3USSA

Crystal structure of cysteine dioxygenase from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure, Kinetics and M ssbauer Spectroscopic Studies of a Bacterial Cysteine Dioxygenase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3ussA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ussA02
3UKTA 4F8AA 1X8MA 4MZUA 1CAXB 1O3QA 3LA2A 3KSCA 2BEOA 2CAUA 2PHLA 2V7QH 3IBMA 1UIKA 1ZZ6A 2OYZA 3WW2A 2XLGA 1DZRA 3IDCB 5I0RA 4EWAA 4WVZA 3EHKA 4H7LA 4A2UA 4MGZE 5JCTA 5I8SA 5I93A 4IEYA 1IPKA 5I0SA 4AQ2A 2Y0OA 3RYPA 1J58A 2GAUA 4N9IA 1OMIA 2WFPA 1GQGA 4HBNA 4CYDA 3H3UA 4HN1A 4B29A 2BNMA 2GC2A 3PJSK 4X6RB 2O8QA 2QJVA 5LRRA 1CAWA 4BHPA 4R52A 4XFFA 2OA2A 2IXLA 5F1RA 5KHIA 3WW3A 2VECA 4EROA 2ZKLA 2XL9A 3LAGA 2EVXA 2D5HA 4MUVA 2BYVE 3NL1A 1WGPA 2H6CA 2PYTA 4IEVA 4OFGA 4HVQA 4Z82A 2B5HA 1EYBA 1J59A 4ONUA 3I7DA 1WLTA 1VP6A 5E16A 5I0UA 3I54A 2IC1A 1ZX5A 1NXMA 1PM7A 1DGRA 1I6XA 1OI6A 4KWJA 1J1LA 3C3VA 1CGPA 3USSA 1X82A 5LEKA 2K9ZA 3DL3A 1NYWA 4HSLA 4IEQA 2QDRA 4MX3A 1ZZCA 2PFWA 5FQ0B 2F4PA 5I0TA 2QNKA 4PJYA 5KHHA 3PVBB 1RC6A 1UCXA 4META 1YLLA 1X8EA 1YFUA 4P9GA 1O4TA 1ZRDA 2C0ZA 4J1WA 1AQTA 4K8FA 5AVPA 2XLFA 3UKNA 1ZRRA 4JTOA 4XFHA 4UBHA 1DZTA 4IEWA 3G7DA 1RGSA 2BGCA 3RDIA 4Q0PA 4PIZA 5CADA 4F7ZA 4DINB 5EZWA 2CK3H 2H0VA 4D7SA 4AVCA 1VR3A 2KXLA 4HSJA 3D82A 4LUKA 3S0MA 3RZZA 4Q29A 3I59A 4QGNA 2PAMA 3IIAA 3EQEA 4KU8A 4LEJA 4IERA 4IEXA 2QE7H 1Y9QA 1VJ2A 3D0SA 3E6DA 4EV0A 1ZZBA 5J3UA 4I0BA 2IXCA 1O3SA 2V09A 4XFGA 1FI2A 3KGLA 2PAKA 2EA7A 2Q30A 2FMYA 4YRDA 2H6BA 4Q0SA 3SXWA 4IETA 4JVAA 2ZCWA 5E1RA 2MPFA 2IXHA 2E5YA 3H1WA 4IEOA 5FQ0A 1ZZ7A 5FDBA 3TNQA 3FWEA 3KMHA 4MH0E 3WW1A 2K0GA 3OCPA 5K8SA 3HQXA 3U11A 3OGJA 4J1XA 2DCTA 4XFIA 2I45A 3ZDSA 5KHKA 5C8WA 1XRUA 5BUVA 3PLQA 2UY8A 4IEUA 3TNPB 1ZREA 4KWLA 2HJIA 1NZCA 4HVRA 4E2QA 1ZRFA 3DKWA 1QWRA 4ZU5A 2GU9A 3CF6E 2HKXA 1BSNA 1QXJA 4QXKA 4XF1A 1UIJA 3ACLA 5LRSA 3RNSA 4AXOA 4UXAA 4Q0VA 1FT9A 4WBBA 4XETA 1J3QA 2OZJA 1YUDA 4XEZA 1EP0A 1QXRA 4PIYA 2N7GA 1TQ5A 5J48A 2Q4SA 2Q1ZB 2MNGA 4E2SA 4E2GA 3EBRA 3FE5A 3H50A 2WSSH 4OLLA 2W6JH 4IESA 3L2HA 3HT1A 3DN7A 1RL3A 3GYDA 3LZZA 5LEJA 1RUNA 3WW4A 4I01A 1O3RA 4HMZA 3CEWA 4L2NA 3LWCA 4AQ6A 2GC1A 1I5ZA 5JSOA 4QMAA 4LA3A 4YYOA 4AVBA 3S7EA 2ET1A 2XHKA 1FS0E 2GZWA 1YFYA 2D40A 1SEFA 2QVSB 3CLPA 4L11A 5BXXA 3H3ZA 3NW4A 3ELNA 4LULA 4IEZA 2PQQA 4GULA 1ZVFA 5EFUA 2UY9A 2ATFA 3E5UA 2OPKA 5CVRA 1HW5A 3NSTA 4MGYE 1V70A 5FLIA 4I09A 3MZHA 3GBFA 2VQAA 3VHRA 2XKPA 1DGWA 3CJXA 3CO2A 4UBGA 1OD5A 2PAEA 1Q3EA 4LUMA 4TLFA 1CAUB 1ZZ8A 4FT8A 2PA7A 2OZ6A 4HN0A 4XF4A 4R8HA 5FPZA 1BSHA 3ROUA 4PIXA 2MHFA 3E6CC 1CAUA 1UPIA 5KBFA 2E9QA 3QOPA 4BIFA 4D7TA 1UW8A 2BNNA 1O5LA 2ETEA 1LB2A 3FX3A 4Z07A 1ZRCA 4XFCA 5BPXA 3LOIA 3MYXA 4XFBA 5JR7B 3E5XA 1Q5OA 3RPQA 4YXWH 3FJSA 4QGMA 4JV4A 1PMIA 1O7FA 5FCCA 4IEPA 1OFNA 3IWZA 2BNOA 3U0ZA 2IXKA 4YARA 4MV2A 4FAGA 4XF3A 1H1IA 3KCCA 3JZVA 1O3TA 4ZU4A 4LA2A 3KGZA 2XGXA 2Z2SB 3EJKA 3DV8A 1L3JA 4AVAA 5FPXA 1IPJA 3QACA 5JSPA 3E5QA 2O1QA 3SMHA 2ET7A 2GC3A 4I0AA 4Q0QA 1YFXA 1E79H 3OD0A 1XE8A 3H7YA 5I8YA 4X6QB 3LA7A 5CU1A 3BALA 4FAHA 2Z69A 3H7JA 3ETQA 1XE7A 3CL1A 3MPBA 4YNIA 3H9AA 5C6CA 2XKOA 4LTAA 1J3PA 2JDIH 3ES4A 4ORFA 4EWDA 3N4MA 3D0JA 3NVCA 3M70A 4EWEA 1U12A 3E6BA 1CAWB 1X7NA 4MGIE 2P17A 3HT2A 1GQHA 1QY4A 3M3IA 5BV6A 5KHJA 1WA4A 2GC0A 5J7MA 4XFAA 4BYYA 1UD1A 4HZFA 3BPZA 1EY2A 1LR5A 4BH9A 4ZU7A 3BU7A 4QGLA 3LA3A 3ST7A 4KWKA 2XL7A 3SHRA 1NE6A 2D5FA 4RD7A 2CV6A 3H8UA 3NJZA 1ZNPA 3HIFA 2XNDH 4QX5A 1CAXA 2PHDA 3RYKA 4KL1A 1YFWA 3UKVA 2UYBA 1RTVA 5HI0A 5JSRA 2XLAA 1SFNA 2Q0AA 1ZZ9A 1LRHA 2B8MA 2D93A 1YWKA 3SCHA 1O5UA 2WC2A 4FBFA 4WZCA 2B9UA 1NE4A 5D1IA 4KU7A 4Q0UA 3O14A 1IFPA 2QCSB 3FHIB 3SCGA 1RUOA 3H1YA 5T3NA 1CX4A 3S7IA 3OTFA 4DJGA 3I59B 1JUHA 2IXJA 2CAVA 4O9GA 5FLHA 2CGPA 3NKTA 2UYAA 3R6SA 3OF1A 1SQ4A 5BY5A 3ES1A 1LKNA 4NVPA 4JTNA 3IDBB 1CAVB 3BB6A 4XF9A 3FZ3A 3U10A 1CAVA 2VPVA 1H1MA 2IXIA 1FXZA 1Y3TA 2FQPA 4HLTA 3SCFA 4QM8A 4YSFA 5FLJA 3E97A 2PTMA 4XF0A 3EO6A 4I02A 4N9HA 5KHGA 1G6NA 2E5TA 1EPZA 3B02A 3MDPA 5I91A 3RYRA 3FFQA 4QM9A 4O9EA 1Q43A 4HVOA 1J3RA 4LLOA 3EFFK 4I3PA 1JEKA 3PNAA 3BCWA 4MGKE 4I2OA 2EAAA 1YHFA 5JAXA 2GH2A 5I8TA 3H1MA
chains in the Genus database with same CATH superfamily
3RZHA 1KITA 4F8AA 4R4XA 4IFFA 2YPJA 4MG2A 2QQKA 1GW3A 3ABVC 1FNYA 1DFQA 2O01H 3LA2A 1ULPA 2A71A 3KSCA 2E75D 1FOD1 1WZXA 2R49A 4QB2A 5DZEA 3AMQA 5FAXA 4FPEA 3WW2A 1JZ2A 1RF0A 5GZGA 1SBDA 5I0RA 2YU2A 4H7LA 4A2UA 4IL6E 2ZVNB 2VNOA 4LBLA 3M4FA 5I8SA 2R32A 2YGMA 4IEYA 5I93A 4Q4X3 1IPKA 3PH0A 1VQLP 2ZGMA 4ISRA 4QQPA 2Y0EA 1Z78A 2QQOA 2FZ2A 1SCRA 2HBUA 1KB9H 3UETA 1UQXA 2Y0OA 3DXUA 3P7KA 3PLNA 5A33A 1OMIA 2WFPA 5LBEA 3NJXA 3VL8A 4BXSV 4AVSA 3T97B 1GQGA 1VBA1 2ZX1A 1AX1A 2E7QA 3WF3A 3DPRA 2JE9A 2C5DA 3PJSK 4IL7A 3VV1A 2PHUA 4ZKUA 1DYKA 1NG0A 5M0TA 3LIGA 5LRRA 1OW8A 3NFQA 2V7QJ 3VBHA 1SLLA 2IXLA 1TNRA 1SQVE 2LR2A 2JJ6A 4LK7A 4XAEA 3L74G 2RH0A 2W27A 1AQ5A 1JTZX 2JD4A 3GZAA 4GMP1 3VP9A 3WW3A 1CPMA 2OUHA 2VECA 4Y99C 3HQUA 4HJGH 1JNMA 3NQHA 3OSDA 4AEDC 4DY5A 4FTSA 4AI8A 2DU1A 3WG1A 2HLEA 1LTJB 1UKRA 1DLLA 1NLSA 3NJVA 4Q8LA 5AFEA 1KYOI 1BLZA 2H6CA 2PYTA 4UT5A 1J1DB 1JU4A 1ALYA 5KLVD 5H2FE 5GLUA 4E8CA 5APAA 2PAJA 1RF1C 1BK0A 2ZXEB 4M0NA 4ZZ8A 1EYBA 1OW6A 3ACIA 4YM2A 3ZYBA 4PT6A 3RK3B 1GOFA 1VP6A 1WLTA 3B9IA 1FMD2 2KM2A 3HVDA 3K75B 3I54A 3FBYA 1GBGA 3C7FA 4CP9A 2Y9ZA 1HQLA 2A75A 1JOPA 5JI9A 4XBLA 3WUTA 2A06D 2HWE2 2G4IA 4CEWC 5BVZA 2VULA 4XJZA 2FFDB 2GM4A 4CDQB 2CPBA 2KIKA 1J1LA 1H8VA 2WTYA 3IB3A 3FXEA 3BCCE 2N9YB 3R2PA 2WSUA 2YKPA 4Q1RA 4QU2A 4S2HA 3NV4A 3GMAA 4LGDE 2YU1A 3USUB 4YW6A 3CJIA 2WNUB 1EC5A 2QJKC 4HSLA 4X8PA 4FTBA 3VDDA 4XE9A 3RMYA 3WNMA 1S5LX 1ZXGA 2RR12 3TWIA 1PP9G 2PELA 4MX3A 1GWLA 4MOAA 1RUI3 4RS5C 3HE4A 3POBA 4HANA 5CIRA 2JDYA 3RK3C 3AC0A 5D8AA 3HN3A 4P9XA 3VMYA 5I0TA 2DV9A 3PVBB 1IQDC 2JENA 3O0XA 3NV1A 5JOXA 1YIJP 1O4TA 2FMDA 1ZRDA 2ARCA 2C0ZA 1AQTA 1AX2A 2O3JA 2JKVA 5C8CB 4ZS2A 4A6SA 1LWUC 1POV0 2XLFA 4QX3A 5B5EE 2PHRA 4TT3H 1DGWX 4RR3A 3ZKUA 1WMDA 1N1TA 1SZBA 2HYXA 2VOXA 4TN7A 4JCKA 5KAFH 1DZTA 1VBC1 4L76A 3WCRA 3G7DA 4GMP3 4EIJA 2BRTA 4P00B 5SV5A 3RDIA 1NTZG 3F89A 1LJ2A 4Y1VA 1W99A 4BMEA 1JOJA 2X5IB 3POJA 3N7NA 1LHOA 1SCSA 1VMHA 5LK5A 2CK3H 2XDJA 3G3ZA 1V9U3 2H0VA 2VZQA 4D7SA 2DUOA 1S1CX 2TUNA 3CDZB 4CCDA 3S57A 2Y0DA 4HKLA 3VOPA 4NWVA 4LUKA 4WVMA 4AHZA 5FYVA 3RVHA 4P9JA 4FOQA 4FPFA 3RZZA 3TEZA 2VMHA 3PTRB 1LHWA 2YO3A 4H13C 2HLOA 2PAMA 3FHAA 2P6CA 3IIAA 3J8F1 1HRI3 1SPPB 4L92A 4NPLA 4QKBA 3VBUA 3T09A 3T4VA 1Z7S3 2WNVB 1UZZA 3EQEA 1SLCA 2VZVA 1SQPK 4OWFA 2VZPA 2P1JA 1MPXA 3TDKA 3EFGA 2ZGPA 4IEXA 4KBBA 2V5DA 1Y9QA 4BQ2A 1NTZE 2BEQD 4CXXA 1PIXA 3A2AA 3KV6A 2RS31 4BB3A 1ODNA 2RMU2 2VW1A 3TOJA 1YYNA 5LZ6A 5A1FA 4JDNA 1GMJA 3WU2H 1GNZA 2EA7A 4W4ZA 2OKXA 1IO4A 3VP8A 1FZFA 2H6BA 4QX0A 4Q4V1 3SXWA 2WO3A 4A7ZA 2FZ1A 1PZ9A 4K7JA 1WW6A 4JVAA 3S1KA 1XQNA 2XJVA 3H1WA 2ZAEB 1GD2E 3BCCD 4N43A 4ZPIA 1W2BO 2JP3A 3CXHD 1CIYA 2RG4A 4HB1A 3CCLP 3MPPG 3N36A 5DDJ2 1LT9B 5CFDA 1GV9A 4CCEA 2D6MA 5FQ0A 1AVBA 4GJYA 1AR91 3WF4A 1ZZ7A 4D7TA 1NO4A 4LJHA 3FWEA 1E5WA 1PGJA 1LP1A 3GHGA 1S0BA 2K0GA 2WA4A 2WL1A 3OCPA 5A7SA 5CZKA 4JRAA 1UZYA 3MV11 4Q4V2 2JECA 3L75J 1BE3D 4ZNCA 2P3IA 1H4HA 3AP5A 1KC8Q 2DCTA 3N9OA 1SQPJ 2I45A 3OGVA 4XFIA 5FZ8A 5FP4A 3VBSB 5LK7B 5FYSA 2VOKA 4FQ4A 1SFCB 3KV4A 4OH8B 2Y26A 2UY8A 1U7MA 2VG9A 3CPWO 4E27A 4LO8A 2D3SA 5FYMA 3LEGA 5DXDA 5CFCC 1K3IA 3IDAA 2HJIA 3PUQA 4Y4RA 3M0DA 3V4QA 3CI9A 2WSCH 3A0BE 4PJ0H 4YTPC 3RK2C 1HQNA 1KJLA 2XBO1 3IMNA 5FY8A 4NHYA 2QE3A 4B86A 1RQUA 2Y8KA 2ZHNA 4Q4X1 4RGGA 3OUIA 4XACA 5GLWA 4CYDA 2QSIA 3DKWA 5CJ0A 3AP9A 3ZDMA 3KD4A 4AQTA 4UF0B 5IVFA 3J7LA 1S2KA 4XQWA 2GU9A 3VBHC 4TXWA 2CDOA 2QQWA 4UI9L 4YW4A 2XH6A 1OVVA 3ITQA 2R063 4QPWA 1UIJA 5DQ0A 3BRVB 3OGGA 5DAVA 2A06G 1LOEA 4AXOA 5LRSA 2ZGKA 1U5YA 3OEBA 1SQVG 1LTBC 1OPOA 3HWJA 4JGZB 2ZJSE 3C1LA 4GIQA 2V4HA 4NRPA 3ECQA 3H1HG 5A3LA 3A7OA 1QXRA 4YW7A 1UL9A 3A23A 4H7MA 3FX0A 4PIYA 1QMJA 5A32B 4YG0A 5LA9A 1UMHA 2GH8A 4CA9A 1OBNA 2BDRA 4AOCA 3W58A 2QQNA 3AE1C 2B7YA 4Y1ZA 3B5ND 3VZLA 4E2SA 4UFIA 3ZM8A 4OLLA 2W6JH 2XJRA 4CCNA 3TEWA 3HBKA 1OC1A 2JWPA 4Y20A 1RUE2 3W9AA 3D4KA 1FZAA 3L71D 1SG3A 1WMEA 2EXKA 2SBAA 2ORZA 1E5IA 3GF7A 3GHNA 4JQTA 4M4RA 1DX7A 4YZ2A 2GC1A 5EP9A 3RQ0A 4M3CA 4AFBA 1IG3A 1GL2A 5KJ7D 4XCBA 2JJLA 1DU3D 1W05A 2Q1FA 4RKUJ 3IF4A 4LA3A 4AVBA 4EN7B 3ZYJB 3PL0A 4QDSA 3E7KA 1RUC2 3JUUA 3MUY1 1FS0E 2NRGA 2WSEH 3ILFA 5BNNA 3HTKB 1WRGA 5AW8B 3H1LG 1F2NA 1ND3B 5E79H 1U0AA 1X36A 1YFYA 3O6QA 5D8AC 2C1FA 5FRAA 5FZOB 2RMU1 5C5TA 4EE2A 1SEFA 4SLIA 2QVSB 4OHZA 1W9YA 1UF2C 4XUQA 4DB5A 5C8CC 1V6IA 5LCWL 2XBO3 1PPJD 2WFF2 4CDUB 3A5TA 2VTXJ 1JYIA 1J2JB 3VYIA 5FXVA 5BXXA 1CI6A 1SQVD 1VQ4P 1S4XA 1A6CA 2VMEA 3I2KA 4GOEA 2WT1A 3H3ZA 3NW4A 1RJ7A 4YGDA 3ELNA 1AR72 1LOFA 4EQVA 5AVAA 1VMJA 4OI0A 1ACCA 2DBIA 2M0BA 3K3NA 3D70A 2ATFA 1Q86Q 3PJQA 2W8ZA 1GK6A 4WVVA 5GM0A 2Q8OA 3ZYFA 2OPKA 4XAAA 4FFIA 5IK7A 4QXHA 5CVRA 4AFCA 1GMMA 1XOYA 3NSTA 1REFA 4K1ZA 5K4LA 2ERFA 3ZLIA 2DVAA 5CAZA 1RHI2 2W5FA 4DZGA 2FKWB 2IFNA 2XKPA 2XXZA 3MEPA 1L7QA 1QJU2 4I0WB 4C1XA 3CO2A 1PO21 3GBGA 1D4M2 4WM7C 4H0LC 3P8CD 4E4HA 2P34A 5DUWA 4COWA 1F35A 1TZOA 4DXZA 3J7HA 2DW3A 1OX3A 1P84H 3J7MA 3LEMA 3L71G 4LUMA 1LOBA 3THPA 3EQ2A 3UGGA 2ZKNA 4BLJA 5KAIH 1CAUB 3K4AA 1KILD 2JDUA 5AW1B 3AMMA 4HN0A 4R8HA 3H1KE 1R1A1 2FBEA 4WV8A 4C91A 4CXYA 4BWOA 2NZ9A 3LPGA 3M1HA 3ZXLA 5HCAA 1JZ5A 3E6CC 1VAMA 2W6BA 3SWKA 4PHZA 1JY3N 3PMEA 1BBT2 1A02F 5LBFA 2E9QA 3WU2E 2QM7A 2V4VA 3THCA 5BNOB 3MIEA 4KHXA 2QDNA 2WS92 5BNNB 3FX3A 4ZXKA 5A3WA 1JMBA 3B5NB 2MEV2 4IOIH 2PLV3 1VQKP 1R081 1BQPA 3ASIA 2YXQB 3GXUA 3J7NA 4Z07A 2JDPA 1HF9A 4XFCA 5EYXA 5GKAC 5GZDA 3WLUA 5BPXA 3JQWA 5J09A 2IFWA 2QQIA 1FOD2 3VMZA 4LBKA 1V9U2 2R062 4EN0A 1XXNA 2B89A 3RPQA 1QOOA 4UFKA 4Y28J 3FJSA 2QQJA 1QJY3 1OUXA 4N7IA 2QJPC 1PMIA 1JZ4A 3FN9A 1O7FA 4NIDA 3L70J 5T5OA 3V2PA 2RE9A 4YW3A 1HN0A 2QQUA 4Q4V3 4R4ZA 3KWVA 1S3JA 3ALQA 3AZWA 3LDRA 5T5LA 3CBNA 4AZZA 2WJSA 4NIGA 3KCCA 2A7AA 3T0DA 5JMOA 2AZ5A 2N1TC 5L36A 1RITA 2WZR3 2Z2SB 3DUIA 4FP2A 3SKVA 5FMCA 2QG4A 5BNOC 2VNGA 4W8JA 4WY4B 2OYIB 5FY0A 1QOTA 1RVF1 3GZTB 4LBQA 5JLVA 4NUBA 4Y1XA 1AYM3 3CXHE 1PZ7A 3NMBA 4XE5B 5DUVA 3TF5A 2ZGLA 4Q0QA 2JG9A 4UWDA 1DQ1A 1IGOA 2BFUL 3JD72 2QTWB 4Q4Y1 1XE8A 2QZ2A 5B5EH 4H14A 3I3MA 2MKVA 1LCLA 3LQCA 4TTGA 5L7OA 2VQTA 3L72J 2BUKA 5F3EA 4FAHA 1XE7A 5APSA 2W68A 1VQ9P 1CPNA 2RS11 2WSVA 1JHJA 1GWKA 5AVQB 1NX9A 1CSBA 5C39A 2IYPA 1HRV2 2R3SA 4A7PA 2E6VA 4FQZA 4LOSA 5A7QA 5F6LB 3O1RA 1NTZD 5KAIE 1KYOH 1LTTC 5APQA 4GB32 5C9AC 1URQA 2HG5D 1S0IA 2VOWA 3N3HA 2WIIB 3SISA 1FZEA 4GKXA 4B8EA 4DUVA 1DG6A 3D0JA 2C9KA 2VNRA 4CU7A 3M70A 3MW4A 2ZGNA 2HWD1 3E6BA 3K4ZA 1FE6A 1SDWA 2P6HA 2KUBA 5H9RA 2VZRA 4GODA 1RUH3 3VBFC 3WG4A 5JZGA 1VE0A 1T2KD 1KXGA 5EPAA 2EAKA 4A42A 5BV6A 1JOBA 1WA4A 2QKDA 2VM9A 1JY3O 3JD73 5APYA 3AP6A 4PD4I 1SQBG 3P5BA 1IPSA 4XFAA 3SEEA 4BYYA 4CDWB 2A1XA 4IV1A 3K46A 1IK9A 1UD1A 3AE4C 4PJ0E 1BEV2 1GYKA 1WKYA 1XSRA 4GDOA 3BPZA 3L2YA 4HZFA 4DEVA 2XJQA 2FYZA 4N78D 1N73B 3K77A 4XQ4A 5DZGA 3CX5E 3ZFEB 5AVRB 2VRSA 2ZXQA 1IK7A 3NRUA 1QIQA 4G3YC 2IFRA 1W6QA 1AV1A 3CCMP 3ZYIB 4C8DA 1N2DC 2XL7A 3SHRA 4RYDA 5D21A 1YBKA 1ST8A 1W0NA 4IE0A 3AE3C 2D5FA 3BCCJ 4P9LA 2ZX2A 4RD7A 3NJZA 4W6WA 4XXAA 1VQ5P 2JEMA 3O1VA 3K4DA 1MZFA 2X05A 2J5UA 1E5SA 1Y9GA 1PPJG 1C5HA 2J58A 1UNBA 2W1QA 3BODA 3GM8A 2D43A 4LBOA 4LBQD 3T2PA 1OF4A 2OS2A 2P37A 5CFDB 2J1AA 2C0XA 3P8MC 1HRV3 2RVAA 3R4YA 5GZEA 2PHDA 5D2AA 1J1EC 2J42A 1YQ8A 2VMCA 4WM8C 1ONAA 3U4SA 3GLMA 2DCJA 4IFDK 4C7NA 3MIWA 5JSRA 3B71A 1PGQA 1SQVK 2FYUG 1SFNA 2XPJA 4WVWA 5IAVA 5F5IA 5C3SA 1ZZ9A 4AVTA 1Q90D 4OHVA 2D93A 1OUSA 3O7OA 4DMIA 3IFMA 3OAKA 4FPHA 3O1TA 3BASA 3KQ4B 3RG0A 1NQDA 3ZMNA 4CP0A 1LU1A 1YC61 4AK3A 4C0HA 1PFIA 1W8HA 4WWIA 3MLKA 2WN2A 4AL9A 2D98A 1PNFA 4GJZA 3N7KA 1WWYA 4NO4A 2E51A 2VOVA 3S6PA 3TBDA 1IFPA 3UJQA 3VBFB 3VKFC 1RUOA 2WNVA 3CLQA 3N9MA 5AC92 3KZIH 1CX4A 5T3NA 3S7IA 1SQPE 4ZHNA 5KLIB 1H2MA 3VDDC 1L0LJ 3F5HA 3ZR6A 2J1EA 4GWMA 3VL9A 3I59B 1JUHA 2BGOA 3CZUA 1NA1C 4OGQC 2EXHA 2DUPA 3AP7A 4QQOA 5FLHA 4IGPA 4CDQC 4FXGB 4UAPA 1IG0A 4YPCA 1PM4A 1BDCA 4W7ZA 1NY71 1D7PM 2D97A 4J25A 1F5FA 4I7ZC 4K40A 2W1WA 4XDOA 5BY5A 3IAQA 4TLGA 5F37A 3VBOA 2X5IA 5DPNA 2VZSA 3IDBB 2JDNA 1J83A 3MFAA 3AE9C 3VLBB 3BB6A 3M9QA 4XF9A 2R042 3VBRB 1QJX3 1ZRIA 5ABJB 1Q56A 3O0VA 2AEZA 5IVYA 5FZ9A 2BVBA 1CAVA 3U10A 2ADDA 3T1LA 1H1MA 1USDA 3SEPA 1GWMA 1L4AB 3NNGA 1OQDA 3AFGA 5T52A 3RWNA 1BBT3 3WNXA 5AW4B 3SCFA 4XFJA 2VNVA 1AHSA 4TWTA 1KV4A 4C7RA 3MIBA 2ZX3A 3ZFFC 1EQ7A 4FOWA 2N9BA 3I2OA 2JG8C 5GZCA 1MZ9A 2PTMA 3OB8A 4KMQA 1ENXA 1VBE1 4XF0A 3EO6A 1W28A 4XOGA 5KAFE 1HRV1 1YXWA 5FMBA 5LW9A 3T3YA 1DGRN 3RWKX 1G6NA 2Q3IA 1E57A 1QJZA 4BIFA 4OGQB 5KXEA 1FOD3 3DPRC 4RSUA 4ZXEA 5AC91 5EWSA 4QM9A 5JWPA 2WPSA 1NKZB 5KLIC 1Q43A 2J1SA 1J3RA 4MADA 3OBZA 1X33A 3CJIB 1V00A 1GZLA 4FPKA 1K42A 1UZWA 5FTTC 4I3PA 1JEKA 1NTKE 3NXSA 5M1BA 1ND3C 4JQ0D 2VZ1A 1V6MA 4XHBA 4ZONA 1CD3G 1GDTA 2QEXP 3CCVP 1Z0HA 2GH2A 2Q1MA 5JAXA 2Z5IA 2KLVA 1W3VA 2ES3A 1FDMA 3ZYGA 3HTKA 5JXJA 4MZUA 2IUWA 2J1UA 4CDUC 5CCGD 1G2CB 1CAXB 2N1TA 2LM3A 2VVEA 4Y3OA 1HV1A 2PHLA 3LD8A 2OYZA 5GALA 5FMOS 3ZFEC 4D6QA 5HPOA 2RDNA 2P1BA 1SMVA 1QXPA 2XLGA 1QGKB 2WWSA 2A45H 1CW5A 4CU9A 3IDCB 4OULA 1Q8QA 3OJBA 4WVZA 1LTJA 3EHKA 3CCRP 2A3WA 4Q4X2 2ZYDA 1P84D 4JPZB 2DFBA 3AE5C 1Y4WA 2RS12 3H1IE 3A4UA 1QX8A 4DOUA 4DT0A 4EYUA 2E74D 3TYYA 1LHUA 2Y6FA 5J96B 1BK1A 2A70A 3VN4A 2KZJA 3I5CA 1CJDA 2YMKA 4J6GA 5FY1A 5A7WB 3OEAA 3Q8CA 5E6HA 3RYPA 1QQP2 4LE4A 4MHUA 5EJ3A 2P7JA 2I74A 2R44A 2BFUS 4JHZA 1PMHX 3GBWA 4HBNA 3L74D 4XZUG 3U37A 4HN1A 4N53B 1PP9D 5FZMA 1KMIZ 4JGZC 1L0ND 2QJYC 2EIEA 2VZ3A 1LGNA 5IHRA 1JTHA 3I8TA 1JYXA 2K9YA 3SWFA 4H3WA 1CAWA 1BKZA 3MIFA 4XIOA 4EN8B 1VBE3 4XFFA 3VMAA 1DP0A 1QKQA 2OA2A 4CSWA 4UYBA 1TMF3 3M06A 1FJKA 2D2CC 1OLMA 3GW6A 2JDZA 5A7WA 4CXWA 2CDPA 2ZKLA 5FJHA 2XL9A 2WR9A 3BKZA 3LAGA 5FZ3A 2H89C 2Q3EA 2AACA 1UXZA 2EVXA 1NUKA 4H13D 2B42B 2D5HA 1VQ7P 3AM2A 1AVYA 2HWF1 1QJU3 1ZBA1 1APNA 1IJDB 3V4WA 3NL1A 5FYCA 3X29B 4YZ5A 4OFGA 2QIWA 2ZEWA 5GTHE 2ZGTA 5A3MA 5F9TA 5IFPA 2ZYAA 3M0AA 3CCEP 1W6OB 1GNYA 2W91A 4QU1A 2YB7A 2HR3A 1EZVD 3L75E 1PX3A 1UX7A 3TSIA 1AL0G 3HD7A 3I2JA 3JD71 4DIQA 4Q8KA 1K8AQ 1MFZA 4YW5A 5AFBA 2E7AA 2UWJE 4N8MA 2VL4A 1I6XA 4Y1UA 1W9SA 4L74A 5F8PA 3I4IA 1DD4A 3UL2A 4DUXA 3SITA 1DEBA 1X79B 2DVBA 1CZSA 2B9VA 3D5OA 2KOGA 1UYPA 1WLDA 3C3VA 4LXLA 4WM8A 1M1JA 1MQTA 1X82A 4CEYB 5LEKA 3DL3A 3H1KG 1UIXA 1NYWA 4OHWA 1RJ8A 4M00A 1B09A 2LALA 4GWJA 2XJUA 2E42A 5CKQA 5FPLA 4JQRA 5AW5B 1CZTA 1JU3A 4RGKA 3WT3A 4CUAA 1PL5A 1U7JA 5JDBA 4PCRA 5GTIH 2G3AA 1O4YA 1LT9A 2QNKA 4PJYA 1F31A 4NRMA 5FBZA 3MF6A 3O1OA 1M56D 1UCXA 4N43B 3MUDC 1K12A 3RBXA 5FZCA 1OHFA 1NTZJ 3POEA 4LHSA 5DAQA 4JKMA 2KSEA 1VF5B 1IFMA 1EDIA 1OPMA 4J1WA 4NHXA 1A8DA 4OUSA 5G05L 5A1AA 5IK8A 1NOHA 1M57D 2EIBA 3UKNA 1VBD1 2VW0A 2E74B 4JZRA 1R092 4W50A 5FUPA 1YI9A 3G4SP 4FCAA 4KG8A 3WD5A 4A7YA 4CUBA 2WLQA 4HONA 3VBRA 1U5IA 4DRVA 2WQZC 2F17A 5KC6A 1POV1 1SLBA 1N7SC 4K35A 4PIZA 5CADA 1NXD1 2VOTA 1KFNA 3CX5D 4DINB 3I2GA 4RHV1 3AZVA 2RS33 2BZDA 1H89A 2ZT9D 1VR3A 1JMUB 1OSGA 4IE5A 1H9WA 1BHGA 1VPCA 2ZGSA 5EQUA 1SQPD 1HGVA 3LEIA 2OYHA 2J1RA 4BMBA 1IS5A 4JX0A 3BTAA 4Q29A 4HH2A 3LF7A 1YJNP 3PDQA 3I59A 2AXCA 3WR0A 3PIJA 2YBKA 2ZGQA 4V2WA 5F32A 2VY0A 2GMEA 5IT6A 5A3OA 4WM7B 5F2SA 3UYJA 3ZFFA 2M5AA 2VCMA 4FVVA 4RHV2 1S9KE 3OA7A 5CBOA 1AUYA 3C9IA 3ZSLA 4XUNA 1KB9E 1AR93 4D8MA 1KILA 3ZSEA 1QEXA 2QE7H 5DDJ3 5A7OA 4YZ1A 2YIUC 2VTXA 2XG3A 2ZEXA 4QXBA 5FZLA 3ZN4A 2WZEA 3ZR5A 4B1LA 4EV0A 5J3UA 5L9VA 4I1LA 1H2NA 3JCIA 1YRZA 3AZZA 3OPZA 4B3NA 5FZ0A 4GT1A 4EI2A 1C4RA 1FI2A 1JN2P 3C2UA 4FP3A 2Q30A 1K05A 4KGQA 4ES9A 1N7SB 4DOJA 4YRDA 1MS4A 4LBJA 4L73A 1M1KQ 3HD8B 5LA0A 1K5MB 2AEJA 2ZCWA 4YGBA 5JI7A 5KXCA 2IXHA 2GMPA 2Z79A 4IEOA 5DN2A 4QXCA 5D8AB 5AVZB 2ARAA 2Y38A 5IYYA 5FZBA 5A7NA 4MVTA 3JCUE 1ZR4A 1N3PA 1URXA 4CCLA 2UU8A 5FDBA 2BEZF 1W8OA 4UFMA 1MZEA 1PO13 1XNBA 2E75B 2ZMKA 4MH0E 1L7LA 4FPCA 4AEJA 3IT8A 5EHDA 2ZMLA 2OGUA 5AW0B 5K8SA 2W94A 1GR3A 1OWAA 3GF3A 1M1JB 2YNYA 1MQTB 3O5SA 3PUAA 4I3GA 4RGAA 4AGGA 2EICA 2G8YA 3L70D 4YWAA 3SFDC 2BU9A 3WDTA 5CG8A 3CQOA 1ZOYC 1PMJX 2WSFH 3ZN6A 3WNLA 4OZXA 5FUNA 1BJQA 2DVGA 3QWOC 1OW7A 1W6PB 1IFIA 2DCZA 3PLQA 3KXDA 1ZM1A 4CCOA 2FDKA 4UW3A 2R043 2NN8A 1CWPA 1MEC3 3CD6P 3MGNA 3HD7B 2RMU3 2R7EB 1S1AA 4PDWA 1GZ9A 1LULA 3U07A 1PV3A 1D4M1 2UWCA 4CEWB 3K51A 5ABJC 3FFZA 1M7LA 3ZOIA 2FDFA 3ZIXA 4CVUA 1UOGA 1C5IA 4LOTA 5KXBA 5KLVK 3PJYA 4XJUA 2X10A 1DQ4A 2R5DA 2H0BA 3D3AA 2HODA 2YKOA 1K5MC 1OKQA 3ENRA 4YVSC 3CF6E 3KT4A 2WPVB 3ORJA 3OYWA 1BSNA 2B87B 1QXJA 5LA2A 1UX6A 2D44A 3KF3A 4QXKA 3JSVC 1S4CA 2ARXA 4GH4C 4XF1A 3U75A 5L7OC 1U57A 4UXAA 5FBJA 4XETA 1BVVA 1J3QA 1R1A3 2OZJA 5APXA 1PIV1 1RUF2 3J9SA 5CEHA 1F9KA 3M9BA 2NMNA 1XYNA 2RDSA 4XEZA 2WQ8A 4D3WA 1UXXX 1GANA 1GZTA 3T4HB 3KYQA 3AE2C 4Y5Z0 2OYIA 2X29A 1RUG3 1CVNA 3GG2A 1T2KC 1L0NK 3G6JB 4L99A 3H1JJ 4XMAA 3W5MA 1UYXA 5C7GA 5FZFA 4E2GA 1RQVA 1RXGA 1S0DA 2WSSH 4H44B 2HWF3 3RK2D 1ZR2A 1COV1 1FJPA 1MS5A 1ZN5A 2QRXA 3LSEA 3CWBJ 1FOSF 4RS5A 4E8DA 2E26A 4B7EA 3OUJA 1RUNA 5KJ7C 3AZYA 4LO6B 4PF5A 5A80A 4I01A 3VDAA 3V0BA 3H1ID 4MGTA 2MJZA 2VQUA 2FYNB 3FGAD 3C7HA 1A8MA 3CEWA 2CWMA 1KN7A 5KKZB 4UFJA 4AFMA 1C8M3 3UIAA 4AQ6A 3BU0A 1I5ZA 2R1BA 1GP4A 3IAPA 1OQEA 2E33A 3HUSA 4JF7A 2VMDA 3POIA 4YM0A 1G2CA 1J1DC 1HDKA 1HX6A 2R0FA 5JXHA 1VQMP 1AF9A 3WZ1A 3ZXFA 4FFHA 1OQ1A 3MIDA 1M06G 3P32A 1REDA 2R041 2VBDA 5IK4A 5FWEA 4PI2A 1WLWA 1L7RA 1OXCA 2E7TA 2CGOA 1OURA 2E32A 3IPVB 3KVAA 4ES8A 1HN1A 1OVSA 3WP5A 3CLPA 4PLNA 5F3GA 1JUIA 1LTEA 4ET7A 5A70A 3NNLA 5FP9A 3Q3DA 2VZUA 1DQ0A 3MBWA 3N9NA 4U3FD 2VCCA 4LULA 2VUJA 4NHMA 5F5CA 3CCSP 3VHNA 4PV1B 4D69A 1GU5A 4N90A 2FYUK 4R4MA 4QQ2A 4DS0A 3TEXA 2JICA 3OG2A 4A3ZA 3B8EB 3HD7D 1FATA 4H0LD 4GXLA 3CZJA 1TE1B 3B94A 3I3DA 4Y5SA 3RMXA 2C9LY 4I09A 1B35B 1F5JA 4UB6E 3GBFA 3L70E 1DBNA 1BE3J 3CJXA 4HKOA 3TGUG 4Q4Y3 3PHLA 1X9PA 1JHNA 4UBGA 5DAWA 2PAEA 3VDBA 2W95A 3C7GA 1G9BA 1JYTA 1Q3EA 1DHKB 2ZS6B 2JDKA 4OI2A 5FZKA 4KJMA 2HFED 4EDFA 4NPDA 2XNXA 1ZZ8A 2WS93 1UO9A 1UPSA 4FT8A 3RZMA 1I1EA 4XF4A 1IS3A 4LIUA 5FPZA 1I9RA 3GCWA 3WP4A 4CUCA 5ACA2 5BYNA 1NTMD 5JOZA 3ROUA 1KB9I 4PIXA 3Q8EA 4K3UA 3OPTA 1OLRA 2OARA 2WAOA 1MS1A 3OGSA 1JBCA 5H9PA 2ZVOB 1RUF3 5A7PA 3BVHA 4BWNA 1PX4A 5HCBA 5K0UA 3AEGC 1YCIA 1UW8A 1VBD2 2BNNA 2BBAA 2FY8A 5KLVG 1UU6A 2EF6A 2IZWA 2ETEA 4AYCA 3FC0A 5FPBA 1YTZT 3EWKA 2WPQA 5G04L 4DY3A 4UB8H 3GHGC 5GLVA 2ZAAA 5JPMB 1POQA 1FZBA 3LOIA 4IDZA 5DDJ1 5FYHA 1NZIA 5JR7B 3VBFA 2GA1A 1Q5OA 1RHI1 2BCCD 1CJPA 2HWF2 5C3QA 5KHIA 4YXWH 2A73B 1XYOA 2XOMA 1A3KA 1H2LA 2EIGA 4GQ7A 4QGMA 4X8NA 1NKNA 5ACA3 3AYCA 3BN6A 2JR8A 1JZ8A 4IEPA 2P10A 3B5LB 1OFNA 3IWZA 4EYYQ 3VZNA 3WF2A 2IXKA 4M4PA 2POHA 2GP3A 3AYEA 2JDMA 4YARA 4WM8B 1FPN1 4FAGA 1AR71 5J37A 4OI1A 3JZVA 4C7NB 4QPIA 3TGUD 2W2IA 1STMA 2Y34A 1GZCA 3U59A 1FV3A 4AVAA 4R4LA 3IR9A 1WBLA 2WMMA 3S5QA 3MO4A 1OVPA 5JSPA 2W52A 1ZRTD 2FXPA 2HWD3 1VBA2 3A3YB 2O1QA 5FY9A 1W8WA 1ND2C 3AVSA 1E79H 1IQAA 4C1WA 5C70A 2RS53 3A0HH 5HXVA 4XBNA 5LY1A 1VDFA 1PZQA 2DYCA 3UT0A 1VMFA 2PQSA 3BALA 2BOIA 2O1KA 2GNTA 2Z69A 3ETQA 4OUMA 2JIGA 2VMGA 1RF1B 2LS6A 3CL1A 2RM23 4XQDA 1PVC3 3ZFEA 2WWUA 1N73A 1RE3C 1UMIA 2ZZJA 2VCBA 1V0AA 3H9AA 1Y43B 5CCHD 5C6CA 2BWAA 5KXDA 1AVOA 2JDIH 3O8ZA 4N3YB 3RL0C 2DVDA 4IV1B 2P58A 2YIUB 2B88A 1K73Q 2RS52 2XDVA 2ZHLA 4YVSA 3TN91 4EWDA 2Y0IA 2KS1B 3AZXA 3DYOA 4QKDA 3VBUC 2VBPA 3VZKA 4MXVA 1U12A 1CAWB 3ZX7A 2BGPA 4IUGA 2P17A 3OJAB 5FYTA 4ATFA 1FDIA 2IBZE 4BQXA 2QM8A 1QY4A 1Z56A 5DMYA 1T3JA 3GZEA 2BVVA 2KNCB 4G9SB 4COVA 4PQ9A 1NTME 5JIAA 1VAKA 1OF3A 3AB0A 3HJRA 3HPNA 4ASKA 1QL2A 1G9DA 5CBLA 1F15A 5FP3A 1PK6A 4XZPA 3H1HE 1LJ7A 2K1AA 1RMU3 4OVEA 4BH9A 3FXDA 1QQP3 3BU7A 4DEQA 2WT7B 2Y60A 2KD7A 3JC22 3ST7A 3W59A 5JOYA 3W5NA 4KWKA 3VKOA 3R0RA 2H43A 2WWWA 5DZFA 5FFOC 1NYHA 1EAH3 3H8UA 5GZFA 3NJYA 4I6MC 3CX5I 1HXS3 2JG9B 2Y9YA 3LSDA 4FO9A 1V6JA 5KJ7A 1ZNPA 3WDYA 4CEWA 2A5ZA 4CU6A 4ZZ5A 4QX5A 1TNFA 3WDXA 1CAXA 2D6NA 5TISE 3RSJA 4U3FG 1OA4A 4QT6A 4UW5A 4DPNA 4CUGA 4C90A 3CJIC 5FYUA 2CPSA 5AC93 1JI6A 1SQXK 2JDHA 1EV11 1Q2NA 1V6NA 3SNMA 1NHLA 2LRPA 3AKRA 1RUD1 2RS51 4XJWA 1YWKA 3ZSMA 1JOCA 4A41A 2I1KA 5BU5A 2VQ0A 1KZUB 1KDMA 2WC2A 5CJ4A 2DFCA 3R4UA 4FBFA 5LWBA 2WNEA 1FPN2 3WQ0A 1KS4A 5A6YA 2Q9IA 1NE4A 3BOPA 3SH3A 1ULDA 2BOJA 4KU7A 3U14A 4AUWA 1VBB3 4QDRA 2E31A 3B5NC 5CFCA 1HGZA 1VQNP 2GDFA 1HB4A 4MSVA 2J7MA 5K9YA 3VBUB 4LPLA 3ZPYA 4QHOA 5CHXA 4XTMA 5DUXA 5T54A 3VKLA 3L73J 4PD4D 4DJGA 3RL0B 2IXJA 1XPWA 3JXSA 3PUHA 3KHCA 4BQ4A 1KFMA 3TGUE 5B66H 1AA0A 1LGHB 1L0NE 1IS4A 1VB4A 2V72A 3NKTA 4XBQA 3VKNA 3OF1A 1SQ4A 5A1LA 4MGQA 5JR2A 3POFA 3JQXA 4I7ZB 1C3HA 5APWA 2YHJA 4YFZA 5JIUA 5AW2B 3S9OA 2QVAA 1QQP1 3DXTA 1URQD 3TN92 3FZ3A 3CIHA 4DUWA 2ZMNA 4MHRA 2LROA 4QB1A 1AYN3 4LLFA 3VBRC 2A06E 1Q81Q 2R0HA 1M4WA 4QPYA 4QM8A 3ZVXA 4HPKA 3CWBD 1EXJA 1ULCA 1HXS1 3P8CE 3EXUA 3E97A 4D6SA 2D2CB 3H1HD 4Y5TA 1LGBA 5T50A 1ZV8A 2GALA 1YQ2A 4KWUA 4BQ1A 1XE0A 2WS91 1MV8A 2Q8DA 1KQGB 2OYHB 1NCRC 1DF0A 1QLED 3CC4P 4GALA 3K5BA 2E5TA 3S30A 3V2QA 3PU8A 4LORA 4C46A 3I49A 1LODA 5I91A 3RYRA 4BK5A 4O9EA 3N7JA 5ANNA 2FHRA 3GGLA 1OLME 3ZFGA 1QH7A 1USEA 1DYPA 1HJ0A 1HWTC 1ZA7A 4LITA 4RL7A 4LLOA 1CI6B 1AR81 3SC7X 3WW1A 4CPBA 3CCUP 1H8AA 3PNAA 4GKYA 5FV3A 2I8DA 4Z1MH 3BATA 3VKMA 4QPGC 3DECA 5FZAA 2NYYA 1H6XA 3LPFA 3WNOA 3MTUE 1BGYJ 5BNNC 1TG7A 5FKCA 1OA3A 1PGPA 3VHPA 1L2PA 2YUEA 2VUDA 1X8MA 3UESA 5A6XA 1DD3A 3CMEP 1GUIA 1RUI1 3POYA 4XUTA 4YM1A 1W8FA 2X09A 3EB7A 4NIAA 2ADEA 4P02B 1PGSA 5F39A 4E2QA 1O3QA 2BEOA 2CAUA 3CCJP 3KB5A 5C3OA 1UU4A 2V7QH 3IBMA 3UGFA 3SSUA 1ZZ6A 1A78A 1NWQA 1FU1A 3AFKA 3VB9A 1BGYE 4YXDC 5AW7B 2WT0A 3H1JE 4RJTA 4W6XA 4CE8A 4EWAA 1AJKA 5FZ7A 1YHQP 2ZHKA 3LIDA 4P9IA 2YFUA 2QUOA 4MGZE 1K9MQ 2Z4FA 3II6A 2I07B 5AW3B 2RDQA 3H32B 3L73G 5AVXB 1VIWB 1Y7BA 5BNPA 1JYVA 1GOHA 1S55A 2QQPA 5KR7A 2WT7A 1VBC3 4N6JA 4M3LA 2KZIA 3VD7A 4LHLA 3RL0D 1W6NA 1J58A 2FDHA 2GAUA 2H8PD 2O1JA 3JBG1 3CMAP 4M0HA 4NPEA 1ZYBA 2ILMA 2Z5WA 2NPIA 1N73C 3GNEA 4NWWA 4QB6A 5EFWB 1NLRA 3HAGA 4B29A 5A32A 3I55P 2D7FA 3AKTA 3M91A 1DQ6A 1SLAA 3AEBC 5AVVB 2O8QA 5FZIA 3G9RA 4R52A 3Q5RA 5ANQA 3JB8A 1DGLA 5FZHA 1UZ0A 1W6OA 2GN3A 3ME2A 3MUDA 4K20A 3APBA 5FMOL 3WNNA 3ZYHA 1FMD3 4EROA 1W9FA 4OQ8A 3ZKYA 1S9KD 1CONA 1TEIA 2W9XA 3W67A 2WO2A 3FLRA 4GB33 4YPJA 3SKJE 2D3RA 3VZMA 3NNFA 4MUVA 1SFPA 5KLVJ 5IVJA 2BV4A 1JMMA 1NTMG 1WCQA 1XU2A 2OXBA 3N9PA 2WINB 4IEVA 2W39A 4BOWA 5L7OB 5CB7A 4HVQA 3LB9A 1LHVA 2P67A 2FXOA 1XTCC 5DG2A 1WCDJ 4AAPA 1W8ZA 3I7DA 5KKZC 4IFMA 1MVQA 2RJ2A 5I0UA 3RGUA 2FBWC 1KQLA 1IZ3A 5HV0A 1ZX5A 3VZJA 4FPOB 4KG0A 1NXMA 3CKHA 1AYM2 2DF7A 1XYPA 4ZS3A 1T6AA 1RVF2 3SH4A 1OI6A 2YPDA 2LXBA 3K3OA 2PXJA 1WCUA 2O14A 1QJEA 1W8NA 3PMSA 1N7LA 2Q5UA 1SQQG 1T6GC 1UY4A 4JGYA 5BNQA 2Y6JA 1NU1G 1CGPA 3USSA 3AMNA 1GL2D 1YQCA 3QH7A 4CCKA 5FIXA 1UOFA 1WD3A 2DUQA 3QH9A 1DH3A 5BNPB 3N7LA 1AX0A 5K5GB 2ZBJA 4AI0A 3J8F2 1GP5A 4IXLA 1BVP1 4JRLA 2QDRA 2YC4A 4BQYA 2AXTE 3H3LA 5FQ0B 5KTBA 4AGVA 1DIPA 1V9U1 4HXCA 3O0WA 3VGIA 3QH6A 4LKEA 2KR2A 4K1YA 1LOAA 3DKQA 5KHHA 1RC6A 4META 4OZOA 5KWRA 1YLLA 3VBOC 1YFUA 1Q82Q 4XUPA 4P9GA 2DTYA 2F4LA 3BTYA 3V5BA 3LEKA 1TVGA 2WZ8A 1SVFA 3H0OA 4L97A 3HUSC 2XONA 3WMM0 1ZRRA 2G9ZA 4JTOA 2IZ1A 3OUHA 2C9AA 4NAMA 3FBMA 3OBAA 4YVWB 1ASJ1 1URQC 3MIHA 1RHZB 1ULEA 1FZCA 1RGSA 2BGCA 1Q7YQ 1G7YA 4B4QA 5FKBA 2AENA 3CMGA 4Q0PA 2P2UA 3HD7C 3RFRA 5K7PA 1BCCE 5EZWA 5JUVA 1NJIQ 4LLHA 3V2RA 2L91A 4AVCA 1RUJ3 1GFF2 2KXLA 4O9BA 4KNCA 3D82A 1BCCJ 1SPPA 2ENRA 5AVYB 3M7AA 4KWJA 1YEWA 2WNOA 1REEA 5JXIA 4O65A 2E76B 1D4M3 4QGNA 3H1KJ 2Y64A 1LOGA 1C1FA 1B35A 1ENQA 3MPBA 2R6QA 1EPWA 2XJTA 4ASWA 3H42B 3I2IA 2NMOA 4HPKB 4LKDA 4AF9A 3PP5A 3VTPC 2GUVA 1L4AA 3OOXA 4H13B 2PP6A 4K3AA 1CN1A 3AVRA 4K8RB 3WV6A 1N3OA 1T3UA 1JZ6A 2ZACA 2EXIA 1A34A 1LESA 2E63A 3D0SA 3E6DA 5ABJA 4BXLA 2IVIB 3V64A 2P3YA 1UY0A 1R091 1VF5C 1X50A 2BP6A 1IZNB 4I0BA 2IXCA 4YZ3A 3WX5A 1W9WA 2WSFJ 2V09A 1KS5A 3RRDA 1SQXJ 3VBOB 2WBKA 4ZKTB 3L72D 1YQ5A 3WQ1A 4AQRD 1QVGO 1YI7A 3QCWA 3H8XA 2Y0CA 3KCXA 1ZBE2 5FZOA 5DJUB 4IETA 2WKKA 4QHBA 1LNSA 4AQSA 1S0JA 2E5YA 3J26N 4UFHA 5HBAA 3EMRA 2IBZG 4ARXA 1MZ5A 4KGGA 5JMCA 1MEC2 4XHXA 1LTAC 1YI2P 2NPSA 2V4AA 1XSQA 4FPYA 4W6YA 4RQPC 5GLTA 4AFAA 4AHYA 3HUSB 4LKFA 3QLQA 3KLSA 3SWYA 5FK8A 2JE7A 2OPWA 1COV3 1ENRA 5FY7A 2Q7CA 1IOAA 1KB9D 3MFCA 3NKGA 2OYIC 3AE6C 3N4XA 3TGUJ 1VRBA 3KMHA 4MLOA 3OY8B 4NN0A 2WABA 5TISH 2JO1A 4V2VA 1SFCC 3HQXA 2R071 4FPGA 5FXZA 2XU6A 4ASLA 1JYWA 1SQBE 3L73E 3OGJA 3U11A 3FUQA 3HR9A 1UY2A 4J1XA 2Q8EA 1MKMA 1NA1A 1VBC2 5FZDA 2L9LA 3RI8A 3VBSC 3ZDSA 2XVKA 4BA6A 4CDQA 4NIHA 3TNUA 1R1A2 2WRAA 1SS1A 2BCCG 5BUVA 5CISA 4QKFA 4IEUA 1PIV3 1GZWA 2RN0A 2VGDA 4GD4A 1RH5B 4QD2A 1AZDA 5FZ6A 3TNPB 1PGL2 2WFF1 1WUVA 4N7UA 3CWBE 1KJRA 4KWLA 4BXFA 4COZA 1ZREA 5DAPA 1D2QA 1W6MA 3RZLA 1OOPB 1XC6A 4ASMB 1W8UA 2PFXA 1NZCA 4BRYB 4HVRA 5C9AA 4O61A 5F3IA 2FXMA 1QWRA 4HKZH 2A6ZA 1HB3A 4R9BA 1AXKA 1GU3A 4PF1A 4YGCA 2B87A 2ZT9B 3AP4A 2HKXA 3I3QA 1F4HA 1MS0A 2XR4A 4P9YA 1W2EA 1GNHA 2HODB 3CCQP 4UF0A 2FYUD 5FR3A 3RNSA 2WITA 2Z5HA 2G9GA 1FT9A 4GA9A 4UFLA 1XU1A 4LR4A 2VO5A 1SLTA 4WBBA 4YGEA 1X22A 2IBZI 4K21A 3VBHB 4URAA 1JUNA 1SQQD 4KBZA 5L9RA 1RUE1 2YXSA 4Q5OA 1RE4C 1W5CE 2ZAHA 1W2UA 3AX4A 2NP0A 1AL23 2WWJA 4PBPA 3CWBG 3ZMOA 3O1SA 1TMF1 2YMZA 5JZGB 4XVHA 2C26A 3T97A 3Q1MA 1OOPC 3HNYM 3IN9A 4NR1A 2AC1A 4NMIA 4XABA 4P5YA 4AAXA 5A3PA 2KS1A 1VLNA 3I56P 4D6TD 2MNGA 2PLV1 2Q1ZB 3BYWA 3H1JG 3ETPA 4PQQA 4XMIA 2B45X 3T0AA 3ZN6B 2RS32 2XZRA 4IESA 3L2HA 3HT1A 4NPFX 2C6SA 1W03A 2R061 4NPRA 5APUA 2HH9A 1LU2A 3VHOA 5F7UA 5SV8A 5LEJA 4ATEA 1PIV2 1L0NG 4OVNF 2K2SA 1NTKG 4HMZA 4Y33A 2YBSA 2JWDA 3HNBM 3OBRA 1VAVA 2MEV1 3LWCA 3AEFC 4L2NA 3L4FA 4W7YA 4EN6B 3KQGA 4TSVA 2KYVA 5A3UA 5JSOA 2W1UA 3VMXA 3W21A 2ET1A 1AR73 3P6BA 4QPGA 1DYOA 5F5AA 1LHNA 2XHKA 3P1IA 4NRQA 1LTJC 5LB6A 2JKXA 1L0LK 3URFA 5DABA 3E1RA 4FOVA 4XURA 4CU8A 2D40A 4XUOA 1J84A 3L72E 4WY4A 2EIDA 2WFF3 4Y1YA 1YIFA 4NHKA 2K37A 2D6PA 5FOJB 2TEPA 2W3JA 1N7SA 3U78A 2M3EA 4Z92B 1GOGA 2WDBA 4EJRA 1EDKA 5IATA 1VF5D 1DQ2A 4L11A 1WD4A 1GSLA 1JZ3A 1R1ZA 2ZYGA 2O0OA 2HEVF 2WNVC 1EDLA 1IC2A 2AEMA 1JODA 1R64A 3G71P 1C8NA 2AGSA 2BQPA 2P5BA 2PQQA 4GULA 1LEMA 3I97A 4IEZA 4YG6A 5EFUA 2UURA 2YY1A 2Z42A 2C0WA 2CU5A 2RM21 3TYJA 3MD0A 2HWE3 3ON7A 1QU0A 2VAUA 3Q5PA 2QBXA 3ZFFB 4H44C 1TU3F 1NU1K 1D0GA 4K9SA 1NVOA 3NMDA 4LMFA 5FLIA 1VRH1 3T0BA 1SQBD 4PBOA 3MZHA 5A6QA 1W3XA 4XW3A 5H9SA 3B5NA 5EIYB 1KEXA 2ZEYA 3I2HA 3ZDVA 5FO7B 3H1KD 4PLMA 1OD5A 1PGOA 1M90Q 1NCQB 2ZZQA 2XUMA 1Y8AA 1R083 4AG4A 3H8OA 2XKMA 1Y47A 4IL6X 1H6YA 3G6EP 1KQRA 1YJWP 1POV3 4XYXA 2RR11 5T55A 2PHWA 4U2AA 1PVC2 5IK5A 3CHXA 2PA7A 1W2TA 1SFYA 3OBTA 2OZ6A 3WUCA 1QJY2 4S2DA 1RUJ1 5E16A 4FSJA 5L8RJ 4UB6H 4UW4A 4OQ9A 1PNGA 2NZ2A 4ASVA 1QOSA 4XILA 2W1SA 1YQ3C 1UPIA 3LW5H 2HBTA 2TBVA 4A4AA 5F3CA 1NY72 3H8RA 2UWBA 1YIPA 1VQ6P 4RR3B 2MEV3 2C9NY 4AR2A 3P3PA 5AW9B 1HBWA 4P14A 3VDDB 3ZYPA 3EYPA 1N7SD 2XJPA 3DYMA 1LEDA 1D4VB 2DCYA 2VMIA 2VZTA 3DCQA 5CCHA 1YJ9P 3MYXA 1PZ8A 3M3CA 4XFBA 2W83C 3HE4B 1D0HA 1VALA 1SACA 2P2KA 3IKWA 3WQ7A 4YNIA 4P9WA 1SQBJ 1R093 3RS6A 5C5UA 4QHZA 2NM1A 1EV13 5FCCA 3B7MA 1EZVI 4LKSA 5CKMA 1JH5A 4W80A 3VN0A 1PK6C 4CEYA 1JXNA 1UY1A 3WHUA 1OT5A 4DQAA 3MICA 4XF3A 1H1IA 4CDUA 2W0XA 2HWC2 4BQWA 5IJRA 4ZU4A 1BCCD 2RV9A 4OCTA 3EJKA 2KP8A 1L3JA 3ABZA 1BDDA 3DV8A 3O6QB 5T5PA 1N1YA 1IPJA 1MR5A 5H9QA 5FPXA 3O1PA 3J4UH 1NOVA 3E5QA 3SMHA 4CDXC 2DU0A 4HL0A 1VRH3 1FAYA 2DCKA 4I0AA 2PHXA 4GIFA 3ZXEA 1RUD3 1LENA 1QHDA 1WW5A 1LT1A 4AEDB 1SLQA 3ATGA 3A0HE 2PN5A 3H7YA 5JVVA 2F6BA 3H1LD 1AR63 4GH4A 4A7KA 4Q1PA 1VBE2 4CP2A 3CXHI 3LKJA 4Z2AA 4D94A 3Q9OA 3H7JA 3WP3A 3V0BB 5DG1A 1HTLC 2CWSA 5K0UB 4QQLA 2AREA 3PURA 1FDOA 3HN1A 4CDWA 3IDEA 1UWWA 1OH3A 4H0LB 1BEV1 4Y20B 3GALA 4LTAA 5EXOA 5GJ6A 1J3PA 3AJYA 3ES4A 4ORFA 2R1DA 3PU3A 1U5ZA 1MEC1 4A3XA 3E1IA 3CC7P 1QVFO 3TAYA 3W68A 1RVF3 1S2BA 1W6MB 2A3YA 5FP7A 2R30A 5C3RA 5IAXA 1JCDA 5KLVE 1KQSO 1NGMB 1IFNA 2BASA 2B9BA 1GQHA 1GZWB 1BBT1 4L8QA 3GHMA 3MLJA 4Q2FA 3L73D 1HQWA 4HYTB 1N1SA 5J7MA 5I0DA 1BMV1 4LE3A 3HRNA 1RE4A 2A3XA 1MS9A 1NQJA 4NE9A 3C7EA 1LR5A 3UK9A 1FX5A 3AECC 4ZU7A 2EALA 1KQFB 5EJZB 5FUIA 3OYWB 3F2ZA 1QDCA 2D3PA 1UOBA 2I2SA 3DGTA 3OY8A 1J1EB 1PO22 1SQBK 4WB4A 5CCGA 2CV6A 2RHPA 1XTGB 3WY6A 4QX7A 3P3NA 5APVA 4AEDA 1EXIA 4IE4A 2XUEA 4JHTA 3MW2A 1JCCA 1ND2A 1OH4A 2G19A 2VZOA 3BCCG 2OVUA 2IZ0A 2KA3A 1UMZA 3HIFA 3ZXAC 2QQLA 2PLV2 2XNDH 2N1TB 2E74C 1HB2A 1QNYA 2XB6C 1YQ4C 3BTXA 4GKGA 3RYKA 3B4SA 4OMCA 1O4ZA 1YFWA 1LNQA 3UKVA 4AW7A 4B7KA 1PGW2 3BI3A 1QJY1 1RTVA 4HKWA 4COYA 2XLAA 3U1AA 1NKGA 1UIIA 1SQQE 3L71J 2DBNA 4N43C 3HOBA 1KTMA 4URTA 1OA2A 2B8MA 2AEYA 4CDXB 4CZSA 2GUSA 1AR83 2CNAA 3CU7A 1BGYD 1UY3A 1HVVA 1AR61 2ITAA 3PTZA 1WW4A 2D6KA 4XA4A 2WA3A 3NAPB 3NTNA 1C8M1 2B9UA 4FFGA 3ILNA 4D7YA 2AUYA 5D1IA 1FAVA 1L0LD 3MUZ1 3KHUA 5CYYA 5FO8B 3GHGB 1RYYA 3GJAA 3KT7A 1QJX1 3AYAA 3O14A 4PI0A 3THTA 4NHLA 2JD9A 2C24A 5L9BA 3W20A 3ZFGC 5FZEA 4B4RA 1AYN1 1S0EA 3L36A 1JY2N 3OTFA 4Q27A 2WZPP 4D0QA 2YO2A 4UW6A 4DZOA 1BZWA 3WHTA 2JE8A 3PRJA 1XNCA 1JY3P 2CAVA 4O9GA 3SQOA 1VQOP 3OW2O 5L19A 2AR6A 5FYIA 1E5RA 5I8YA 1K5MA 3POGA 2UYAA 1N1VA 4NAOA 3R6SA 4CPBD 1N3QA 2BERA 3J8F3 2OQ7A 4LC1A 3ES1A 1LTGC 1G9FA 1LKNA 4RO0A 1V6KA 1US2A 3AMHA 4JTNA 4NVPA 3WUVA 4D6TE 1CAVB 3VD4A 1O8SA 2ZX4A 4LHNA 4P5HA 2ZABA 5FYYA 3V2NA 2KI7B 3LIHA 1ODMA 3AEEC 5LBCA 4AI9A 3SFEC 3AL6A 1KILB 3D71A 1GU4A 2IXIA 4Q4W1 1FXZA 1FZCC 4RFT0 1PO12 1Y3TA 2VVDA 4HLTA 4YSFA 1NCQA 4HFSA 1SQQK 1IS6A 3BVCA 3IZOA 1QJU1 1ZBA3 5FLJA 2FDIA 3V56A 1SBEA 3B93A 2YXRB 1OIPA 1T6BX 3I2DA 3KCYA 3TK1A 5EYYA 2OQ6A 2BW8A 4S2FA 3L70G 3CC2P 3ACFA 3N7MA 2J59M 1G1JA 3ACHA 3HBZA 4D6TJ 1QJX2 3IAOA 1W0PA 3WDUA 3NAPC 1KORA 4WVMB 1F4AA 1EPZA 2QJYB 1AYN2 1SP4A 3B02A 3VZOA 3RK3E 3ZXGA 1H0TA 4R9CA 5FREA 5IVVA 3ZXKA 5AVTB 2E75C 4D6TG 1NU1E 2GNDA 2YBPA 2YG0A 3FFQA 3T08A 1B35C 4HVOA 3MHVA 2IPPA 1RUD2 1MS3A 2K9JA 3NV2A 5E8AA 1CX1A 3BCWA 2KSJA 4W65A 5KC5A 2OTKE 4M3CE 1OVRA 4I2OA 1KYOD 4PV1C 2GN7A 2VR4A 3MV01 2N1TD 5E89A 5HCHA 1QDOA 3HE5A 1JW6A 4FI9A 1VBB2 1AJOA 4JDMA 3H1MA 2V5YA 4M01A 5I8TA 2FDGA 3UKTA 2J22A 1PGW1 3NNJA 3BTZA 3N9LA 1HJFA 3LIEA 2WN3A 2NPSD 3POSA 2M3BA 3FUOA 3LFIA 2LXCB 4L75A 4ZMDA 3D6YA 4H55A 3SLIA 3MIGA 5JPNB 1UIKA 1JYNA 1VPHA 2ZPXA 4IV3C 4ITCA 3HNMA 1H9PA 1GQPA 1KDKA 1DZRA 2XWJB 4E4SA 3MF9A 2A6YA 4CCJA 4B1MA 3KZ4C 1ZW0A 1YYCA 4WY4C 5JCTA 1G8WA 3ZYRA 1QL1A 1QF3A 1L0LG 1WCKA 5I0SA 1H8TA 4AQ2A 4B4PA 4IGOA 4JC1A 5LA1A 4DXTA 1GP6A 2H88C 1HV0A 2ORXA 3I3EA 4N9IA 3A0KA 2W08A 4PDWC 1JM0A 3PVOA 4HETA 5FYBA 3WOGA 2IX7C 2GNBA 2ZEZA 4XC9A 2QJPB 1O91A 3ITKA 3H3UA 3PIGA 5IUQA 2X53S 2XVLA 2BNMA 3C8XA 2GC2A 1OKOA 5ERLA 4OHXA 3M3EA 3WUDA 3KDPB 3H6PA 1K5JA 1OFSA 2QJVA 4X6RB 1WCSA 5C3PA 4BHPA 2WSCJ 3U1CA 3AMPA 4JKKA 2FYUJ 1W6NB 5F1RA 1SQXE 2ZT9C 1S0FA 4QAWA 3KVBA 1PVC1 1FZGA 2P3KA 3VD5A 3WP6A 4FOYA 1ZA4A 1PPJE 2VC9A 1XJAA 1URQB 1BEV3 4CP1A 3LE0A 3LDKA 3H32A 4HK8A 1YITP 1S0GA 4EZHA 4LT5A 4Z1VA 3GDBA 3BOWA 4GAZA 4RN5A 3JB4C 2BYVE 4BRYA 1WGPA 5C9AB 1BXHA 2UWAA 3FWNA 4IQPA 5T5JA 4Z82A 3ZO0B 2B5HA 2CYFA 1W2AX 2IBZD 1J59A 4ONUA 1HXS2 3AXEA 1NTKJ 4IGQA 2O01N 2BWCA 1VQPP 1QH6A 4IE6A 1FV2A 4UOJA 1RF0C 2FYNC 1JTHB 1ULFA 2IC1A 2XBO2 3ZIWA 4TZDA 3IN6A 2QZ3A 4LBQB 2QQMA 1PM7A 1DGRA 1SLIA 4IW3A 4N53A 2CGNA 3HE5B 4YW2A 5IW0A 4U7JA 1UZVA 3RK2B 2QFEA 3BUCA 2WQYC 1VL2A 3KZIE 3L75D 2HPCA 2AXTH 4YZ4A 1NA1B 5BNPC 1EZVG 1F8VA 3HMYA 4BQ3A 1OLQA 3LGRA 5FOBB 1LOCA 1ZMEC 4QPIC 5TJHA 2WAAA 2Q1KA 2HWD2 2K9ZA 3BIWE 2FFDC 3ZFGB 2WYSA 1GLHA 5C33A 4IEQA 5B2GB 4D6RA 1H0TB 3H1HJ 2XQRA 2OTLP 1ZZCA 4RFRB 4EZ4A 2O8OA 3AKQA 2PFWA 1Z7S2 4N78E 5FP8A 2BPA2 2A6XA 2F4PA 3FLPA 2AH2A 4RHV3 5FK7A 1ZLLA 2NPSB 5GLZA 1M8OB 4EOTA 1W90A 1IKQA 3DF0A 3WUUA 1X8EA 1SFCD 3L72G 1D2SA 1YTZI 2NLRA 3U1XA 3PTYA 1FNZA 5BNOA 4K8FA 2A45G 2FCVA 5AVPA 1UAIA 1UU5A 3MI8A 1RE3A 3KF5A 1W9TA 1JYCA 3L35A 3B00A 2JIJA 4XFHA 5CFDC 3GJBA 4UBHA 1V6OA 1GTWA 2R073 4PV1D 4IEWA 1X0TA 3AL5A 4OMDA 2OT7A 4RQPA 2DVFA 1JB0J 1R5LA 1WW7A 1RUJ2 3L9JT 3PHMA 2R16A 4HT1T 4F7ZA 1VBA3 2RKLA 5TSWA 3V0AA 4LHKA 1G86A 2KB7P 1S2EA 2BCCJ 1AR82 1JY2P 2E76C 1H88A 2WO1A 2YDEA 2FYUE 3KV5A 3R4SA 4HSJA 4MYEA 3S0MA 1NCRA 4BIOA 1PP9J 1LTIC 1ULGA 2JB4A 3L75G 3AK0A 3VD9A 1L4AD 1EUTA 4JGYC 4OHYA 1W0OA 5FPUA 3RZKA 1NAEA 4BQ5A 4AI1A 5HV4A 4KT0J 1NU1J 3WDWA 4QX2A 3I2FA 1RUI2 3PUIA 1SQQJ 1BCXA 4IE7A 4ARYA 4CCCA 1NH4A 2V73A 4KU8A 4R9DA 5JZGC 1JY2O 3T1MA 4LEJA 4IERA 5FYZA 1G9AA 5DUUA 4RA0A 1XBFA 3V65A 2YFZA 3A21A 1K04A 4UB8E 1H2KA 1VJ2A 4OGQD 4PD4E 3NAPA 1SDDB 5K0UC 1RMU2 1Q8VA 4IV3B 1ZZBA 3SH5A 4YVWA 3FWLA 1CR7A 2B39A 1UYYA 3N9QA 4Y26A 3AXDA 5LBBA 1O3SA 4XFGA 3KGLA 1DCSA 1SQVJ 1CESA 1T2XA 2PAKA 5FZ1A 3VUOA 2FMYA 1AL21 3RJRA 4YLZA 4Q0SA 5C4WC 4I2LC 5C71A 1I3HA 1T8ZA 2AYHA 3B69A 5FXWA 4JKLA 1R8EA 1ND3A 2MPFA 5E1RA 1AFOA 4WZFA 3UJOA 1RIRA 1AXZA 4DNYA 3WINE 4BZ4A 4U3FE 1ND2B 2KLUA 1MZ6A 3MW3A 4HOOA 4FPJA 2OIIA 1GL2B 3AE8C 2VE1A 2WNUC 1QJFA 3B01A 4XJAA 1EZVE 1Q8OA 2ZGRA 4YG3A 1D7MA 3TNQA 4AI2A 3ACGA 1XNAA 2ZX0A 3S5AA 3NWKA 3AEAC 1DDLA 1GKBA 4BPZA 2QQVA 3WF1A 2XV5A 5ISLA 1VQ8P 2R5BA 3QD6A 4AEMA 2TNFA 1K45A 1PK6B 2GMMA 4WY4D 4JGYB 4LBMA 2BBVA 3V6IA 1S5LE 2HPCB 5KHKA 1SQPG 4QX8A 5C8WA 2RJKA 3RZJA 1XRUA 1VB2A 5IVEA 3BIEA 4CEYC 4G4FA 1HIXA 2HWE1 2Q6QA 3T2TA 4HG6B 2ZTNA 4JAAA 1OVUA 5JXGA 4F3JA 2IVJA 3ZXJA 1GL2C 2PHTA 4YVSB 5B4NA 2ZJCA 2VD7A 1RUG1 2Y6KA 3CL3D 3Q8FA 4QWNA 1OFCX 2K3RA 5BU8B 1O8PA 5FY4A 2BTVC 1Z7S1 5AVUB 1ZRFA 3H1LJ 5CBNA 3KHBA 2HWC3 1GICA 4ZU5A 3M3QA 1YQ6A 2DDUA 1W6QB 2VTFA 1HUCA 3TB0A 5FPAA 3CNAA 2B4KA 3ACLA 4LIVA 4GH4B 1KRIA 1IKPA 4Q0VA 3TRSB 5J36A 1SQXG 4DFSA 1W39A 1P84E 3C8VA 3FHQA 3ILRA 3T2QA 1PGL1 5B66E 1HB1A 2WO7A 1L0NJ 1HRI1 3H1JD 1YNAA 1KYOE 1RUG2 1EP0A 1YUDA 2LUWA 2ZGUA 4LO5B 1YJKA 2YYOA 4U36A 3K48A 3H1IJ 2N7GA 1CZVA 2SPZA 1ZBE1 2OX0A 4FFFA 4XDPA 4XIKA 3ZPOA 1AL22 1TQ5A 1NCQC 1FMD1 2ZGOA 3B3QE 4Z8BA 5J48A 2XMLA 3F95A 4QPIB 2I1JA 2B46X 2Q4SA 5B4XA 5HXMA 2ID4A 3S4RA 3EBRA 5IWFA 3FE5A 3ZSJA 3H50A 5DJTB 1H8TB 2CTVA 5CNAA 4OYUA 1R5SA 1YO8A 1HLCA 4FPLA 1BYHA 4NJ4A 2GSYA 3Q8BA 3DN7A 1RL3A 3GYDA 4YW1A 3WSOA 3LZZA 1G9CA 4GOFA 2A6VA 3WW4A 1BCCG 3MLLA 4GWIA 4CCMA 1Q8SA 2Y6LA 4K6BA 1LP1B 1O3RA 5CMZA 2CL2A 2WPRA 2W87A 4P08A 3WG2A 1FYUA 1M1JC 1EUUA 1MQTC 3L71E 4AFDA 1S72P 4QKNA 3RGBA 3AKSA 3M0DC 1Q8PA 4QMAA 4YYOA 1E5HA 5FZ4A 3WQBA 3S7EA 2JKBA 1RINA 4H2AA 1JO5A 5LY2A 1C28A 3WNKA 2WZ7A 3WVJA 2YC0A 2GZWA 1N86A 1KD1Q 1LWUB 1LT9C 1W8TA 4LK6A 3Q2YA 2CY6A 2Y6GA 3OD4A 3ZSKA 2YZ4A 3KPEA 3MP7B 3NNMA 3RL0g 3T2OA 4BU2A 3KV9A 4BE3A 2VMFA 1LTSC 2K88A 2K9JB 2XQXA 1HRI2 1SQXD 1NT0A 2RR13 2FD8A 1WLCA 4CDWC 4Q26A 2HWC1 1ASJ2 3WF0A 5FO9B 5CKNA 3JU9A 2E43A 1ZVFA 2UY9A 3M8LA 3LW5J 3E5UA 2VH9A 3WCSA 2G1MA 2JG8B 2EXJA 2GNMA 3LDBA 1QGLA 1XNTA 2IWGB 3B9CA 1HW5A 3ZXDA 4LQRA 1KFXL 3LCPA 4MGYE 1H8TC 1V70A 4AHXA 1O59A 4AHWA 4S2GA 2NQYA 1W2NA 2VQAA 1L4AC 3VHRA 4F83A 1CZQA 3TEYA 1DGWA 2K46A 4XDQA 3GZUC 5FXXA 4Z2WA 1ASJ3 2J1VA 4L0PA 4V1PA 2OYHC 1NCRB 1ZBE3 3L37A 4NPMA 1FBMA 4MXWB 3V0AB 1HH0A 1ENSA 3R4DB 4BLIA 4TLFA 1HJGA 3MHZA 3E1F1 5JOWA 4XJ9A 1IFDA 4DRRA 1MFTA 4E4DX 3WXPA 2C4XA 2VVFA 1BSHA 2XWBB 5LASA 2MHFA 1L0LE 2XJSA 5J98B 1JZ7A 4FTEA 2YC2A 1CAUA 4FXKB 3WG3A 4L9BA 1KILC 4EWEA 5KBFA 2R072 2M8RA 3IPVA 2D2CD 3M3OA 4SBVA 1O6UA 1RXFA 2NPSC 3QOPA 1I5PA 3UGHA 1NTMJ 1FPN3 2ZOEB 4MXWA 4LNVA 3A0BH 4XJ8A 3I3BA 3RJ2X 2PRRA 1O5LA 4XCAA 2A45I 2HEYF 2JB8A 4INDA 3T30A 5C8CA 3WNPA 4QPGB 1LB2A 3A0NA 2W6AA 4MGSA 5FPVA 1NTZK 3CX5H 3Q5SA 1ZRCA 2ZHMA 2ZFCA 1R082 2VBBA 2VU9A 4DXSA 5AVWB 2FCUA 2RDRA 4QX1A 1KD7A 1LOFC 5CFCB 5J1XA 2JG8A 2HEWF 3E5XA 3L74E 2HWB1 2IDBA 1RUH2 3A22A 4DO0A 2PMWB 2VJXA 3KS7A 4QDQA 3AEDC 4Q4W2 1Y9BA 3AJZA 1X8YA 2JX9A 4JV4A 4N53C 5F6KA 2RMZA 4JYBA 1OZHA 5AW6B 4RS5B 4CRQA 1MVEA 3HEIA 3THDA 3UNPA 2WNUA 3IIIA 2BNOA 3U0ZA 4MV2A 3USUA 2R3CA 2JDAA 2OYOA 1WT6A 3K2OA 4BISA 1O3TA 4LA2A 2FFDA 3KGZA 2XGXA 3RZGA 3M2MA 1LWUA 2YGLA 4RR3C 2Q8CA 3TN93 4QQHA 4R9AA 4AI3A 2YV8A 1UKGA 1AXYA 5CCGC 3QACA 3RBZA 5F2WA 4C0BA 4CP9B 1X9TA 2O01J 2ET7A 1PHMA 2GC3A 2P4EA 2WQ4A 1IFJA 3AE7C 1PP9E 3H1LE 1SBFA 1RHI3 1YFXA 4AYUA 4ZY9A 1ZBA2 1LAJA 1A02J 1PO23 3OD0A 4M3CB 4ISQA 1GK4A 3LOBA 4X6QB 1LECA 3LA7A 1ULOA 5CU1A 2XVGA 4NOTA 1N47A 1TME2 1ZRTE 3CXHH 3ZN5A 1N8RQ 2Y6HA 1XB9A 3H25A 4Y4YA 2A6WA 3AYDA 4RESB 3GF6A 1TME3 4A6OA 1OXZA 5CA6A 1NAYA 4E4ZA 2XKOA 4I30A 4XPVA 2JXAA 3O12A 2WZR1 1DEEG 1QNWA 4GZ9A 1BGYG 4OI4A 5FY5A 3PVEA 2WUHA 5F5QA 3N4MA 1OOPA 1DIWA 1NLQA 2WT2A 2LW8A 3NVCA 2KNCA 1COV2 4DCKA 4Y99B 2PHFA 5CCHC 3FLTA 4PDWB 5FMDA 4NROA 1X7NA 5HCFA 4MGIE 1PVXA 2JEEA 3N35A 2AEFA 4MN4C 1CIWA 2FCTA 3HT2A 3M3IA 3DPRB 3GCXA 5KHJA 1FC2C 1W6PA 2GC0A 2LTNA 1NTMK 4WBAA 1J1TA 1X9VA 2VW2A 3TNUB 3D6EA 1RUC1 1G1IA 3LFMA 1GW4A 4XTPA 5DAXA 5FZGA 2WZR2 1KILE 2KXPB 3VDCA 1SHWB 4JGZA 5A33B 5AVSB 1HKDA 1IHMA 3JBG2 1EY2A 1WMFA 3HQRA 4QGLA 3LA3A 2HWB3 1RF1A 1RUF1 4EN9B 3O1UA 3BRTB 3KQRA 1AR92 3MGUA 4DXRA 2ARBA 4Q4W3 4KQ7A 4H44D 1RUE3 4JBZA 1NE6A 1WBFA 3PUSA 2X5IC 5IVCA 1Y9MA 4ZKPA 1OD3A 4CPGA 1EDJA 1DQ5A 3INAA 4O7XA 4AEKA 1VRH2 5GTHH 5A3NA 3RI9A 3BPSA 2JG9C 1UN1A 1EAH2 3D6ZA 2OQQA 3QBQA 4KH9A 2BJSA 4YVWC 4LO7A 1MUUA 2W92A 4MO3M 2FDJA 4A45A 1BMV2 2WLPA 1U5XA 2WSEJ 1HJBA 1DLCA 2DTWA 4NIIA 2IYOA 4KL1A 4KI5M 3WEZA 1NTKK 5C4WA 5ACA1 3L74J 1AYM1 2UYBA 4GWNA 2WVRA 1RMU1 1SFCA 1JS9A 4YM3A 5HI0A 2IFMA 2Q0AA 1LRHA 1P8JA 3SCHA 3NO8A 2ZXXA 4GMP0 3VBSA 1O5UA 1KFUL 1NAFA 3IMMA 4JDOA 4WZCA 1VBD3 5A6ZA 2P3JA 1BE3G 1EAH1 4COUA 4Y22A 1DZQA 2WYFA 4PLOA 5LATA 2J1TA 2KK7A 4Q0UA 1TME1 2QCSB 3SCGA 3FHIB 2QJKB 2BCCE 2M5AB 3H1YA 2W90A 4WM7A 2OTJP 3DEMA 2W46A 3DYPA 5FJKA 4AGRA 3FMGA 1H30A 1W2OA 2G9FA 2HWB2 2JWAA 4IV1C 2VXRA 5E88A 3JBG3 1W06A 4OUEA 4YFWA 1ZP0C 2CGPA 1C57A 1H1AA 2VUCA 5IFTA 2GP5A 2DURA 3BGAA 2L5GB 5IVBA 1MACA 4Y24A 1AJYA 2VUAA 1UYZA 2RS13 4BJ0A 5H2FH 2SLIA 2Q5TA 2H7HA 1S5LH 1XNDA 3POWA 1RUC3 3R05A 4LO4B 2PGDA 5E79E 1KGYA 4E9KA 1V6LA 3A7QA 1C1LA 1WMKA 4U3FJ 1BE3E 1P84I 1RY3A 2RJLA 3WDVA 1FOSE 1FZCB 4LBNA 2ZA9A 1VBB1 3IM0A 4IV3A 4JYCA 2VPVA 5APTA 4GB31 4BM8A 2YROA 3OPWA 1H4GA 1RUH1 2E76D 1US3A 2FQPA 3KM5A 2D6LX 2VXJA 4M3CF 2OUJA 5EV7A 3O1MA 3FL7A 3Q8AA 2E53A 3NV3A 4AE2A 4HK9A 2HYKA 3MZWB 2CHHA 5A3TA 2YKQA 5CG9A 4I02A 3OGRA 2X8KA 3KT1A 3RK3D 1H0BA 4N9HA 4TYSA 5L73A 5FWJA 5KHGA 2RM22 4XXPA 1NU1D 3M9HA 1CQ9A 1XNKA 4BDVB 4AVVA 3MDPA 2CSGA 3C7OA 1W04A 1S0CA 4Q4Y2 1UOJA 1RB8G 1LGCA 2W47A 4Y22B 2HYNA 3H1IG 4PD4H 3EFFK 3UV9A 1EV12 1C8M2 3U4XA 1PO11 1TMF2 4MGKE 2LKMA 4RQPB 4A44A 1AR62 3AKPA 5EJ1B 4IL6H 5GTIE 2XHNA 2D6OX 1MS8A 2DWRA 2OW4A 2Z4EA 2Y33A 1WMXA 3JCUH 1NTKD 1WA6X 2YMYA 1YHFA 1YJLA 2EAAA 2VCAA 4CDXA 3D8CA 4BCUA 3PVNA 4BK4A 3VD3A 4CTEA 4AWDA 2QA4P 5C4WB
chains in the Genus database with same CATH topology
1KITA 4F8AA 4R4XA 2YPJA 1FNYA 1DFQA 3LA2A 2A71A 3KSCA 5DZEA 1FOD1 2R49A 3AMQA 5FAXA 4FPEA 3WW2A 5GZGA 1SBDA 5I0RA 4H7LA 4A2UA 2VNOA 4LBLA 3M4FA 5I8SA 2R32A 2YGMA 4IEYA 5I93A 4Q4X3 1IPKA 4ISRA 2ZGMA 4QQPA 1Z78A 2FZ2A 1SCRA 2Y0OA 5A33A 1OMIA 2WFPA 3VL8A 4AVSA 1GQGA 1VBA1 2ZX1A 1AX1A 2E7QA 3DPRA 2JE9A 2C5DA 3PJSK 4IL7A 3VV1A 2PHUA 1DYKA 1NG0A 5LRRA 3VBHA 1SLLA 2IXLA 1TNRA 2JJ6A 2JD4A 1JTZX 3GZAA 4GMP1 4EN8B 3WW3A 1CPMA 2OUHA 2VECA 4DY5A 4AEDC 4FTSA 4AI8A 2DU1A 3WG1A 1UKRA 5AFEA 1DLLA 1NLSA 4Q8LA 2H6CA 2PYTA 5GLUA 1ALYA 4M0NA 1EYBA 4YM2A 1WLTA 1VP6A 3B9IA 1FMD2 2KM2A 3I54A 3FBYA 1GBGA 1HQLA 2A75A 5JI9A 4XBLA 2HWE2 4CEWC 2G4IA 2VULA 4XJZA 4CDQB 1H8VA 1J1LA 4KWJA 3SLIA 2WSUA 4Q1RA 4S2HA 4QU2A 3NV4A 3USUB 3CJIA 2WNUB 4X8PA 4HSLA 4FTBA 3VDDA 4XE9A 3RMYA 2RR12 3TWIA 2PELA 4MX3A 1RUI3 4RS5C 4HANA 5CIRA 5I0TA 5D8AA 4P9XA 2DV9A 3PVBB 2JENA 3O0XA 3NV1A 5JOXA 1O4TA 2FMDA 1ZRDA 2C0ZA 1AQTA 1AX2A 5C8CB 1POV0 2XLFA 4RR3A 5B2GB 2PHRA 1DGWX 1WMDA 1N1TA 2VOXA 4JCKA 1DZTA 1VBC1 3WCRA 3G7DA 4GMP3 3RDIA 4Y1VA 4BMEA 1JOJA 2X5IB 5LK5A 1LHOA 1SCSA 2CK3H 1V9U3 2H0VA 4D7SA 2DUOA 2TUNA 4HKLA 4NWVA 4LUKA 4WVMA 4AHZA 4P9JA 4FOQA 4FPFA 3RZZA 2VMHA 1LHWA 3J8F1 2PAMA 3IIAA 4L92A 1HRI3 3VBUA 1Z7S3 2WNVB 1UZZA 3EQEA 1SLCA 4IEXA 2ZGPA 4KBBA 1Y9QA 2RS31 2RMU2 2VW1A 3TOJA 1YYNA 4JDNA 2EA7A 1GNZA 2H6BA 4Q4V1 3SXWA 4A7ZA 2FZ1A 1PZ9A 4K7JA 1WW6A 4JVAA 1XQNA 2XJVA 3H1WA 4N43A 5DDJ2 5CFDA 3N36A 3MPPG 1GV9A 2D6MA 5FQ0A 1AVBA 1AR91 1ZZ7A 3FWEA 1S0BA 2K0GA 3OCPA 3WW1A 2WA4A 2WL1A 4JRAA 1UZYA 4Q4V2 2JECA 2P3IA 1H4HA 3AP5A 2DCTA 3VBSB 4XFIA 2I45A 2VOKA 4FQ4A 2Y26A 2UY8A 2VG9A 4E27A 4LO8A 2D3SA 5DXDA 5CFCC 2HJIA 1HQNA 1KJLA 2XBO1 3IMNA