 5EJ7A 5TQ2A 3UICA 4TYNA 2PZEA 3GAFA 3R6DA 4KWHA 2JJ2D 3JXEA 4JUFA 4J2TA 3H0CA 3VDXA 3R0ZA 4Q3LA 3WL3A 5CFOA 1KK2A 2V7QA 4BATA 2QJWA 1XWFA 1UJMA 3R7DA 2IIVA 3KQOA 3EG9A 2IPLA 1I7NA 3IEXA 5EWMB 3CCFA 4UXJA 2YXEA 3HYSA 3AI1A 3I9KA 4ZCSA 3X43A 5JTUA 3JQ7B 4W1PA 4JBLA 5CA1B 4DPMA 3HDVA 4DTCA 2PGIA 1U3DA 2V6GA 3WBBA 3KAQA 3K5IA 3QU7A 3AI2A 1ORTA 1KARA 1PSZA 1LVGA 1O1YA 4K1LA 2ZJ4A 4L6CA 4ZZ2A 1EG7A 2HPVA 5CVEA 1XELA 4JYPA 1E2FA 4NBSA 3D9QX 3C98A 1KDYA 2GM4A 3JPWA 5C8YF 3OE5A 2OXEA 1GUBA 5EWMA 1Y6GA 2NMVA 4KX3A 2ZI6A 4V24A 3E22B 5E9JA 5CA1A 2G07A 1EVJA 1KI6A 1L4BA 1XTTA 3ABZA 3ZI7A 2AI1A 4LRXA 1GL6A 3RSGA 2BCEA 3K9FC 2B35A 2QTGA 3GGGA 3FMGA 2GM5A 2B25A 1EWRA 2GZ2A 4H3HB 4L15A 4MQEB 4YRLA 5FBKA 3NZEA 3SICE 3GNQA 1ESDA 1G3RA 1UBKS 2CMKA 3RHSA 2GNOA 1C7JA 2A6PA 4JT2A 3IUQA 5B4VA 2BFEA 2Y05A 4PXSA 3BMQB 3RRBA 2VATA 1OD6A 1WSAA 3OAAD 4WOBA 2HZ7A 2YBEA 4ML3A 4G5SA 3B9PA 5AJUA 1GCOA 2V9PA 4F2HA 4EY7A 3LY8A 3BAFA 4MQEA 2CHQA 1P33A 1KIMA 1TIPA 3N39C 1T8WA 4RIGA 4Z9FA 1EH5A 5A4DA 3HCWA 1J42A 1QR6A 1PWXA 4EFMA 4F8JA 3IUSA 4RSMA 1HDRA 3V4OA 4P8RA 3CKYA 3GDOA 3BMQA 3BZBA 4EELA 2XMDA 1CR0A 4R2KA 2I4MA 3BS4A 4HDCA 3V6LA 5B1EA 1L7NA 4YRCA 1PWEA 1BCSA 1O94C 3ZIAD 1OI3A 2YXLA 4DJJA 4ACAA 1EFRD 1LV8A 1OI7A 3GLTA 4KP7A 3HGQA 3NIBA 3PFHA 2CVOA 3DZBA 4YHHB 3WHKA 1NRJB 1ZITA 3LHIA 3Q4GA 5CLJA 2B8WA 1NVAA 3O21A 3TW6A 2ZUFA 3TRHA 3DLAA 2VSYA 4KVAA 5CX1A 4BFUA 3B6MA 4P98A 4I50F 5FBLB 4EF4A 2IXTA 3MEQA 2J7PD 4UHJA 1DAEA 3VKFA 1EBUA 1HBJA 1QTIA 2DPLA 3L8HA 3UMJA 4EEKA 4NXNB 3ORRA 5IDWA 1K88A 4ZRNA 5A3VA 2OPBA 2OO5A 3FMPB 3FNRA 3SK0A 3W5AA 1E3SA 1BE1A 1J0BA 3QBVA 5K3DA 3U56A 2H1CA 1EBFA 1U4NA 1CW2B 4BUZA 1JJAA 2QVXX 4J8PA 5EPUA 3EAFA 4WK4B 1EFKA 4GWLA 2BFOA 3CNEA 3JYLA 3ABIA 3FYTA 4L1KA 1A4IA 1LWOA 1NVUQ 5HRCA 2CNOA 1ZICA 2M1ZA 3BICA 1KSGA 3U62A 4AF7A 1Z22A 2GHQA 1Z13A 2NADA 2ES4A 5FHRA 5MF6A 3IKMB 1OWNA 2OORA 3UUWA 3RLIA 3DFUA 2OCBA 3EEIA 1L4GA 3TX6A 3NPAA 1MRNA 4YRGA 4UCWA 3NWPA 2XCRB 4R0VA 2DSTA 5FOVA 2HTEA 2C2ZA 2QD5A 3RFVA 2QSYA 3ETNA 2HA3A 2K87A 4MGZR 3N76A 3P9IA 2ID9A 5JQWA 2CL6X 3G79A 1TQ2A 3NEPX 3N3AC 4KI7A 4N5IX 1PG2A 1J23A 1O9HA 1V4VA 2CEKA 2F48A 1NNSA 4DJAA 4IVPA 5ELMA 1HEUA 4K46A 2HHJA 1XLTC 2I76A 4MARA 4UBJA 3LDAA 4FZ5A 1WCV1 2P62A 3RTGA 3VR6D 3EDOA 5EIOA 2YVUA 2D8MA 3DQPA 4N54A 2X8LA 4UCFA 3U39A 1OYVA 2F3QA 2PXHA 1LPBB 3MOIA 4CKXA 5AJHA 1CCWA 5AI0A 2C07A 5G3YA 3X1MA 4ZD6A 1V39A 4KPGA 3U4AA 4M6WA 5DHTA 3UMBA 3NDJA 2CEAA 2BCGY 3NG1A 1DUIA 3QLUA 4G86A 4QWWA 1E61A 3KUDA 1CB7A 4QUAA 2RHOA 4I1SA 2IIQA 1EX6A 3L0ZA 1BMQA 1BKSB 2FETA 4EW6A 4POOA 1DELA 5HJEA 1SCKA 1H85A 3SKYA 3P2OA 1NPDA 3BBPA 3F0TA 3CZAA 1E9RA 4WECA 3ZU4A 4B8WA 5TV2A 1DIAA 1K7FB 1R4ZA 1Z4LA 4Q1EA 4ITRC 2QUBA 2NQTA 1RHQA 3B9BA 4KIJA 1ZMXA 3K09A 3AL3A 4E14A 1ES9A 3L8GA 1Z34A 4YCNA 1G8JA 2W0SA 1U80A 4M9SA 4F8EA 4YIHA 3V2HA 1M0WA 1WZCA 4RSHA 4OJYA 2PQMA 2VP2A 2NUPA 3S7TA 1UK8A 4U00A 4YMGA 1KP2A 5A1TA 2RJOA 3H6GA 1L7OA 3T0FA 4B31A 2CV0A 3L1UA 1NP6A 2YXNA 5EJFA 5CNJA 4HWOA 3N2KB 3C3MA 4ZOBA 3H5TA 3QI2A 4KX5A 2H4ZA 4KO8A 3W2FA 3RW9A 3NKFA 3WGYA 2PM8A 2AG1A 2PNFA 3AUKA 3DFKA 4M88A 4O02B 4FYIA 2D6FA 2H5IA 2PGOA 5AW8A 1XEWX 4P3NA 4M83A 2RE8A 4XCXA 3PE3A 1JU3A 1HDCA 1BHO1 3HZHA 3LUJA 5F21A 5BWOA 1WDKA 4FEEA 1B8PA 3C4VA 1VL0A 3TQFA 3WKBA 4DIKA 2C96A 2C82A 1UMKA 4Q3NA 4Y2SA 3GDGA 4I3HA 4JDPA 2YZMA 4L02A 2ZCJA 4YH1A 2I22A 2ZAYA 4ND3A 3VHXB 4PAGA 4GE3A 1Y1TA 7MHTA 3IQEA 1MMFB 1XCOA 2ZIZA 4E13A 1VCMA 3E7FA 4HZGA 2H3HA 3HDTA 4RIHA 3WZLA 5KWEA 2RH4A 1EFCA 4QBTA 3BD6A 4EA7A 4ZI3A 3GPBA 3PK0A 5HUJA 3TEFA 3HB5X 1JKFA 1X7YA 1UAAA 2QW0X 3JVDA 4NQRA 5CHEA 8LDHA 3D6HA 2X4DA 3BL8A 3NPMA 1A50B 4TKUB 4XAQA 4DAEA 1GPKA 2AI2A 1GKUB 2ZUSA 3X1DA 5BQFA 4BBPA 4ZTBA 2NTJA 5NLLA 3LNCA 1S0UA 2X76A 3DOHA 4RFLA 4UCQA 2E21A 3TIXB 3VU3A 1MNQA 1XRLA 2MT9A 4FEAA 4V0OA 3VM6A 1TKAA 1RM5A 3Q8WA 4O4JB 3A4TA 1IK4A 3LAWA 5CM2Z 3CUVA 4TRRA 4TKUA 4QBIA 2GGSA 3TTYA 3U44A 2XE7A 1GUDA 1KBQA 2HREA 1Q0PA 1SXJB 2IW3A 3EVZA 2H1SA 3OZRA 4R68A 1G17A 2CGEA 2RHGB 2YJGA 3D6JA 3EODA 3KR1A 4LDRA 3L0BA 1YI8A 3IHWA 4FWTA 2I7DA 5JJKA 1WHTB 1GGKA 3K0BA 4Y6GB 1P1FA 4G07A 2C4MA 4A92A 2ZTHA 1ZJWA 3OICA 4MWBA 1ORDA 2JD2A 2OE2A 3OIDA 2BBSA 4UUNA 4AS1A 3LPAA 4OK5A 2FFQA 3GRKA 1SXJA 5JCZA 1LS1A 1DAHA 3T61A 4AJPA 1IJKA 1TX4B 2QLMA 1JG2A 4QQKA 4EOGA 4IS3A 1OUMA 2NZWA 1KIFA 4YMWA 3TWOA 5G4KB 4DDTA 3A9RA 3PICA 3IBCA 4AM8A 1EXVA 3BT7A 1UWKA 3ROGA 2H8GA 2PMFA 4CHTA 1SHZA 2CK3A 4B3JA 4D8XA 3B60A 3IBSA 3AKZA 1P29A 2OCIA 1NSFA 1SC9A 4IJMA 4BS9A 1G20B 1L5HB 3ELDA 3N2GA 4D9JA 2GEVA 3NMUF 1KDZA 1JS1X 3DYIA 5G4KA 3SS9X 3LLCA 1YUNA 4Q4JA 1ZD1A 3EC1A 3ESBA 3P2JA 4Z9BA 3RIHA 3R3VA 4ESHA 4J3JA 4QDOA 2FWAA 1QMGA 2G1UA 2R48A 3H75A 5C35A 5LQAA 1KR5A 1XYGA 1R8XA 3DB1A 1QGUB 2I6XA 3QNMA 4NK5A 2F6RA 1L5HA 3UF0A 3VGJA 4Q0MA 1OH6A 3AVVA 1UDCA 5KNDA 2LR0A 4UVEA 4X6LA 1FTGA 3GA7A 6REQB 5JNLA 4U1RA 4WXMA 3JAKB 3SQOA 1UWCA 4JVOA 1L6RA 1USVA 4KXQA 1CV2A 4N01A 3RVQA 2Q2OA 2O4CA 1JFRA 1K6EA 3FA2A 4FB5A 1OLOA 3NTRA 2ZB4A 3UJHA 3UXEA 2FV8A 4KAJA 5JNRA 1VMAA 3JWGA 3KBOA 3KQQA 4J7CA 1CY2A 5IJ9A 3HUUA 1EE2A 1UT5A 2JIOA 3EZ7A 5GJVC 1Y8AA 5H9WA 4E1BA 3HPQA 1QX3A 2GO1A 5E2AA 4ZKEA 3G68A 3WR5A 1SXGA 3ZLVA 3ZWKA 3DXYA 1EFVB 5FX2A 1GGFA 4EHLA 3FVTA 2CSUA 4G0ZA 2IYWA 2C9CA 3OPNA 1P6XA 2A9PA 1B42A 3JVEA 3I12A 2FA9A 3FWHA 1ISSA 3O47A 2JAPA 4J0DA 2AFVA 1JR3A 1KYZA 2FNAA 3GLSA 4MYSA 3RO7A 4UUOA 2XUFA 3NX4A 3IMEA 2EFEB 2Y1XA 4Q15A 2EXXA 4LMBA 3PHLA 5E7JA 3DNPA 4N6GA 1PTJC 1ODTC 1JIXA 1WP9A 3AERB 3YASA 1AQIA 4UBLA 1XIVA 2G9RA 5ALDA 3CA8A 1H4QA 1VXRA 4CF5A 3UAVA 1SKYE 2YQ4A 1NUPA 2JGEA 2ZLBA 1WXIA 1WSWA 4KRGA 3O94A 5FNVB 1EVEA 3VR1A 4FYVA 1GUFA 1YMVA 4Y9DA 4C2UA 1YO6A 5B30A 1AQLA 2D5IA 1RS0A 3QEBZ 621PA 1KERA 1NQVA 2VLIA 3GCDA 3R6WA 4D9CA 5K03A 3AERA 4MV0A 4N7MA 2Y1DA 1F8GA 2B4KA 1YL6A 3GUHA 3JQAD 4R8SA 5H1YA 5HW0A 2WZBA 4FNOA 1TF7A 5K0SA 2HWYA 3WJ7A 2B98A 1V4NA 5FHQA 1QYWA 1QLHA 5AVJA 5FNVA 4YV1A 2YY7A 4OLAA 4PSCA 5F23A 2I7XA 3BQNB 4MGEA 5BV1A 2P3SA 3QP9A 2GASA 3OH8A 2DG2A 4FE7A 3MK31 4Y0VA 4K8RB 5TY0A 3DF9A 3OZCA 2IH5A 4WUTA 3GVHA 1RQ2A 2Q6TA 4X6YA 4DABA 4ZMBA 4JB3A 2EKZA 1TJ3A 3GCXA 1D2EA 2VUHB 4Z3DA 5L7WA 1QP8A 1S2NA 2B94A 3G9QA 3PEUA 1SC1A 2Z2JA 5AKIA 2JRCA 3ZR4B 5K0JA 1G8MA 2FAXA 2I4NA 2SCUA 3UT5A 2D0IA 5E3HA 3L0YA 4DCMA 3FCAA 5LYJA 3R24A 3PVSA 5ADUS 5CNIA 5IAOA 2E5LB 5A5EA 4C0XA 2BFWA 2X0IA 4KSCA 4KH1A 2BJHA 2OYCA 4DCGA 2WIDA 1ZSYA 1J06A 3EXG2 2PT6A 5CVDA 1LW6E 5DLEA 1C1HA 1NN0A 3OOYA 3M5WA 2XCUA 3L06A 4HN9A 4MINA 4IUYA 2PHZA 3O3OB 4FHGA 4X20B 2OV4A 2BEUA 2ZUWA 1S3FA 4YGYA 1CZUA 1JBKA 1LBHA 5DYIA 1F2TA 2VJLA 2NAPA 2PKYX 4B4KA 2JJ8A 2HHCA 2P0AA 1HSOA 4YRJA 1E2NA 3LT1A 1O2DA 2JHGA 1P5ZB 1KQFA 3IT3A 5LM3A 3I0ZA 1A8IA 4MKIA 3WVNA 5JS6A 2YIJA 3HA7A 1RQPA 3TTXA 4DNXA 1QBKC 2J4CA 4GPAA 4E5MA 3AVTA 2V7BA 2ECQA 4FMCB 2WY2D 4YP0A 4JN6B 1REQB 1P2TA 1SZJG 3UAZA 3IEPA 3A8TA 3LWZA 3ORQA 3L4SO 1LY1A 2FWNA 4Q9KA 1FDUA 1QQ5A 2HH9A 5HJ5A 5B12A 4JB8A 1DEKA 4NECA 1FS4A 3OIFA 4RTOA 1NR1A 1QHSA 3LX5A 4ZC8A 1LNZA 1E92A 1GSOA 3HGMA 2ZWAA 3B51X 4MDYA 1LI4A 3LUHA 2VAMA 1UXHA 4O5AA 4XUDA 3TO5A 3GLFA 2PUEA 4NYMQ 4ITUA 1K97A 2IYXA 4PPNA 5M3BA 1E7SA 2VJNA 3S5JA 4LFAB 4FJ1A 4KC0A 1IZYA 2MYPA 4DCNA 5IYZB 5LYJB 2AYXA 1OI2A 4S1NA 3DZKA 3M0EA 4AXBA 2IYOA 1OWPA 3IMCA 1VG9B 4CV1A 4ER6A 1JYEA 2VPWA 2YDXA 2XOKA 1JEEA 1OIXA 3C6ZA 2XE4A 1BJKA 3HDQA 4ENTA 3RSHA 3FLMA 4KGDA 1DJOA 2ORWA 3I6BA 5GP1A 4A7PA 4HPJB 4Q7KA 2NM0A 2WOJA 3DV0B 1S89A 1I8TA 5CYFA 5IYZA 2OCLA 4ROSA 1EWYA 2EQAA 2ZIAA 3AILA 1GU7A 4OAPA 1ZHFA 2FW9A 4I08A 5EUBA 1GAEO 3GBSA 4TQ9A 1CUFA 1YQUA 4GEGA 4B6SA 4V0MA 4E70A 4E0BA 3VZQA 1H2ZA 5FL3A 3DV0A 1JG3A 1RXIA 1IY9A 3KJQA 2P5TB 2JZNA 1UBTS 4YO8A 3KQYA 1JB1A 2Q50A 3P9ZA 4E6EA 1J8DA 2QX9A 3DOJA 4H16A 1ZU4A 4RYDA 4DJFC 4C6RA 2HBQA 1W30A 3SZLA 3K2IA 4TMFA 4B3GA 4GXQA 5EQFA 4BECA 3T3NA 1R64A 2R6AA 4KE9A 1NW7A 3RREA 1P0QA 1RAGA 4E5YA 1TPZA 1TU0A 5F12A 1GQQA 1QJCA 4YUXA 2FZKA 5CHYA 4C08A 1YHNA 1EVIA 1XVVA 4Q7LA 4AZ3A 4GP9A 2QQGA 2QF7A 4EARA 1RBMA 1KJIA 2O3TA 2LRHA 1MTZA 4DCJA 3UB2A 2C78A 5CH8A 2XCIA 1J09A 4MWEA 4BUCA 1XTQA 2I8LA 3LBIA 4O59O 2R5NA 1MO3A 1X1EA 3ZWVA 2F43B 1T4MA 3DTYA 2AF3C 1XF1A 3VO2A 5LD2C 1FU7A 1Q57A 1K5PA 2GHIA 1O57A 4L0DA 3JRWA 2H5EA 4LYHA 4XB2A 3D0QA 2COUA 3IVCA 8ADHA 4BFCA 3W9YA 4WGFA 4CLRB 2PT7A 3MOGA 4OFBA 5GIOE 1TUBB 1SVOA 1L7QA 3CX7A 3KWMA 1Z0FA 4J0IA 1NW6A 4AW9A 5C2JB 5E1OA 1Y33E 3GGDA 3IP3A 4F7DA 1NQOA 2A57A 3KZVA 1NXPA 2Q2NA 4A16A 4RTLA 2F43A 2I1QA 4JVLA 3CR3C 3FTNA 4RA6B 4RZIA 3K20A 3FD8A 5JARA 1W34A 3CH5A 3TD6A 4MROA 1UPBA 1E58A 4MULA 4UU1A 1TUBA 1XYYA 2O2JA 1Q7TA 2ORED 2C54A 2VWGA 3DOEA 1R6XA 2ZYRA 5AHOA 3REQA 3WMXA 4ZICA 2ZIWB 3SJAA 3U4IA 3HN2A 3HS3A 1NJ5A 1W19A 2C61A 3DVRX 5B1YA 4RV9A 4ZJZA 2QLJA 4ARIA 3HFRA 2I7CA 5EJ2A 2HRCA 2YQ5A 2PAFA 1KPHA 3EFOA 3EZGA 4J90A 1YS9A 4ND5A 2C2XA 1ZWKA 3F46A 3EBLA 3A1WA 3DO8A 2RAPA 2EFHB 2B1GA 2FPSA 1E6CA 1ZP6A 3A4VA 3L7MA 4MEBA 1ETUA 2FTKE 2JI7A 4Y7DA 3NU1A 1OHHD 2Y9PB 3W0LB 5HPYB 4I4IA 1XJ0A 5C0OE 2QWXA 5EG5A 3BWCA 3PYMA 4XWTA 4ETNA 1XDZA 4KWTA 1SOVA 4QDJA 1EP2B 2QIOA 3M34A 5MFPA 4IIFA 5GM2A 4TRMA 1PK9A 1USIA 2QAGC 5HE8A 3C3YA 3QA3E 2FPRA 3SYRA 1IQPA 1JW9B 1L5SA 5CCEA 4HPWA 2OCGA 1J8FA 2WAMA 1S8FA 3HKDB 4RQAA 3H1PA 3JD0A 1M7GA 2XUHA 1VDMA 1AVTA 3KQVA 4HB0A 3SJ7A 1OYWA 2QV7A 4BP3A 3GP5A 4G56A 3S0JA 3VBEA 2V6IA 1AXEA 2A7QA 1FQJA 5K0NA 5BN4B 1YS7A 2EATA 1UP6A 2GA9A 1OZHA 4O33A 3AQ4A 3TW4A 2QG4A 4G24A 5LPNA 1A88A 4IIUA 2COEA 2IOYA 2VPZA 2C84A 3CKKA 2YV3A 3AUJB 4YBZA 4YRZA 5DP1A 4ACBA 2WNIA 4JX8A 3CIFA 4X1KB 5L4LA 1PFYA 3FCXA 2X0NA 1E5TA 3F9RA 5TXGA 4Z8XA 5JECA 3B6IA 1T91A 3P32A 5KJ6A 1KYYA 2XDQB 1VE3A 2F55A 1SM4A 3D5TA 2OLJA 3EIEA 3KJHA 3KZXA 3NASA 4OK6A 3UJ6A 1P0FA 5DNCA 1G0NA 5AVVA 4YCJA 1V35A 2B34A 3OZFA 1HX7A 1JA1A 3HU2A 5F7OA 4PSKA 4DRXA 2Z5GA 4TWJA 3AVYA 1YRHA 3FUXA 4MX8A 2FSSA 2G4LA 5B6PA 1UKYA 1RLTA 1DJMA 1DWQA 3FDJA 4TXHA 4AI6A 4NONA 2IUFA 1QHXA 1D4OA 1KJYA 4IR7A 1Q84A 5H59A 1A5AB 4QICA 3NUQA 3IUEA 3TSWA 1UBFA 4WFQA 4ETIA 4A0GA 4EG0A 2FPGB 1XROA 3L7KA 3CNNA 1Q7CA 2Q3LA 3O8QB 3C41J 1I2CA 4LC9A 1KDOA 2PDAA 5EXPA 5CPBA 1RWPA 3KEGA 1S8NA 2UZ0A 3CEHA 1UL1X 4BZWA 1A5ZA 4UU7A 3SDSA 3PC8A 3K9QO 3FPLA 5ESXA 3ZU3A 3FOEC 4NZ9A 1S02A 2P4HX 3ANMA 2VSFA 3L40A 4N9QA 3SZMA 2FPGA 3O95A 3N0VA 4X41A 1DADA 1B0PA 5ULLA 1X39A 3L8MA 3O8QA 3VVMA 2BDUA 3C43A 4Q4AA 5F7JA 1QE5A 1YVDA 2HA6A 2XA2A 4H7JA 1G3MA 2YUTA 4BO4A 3QTBA 1FUYB 1XRNA 4DMLA 3ND8A 1L9KA 4GWGA 1P9NA 4MYRA 3TIFA 5CEJA 5H3HA 2DY1A 3QVXA 3TZQA 2HLDD 3ZDCA 5L40A 4E46A 5GINE 1U7UA 3BA6A 4U7HA 4W8GA 3EXAA 2OD2A 1XA3A 4HATA 4L08A 4PIMA 1Z29A 1IG0A 4R8MA 4G8BA 3I6ZA 1ZNYA 1IBCA 1VHQA 2ZR7A 3PS9A 4PC3A 1HLPA 3N74A 2XMPA 4RFSB 2MDTA 5CA1F 2PMDA 2RGRA 5MN6A 2HK7A 2W22A 3LKBA 1MEJA 2YJ3A 2YS6A 4KO3S 4R9SA 3LWBA 5C1OA 1FA9A 1KQPA 2Q3CA 1UC8A 3EEBA 4L75A 2OILA 5ALFA 5FJJA 3C4JA 3CUSA 2VHVA 3I5MA 3S2UA 5LQJA 2ZJ0A 3REOA 4JODA 2OOKA 3ZVKA 4L5AA 4F45A 3QFHA 3H97A 1PJTA 2CVZA 4JLJA 2XNJA 4OJQA 4GS5A 1NNUA 2QL9A 1G6HA 3QJYA 4A10A 1G3IA 2HSGA 3KLNA 1H8HD 3SSMA 3PA6A 1U7HA 3RADC 3CIOA 1JDNA 1A72A 3M70A 3OWXA 2QENA 3MQFA 1J90A 3DMTC 2BTQB 2BEKA 2WTAA 3MJ4A 4MKXA 4NAUA 5KOHB 1NUUA 1PJ8A 2BW0A 3CVWA 2HHAA 4KXNA 3HH8A 3MJCA 3V1YA 5LJLA 5I8PA 4IV5A 1W88B 4JSRA 1ZIDA 2HV9A 4OGFA 4CMBA 5CCBA 5HTKA 2VCEA 1XALA 3JARA 5LZ7A 1DAIA 4GR9A 3UXHA 2R4UA 5TPZA 2Y9MB 3LRTA 1DDOA 4PICA 1TGYA 3HMKA 3Q5DA 1Y3AA 1E7MA 4CIBA 2ZSHA 3H2YA 7GPBA 3IJPA 3ZIUA 2I3AA 1LV7A 3MGKA 4P4LA 1QF7A 1UP7A 2JI9A 4KRFA 4V0LA 3W4JA 3KQNA 1W88A 2OD9A 2A5GA 1X1DA 1DG3A 2IS1A 5IT5A 5ICFA 2FJPA 4RTKA 2QN7A 4XWKA 3EPHA 1VGRA 1O95A 4CTOA 2R87A 3EGOA 3PQ6A 4E3ZA 4HZIA 3EDCA 4YCLA 5JS1A 1ENPA 3W5JA 1HTTA 3TLZA 2D8AA 5EJ8A 1ZESA 3ECSA 4Q5IA 5L6LB 1N6NA 4LJYA 3PNKA 4PANA 1WBBA 4UKDA 1SOMA 3KSMA 3OE7D 5L3QB 1CUZA 4QUHA 4CCYB 5FB3A 1MPXA 4LDZA 3D6VA 2ZAMA 4OX9B 2CW5A 4LV8B 4CETA 1FTYA 2I1VB 3LDFA 4Q19A 5DTIA 2N3ZA 5KNCD 2Z9BA 3QVLA 3LZCA 4I9GA 1NUHA 4D4JA 4BCBA 1BX1A 4IEFB 1HYGA 4WCFB 1GHTA 4JKYA 4KODA 3GFQA 3KT3A 4J75A 4KQHA 5L3QA 3O4HA 2J3IA 1JEJA 4CCYA 5K0TA 2NPFA 3KLBA 4BJ5A 1FDOA 1A2OA 1CJSA 1XVIA 2R6CA 3RRMA 3KJNA 1JQDA 2RGAA 4P35A 5CJPA 4AJ1A 1HG1A 4I4CA 3ZCRA 2V58A 3PQ8A 1UKEA 2X6RA 3EZYA 3FDFA 2VTDA 4WCFA 1QP0A 4WL0A 2NPIA 1A2QA 2VJMA 3C5CA 4PX9A 4S24A 1EZ1A 2YQZA 4URWR 2GETA 3DD5A 1QNLA 1Q1GA 3RFXA 4BRWA 4EY3A 1OT3A 4OO3A 1EX7A 4F6CA 5AQ1A 2IP2A 3PUWA 4AKTA 2BSQA 4QTTB 5IBRA 1GPWB 4TLDA 4HGRA 1W93A 3IKJA 1TZCA 3DWGA 5F7ZA 3IEUA 3KJEA 4LXHA 2QM7A 3K3PA 4KYIB 1DQSA 3W2TA 4HC4A 4J16C 4PNHA 4BNKA 1OAOC 5DBGA 1RMYA 4OGKA 3LY7A 4BBJA 3T7TA 3W1EA 1H5UA 4OHBA 3EN0A 1SUEA 1UXGA 3I9MA 2R44A 5FAKA 1RM4A 1N9GB 2GAIA 1IMJA 3FTDA 2O19A 3FOAA 1UFRA 1YZUA 4NNOA 1TT7A 3KJZA 4GOND 4LWPA 2R8RA 1RJFA 2FP3A 4WUVA 5CURA 4ZVSA 3SC4A 4ND7A 2DLCX 1KAMA 1GDHA 2IXBA 2EZ8A 3AHGA 4BZXA 2Z1MA 5F64A 2D5AA 1AQUA 2C98A 4A6PA 3KKKA 4FYYA 4GZ6A 1S4MA 5ED4A 5AI5A 4CF4A 1HKHA 1J5XA 2R8BA 1N9GA 3M6AA 3NFYA 3Q10A 5THXA 4WKBA 4NE9A 4ID3A 3TLGA 3W3AD 2XUDA 2EJWA 1WPRA 4OXKA 5DO9A 4GF5A 1N5RA 5BO5A 1VPWA 1PFQA 3KPUA 3KSBC 5CDFE 4I5DA 1I51A 5CVCA 4JBWA 4R0MA 3LFTA 3LUBA 3K9BA 5INTA 4II7A 1C7EA 4P6VF 3U16A 4S35A 3EZ9A 1F4PA 2WUVA 1TD9A 1AJEA 4AO7A 2PUTA 4EI2A 4DR2B 2JFYA 3RU2A 5BMOA 3K2EA 3PXAA 4BP8A 3DVAB 3SIWA 3TSZA 2ZZMA 3JWEA 5TS2A 2E0IA 1BKYA 3OD5A 1P7YA 4IO1A 3IVXA 4O3FA 4QUEA 4B32A 2ZRJA 2V8BA 4Z3KA 4NCIA 1NQTA 3JQFC 3LPLA 4KWIA 3V2UA 3ITKA 2ZWPA 3F5SA 2VL7A 4PLZA 3QMMA 2ZUTA 1F2UB 3GJQA 1A1SA 1PJSA 1XAHA 2PSFA 5EFZA 3SIPA 3EARA 4UNNA 3WL4A 4C76A 4CZ2A 1H4TA 1CF4A 4F5ZA 5ITWA 1ZYUA 4RH0A 2Q6OA 1Y4UA 1Z07A 4N4AA 2ZIFA 3ZHOA 1S3IA 2HF2A 1N3BA 1Z17A 1VSTA 3I9FA 2JHCA 2B69A 1FFGA 2ZJAA 2W5UA 2ASEA 3R6TA 4LJ8A 3B8HA 1NURA 1E3MA 3UTCA 3W6ZA 4CG2A 4OM8A 5EWLA 1QM5A 5LBTA 1VIDA 1J0CA 1DX6A 1M1XB 3RVPA 4OYYA 5JNTA 1FMJA 3K1JA 2F4VB 5A03A 2HIGA 2K2WA 1TMGE 1E62A 4R1UA 1Z0IA 3AGQA 1WWKA 4ZAVA 2BI8A 3JQBA 2ODWA 3F6BX 2PRIA 4COOA 3IP5A 4MMZB 1SAYA 2O0JA 3WMGA 1C0IA 1MB2A 1MTOA 2GJSA 4BFTA 1BVYF 4JP8A 3OLCX 3ABSB 1KAEA 1YZGA 2P5SA 1ZUD1 1YJBA 5TMPA 5HP4A 4LX8A 4RAOA 2A9OA 3E2PA 2ENWA 3PJEA 3Q6NA 5BW6B 4OKIA 1D6JA 2IEAA 4FN5A 2XRYA 3GFTA 1X9HA 1UEIA 2FP4B 4NKRA 2GBFA 3FYUA 3OEWA 4JMLA 4OL0A 5DFAA 5B3JC 5F9MA 5GMOA 1IB6A 4BZPA 3U7IA 1OXVA 2JFWA 1G9SA 3VDQA 5CDSA 1EEHA 1ORHA 4HEA1 5BOSB 3LV8A 1A5SB 5HCUA 5J59A 3HXMA 4IIGA 1A3CA 4JBIA 4BMOB 3AUYA 1DRJA 2BZ0A 3WK7A 4BLQA 3ZY2A 4DV1B 2FP4A 3RANA 5GJBA 3HJHA 2RHJA 4JFAA 5DISB 1X92A 3GVPA 1BTOA 1XCJA 1EB8A 4FSHA 1H8ED 3WLSA 6ADHA 2AC2A 5ITSA 5JRZA 3VR5A 1EVYA 3HRHA 3O90A 3QWFA 1UZLA 4OCZA 4DA8A 4OBWA 3GGJA 4KL8S 3TLXA 5AKYA 3F2IA 1S96A 4D8UA 1E8DA 2R66A 2P0EA 2FRDA 4KZPA 2A1UA 2A59A 1MO6A 4LHYA 1NJ1A 5EIBC 4AX8A 2NW6A 3BWXA 4FHDA 5AXAA 4AP5A 1OV6A 3EGWA 4OGGA 1G41A 5ENZA 3IR5A 2Y68A 3G2OA 4MJXA 2HRZA 5ALKA 2F1IA 2OFXA 4RD6A 4HGOA 1US8B 3DT6A 4JXXA 5DNEA 2ZBGA 3IA7A 3NDRA 3A70A 4IH9A 2D0PB 3I5XA 2X22A 2QSJA 1DMSA 2CXQA 3UCXA 2WP0A 3ROEA 3I5YA 1FXWA 2F1HA 3CRZA 2HADA 2X14A 1W8IA 2C7VA 3DMGA 3UV6A 1V2GA 4QOSA 1US8A 4Y9TA 1MC4A 2DPMA 3SLRA 3FNIA 1P2DA 1DKLA 2C3OA 3VFDA 2CD7A 4FYWA 4XX1A 1ABBA 2DUUA 3OY2A 5AW4A 3U9TA 1GRRA 4UFPA 1PZNA 1DAPA 2V5VA 4QA9A 1XO1A 1PT9A 3FAZA 3GD7A 4V2IA 4B4DA 2PA3A 4V1CB 2BBOA 5JAPA 2NO1A 4BPBA 3WGOA 2EHDA 5F1PA 3GEGA 2P4EA 3C4QA 4WA7A 1KE2A 4URVR 2I33A 3ZZ1A 3ZN2A 1WM1A 1C7IA 5CEEA 2HD4A 3U4MA 4A91A 1RW4A 2FVXA 1J0EA 1WKVA 2VPTA 3I6IA 1JPUA 3DFZA 3LUDA 2A58A 5KVAA 3G0HA 4V1CA 3AHIA 3ADKA 2IOFK 1E6EA 2ORIA 1LDYA 4JQSA 2IUTA 4CT4B 2F3RA 1NW4A 1T25A 1OBOA 1MRSA 1Q5PA 1GRQA 3DJYA 4Y6RA 3UMCA 1WVGA 2O2CA 2Q2WA 5HZMA 1F1BA 4PO3X 1L4LA 2I5PO 2G9NA 4CIAA 1HY3A 3LWDA 4L9WA 5K3BA 4JY7A 2IDZA 4J0GA 3EBOA 5FBRB 3R9KA 1VP3A 5HTOA 1XTIA 1AN9A 1C50A 4NYJQ 4OMFG 5FQOA 4FSXA 4KFRA 1MLDA 4ZVVA 1RXWA 2XVXA 3C6KA 1NRXA 4G2TA 3PFGA 2PZ8A 1KOLA 3WGVA 4EVQA 1LQ2A 4BVJA 1CSEE 3DEAA 1KJ9A 3UK6A 4RIIA 2PUCA 2AMVA 3PWKA 2RK6A 1XOIA 1MC5A 3BM5A 3E18A 1SIWA 3E61A 2VP9A 4TKVB 3PKIA 4E31A 1N5OX 2Q3MA 3A27A 4QG3A 1V16A 3HU5A 4LRYA 4PBRA 1UJ5A 2DPYA 3MQ2A 1I30A 3C85A 1U3GA 1ZRHA 5EIFA 1VI5A 2XD4A 4INAA 3RSCA 2VIIA 2GLTA 4WOJA 1PT5A 2XWJI 1ZGCA 5L51A 1FDTA 2D54A 1ZO8A 5LYJF 1ZH6A 5H4GA 2Q4BA 3PX7A 1R6AA 4FOSA 4AICA 4C0KA 4EX6A 4LZLA 5K8TA 4O2BF 4P86A 1E1LA 4TKVA 2ZDGA 2HA7A 2BI4A 3IFSA 4D97A 3D02A 1NA5A 1ZXXA 3HJRA 1XNGA 2WIFA 5F1OA 3FWKA 5DOZA 2IV3A 4BMCA 1LQTA 2EJVA 5COQA 3D3KA 2FPPB 4BBZA 3H5AA 4V0RA 3PRKE 1IHDA 3IL2A 1GQYA 2ENUA 3R44A 3L8FA 3JWPA 4QOFA 3TOCA 3P2IA 3IDAA 2ZAGA 5G53C 1CUCA 3LPNA 3AF0A 2PVSA 2R6GA 2BMAA 1XSEA 3PBKA 4G23A 1KVRA 5CDTA 2I3BA 2OP1A 5EIEA 4M1KA 5DH9A 1NBMA 1E5QA 3R0JA 5FLEX 5IK2A 3ZE2B 3U17A 1C7FA 4IGIA 3FI0A 4C1BA 2IY9A 1DBPA 1I6LA 2QRMA 5FPHA 1TKCA 5BQPA 4DE5A 5AYVA 3MAAC 4COKA 2QPLA 4R40A 2EBUA 1TAQA 1KYQA 2PGLA 1T8SA 1DPGA 4XKJA 4R9VA 3UHPA 3WL7A 1P5HA 3ZE9A 1V5FA 1PEKE 2YOGA 5SYAA 3CBGA 1IY1A 1T0IA 3AVQA 2CT8A 1VM6A 4EJMA 2V0GA 4H1WA 3B1KA 3WGMA 2GCOB 1C7QA 4GE0A 2WNHA 3WLEA 4S0ZA 2AX4A 1LCIA 1TGVA 2CLIB 1W29A 1EA7A 3JAWB 4OLHA 3I04M 1DXHA 1G19A 4QPJC 3SI7A 3FCUB 3V80A 5K8CA 1W44A 1X7WB 1GLNA 4TSFD 1AMUA 4UD6A 1P60A 3WXMA 4PO1A 1S1MA 1BYIA 2GCOA 4UATA 1PJ3A 1ULSA 3EUEA 3MRSA 1K4MA 2OXFA 4L8WB 3IPRA 4YHBA 3KOZA 5FUMA 5JISA 4DV3B 1K89A 5DULA 2O3QA 4RA9B 4B84A 3BH7A 3JAWA 3TNFA 2B4AA 4FKBA 3EE6A 3ADOA 1LLFA 1YL7A 1XMVA 4HNRA 3U3MA 1UOPA 3NT5A 3PGJA 1JHMA 2ZULA 4EDFA 2BR4A 2PG3A 4IZIA 2V0CA 1ISIA 3IJEB 4A6EA 4KSYA 4F1KA 3BTOA 1BN7A 3D64A 4LVNA 4RA9A 1RRKA 1GY8A 3QH4A 1T6NA 4Z0PA 1N2OA 1LPPA 5JRJA 2QTTA 5IXJA 2V0NA 1QHEA 3A1UA 4TN5A 2WJPA 4TMYA 2RJ3A 1H0RA 1NAIA 2FSVA 3AM3A 3HABA 2OHJA 3CCBA 3MGBA 1V7PC 4P38A 1KEEB 3LCRA 4E2YA 4BY9E 5F3WB 1XRSB 1G18A 3HXKA 1QHIA 1YONA 1IIBA 4YWHA 3STUA 1HYBA 1ZLYA 4XPIB 3JWHA 3A9CA 4IDAA 1LBQA 1G8YA 2V6MA 1NVKA 3HSSA 3OHMA 4WE3A 5TEVA 5JS2A 3TDMA 3UJCA 3KTDA 5AUNB 3HCCA 1GFIA 1KEEA 2LCFA 2FFHA 3W34A 3QXCA 3ILSA 3JV7A 1WBDA 1M34B 1YE3A 3L6CA 3MMPA 5AI9A 2O52A 3PIDA 1X94A 4HUQA 5DTQA 1QVZA 1RFLA 2FPLA 1XRMA 1Q11A 2GM3A 2WABA 1B8NA 1RU3A 2EP5A 2ZIGA 1QH0A 2EW2A 4MB0A 3HKEB 3UWMA 4AN0A 1P1RA 5AK0A 3GOQA 4EITA 2NO7A 3A1DA 1FFYA 2EZ9A 1YB1A 3QYFA 1M34A 3LQKA 4F4DA 2FPMA 4MR8B 4UZFA 3FDXA 1G8HA 4OI2A 4PGMA 5HVNA 1V1JA 1O6GA 1Y63A 5HF9A 3B1VA 3TR5A 3H4MA 5SY6A 1H4VB 2UKDA 4MI6A 1ID8A 1L3IA 3CT6A 3PD0A 1GV0A 1Y4DE 4J43A 4RC9A 2G0TA 4HSEA 3JRNA 4RXMA 1N8NA 3IEVA 4N0DA 1B3RA 1VE5A 2P2YA 3JYNA 4FGUA 4UBKA 5KC8A 1IVYA 2QRPA 3ZDXB 4L9RA 3GWGA 4OH1A 5I9TA 4O2AB 2BUAA 1BMDA 3N8HA 2C2MA 2N46A 4TLAA 2GRUA 4OAQA 2PZKA 3KYDB 2P1DA 5EA2A 1TO2E 4Q3BA 1J2RA 2Z8ZA 4P7KA 3WNZA 1BMFD 1CQXA 3DVSX 4HJXA 1HE8B 1XL0A 3LQYA 1VA4A 4I0WB 4OHOA 3HC7A 1MUUA 2JW5A 4TQAA 3IS3A 4M46A 1M5RA 4EJ6A 2O59A 5IJAA 1J2JA 1S9DA 1MXFA 3IP7A 3F90A 4DSAA 3LUPA 1R4MB 2ZZKA 4H0NA 4D4HA 3H4TA 3KYDA 1K5DA 1B14A 1MB0A 1RRPA 3GFSA 2GZ3A 4V38A 3HBMA 3HEBA 3QU4A 3QVOA 5KNBD 1WB9A 3D6NB 3A10A 4U6SA 3TVDA 4BE7B 1LK7A 5C81A 2RB4A 4PONA 3ZEAA 5IHPA 4D74A 3D3WB 4L28A 1NI3A 2PIAA 3PUYA 4JOCA 5FFMA 1JXOA 4BNNA 3KXIA 2DKNA 1QZUA 4X71A 1MEEA 1NXSA 1XKLA 1RSZA 2IHUA 2QL6A 4UMVA 1N2CB 3VX4A 2OUIA 1AU9A 3EFEA 3P0HA 1L8QA 4IMRA 1NV8A 3T4EA 3EGEA 4TKMA 3VVBA 4ZVRA 3HJBA 2QN9A 1QYIA 4F0JA 2GBLA 1Y4ZA 2HJGA 5ARCA 5BW5A 4LXYA 5BN5B 5JMPA 5C1BA 3N9IA 4ZHSA 1T5IA 2Z0MA 3HB4X 1J97A 1Y8QB 4ZVLA 3VO9A 1YJXA 4Q7JB 2WD7B 3P27A 3KC2A 1AHNA 1N2CA 3S27A 1DOHA 3AINA 3CEJA 4HQRA 3KK0A 3T3OA 3SOZA 3QZUA 4OMUA 3V8MA 3U40A 1T36B 4NCKA 2QJRA 1WE2A 1QOZA 2OHXA 3DG9A 3PUVA 4RMNA 2P9ZA 1TZKA 1F0PA 1U2TA 1P2BA 1OXSC 5DDIP 1CRLA 2O2EA 2WD7A 2JIMA 1AQYA 1TU3A 1Y8ZA 5FTMA 4NYMR 3V1UA 2EBHX 2VQ6A 5JYBA 1BRTA 1C8BA 3K16A 1YKGA 3HJUA 4ICIA 1AO0A 2C7QA 1N4DA 3TLCA 2IZOA 3CZ4A 3V7FA 5ALGA 1GPLA 5GTDA 2V4UA 4C29A 3PZRA 5EGNA 1QTQA 2VH5R 1E79A 2H11A 3OSZA 4P81A 2VHTA 4Z0TA 4BLSA 4BNDB 4TMWA 4K6FA 3SSNA 1YOVA 3KLOA 3CCCA 3A4MA 1JDZA 2BFFA 3FPAA 3GJSA 4PR0A 3HGTA 3TS1A 3CRQA 2ZRMA 3ZW8A 1QCDA 2X8AA 4RD1A 1JG1A 1EZZA 1IEVA 2QAIA 2E37A 3C97A 4TX1A 4ZGGA 1CYDA 1YZVA 3BFKA 3KQWA 3MF4A 1KTIA 3ZIDA 2IZZA 1CIPA 4MYDA 4WXRA 3V1TC 3ZDQA 1QYVA 2WG2A 4DA7A 5JD5A 2H06A 2H63A 4LF9B 5CT6A 3OZWA 5K6TA 4HRAA 3P9RA 4YRTA 4Z4CA 2I6QA 2HMUA 5FLYA 3ZX5A 1E2HA 3HCNA 1OYOA 1YB2A 2O5CA 2B4YA 1J00A 4ZZ1A 5G0VA 1HDOA 4WOCA 4ZAWA 3CC8A 5F4ZA 4PYLA 5TNXA 3UMRA 2L19A 1PR3A 4DZRA 3CG4A 1OASA 4GUAA 4ZT2A 5KSZA 4LWQA 3WGJA 2OVFA 5HQ3B 4BV2A 1P77A 2QN2A 3HXQA 1W75A 3H3FA 5TS3A 2H31A 3HCAA 2O2YA 5DTEA 4CL3A 1OB5A 1PNQA 5TEWA 2PZFA 4C0WA 1H93A 2IYYA 1Z18A 4TLEA 5LD2B 4UARA 2AVNA 2KLBA 5EUQB 1QGOA 4K6KA 3R3WA 2IYNA 4FKMA 3THXA 1KU0A 2RGWA 2CL0X 3KJGA 2IOQA 3AC0A 1PW7A 3NTOA 4Y2JA 1V43A 2VYND 4MQFB 4IVNA 1QG4A 2H00A 1DXOA 1BFKA 4X93A 2B8TA 5F76A 3IT1A 4LE1A 3MWFA 2IP4A 1W85B 4ZK2A 3R7AA 3R20A 2H1FA 1CEEA 1RTKA 3B70A 1GYPA 1GN9A 4NZZA 4OQDA 3NBZC 4V3CA 4ZAXA 4ENRA 4UM9D 3OVMA 7YASA 5DM70 4F3TA 3WZ2A 1XVUA 1DZ3A 1FS6A 3HHEA 3LH5A 4MQFA 4V0QA 3GOHA 4F46A 1YFLA 1XL1A 2Q5JA 1YBHA 3BXXA 1BHSA 4G65A 4CFYA 1D7OA 1ZM7A 2YFKA 1XXHB 2POQX 2ZE7A 1W85A 3EASA 3GGCA 3I2YX 2R6FA 1OJ7A 1RBZA 4JITA 1YBAA 2PWZA 5IEBA 3IUYA 4Q3KA 1I3CA 1RXEA 3JZAA 5D85A 1ZH2A 1EHCA 5EJ5A 3HY4A 3U2QA 1Z7GA 3LY5A 4CE6A 2ZRLA 4H1HA 4AB1A 1VJ1A 4FGKA 1ZXBA 3AEUA 1ZGZA 1D8TA 3PUHA 4RSRA 5F77A 1KAGA 2FSGA 2ZXFA 3LRXA 2QAGB 4QSMA 4BAGA 1N2XA 5LNK1 5DBFA 1PZEA 1QFJA 4LX0A 3G13A 4CU5A 2NU6B 1Z7WA 4Y2PA 1UBGA 4C0HA 3WLIA 4L8VA 4G67A 1RP1A 3KTOA 1SHLA 1E4EB 1KDRA 4R41A 2JIZA 5IAKA 1RHJA 2GKOA 3GLKA 1LRLA 4C6TA 3GC6A 5JY6A 1O97D 4HDNA 3SFTA 4E6PA 3E2MA 4RVHA 4XVCA 1SHKA 3ORFA 4I8XA 4FMPA 1JDTA 5DV9A 1PZXA 2NU6A 3FRJA 1DO8A 2WAYA 4PNZA 2VYVA 2F00A 1MU0A 4Y3UA 3SX2A 4ZEVA 5B4TA 4RDXA 1NMZA 1ZVMA 2O50A 2Y4NA 5HKBA 3AKCA 4PG6A 3H5WA 1ZA2A 7ADHA 3NRBA 3M5CA 2RG7A 2X2EA 5TDHA 2X5XA 1SVIA 5SYNA 1AUVA 1ZCJA 3PNLA 1VPDA 4HI0E 4QATA 4DN6A 4AUKA 5CITA 4WVLA 5EAIA 5ALZA 1YVEI 3DBOB 2M2IA 3E27A 4Q1BA 1FDVA 3OPMA 2OQRA 4MQLA 1PNRA 2ECFA 4NH4A 3GVCA 5DX1A 3IMFA 5GV8A 3RVOA 3KVYA 2JEZA 5J4VA 1KL7A 3L7CA 2O06A 3G9TA 2RD2A 1F9AA 1H6DA 1KBZA 3DAGA 3LC0A 2WHRA 4JX9A 1J20A 2D1YA 3HCPA 2WSSA 1CJVC 1WAMA 1HO3A 2XYHA 3SS7X 4R7GA 2AMJA 2GM9A 3HLKA 3T1NA 4E5DA 3D54D 4RF5A 4BEBA 1MVOA 4TXJA 5AKZA 5LUAA 1ELOA 2G4CA 2VT6A 3I64A 3WKCA 2LGJA 3WK5A 1ETHA 2ZYTX 5H3CA 4MW2A 4EGCB 1E6MA 4BPRA 1QGDA 2VCYA 4KH0A 5CNMA 2FJ0A 2GT1A 2YWBA 3LLVA 3TIVA 1SQGA 2A35A 4AWBA 1L7BA 2WQ7A 2YXBA 1ZEJA 1ZNXA 4PWYA 1E6LA 1WY7A 2EWVA 5G41A 3AJ9A 421PA 2YX1A 4Q1DA 3WK6A 2CCJA 1YFJA 1VJ0A 1I33A 4LOAA 1ZC4A 2GEUA 2IS4A 5EZQA 1CFZA 4N7BA 4PSVA 3VPSA 3ER9A 2JAHA 4DW8A 1P74A 3E9YA 4MWCA 4JC4A 3NYRA 4CIWA 2J46A 1GAQA 1MJGA 2QN1A 1KH3A 4AWXA 6ABPA 1GLGA 3TYXA 1E8MA 1M6HA 1VIYA 4L0QA 4HUJA 1V4BA 1G8SA 1WXFA 1GTG1 3Q5GA 3NB0A 5CVVA 2BH9A 4U7TB 2J7KA 2E7ZA 3O1JC 4IEEA 4EK9A 2QR3A 3PJFA 1E2IA 3KPWA 2J0UB 3INNA 2LCQA 3O9MA 2XVZA 2P3OA 3EXHC 4L5YA 1F5NA 2LD4A 3P2EA 4LGYA 3BWEA 3IDZA 4HQ0A 3IRUA 4F3YA 1CG6A 3O5AA 5LZ8A 4BASA 4EFNA 3ZQUA 3KETA 4RK0A 1B7GO 3A05A 1Z5PA 2QJOA 3A9SA 3GMSA 4HEJA 2J0UA 3LF2A 4XJTA 4DM7A 3U7GA 3JVUA 2C3YA 5L3SA 5KZMB 1E1QD 5EJAA 4BKMA 5KO2A 2LKDA 1VSVA 1Y9ZA 2GCGA 4KAXA 4QAJA 4R7ZA 2W0MA 2ERCA 1ESNA 2NSYA 1IN1A 1DUVG 4YO7A 3RS7A 4BLUA 3ZDAA 4D56A 2WJJA 5E8JA 4H9GA 3LO5A 1IHYA 2FQQA 3OJLA 1XD2A 3RYFB 3VBCA 1FSZA 1DU4A 1MJGM 5LLSA 5CLGA 5BR4A 2LP4Y 5LQNA 2Y66A 3HPRA 5DYYA 3N5KA 5CCDA 5JIBA 1JWAB 1P8AA 1AH2A 3V4PB 3HB9A 3RFTA 3DMTA 3QJGA 5FYDA 3DR3A 2CUNA 4MUNA 4F2DA 1A77A 4AMGA 4PVDA 4NBLA 3EMBA 4MVCA 1JHYA 2C4KA 4X94A 1P91A 2EFCB 3WADA 1U5CA 2E4XA 1XC7A 3VPAA 3C8MA 1TM3E 3RYFA 1ZDMA 3SE0A 3A3PA 2DQ4A 2C31A 2GPTA 2Q3DA 3EIUA 3TCNA 4ZYXA 4Z6KA 1V47A 1PS8A 4GMGA 5ALWA 1WG8A 1W1UA 1YQDA 2X5JO 2ZUDA 2I4LA 4LOLA 4PM4A 5DJ5A 4Z2AA 5EJ6A 3J81A 1W76A 3DONA 2IZ1A 2RIRA 5A9SA 2H4HA 4KUEA 3JD4A 1FCJA 1M8JA 1MAUA 3GAMA 3ONNA 4L74A 4NU5A 5EE3A 2VPPA 5I7AA 3SY8A 2PZJA 3B1WA 1OGIA 3EIQA 3G5MA 2WB2A 1TYZA 1RWOA 3MBKA 3AVUA 4TKLA 1OVMA 5ICMA 2JFVA 1QV6A 1Z2PX 4QJIA 3PR3A 3RC9A 2JGDB 3ZS8A 1IXKA 3BSSA 4QBKA 5CB4B 1Y89A 3T9AA 2B0JA 3DBLB 2JZOA 4QJBA 3T7AA 4PC1A 4C0BA 4Y9SA 5EE5B 5JYEA 2N9UA 4P33A 1HT3A 3F3YA 3KSRA 2ZS8A 4G5RA 1UBEA 2EFDB 2FKAA 2VF5X 1IXZA 5AHWA 1YDGA 5FLKA 3RAJA 4RTQA 5K8UA 4N9WA 1QIMA 1V8OA 5CB4A 3C0KA 5HIAA 2PL3A 2QRGA 2WPDA 2OENG 3BJMA 3I0NA 5IW8A 4BLPA 1ZVVA 3DBLA 3FSRA 4PY2A 3CLSD 3KFVA 4Y2XA 3TCXB 4MYTA 1JLHA 5C46F 2BMDA 2PVPA 5EZ6B 3ZTWA 3EQZA 4ODIA 4X6XA 1R66A 3AP3A 1D6MA 3DHVA 1L5WA 1U3VA 2ZSBA 2WYVA 1N5MA 4K1XA 3Q7EA 1XU4A 1JSCA 2J5KA 4GQIA 3CZCA 3Q7IA 2QRUA 2C5LA 4HQLA 1Q92A 2VNJA 1VMKA 5G0TA 1M6YA 1OXXK 2A0UA 2O05A 1ZRSA 4E32A 2FEOA 1N7GA 4JEIA 4XRGA 4LHSA 4YAGA 4ZXPA 2VTBB 2DBYA 3AW9A 5TC4A 3PCXA 5ICGA 3C24A 3FYSA 2WA2A 2G04A 3OUZA 4W63A 2DT5A 2PZAA 3GLHA 1TW3A 1WQ4A 4FNMA 5D5QA 3GEMA 3HKBB 4MDHA 4F97A 3AHFA 2VTBA 3BF8A 4LYEA 4RO0A 3L41A 2FZ4A 4F5EA 4C4AA 2NSDA 5GONB 2X1HA 3EULA 5HJ2A 2BR3A 2DJIA 2R3SA 5BWCA 3QEAZ 5BOVA 1YRBA 3ROTA 4EPYA 5HDBB 2OC4A 4U8HA 2GCEA 4OL9A 3LECA 3H6KA 3L43A 2YN2A 3BKXA 5J58A 4RTRA 2C5HA 2FSHA 4MVJA 1NN5A 4AU1A 4HVCA 5A04A 4IQ0A 1I1OA 1OGYA 1U2RA 3EIFA 4BXOA 4JR1A 2IVZA 1ZD4A 4GQAA 2O14A 2P3QA 3QY0A 3VHLB 4FFOA 2JLCA 2ZVQX 4FT2A 4Q4HB 3WOVA 1YQGA 3A06A 1NOJA 3OEHD 4AP9A 5AVWA 2FRXA 3CM0A 4NVRA 4DADA 1J5EB 4G9GA 3SF8B 5LXTA 1P1CA 4PGHA 2B21A 2YJTD 4HEHA 3H7AA 2Q2VA 5JFGA 3QE2A 3GNLA 2IDKA 3OLVA 3PPVA 3ZE6A 4A23A 1FU4A 4XE5A 5AM1A 5EJIA 1X1TA 3HP7A 3QE4A 4Q4HA 4ZP1A 4W5QA 2YWFA 1CJMA 2PYIA 3LLUA 4ALNA 1W2GA 2B4QA 2X86A 4X44A 3SF8A 4J1TA 4PFSA 3TM4A 4IDCA 2YWHA 1UBSB 3HCDA 3NH9A 3KUUA 4GX5A 1BEEA 1DTSA 3G0GA 1M8FA 1G4HA 3TQSA 1X3SA 1WMSA 3RKRA 5KJCA 4EB6B 2A7XA 2XSZD 4MVJM 4PBSA 3ZYCA 1Z0UA 2ZYWX 4D82A 5K05A 3ZJVA 3V2IA 1YGPA 3EK2A 5GJWC 4MV9A 4ZOLB 3UPTA 5F9FA 1DEOA 4LUCA 4X45A 1UKAA 5AH0A 3DJFA 3Q9LA 4KBGA 1MC8A 1NYLA 3Q12A 4ZALA 2WVHA 2BR5A 5K3OA 4F86A 3PLRA 4YMHA 1V25A 1H9CA 3TSOA 2ZYAA 4EB6A 3ZDZB 1LPMA 1FJHA 3E4DA 2PGAA 2WYHA 2ZT7A 3ZKWB 2X42A 4H3VA 4JP1A 4RZ3A 4XJSA 3S2FA 1Q16A 4H4EA 4B73A 1JR4A 3IR6A 3BWVA 4ZOLA 3G88A 2WZDA 3F6SA 2XB8A 5B53A 3NHYA 1U8UA 3LCUA 4RK7A 1A5BB 4N76A 1ZUHA 4IBOA 3O2NA 1U0GA 2FZLA 1XMPA 3ZJ5A 1Y1RA 3JQPA 3VVCA 5C8DA 3ETLA 3JPYA 2O9JA 3V8RA 3ZKWA 1ML3A 2VPYA 3T7CA 1UBOS 5ICCA 5M29A 1RI4A 5TF4A 3GG2A 4MIKA 2HF9A 1RI1A 3M4JA 1AIPA 1QUFA 4IFBA 3O8CA 4ZO8A 2A0KA 1J4AA 2ZQ5A 2GX6A 3WP0A 4G81A 5KQGA 4DBLC 3UW1A 3GVIA 1N2JA 3JQEA 4TUYB 2M9MA 2IJGX 2WAAA 4UDOA 3FMOB 1KZ7B 4EI9A 3DQQA 3RAEC 3ZHBA 3L05A 1DLJA 1TQ4A 3DEZA 3LFUA 3NP9A 1JYSA 1PZFA 3Q1KA 1CNEA 1TVEA 1W5FA 3ELYA 4M86A 1GZ5A 4BGIA 4D8TA 1T3TA 4YMTA 3VTZA 4R8VA 2GJKA 4G36A 4ZI7B 4N3GA 4LCBA 1QMPA 3OPQA 4OSPA 4HRVA 1ABEA 3FHJA 2JKYA 4V02A 4WIAA 3WLMA 4DJDC 1YD7A 1C4OA 4TUYA 3T5TA 2QZZA 1VLLA 3ICCA 4RXUA 5YASA 4BGUA 4BFXA 3QY9A 4KRYA 2GUWA 2M6LA 3HR4A 4I81A 4OV6B 4R1QA 2FU5C 2R4QA 4NPCA 3KSAC 3J80A 3DR5A 4I1RA 4TZ0A 4DLAA 1II8B 2XKAA 1SOAA 1QSGA 1Y5MA 4PR3A 1OTXA 1KO1A 1XF9A 1SR8A 3HO8A 3OQBA 4M60A 4NEQA 4UFOA 4YBRA 2NP6A 4RMGA 3PQ2A 1DWPA 2UU9B 2ONKA 3GCZA 4MGKR 4WKGA 2GTIA 4TWAA 2VUIB 4AJOA 1EQAA 1H22A 1NMXA 2FEXA 4LRUA 1YS2X 4Q66C 2V6BA 3QHQA 4XVQA 2Q6VA 2I4TA 3HVKA 1Q0SA 1EXWA 1FTWA 4LCEA 4YI3A 3ZBTA 4MMXB 3Q8KA 4FZVA 3GRCA 3FGOA 1II8A 1L3BA 2GN9A 3D3JA 2WRZA 3ONVA 4PAOA 1DQYA 4JL8A 5E6UB 4R2XA 1Z36A 4CG3A 1F7VA 2GTHA 4Q1VA 4QPNA 1G2QA 4QD3A 2VDJA 3D4PA 2C8LA 2XIQA 4G0PA 4MLPA 1CQIB 3VSDA 1UMDB 3KNZA 2HMYB 5HNKA 2EOAA 2ZS7A 2ZKLA 3O1LA 2QGZA 3AJDA 3CT4A 4G4SP 5BSHA 4RF2A 3E9ZA 2AEFA 2V74B 2HQRA 2VDMB 1LSOA 3K5HA 1F6DA 2ZWIA 3D81A 2ZR0A 2L82A 3D43A 4Q3EA 5AP9A 4M1OA 4TMXA 9ATCA 3AUUA 3WL8A 2OKGA 1V9SA 1Q0ZA 3LP5A 4MPPA 1CQIA 2EC5A 5FFFA 1UMDA 2P9QA 4FLEA 3JTEA 4YX9A 3PC3A 5HEKA 4BWFB 3M4XA 4YJKA 2ROQA 1U1CA 3QUTA 4Q3CA 4QM6A 4G2NA 5ALNA 1R15A 1E3WB 1Z2EA 2CN1A 2JLXA 2A4KA 3TBHA 1HYQA 2RONA 1ODJA 1PR5A 3H19A 1SMKA 2IE8A 1TFRA 1QK5A 3COVA 2AZMA 2MSLA 5F2EA 3G82C 2XYQA 1WXQA 4KE7A 1JP7A 3AXTA 3MT0A 4BCCA 4JENA 1WUTA 4D9HA 1E3WA 4OLFA 1QONA 1SCNE 3PR2B 3D8HA 3K0AA 1X0XA 4XYEA 1NVEA 1L8OA 2ZUBA 3ZK9A 4G37A 2BPOA 4Q37A 5JAUA 4XM1A 3GUVA 1CR1A 5THKA 1U0TA 4FIDA 4MKFA 3NVKI 4L07A 2VHYA 1DBQA 3MJTA 1AUPA 1K1EA 3HEMA 3R5KA 4R3UC 1NVXQ 1U02A 5KQSA 1KETA 2CFRA 1DX9A 2X2PA 3ELBA 2PBFA 2X8BA 3K9CA 4QRDA 1JR6A 4HSGA 1ZS9A 3ZHRA 1P4GA 3ORHA 3OOSA 4XWYA 3BMCB 2VHXA 3GBPA 2DBRA 2IX3A 2Q4OA 4LJ4A 2WU4A 5FUVA 1JTEA 3BAZA 4K6CA 5BR1A 1LBTA 1LNQA 4LAFA 5AOBA 3RD5A 5CB6A 5EKTA 1PFKA 3ZBPA 2BM8A 2NAFA 5F33A 4LTMA 1S3GA 4RSGA 1N0UA 1OIWA 4MAMA 4X7PA 2E9SA 2F1JA 3VV2A 1RE0A 3EY4A 1R50A 5IVIA 4MQBA 1YZNA 5BQ5A 5JR3A 2HMTA 3P2KA 1BDBA 4FZ3A 1UIMA 2JVKA 4OREX 1JLLB 1X77A 2VJPA 3QLEA 2OYRA 3UV3A 1RYBA 3KRTA 3ZLTA 1VIVA 3FPBA 5LCXA 2G09A 4NJEB 4MP6A 3DT9A 3H5LA 2JPDA 2WWYA 2BGGA 3RUAA 1I2DA 3WV5A 3ES9A 3FFWA 4XX0B 3R4CA 4Y0AA 3QKTA 1B6RA 3W7VA 4AXXA 2AZXA 4JUAA 5EHNA 4AF8A 2QSUA 1U6KA 2F8MA 4NF2A 4B9AA 4YAOA 4F4CA 4UPVA 1M10A 3RWMB 4PN3A 3MD0A 7AT1A 4EL5A 1K5HA 3ICPA 2I03A 3T0GA 1Z0KA 1RBYA 3C6YA 3CH6A 3QOFA 5EJ9A 2KQUA 1I1NA 4DDMA 5DSZA 1ZUIA 5E1BA 2OCPA 1ECFA 4IMIB 4ZOCA 2REOA 4LGMA 1EQUA 4ZEWA 3AL2A 5K2OA 2CL7X 4Q9IA 3IE2A 3T7EA 1U8CB 4MOWA 1JMYA 3ZUPA 1Q77A 4BKOA 5JFOA 3CU5A 1L8XA 2NZ2A 1EK2A 3IESA 4XD7A 2RBEA 3LQ2A 3O1IC 3VNSA 3CLSC 5BV7A 2C5BA 1F4LA 2DXIA 2Z4RA 3SXPA 1FVOA 3TZ6A 1N2ZA 2OUKA 2Z95A 3IAM1 4HWRA 4MLDA 3UWSA 4BC0A 4H7PA 4P7GA 2FPIB 2J59A 4X65B 3WDSA 4K0KB 4HGPA 4MUYA 4PZLA 4QT0A 2G9VA 1HOXA 3G2MA 2NT4A 4HQFA 4S1VA 5KINB 3BORA 4JC8A 3MMXA 3QE0A 3DFMA 3W4KA 3NHKA 4R1LA 1MH1A 4FEYA 3D1LA 3OLXA 3SGLA 3H2HA 4QYMA 3IHTA 5B2EA 1DFHA 2CLFB 4MRMB 2FPIA 2O8NA 1RRFA 3KKMA 4X63A 4JU9A 3SZ3A 4ZCPA 4YPFA 3T7IA 1M2WA 1THGA 2DGDA 4RWEA 1AKVA 2AFIE 3VC7A 4AYWA 1GZ6A 1CNMA 1ZJ5A 1ZXLA 2ETXA 2YVKA 3KQTA 1KOFA 3PVCA 5TGDA 1B93A 2FMUA 3FW1A 5DB4A 3FVRA 3KFLA 1YB7A 1HORA 4FWIB 1U0NA 3RBVA 4QXPA 2PFKA 3UK0A 1ZL2A 4B8ZA 2ZJFA 4PV7A 4A6XA 1M6WA 3WJAA 2W2MA 3K05A 4M8IA 4DFDA 1GGJA 4X9XA 1UM9B 4C88A 5C9ZA 1XNJA 3OKPA 4YLGA 2PX3A 4IO0A 4QM7A 3K8ZA 4CHGA 1C9YA 1I2BA 2GO7A 3FWPA 4NYIR 2GN6A 3TZEA 1RACA 1KKUA 1PWHA 1YZKA 2OZPA 3CF2A 2Q7DA 4RFVA 2GILA 1AURA 2XMGA 3OZVA 4UE2A 3TXAA 3SC6A 2V5AA 3HY6A 1RD4A 2I6UA 2ZYSA 1HZJA 1W87A 2JLRA 3HV0A 2JGNA 5JJBA 4QYIB 2IGTA 4O29A 4HWGA 4I5FA 2QORA 4K88A 3QEJA 3WDKA 1U0BB 2AF4C 2CVQA 8ABPA 3U0VA 5I8WA 4JYZA 2G5PA 4P84A 1A9PA 3ZHQA 3EXEB 1OA1A 4LQCA 4N8EA 3NP7A 2EERA 2KHZA 2C2YA 2PR7A 2UUBB 4Q7QA 4IOLA 2QY6A 1COWA 4QYIA 4BP9A 2C9ZA 3OQVA 2GZAA 4MGYR 3KEOA 4HUTA 1JDPA 1UEJA 2E49A 1SUBA 3M81A 2CBGA 4RD4A 3OLWA 1KP9A 3ENQA 3OFKA 1TA9A 1X7XB 2G77B 4ZYUA 1C9EA 4MNTA 1ESMA 4R69A 5D3ZA 1MOZA 2TMDA 1ZM9A 3BA1A 2DFKB 1YRLA 3GIDA 4M9UA 4PAQA 3TK1A 1TAUA 1ENZA 4FMDF 2FMXA 4UHHA 2PMEA 3AF2A 1UCFA 5HWSA 2Q3EA 4IKPA 4N49A 1Q2XA 3BJIC 2JLZA 4NV1A 4FBLA 4CM9D 2JKZA 1L4MA 5HOQA 2BGWA 3C5WP 4E12A 3GI1A 1QU2A 3NEJA 2QW8A 5A05A 4P54A 2FF7A 4NAHA 1MOSA 1K7EB 4MR7B 5DHRA 3M2PA 3ZY4A 2FFAA 4ZN6A 3AOEC 4O1HA 4CKBB 3OETA 4JLAA 2H7CA 5KDDA 4RLSA 2AMFA 2BP7B 2G80A 3NM4A 3AR4A 4NEHB 2WV7A 4DIUA 2H1VA 3VV3A 3LUKA 2VDKB 3CF4G 1O58A 1FUKA 3G2QA 4EW2A 4C05A 3FYHA 4S05A 3HCEA 4MR7A 5TR9A 4W5OA 3RU3A 2BH2A 2Z9CA 3DS8A 3LBYA 5ILGA 2AWNA 2YCBA 4FQ7A 2VNSA 4JJGA 4CKBA 3QE9Y 2FRVA 2C7OA 2HCJB 2QM8A 2BP7A 5J2UB 2XZDA 4RD0A 3NWJA 3R5XA 3UK2A 4AJEA 4YUZA 2WC1A 2G6TA 2IS2A 4B17A 1UBRS 3VNBA 3MJSA 1EHIA 5IM4A 2JDID 4V0NA 2HA5A 3ACCA 3IBFA 3URKA 1E1MA 4JLKA 3E3AA 1HM5A 1CY6A 4DS3A 2VNKA 1RAHA 2HNKA 4DWWA 3OE1A 4WXHA 3CISA 3F5FA 4JI3B 5CX4A 4YFYA 4OBEA 1L5LA 4XUGB 2V98A 1JT2A 4N5MA 3ECCA 3D6AA 2OWDA 2R6HA 3BMNB 1MW9X 4B6OA 3MMSA 1MOQA 2DQKA 1A4UA 1YS1X 2CXSA 3DVQX 3RHZA 1I1HA 4XQ0A 5HF8A 1P3JA 3G9UA 2OCAA 4MWTA 5HS6A 5KYYB 5TB5A 4B45A 1CEQA 5BURA 4WBNB 5IUNC 1IAVA 5I7WA 1IY8A 4WI1A 1FBNA 1SHJA 3N2ZB 1PK7A 1IEQA 3BMNA 3CJTA 3N8KA 3Q3VA 1IN5A 4ZVKA 2GDJA 4EW1A 3HYLA 1DXYA 3V7YA 3ZKAA 3DE4X 1QPZA 2PPVA 3AZOA 2WG0A 3BRWA 1WRBA 4E22A 5KYYA 1S8OA 4BVGA 1JHOA 1VB5A 2I0FA 2Y6VA 5JNVA 3MCTA 1K4YA 4H6PA 5B58C 1USWA 4WBNA 4J49A 4UBMA 2ZVJA 5JSZA 1Q0TA 3BH0A 5EEHA 4P0QB 1Z3IX 4LKRA 1MOPA 3VR4D 1Y1QA 3IE0A 4UVDA 4U7PB 1D7AA 3WIUA 4CM6A 4ES6A 1AZWA 1U2QA 3PX3A 4AMUA 5EP2A 1N8SA 3EF1A 5KNDH 1Y1SA 4GMDA 3ZXUB 1NDUA 1CY7A 2GD0A 5EI5A 3IP9A 1E9DA 2VJCA 3D7LA 2FUCA 4CLDA 5KEIA 4H7FA 3ZHXA 3QIAA 5KKNB 4DC9A 1XZDA 3AIOA 4RY8A 5ADHA 1MAWA 3UWPA 4E2WA 821PA 4ZOAA 2DOKA 3F73A 4I5IA 2H2GA 4DRYA 1JH9A 2I6FA 3O8BA 2A92A 2UYHA 3AR8A 4KOEC 4NJOA 2LCIA 1T4CB 4LSMA 2FK7A 1DAFA 2CMGA 1HE5A 3GRAA 4JS0A 3MILA 1ZVQA 2HLHA 4KN6A 3D3EA 2NU9B 5A5FA 5CYGA 4P3PA 3H1TA 4LDAA 3OQMA 2DWPA 4JJ8A 1C8VB 1E2BA 3H42B 1OLXB 3FB4A 1Z6XA 2XQJA 1KI8A 1C3EA 1N5JA 4I55B 1EM8A 4AYTA 1KEKA 4RH1A 5T6MA 1PL0A 2HL6A 1T4CA 3DZDA 4OQLA 3ZV3A 4MHOA 5T67A 2NO6A 3NWOA 3WX0A 2OB1A 1RC8A 2ZYHA 2NU9A 3FJ1A 4OHXA 3R9WA 2FGJA 4LMPA 4MIOA 4CMIB 4G0OA 4YP1A 4HAIA 2IELA 3R0IA 2HI0A 1QG2A 4EX7A 1RAFA 3NIGB 2WU3A 1OLXA 3CEMA 3BFPA 4NCNA 2R6JA 1PT6A 4I55A 5CLLA 5B57C 4UEOA 1PBNA 1RJWA 2AZ4A 4X24A 2AC7A 2OAQ1 3A6EA 1JYFA 2QD1A 3BOSA 2NIPA 3KOUA 5ELXA 3A9WA 4X66B 3VKVA 2XA1A 1OA0A 3DCNA 2DRIA 2WQZA 1CETA 3ILVA 2IQIA 5M7EA 5LP6B 3CVUA 1I5EA 3O0DA 3H1FA 1CRPA 3E5NA 4P3KA 3WG9A 3DNFA 4HH0A 1W4ZA 4YDRA 1OROA 3DBIA 2J3DA 3CRMA 1Y0BA 4NOMA 3TZLA 2C9MA 2F67A 2GPAA 3BRQA 2J3JA 4YS6A 5KTPA 2VA8A 1YR7A 4MUEA 4RF3A 1Q0RA 2J4FA 4FM9A 4HS9A 1J7JA 4URXR 1SRQA 2AJTA 2XUPA 5LP6A 4ZTUB 4TS3A 3OG9A 3QX8A 1RWQA 2PXCA 5DI3B 2I71A 3UGQA 5GOZA 1CZRA 1T2FA 3KV1A 2CLEB 2IIPA 3PV0A 4UHFA 1KQOA 1XTSA 2GZDA 1VLHA 5JVDB 1ZZEA 1WBJB 1PI3A 2G17A 4U2GA 1FDRA 5B5SA 2OLEA 3L6BA 4RNDB 4FOPA 2FW8A 3G0DA 3U19A 1GTL1 2GEFA 2HX1A 5DI3A 2NZUG 3MWEB 4X61A 4RACA 1YF3A 2ACKA 3ERCA 5KDOA 1Z6GA 2WMNB 4F06A 1WLYA 3AEKA 4WA8A 2ZWMA 4RVOA 3KJXA 3WYAA 5KWSA 1N8KA 4HK4A 2PUBA 3U3JA 3FTFA 4PPGA 4OHRA 1GT91 1TQ6A 2YWCA 4ZCQA 3RM3A 4HN4B 3MWEA 5IT4A 4J03A 2V7QD 5CBPB 2UYGA 3NVDA 1GGVA 3WNVA 4OM7A 5CB4F 1HC7A 2XYGA 5TRTA 3WLAA 4I1VA 1N1DA 3BXZA 1G7CA 3OTHA 4JYAB 4BVAA 3ADBA 3EC7A 2B36A 5IVKA 4F2WA 1P31A 1MDFA 4YRNA 2X41A 1IOWA 2XOXA 3NBYC 1AF4A 3GP3A 3IV9A 4BNYA 5MGNA 1ZD8A 4QUIA 1Y7HA 5GY7A 1QLJA 2FFBA 4G5XA 3M4NA 1PL7A 2REQB 2XWQA 4H1UA 2CL5A 4Q6BA 5CBPA 2VZ9A 2VF4X 4DPLA 3L7NA 3U7JA 2H4YA 5CT4A 4YRBA 1YIDA 4U5QA 4GYJA 1QIDA 1MQAA 1XG5A 4UDYX 5CDYA 1K7YA 3NHZA 3EWSA 3HU3A 2CB9A 1N2HA 4HX2A 1IAQA 1JG6A 4C20A 1Y7LA 3H2ZA 1I2AA 4MSUA 2JL1A 1ATIA 1DOAA 1IB0A 2FZCA 3CFYA 3GYGA 3DLTA 3EH2A 3BCRA 3H2SA 1NATA 3H9GA 3GZNB 3RVSA 2E4YA 2ZE6A 2NV2B 1QGYA 1Z8NA 3FZGA 3UT6A 3WB2A 5IS2A 3ER8A 1EKXA 2C5EA 2QYOA 2D2VA 2D74A 3A1TA 2YFYA 2OSVA 4FE4A 2UZ4A 3PQ5A 1RKQA 4U2FA 2BM9A 3PTAA 1QIFA 5A4AA 3WFIA 2A3RA 2CDCA 2DHEA 1KAHA 2GWRA 3QNUA 4DY4A 3NI2A 2JJ1A 3C1TA 3U49A 4BVFA 1MD9A 3K9WA 2PQ0A 4HVAA 2E4AA 2EFYA 2QPOA 2ZYGA 3QXGA 3H3JA 4MVJF 3OT1B 4DLRA 4DLPA 2JCVA 2WIGA 2BGRA 4KN5A 3ULKA 1SWWA 3SQLA 2PEZA 2W6JD 2C1EA 3C3AA 1M0EA 4Q21A 5DTMA 3DMDA 1EAMA 1EJBA 1KEUA 4US1R 4EGJA 4IJVA 4LVCA 4R6WA 4PO9A 3B85A 3T52A 4I8IA 3GY0A 3NKVA 3PG5A 3KYBA 5J9FA 3TFOA 3GEBA 4NBKA 1XVTA 1JHPA 5KYTA 1SBIA 2C42A 1QAQA 3E81A 5LXTF 3ZXXA 2J5XA 1J99A 4JIGA 4CR6A 3DMNA 1E59A 3NTLA 4GPTA 2O3JA 1T1SA 3D3NA 4MYHA 4KLNA 4D57A 4Y2VA 3QBTA 2K7FA 2PJRA 5CFNA 1HL3A 2GFQA 1DFGA 1JQAA 2WJHA 4FI3F 4O4IB 4IJ5A 4CG0A 3BCHA 3KLMX 4GZLA 4URUR 4O6VA 2JAUA 4EMBA 4V1CI 3WJ2A 3ODGA 3L7OA 1WCYA 1JI3A 3EXHB 4I19A 5BYBA 4HHEA 2Z6VA 5E38A 1DJQA 3Q40A 4ZI2A 4QOJA 3ZGVA 4QC2A 4B2YA 3LC1O 3LBHA 3NXKA 2BJWA 1PJQA 3F6RA 4O4IA 2PS9A 2A94A 1X8XA 5JLAA 3PXGA 1SZDA 5AUQA 2OQ2A 5CVTA 5L6MB 2BTOA 2ZRAA 5ALEA 4ZO9A 4G9EA 4V3BA 2GF0A 3DPIA 3EXHA 1UK9A 3WBFA 3EOAI 4AJJA 3KVOA 3IQWA 1E1RA 4KFUA 3T1TA 2AC4A 2WINI 4EWLA 1FZTA 2IHKA 4LRQA 4IIXA 1BH2A 1VSUA 4B75A 2QG6A 1LPOA 1UJCA 3MS4A 1BJTA 1C3XA 2QU8A 2WF7A 4MTCA 2DCUA 4TLMB 1N32B 3FMIA 2CNDA 2JASA 2VRNA 4FK8A 3VR2A 1VHWA 4G8DA 5KYXB 2JLYA 4KVFA 2PX8A 2W6MA 4WDQA 1E2DA 1AXGA 2O7VA 4ERNA 2YJ4A 3VTAA 5DN9A 2YIMA 3O8OB 2GFIA 3OY7A 5A7GA 3TEMA 3FFXA 2XD9A 3BXPA 4IOJA 1HNNA 4M87A 4GKJB 3QVGB 1IHPA 1FSGA 3CX8A 4IKEA 2OBFA 3QLVC 1VJRA 2JFZA 3IJRA 2D2IA 2XB4A 1JBEA 3MA0A 3QFSA 1CB0A 1UOOA 3HI6A 4MKRA 4ETWA 3VOTA 4PZYA 2XGGA 5I9NA 5AIBA 1R0YA 3VPDA 3VZSA 1YZLA 3AQIA 1S4QA 2E3JA 3QVGA 4JYMA 4OH7A 3NOXA 4BO9A 2R86A 1IM8A 1BS1A 1VBMA 3H5NA 4XW2A 4XOUA 4ZO4A 3SYNA 2PS1A 3WISA 4GC9A 4DJ5X 3MSCA 2FR8C 3BERA 2OV6A 3BJRA 1M0TA 3HYRA 5FI3A 1FMCA 4EHKA 1KOJA 1B43A 2QW1A 2WWHA 3JRXA 4TUYF 3ZGNA 4GM4A 1AGPA 1KBOA 2D62A 2BY4A 3DDOA 3UGTA 3I01A 1GSHA 1RFGE 4E5PA 3BL5A 4M0MA 2GZHA 3UOAB 1YI1A 2UV8A 1U2GA 1AMNA 1SXPA 5I7SA 3QHPA 1MHPA 4UULA 4DV0B 3Q11A 2EIXA 2ZAOA 5U4XA 4B40A 3AU8A 4NNPA 1OU0A 5CVUA 3HFGA 3MIZA 1LKZA 4HQNA 4LE0A 4D99A 2E4VA 5JASA 1VKJA 1X8LA 4OD0A 1WD5A 3WMWA 5BRJA 3RIXA 2RC5A 4QU8A 2XNKA 1Y4AE 1XMXA 4B5KA 2XIJA 5AW1A 4C4TA 3M4ZA 3KWJA 2H2IA 3IQFA 2CMHA 1C3OB 2AIRA 3HMQA 5IBPA 3UJ3X 3ZZNA 5A4MS 2PRJA 1RCUA 2J30A 4JB2A 3HN7A 1UDRA 1Y1KE 4G0UA 1TIKA 3AO0B 2UDPA 3U60B 2EX4A 1HZZA 2G67A 3R6GA 1U8EA 2XCOA 5FBHA 1SB8A 5KTOA 4AAYA 2FEMA 5IBCA 3CR8A 3I01M 4CQMB 1BQ4A 3AB7A 3FPJA 1C3OA 2PJZA 1GL7A 3L9XA 5L45A 1TUGA 1JFFB 4PHGA 3GUUA 4Q02A 1SQ6A 3WIEA 2N1BA 2ZE8A 2ZJ5A 4D3DA 3QUSA 4TMKA 3E7DA 2C9OA 1I2MA 2QT0A 4EMUA 1XCPA 2IPMA 2XR1A 1P4RA 5KVQA 1LTHR 3D0RA 5AM4A 1WV1A 3PB3A 4HB4A 1IHUA 2DFVA 2WYWA 3GXOA 4HLUC 3O83A 4CQMA 4CUJA 3V3KA 1CUHA 3HNOA 3LDUA 2B3DA 1JFFA 5JFTA 4RV4A 5DYGA 4EBBA 4HLDA 1FW6A 3C6XA 5KYNA 5K0ZA 4HRYA 4NBUA 1EQ2A 3EPJA 3RVLA 2B2XA 5C3MA 2HYIC 1WUJS 1WCXA 1Y1LA 1R18A 4YDHB 4P22A 2VWQA 5FOSA 4Y18A 1XK6A 3X1WA 3WGLA 3C15C 1YDMA 2B4TO 1B8OA 3P7MA 4AS2A 3K0HA 3PC4A 4PPQA 1EK1A 3CXRA 4RENA 4DR4B 4WCVA 1ZSVA 4H0CA 4B3MB 2C0PA 5DN6A 1OBHA 4MW1A 2Q1XA 3PQCA 5EQTA 1BA3A 4FQ8A 2MJLA 2CYBA 1KQGA 1F3OA 1KMCA 2BLNA 3BD8A 1COZA 4JUCA 4A2QA 1GV1A 3LS2A 4L3VA 5E8RA 1YRAA 3NRJA 3V2GA 3T4PA 2WKQA 3E58A 1NZJA 1PBTA 1VCIA 2JJ2A 4C43A 2PTGA 4UQOA 1BE6A 1SXJD 2HJRA 3SMQA 1N33B 2H65A 2GK7A 1OAKA 4KEAA 4PZCA 1QO9A 3DBVO 1I3LA 1XTBA 4P2BA 5JG7A 3D7RA 3TIGA 5A02A 1OQAA 4LS3A 5A6VA 1JQJC 2GJ9A 2W2LA 3AGPA 5CLIA 4PGFA 4ZMSA 2ARKA 3LCJA 4M8SA 5KHAA 4IMJB 4RE5A 3CN7A 3I37X 4MA5A 4E2FA 1NBHA 1P1JA 2ZCVA 3DLBA 4QQ8A 1JLSA 4C6HA 3B2EA 4MS1B 3FVWA 4BJHB 5ECWA 4LZZA 2QZ4A 5CB0A 1CQWA 1OFVA 1GU1A 2BELA 2VK4A 4YAEA 5EHXA 1ESCA 3K15A 3ICOA 3OHPA 1PSWA 5IDQA 4FYHA 4GI7A 5LYYA 4C4OA 2QY9A 1PEDA 1U8AA 3GT7A 4B47A 1CEXA 4INOA 2PD6A 4MS1A 5KNDD 2G08A 2PFGA 1M2JA 3OCVA 1F3LA 4B74A 5KYWB 2I3DA 2ABWA 3OAAA 4DVJA 3OQJA 3GF4A 2Z58A 1N7HA 4M1SA 1N2EA 3KPYA 3ZH2A 1UZMA 3G02A 5AUOB 2VPXA 3F8WA 3QENA 3J7TA 3O4GA 4H77A 4XQGA 3RSZA 2W6PA 3E1SA 4LWZA 4UNRA 4RLQA 4A82A 2PUJA 3V32A 4HNGA 3BF7A 1QH1B 1ZCZA 1FPMA 4EG3A 3ITEA 4ZDIA 1WDLA 2WYOA 4AROA 2IW1A 3IV6A 3T35A 1Z83A 1XR3A 4MRAA 2YN0A 1XEXB 5KSWB 2X9NA 2QXUA 5J1TB 3GEPA 4NZYA 4DWVA 3S5UA