3USSA

Crystal structure of cysteine dioxygenase from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
b'SILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structure, Kinetics and M ssbauer Spectroscopic Studies of a Bacterial Cysteine Dioxygenase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3ussA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ussA02
2QE7H 1O3TA 4UBGA 5BPXA 3CJXA 4AQ6A 3PJSK 2VQAA 1J59A 1HW5A 2UY9A 1JEKA 1O3QA 3NSTA 4MH0E 2QNKA 3WW3A 2PAKA 5E1RA 1ZRRA 3H9AA 2D5HA 1ZX5A 1U12A 4KU7A 2PHLA 4PIYA 4WBBA 5BXXA 4DINB 4Q29A 2PTMA 1X7NA 4EWEA 1CAWA 2OZJA 5KHHA 4X6RB 4CYDA 1UIJA 4MV2A 1UIKA 3USSA 2H0VA 3S7EA 3RYPA 1FXZA 2Y0OA 4E2SA 3FE5A 3PNAA 4PIZA 4XEZA 3NKTA 2OPKA 4L2NA 4YYOA 3MZHA 2XGXA 4KWJA 4F7ZA 1RL3A 1LB2A 2CGPA 2Z69A 3CLPA 3TNPB 1Q5OA 4LTAA 1FT9A 5HI0A 5J3UA 1YUDA 4HN1A 1CAVB 1L3JA 4R52A 3R6SA 3U10A 1ZNPA 5KHGA 2GU9A 2D93A 4HVRA 3B02A 3BPZA 2VECA 3NJZA 1DZTA 2PAEA 2QDRA 4QGNA 3RPQA 4D7SA 3JZVA 3MPBA 2GZWA 2UY8A 4OLLA 5CU1A 1J3RA 2B8MA 1EP0A 1NXMA 2MHFA 4Q0UA 1OFNA 3O14A 3CF6E 3PVBB 4XFBA 4F8AA 1Q43A 4I01A 3I7DA 2BNNA 3FFQA 4HBNA 4FBFA 3E6BA 1DGWA 4IEXA 1YFYA 4XF1A 5FQ0B 2DCTA 3RYRA 3OD0A 2BNOA 2OZ6A 4DJGA 3C3VA 4ZU5A 3EFFK 3VHRA 4MGKE 5LEJA 2QCSB 1ZZ9A 4Q0VA 4AQ2A 4HSLA 5I8TA 5J7MA 2GC3A 2K0GA 4Q0QA 4XFIA 4ZU4A 4UXAA 4H7LA 3ELNA 4IEZA 5JSPA 1CAWB 3ES4A 4HVOA 4XFCA 1BSHA 2GC1A 5FLHA 1CAVA 3E97A 3EHKA 1QWRA 3M3IA 1UPIA 3EO6A 2PAMA 3HQXA 5C6CA 1PM7A 1QXJA 3QACA 1NE6A 4OFGA 1YFWA 3LA7A 1Y3TA 4LUMA 2O1QA 2EA7A 2XNDH 4UBHA 2V7QH 5JSRA 2D5FA 3DL3A 1QY4A 3L2HA 2WFPA 4QGMA 2I45A 5KBFA 3U11A 3RZZA 1SFNA 1ZZBA 2KXLA 5C8WA 4XFFA 1O4TA 2W6JH 3RNSA 2UYAA 1OI6A 2GC2A 1OMIA 2ZKLA 3OGJA 3DKWA 4QX5A 1ZRCA 5FQ0A 4YSFA 2IXJA 5BY5A 5I91A 1VJ2A 4MZUA 5LRSA 4O9GA 2B5HA 2IXIA 1H1MA 3PLQA 1O5UA 2ZCWA 3OF1A 4PJYA 4EWAA 1NYWA 3MDPA 1GQGA 3SMHA 1RGSA 4XFAA 4WVZA 4JTNA 1O3RA 3I54A 5FPXA 4AVCA 4TLFA 3BCWA 1IPJA 1Y9QA 1UD1A 3WW2A 1O3SA 2EVXA 1IPKA 3LAGA 4GULA 3FWEA 1E79H 2D40A 1O5LA 3S0MA 3IBMA 1NZCA 3KGLA 4X6QB 1YWKA 4AVBA 4BYYA 2Q0AA 4IEQA 4K8FA 2Q4SA 3EBRA 5I8YA 5JR7B 4IESA 3RYKA 2XHKA 3KGZA 2FQPA 4B29A 4MGZE 1IFPA 1GQHA 2BNMA 4QM8A 3DV8A 2PYTA 4P9GA 3HT2A 1G6NA 5I93A 2WC2A 1CAXB 4IEPA 4WZCA 4NVPA 1FS0E 5LRRA 1I5ZA 5D1IA 4ORFA 5E16A 5J48A 3EQEA 2PA7A 3H1MA 1EYBA 5BV6A 1OD5A 4A2UA 2C0ZA 3KSCA 3HIFA 4IEOA 2K9ZA 3NVCA 5FCCA 3ZDSA 3H7JA 1Q3EA 2MPFA 2IXLA 2GAUA 4BIFA 2GH2A 2H6CA 1PMIA 3SHRA 4QMAA 4I2OA 1ZRDA 2WSSH 4E2GA 4IEVA 3WW4A 3D0SA 1I6XA 2IXKA 4KU8A 3LZZA 3LA2A 4LA2A 3OTFA 2O8QA 2XLGA 3H3UA 4I3PA 2Q1ZB 1J3QA 4I0AA 1DGRA 2HKXA 3IIAA 4YARA 2E5TA 3IDBB 2P17A 4Q0SA 4YXWH 1XE7A 2XL9A 4N9IA 1YFXA 4IEWA 4QM9A 3NL1A 1CAXA 2F4PA 5KHIA 3SCHA 1XRUA 1BSNA 5EFUA 4HVQA 4FT8A 4ONUA 3SCGA 4AXOA 1J3PA 1ZZ6A 4LLOA 4JV4A 4JTOA 5I0TA 4I09A 1ZRFA 4LA3A 5T3NA 4XF0A 1QXRA 3FX3A 5AVPA 3FHIB 1CAUB 3LOIA 4I02A 4IEYA 4MGIE 5FLJA 1LRHA 2N7GA 3WW1A 5F1RA 1X82A 2H6BA 1RTVA 1VR3A 4L11A 4E2QA 3S7IA 1UW8A 4ZU7A 3KCCA 4BHPA 4EV0A 4I0BA 3FJSA 5JCTA 1FI2A 5CVRA 3OCPA 2OA2A 4XF3A 3TNQA 3UKTA 5FPZA 5KHKA 3H50A 3I59B 2QVSB 1JUHA 2B9UA 1CGPA 1ZVFA 4MGYE 5I0SA 3G7DA 2ET7A 4R8HA 3CL1A 3CO2A 4IETA 4YRDA 1EPZA 4XFGA 4HN0A 2IXHA 1YHFA 3E5XA 1ZREA 2JDIH 2XLFA 4Z07A 3GBFA 2Z2SB 1CAUA 1J58A 4MUVA 3LWCA 1ZZCA 2XKPA 5I8SA 4EWDA 3H7YA 3RDIA 2CAVA 1NE4A 4HZFA 2Q30A 4LEJA 3ROUA 2XKOA 4FAGA 3H8UA 3MYXA 1H1IA 3IWZA 4JVAA 3FZ3A 2ETEA 4LUKA 3D0JA 3NW4A 2BYVE 5CADA 3IDCB 2PQQA 3I59A 1X8MA 3H3ZA 3QOPA 3ACLA 3EJKA 1WGPA 3N4MA 3E6DA 3GYDA 2EAAA 4HLTA 4QXKA 1SEFA 1YLLA 2CK3H 3BALA 3CEWA 4IERA 1LKNA 4IEUA 1SQ4A 1O7FA 2XL7A 3UKVA 5K8SA 4XF4A 2FMYA 4KWLA 3U0ZA 3E5UA 5JAXA 4PIXA 3E6CC 1RUOA 4XF9A 4J1WA 1XE8A 2HJIA 3E5QA 4J1XA 2CAUA 2IXCA 1AQTA 4N9HA 2UYBA 5FDBA 3ST7A 3M70A 1ZZ8A 5I0RA 4EROA 1UCXA 1X8EA 4AVAA 3ES1A 5BUVA 1DZRA 4MX3A 2E9QA 3D82A 2QJVA 5FLIA 2MNGA 2BGCA 1VP6A 4LULA 2ATFA 3SCFA 2IC1A 2XLAA 1RUNA 3SXWA 5LEKA 2BEOA 1EY2A 3LA3A 3H1YA 2PHDA 4D7TA 3BU7A 4META 5KHJA 5I0UA 2VPVA 3DN7A 2V09A 1WA4A 4BH9A 2OYZA 1WLTA 2E5YA 3ETQA 3KMHA 4HSJA 4XFHA 2GC0A 3BB6A 5JSOA 4QGLA 4RD7A 1RC6A 3HT1A 3UKNA 3H1WA 2CV6A 4KWKA 4FAHA 1CX4A 1YFUA 4Q0PA 5EZWA 2PFWA 1TQ5A 1LR5A 1J1LA 4O9EA 4XETA 1V70A 4KL1A 4YNIA 2ET1A 4Z82A 1ZZ7A 4HMZA
chains in the Genus database with same CATH superfamily
1KDMA 3GHGA 1Y9MA 2JWAA 4GQ7A 4NE9A 4QPYA 4CXXA 1JEKA 3VZJA 4JKLA 4KU7A 4L73A 4D6TJ 3IIIA 2RS13 4TTGA 4DINB 2WNUA 3KT7A 2OZJA 3WF0A 2NPSD 5FY1A 3L72J 2AUYA 1F35A 4N8MA 5KC6A 4LJHA 3RYPA 4AF9A 4ZKUA 3ZPYA 1XJAA 3PNAA 1NTKD 1O8PA 2ZMNA 2RM21 3INAA 2QJKC 1RVF1 2D6MA 5B4XA 3KV5A 2Z69A 4OQ8A 1DF0A 1XNAA 3AKQA 5L7OC 4H44B 3JD73 5FZAA 1YO8A 3C7OA 3B02A 1TME1 4H14A 1DZTA 2FYUK 2XKMA 4D7SA 2VVFA 2QM7A 1L0NG 4IV3C 1W6NB 4PBOA 1NXMA 5IK7A 4XFBA 1N7LA 5JUVA 2H89C 3LEIA 1YFYA 2C9KA 4DJGA 4Z1VA 4YPJA 4LORA 3CL3D 2NPSB 2EF6A 4Z1MH 1CPMA 1NU1E 2WQ4A 2GUSA 5FZHA 2ORZA 1QH6A 3H1IE 2V4HA 3WUDA 3VB9A 2E6VA 3AKRA 5C3SA 5FP9A 1G2CA 4HJGH 2YROA 1DQ6A 1W0NA 2Q1KA 5FYBA 2PHRA 1ZZBA 4NPEA 2ZACA 3P1IA 1BXHA 4OH8B 5CMZA 1SLLA 2VMDA 4W7ZA 2ZKLA 3W67A 1PP9E 4COWA 4XJUA 4EN7B 3VBRC 5LRSA 1SP4A 4WM7C 5CFCB 5A6YA 1GQGA 4XFJA 4WVZA 5JOWA 3BKZA 5FPAA 3ZR6A 3ZXJA 1YIJP 2E33A 4URTA 1RF1B 1IG3A 4M3CB 4XDOA 1CZSA 1S0BA 3ZSJA 2R0HA 4Z2WA 4XPVA 3O5SA 1FJPA 3ACFA 1UKGA 1USEA 2JXAA 5I93A 1U5XA 2CTVA 1LU1A 4NVPA 4HK9A 4AGRA 1YQCA 3FWLA 2QQNA 2VQTA 1N7SC 2OYHA 2WZ8A 1A02F 5FCCA 3ZDSA 5A3MA 4N53A 4AE2A 4EN0A 3CX5I 1PO11 3WW4A 5FYZA 2IXKA 3TGUG 3LZZA 3OTFA 2A45G 1MS0A 4CUGA 2JICA 1UY1A 1S5LX 5JXHA 4HKZH 1DHKB 1A8MA 3ACHA 2FDHA 2G3AA 1J3PA 5BNOB 4XAEA 2L5GB 1ZRFA 2EXIA 4DRRA 4HL0A 2IZ0A 4AHWA 4IEYA 3WV6A 1JZ6A 4YM2A 1K05A 1RE3A 3CWBJ 3FC0A 1FNZA 3ZFEC 2RH0A 5KLVE 4FTSA 2J22A 3LSDA 4EV0A 1RMU3 1GL2C 1M57D 4LQRA 2R1DA 5CFDB 1N1YA 5FXZA 1UX7A 1NTKK 3GALA 1MVEA 1FPN3 1W6OB 3CO2A 3LDKA 3H1LG 3PUSA 3WG4A 2ZBJA 1NU1D 4JKMA 5L8RJ 1T6AA 3PJQA 1HIXA 3OW2O 1W6QB 1HGZA 2P5BA 2XKPA 2RHPA 1H89A 3N9PA 1DQ5A 3KT1A 3OJBA 3JUUA 1RMU2 1EV11 3RMXA 3TOJA 3H8XA 2J1AA 3VBSB 4IE6A 5FREA 4L75A 3CI9A 1UMIA 2ETEA 4G4FA 2C24A 4YZ1A 3QLQA 1RUI1 5F2SA 1KS5A 3ZMOA 2IUWA 1JY3P 1PP9D 1YITP 2HWF1 2UWAA 3AFGA 4IE4A 3ASIA 2ZT9C 3S30A 5FZ7A 4BE3A 1UU4A 3AXEA 1H88A 1WCKA 3KM5A 4WV8A 1LHNA 2ZYDA 1NCQC 3WINE 3VV1A 5F37A 4IQPA 2Y33A 4MADA 5FYVA 3O1SA 1XYNA 4QX2A 1X8EA 3V2RA 4UOJA 5LK5A 5FZCA 5GZEA 1FNYA 4CZSA 2J1RA 4LULA 2IFMA 2Q8OA 5JIUA 3B5NA 2WO7A 4WVVA 1ND2A 5FP3A 2W47A 2PMWB 2Y6GA 2WT1A 4D7TA 3KDPB 4META 1UZYA 2WSEJ 3DYMA 3PHMA 3VHOA 1G7YA 1VQNP 3GNEA 1H8TB 5DZGA 2ZX4A 4EI2A 1ZZ7A 4XOGA 1XNKA 1VBE3 2O1KA 5B4NA 1V00A 1COV3 5BNQA 1PPJG 3LSEA 1SLBA 2ZGMA 3JC22 4Q29A 4BK5A 3VZMA 2AEFA 2VU9A 4P08A 4W50A 1LTTC 2WO3A 4LC1A 4LXLA 2IFWA 1KB9H 2E7TA 5KLVD 3ITQA 4FFFA 1VBE2 2Y6LA 3VD3A 1COV2 4RESB 1S72P 1PIV1 3MZWB 3GCXA 1OURA 2ZGNA 3GG2A 3MV01 3GZAA 5IUQA 1SG3A 3R6SA 3I3QA 1SS1A 5D8AA 1ULEA 4QB1A 5CNAA 5A70A 5JZGB 3RPQA 2VM9A 1S2KA 1MEC1 1GWMA 3VP9A 3ILNA 5CU1A 3V2QA 3OA7A 2ZGUA 1TEIA 4H13D 3FFQA 3A0HE 3J26N 4KBZA 1WA6X 4DXZA 4CP9A 4IV1B 3MW4A 5FZDA 2Q3EA 1AVBA 2A6ZA 2JIJA 1JZ5A 1C57A 4IEZA 1CAWB 2QVAA 3B4SA 3UIAA 2BRTA 3TNUA 1J1EC 3AE8C 2GN7A 4H0LD 1LTJB 2B42B 3M3IA 2J1TA 4N3YB 5FZ6A 5CKNA 2D44A 5GM0A 1NU1K 2QJYB 2H88C 2R041 3ILFA 1GFF2 2W95A 5JSRA 1YRZA 1H6XA 2G4IA 2GMMA 4GIQA 2OTJP 4U3FJ 3CDZB 5LBEA 3HTKA 2UYAA 1LTEA 1SQPG 4PI0A 1L0LJ 2AREA 2DBIA 2Z5IA 2W3JA 5JPNB 4K40A 3SMHA 1SQVJ 1PGL2 2RDNA 3GHMA 1O3RA 4H13B 1ZR4A 2KOGA 1BYHA 4CEYB 2RG4A 1H8AA 3A0HH 1NO4A 3V4WA 3ORJA 3PTRB 1RUD3 1NYHA 1E5RA 5TISE 4ZPIA 2VZRA 2KXPB 5HCBA 1AZDA 4XACA 4IESA 5ACA1 1V6OA 3AE7C 5BNPA 2DCYA 2I1JA 1X33A 4QM8A 5JPMB 3AM2A 2WNOA 1N73B 3EB7A 3RK2D 1HJFA 4H0LB 3ZPOA 5E16A 2BGPA 2BERA 4CCJA 2K9ZA 1IS6A 1R5LA 4U36A 2ZGSA 1SBDA 2VBDA 5E6HA 3D8CA 4AI2A 1AYM3 2Q1ZB 5T52A 1MZ6A 5IVEA 1CX1A 4CUBA 3L35A 5AVYB 1CAXA 2RE9A 1JYNA 4MOAA 1XRUA 1QJY3 1XPWA 3SCGA 4AXOA 4JTOA 4I09A 4XF0A 2E43A 2A6XA 4ZZ8A 4FPFA 2Y0DA 3CJIC 4JKKA 3RK2B 1AYM2 4AZZA 4BQ5A 4ARYA 3SWFA 1WBLA 1EZVE 4ZS3A 3KCCA 1POV1 3W5MA 4BLJA 3VZOA 1RY3A 4GA9A 1KB9I 1YQ2A 4R4LA 4PD4E 1QJY2 3L74E 5KLVK 1QF3A 2JEMA 5I0SA 4R8HA 1OVVA 1EPZA 1ZREA 2Z2SB 3LDRA 3VBHC 3LWCA 4DQAA 5M0TA 5A7WB 3L71G 2F6BA 3HD7C 4GOFA 5ABJC 3ZIWA 2RDSA 1SVFA 1H2NA 2CDOA 4L8QA 3ZN5A 3PTZA 2RMU1 2W1WA 1JH5A 4BRYB 1QQP2 2QQPA 5KAFE 2Q9IA 1YLLA 1SQ4A 3T97A 1JOPA 1C5IA 5CCHC 4PJ0H 3BU0A 4FP3A 4LK7A 3JBG1 4PD4H 5AFEA 2IXCA 3NJVA 1W2UA 2SPZA 1H30A 1OA4A 3QD6A 2O0OA 1ZZ8A 3OUJA 1GR3A 2E76D 3WNOA 1JYWA 2XPJA 2P6CA 3NTNA 2W46A 3WZ1A 1NGMB 4XMAA 3B9IA 1G9BA 2K9YA 1S1AA 1IS5A 4PV1D 2D6PA 4YVWB 2MEV1 5JSOA 3TDKA 2JJ6A 3UJQA 3UKNA 1W8UA 2XONA 1SCRA 1J1LA 2BFUL 1AYN1 3MIFA 1JZ7A 3TGUJ 2WNVC 4HMZA 1WLWA 1VF5C 3VTPC 1H1AA 5J96B 2WAAA 4U2AA 3V5BA 4QX7A 2B89A 3OYWA 1MZ9A 1HUCA 4AUWA 5FZBA 2XBO3 3ZYBA 2ZGPA 3VDDA 1ULGA 5L7OA 3I2IA 1WLCA 4CE8A 4HKLA 1JM0A 4NJ4A 1YTZI 1YQ8A 1Q2NA 4QDRA 1C1LA 1PMJX 3CMAP 4W6YA 3MO4A 3K4ZA 1NOHA 1OF3A 3WUCA 3HNYM 3L74D 1UU6A 1WMXA 3CLPA 1KRIA 3HWJA 2R063 2OYOA 1S0IA 4A6SA 4TWTA 2XBO2 2W39A 3SQOA 3OBRA 1LJ7A 3CBNA 2NM1A 1WCQA 1M56D 3WG2A 1GNHA 2V7QJ 4CDUC 2BOJA 2VOVA 3MF6A 5DG2A 1O91A 2BBAA 2KNCA 2WN2A 5H2FH 3MTUE 3J7HA 3ZYHA 2ZXEB 5GLZA 4CCMA 3ZOIA 1NG0A 2WWSA 4LNVA 1IG0A 1W3XA 2D6KA 2ZAAA 1UOJA 5JR2A 1D4M3 3CCSP 4UB6E 4XFIA 3P5BA 2Q8CA 4AVVA 3ES4A 4A41A 1JYIA 1BSHA 4JHTA 3ZFFA 1SQXJ 2VH9A 1HQNA 4GIFA 2LR2A 2EIDA 1L0NE 5KWRA 5KXCA 2O14A 2WZR3 3I2HA 1DCSA 2GSYA 4WVMB 3WQ0A 3T0DA 1R093 4AFAA 2E32A 5I91A 2A3XA 1WW6A 2FDKA 3VMXA 4GWMA 4WBAA 4BXFA 2XMLA 4DB5A 1HQLA 1IPJA 2BWAA 2AH2A 1EZVI 1N7SA 3UGGA 2Q5TA 3HE5B 2ZVNB 4V2WA 3B8EB 1GZLA 1JZ3A 4QB6A 4I6MC 2WZR2 1JN2P 1JU4A 2FQPA 4PD4I 2A73B 4UB6H 2PYTA 4OUEA 1R092 5APSA 2CYFA 4IEPA 1RITA 2HPCA 3G9RA 2PHUA 3THTA 3X29B 2LXBA 2EXKA 3HJRA 2P4EA 4IEOA 3GMAA 1MFTA 3W20A 3C7FA 5K0UC 3VBUC 2YC2A 2MPFA 2GAUA 1GP5A 4XUQA 5AVSB 1K5MA 3MPPG 3VD9A 2QSIA 1DEEG 4Z2AA 2RJ2A 2HODA 1STMA 3LEKA 2VUDA 2WA4A 3J4UH 1OKOA 5DAVA 3M0DC 4CU9A 2IBZG 1GL2A 2AEYA 1R1A1 2ZA9A 1OLQA 3UJOA 4JYBA 1HV1A 3M91A 3QCWA 4JV4A 3R0RA 1JU3A 4RA0A 4XYXA 3AP7A 1YQ5A 2AACA 1ZV8A 3FHIB 2FYNC 1PO21 3LOIA 4DZGA 4KHXA 1WW7A 4FOQA 4Q4X2 2QQJA 1N1TA 4IFMA 3V2PA 2A7AA 5JCTA 1JOBA 4Y1ZA 5A3WA 1PVC1 3RI9A 2K2SA 5FPZA 2KK7A 2DWRA 1H2MA 2A3YA 1ZP0C 3JCIA 3RI8A 2ZJSE 4KT0J 5G05L 1HN1A 1YJWP 3H1JG 2VNGA 3KVBA 4P9WA 5FXXA 2ID4A 4KGGA 3ZKUA 1ZZCA 2D2CD 3DCQA 1PZQA 4XA4A 2WPRA 1EUTA 3DPRC 1RUJ1 2QG4A 3FBYA 1L0ND 1G9FA 4PHZA 4BQ1A 1IGOA 1URQC 2C1FA 3A0NA 1LOCA 1GUIA 3VBFC 2R32A 3WDUA 1NCQA 3IPVA 3Q8BA 3WVJA 3NW4A 5IK8A 3KHUA 1MZ5A 2OGUA 2WQYC 1WGPA 1KD1Q 5DUXA 3T2PA 2YKOA 2HWD1 1YEWA 2G19A 4PIXA 4MYEA 2ZHNA 2YXQB 1DQ1A 5F6KA 1CSBA 4E8CA 2I8DA 3Q1MA 1S0FA 4NPRA 1URXA 2X09A 1UCXA 1NA1B 2CSGA 4BQWA 3HNBM 2QJVA 4OGQD 2D2CB 3DF0A 3MIBA 4LBQD 3Q5RA 2VUJA 3H1HG 2XHNA 2A3WA 1H4HA 3OGSA 1EY2A 3MI8A 4UYBA 3BU7A 5TSWA 3I2KA 5A6ZA 4BXLA 2YC4A 2GP3A 2QQWA 2YIUB 2Z4EA 3HUSC 1UXXX 1W2BO 1EAH3 5FZOA 2WS91 1SFCC 1KFXL 1H2LA 3POJA 1JUNA 3VBOB 1O3QA 5L73A 2VE1A 1OH3A 2PAKA 2P1BA 3H42B 4ATEA 3FGAD 5BVZA 1OW7A 2VCCA 1JS9A 4OGQB 4LBQB 3IB3A 1W39A 3TGUD 2ZHMA 3BN6A 1DBNA 4N43B 4XDPA 3POFA 3AC0A 3H1KJ 2B87B 3MEPA 2IDBA 3RFRA 5ERLA 3M3CA 5E8AA 1OXCA 3RK3E 3KHCA 3U10A 3KQ4B 2WPSA 2VECA 3NJZA 4UW5A 2PAEA 3JZVA 3MPBA 1LTSC 3IDAA 4O9BA 3USUA 1PGOA 3ZXEA 4CDWB 2ARCA 4HPKA 1W6MB 1DYPA 5CBLA 5C9AB 2RS31 3O14A 3RBZA 3MP7B 2R16A 3ZN6B 1HB3A 1RUF3 2J58A 1QMJA 2BNOA 3ACGA 5IK5A 3OSDA 1VBB1 3ZIXA 4FPOB 3ME2A 3VZNA 4FQ4A 2HG5D 1IC2A 1VBC2 3CPWO 1CAVA 3H1LD 4B4PA 1PZ7A 1J83A 3MW3A 4QU2A 5EFWB 2NZ2A 2WFPA 4QGMA 4D6TE 1EXIA 1LULA 1L0NK 2BU9A 3N4XA 1RVF3 1H1MA 4H44C 3JB8A 1PM4A 4TYSA 3OY8B 1BCCG 2PFXA 5APVA 1JY2N 3LAGA 3DXTA 4AAXA 3FWEA 2D40A 3L36A 4LK6A 3PP5A 3FFZA 1TME3 4BYYA 2ARBA 2Q4SA 5GLTA 5JR7B 1RUC3 3KGZA 4MGZE 4QKNA 3SSUA 4XHXA 3DV8A 2E7QA 3ZYFA 3ZR5A 1KV4A 1RQUA 1JZ2A 2RM22 2NPSC 4H2AA 4UW3A 1QJX1 1RVF2 1SQPE 3AP6A 2POHA 3IMMA 4AEJA 4B4RA 4ET7A 5F6LB 3H7JA 1OVPA 1H0TA 2HYNA 4W65A 4A7KA 3L73J 1TME2 4NPFX 5D21A 1CI6B 2RS11 4XW3A 4IEVA 1AA0A 1M1JA 3IAPA 3BCCJ 1DD4A 3CJIA 4WY4D 4NMIA 2AZ5A 3IIAA 3TRSB 4FFHA 5DAWA 2WQ8A 4Q1RA 1LHVA 1OT5A 1SBFA 4CVUA 1FZCA 4NHKA 1DYOA 4ONUA 5DQ0A 2QQMA 3ZSEA 2ITAA 1PPJD 2KZJA 1RF1C 4CRQA 4QKBA 3RK3D 1V0AA 1UW8A 4D94A 2FCUA 3VBHA 2JECA 2F17A 3HD7A 3WNMA 3P6BA 4LBNA 2WKKA 1YCIA 5CCGD 3D71A 2WBKA 2KP8A 4WY4B 2EICA 4PCRA 1W05A 4WB4A 3CMEP 4N78E 2YKQA 1QJZA 1XC6A 5C33A 1RE4C 1PO13 2ZGRA 5CCHA 1AJOA 3L70G 3MYXA 1HXS3 4A3ZA 4AQSA 4RQPB 2YKPA 2FBEA 2W5FA 1ZLLA 2PQQA 5BNOC 3KXDA 3H3ZA 1NTMJ 3RK3B 4JDMA 3N4MA 1KJRA 3O1UA 1IJDB 1BKZA 3SH3A 5H9QA 2FYZA 3RWNA 3H8OA 2C0WA 4XE5B 1PO12 1AHSA 4IGOA 2XB6C 2OYIB 3L71E 1IQAA 4N9HA 1S9KE 3GF7A 1W8WA 5CFDC 1REFA 2VOWA 4P9YA 5A32B 1YTZT 1FATA 3ZN4A 3TEWA 4MX3A 2FZ2A 1RYYA 4GZ9A 4V2VA 1SQPD 4FOWA 5DUVA 2XLAA 2CGOA 2KS1B 5LEKA 5HCFA 3B5LB 1E5HA 4K9SA 4M0NA 4BH9A 5T55A 3CD6P 1EV13 4KWUA 1V6IA 1CX4A 4Q0PA 4XTPA 5CISA 1VQ6P 1LR5A 4QXBA 3CC7P 5APXA 4YG0A 1OD3A 1DLCA 1C8M3 2E74D 3ZXGA 1RUI3 2VGDA 1AX1A 2VQAA 2W27A 1BVVA 5GTIH 5C5TA 1F4AA 2VUCA 4XCAA 3V0BB 4Y33A 3O0VA 2XJVA 1Q7YQ 5KHHA 2XJTA 3TYYA 2GH8A 4XXPA 1HQWA 1EV12 4YTPC 3A23A 2B46X 1KFNA 5C8CB 3AZYA 3N7LA 4CDUA 4OHZA 1U7JA 2NP0A 3CCLP 4YYOA 3G3ZA 3GCWA 1Q8PA 1VQ7P 3MGUA 1RUI2 4COZA 1IOAA 2NQYA 2G1MA 4IFDK 2HWF2 2LXCB 5BNNB 2VRSA 1F15A 5A7NA 1HBWA 2R49A 5KHGA 1ZBA1 3BPZA 2M5AB 2Q5UA 1K9MQ 2E74B 1JYTA 4NIGA 1YYCA 1GD2E 1WD3A 4Q0UA 2YXRB 5FWJA 2EIBA 1OOPB 4ZS2A 4B1LA 4RO0A 4FBFA 5IVFA 5FIXA 3I56P 1XNDA 3ON7A 2OZ6A 3BGAA 3VHRA 1T6BX 2RV9A 2P37A 2DUPA 4Q0QA 4YGEA 1FOD3 4RGKA 2Z5HA 3IF4A 2GC1A 2BFUS 5IT6A 1QWRA 4ASWA 1G9AA 4QXCA 1PM7A 4IXLA 3I49A 5FY5A 2EA7A 4HG6B 1JNMA 1DIWA 2D6OX 2Y0CA 1CVNA 3L71D 5CHXA 2QUOA 4YFZA 1S9KD 3K46A 4NWVA 4Y5TA 1LHUA 5FZ8A 1FOSF 2C26A 1OQEA 4MGSA 1PIV3 2V73A 5K9YA 1IFIA 1UQXA 2NZ9A 2FBWC 4BQXA 5JZGC 5FZGA 1W04A 2WSEH 3S0MA 1NZCA 3KGLA 3VBUA 4DUVA 4IEQA 1SACA 5C3PA 1MEC3 1ULFA 4MG2A 1ENXA 1ZA4A 4B29A 3ILRA 3HT2A 5T50A 4IV1C 3K3OA 4UWDA 4ASMB 1PIV2 2DVFA 4YLZA 4EE2A 4D69A 3M0DA 4RGAA 3KCYA 1LTJC 3G6EP 2VXJA 3JQXA 3ZO0B 1SQPK 2QJYC 4CDXA 2BOIA 1I3HA 3GM8A 4QMAA 5JIAA 5KTBA 4C8DA 5G04L 3N36A 1ZRDA 2WSSH 1MEC2 1KFUL 1NH4A 4P9XA 2R043 3LIHA 4FO9A 1YI7A 4Q0SA 4N9IA 4QM9A 1POV0 2PP6A 2DVAA 4Q1PA 4NRMA 2NMOA 2X5IB 2BCCJ 3LDBA 2WO1A 2ZX1A 3FX3A 4CEYC 3WDVA 5DXDA 4YW7A 4MXWA 3OPWA 3WW1A 1TE1B 3KLSA 1W8NA 3ZXKA 5KJ7D 3IMNA 2R042 1W03A 1IKPA 2B7YA 2NLRA 1KILC 1ZOYC 4K35A 1VQKP 4H0LC 5ACA3 2OA2A 2DFBA 1WT6A 2OW4A 2JE9A 3DPRA 4PLNA 2NYYA 4TT3H 1EXJA 1NKNA 2QVSB 3KB5A 2IBZE 2BV4A 1GYKA 2XVKA 4DXRA 1LWUB 3A5TA 5FPUA 1U57A 3GBFA 1CAUA 3WNLA 4NPLA 3CC4P 1SQBG 2W90A 5ACA2 3JCUH 1KFMA 4YG3A 1J1TA 1CIWA 4J25A 3S57A 2JIGA 4D8MA 4W80A 3GHGC 4RR3A 3RJ2X 4XVHA 4OHVA 3PVNA 5LA2A 1UIIA 3JXSA 3UETA 1LKNA 5FYIA 1PMHX 3RK2C 3H1JE 1FOSE 1VE0A 1AR61 3W68A 1D0GA 4JGZC 3H1IG 2OTLP 4XZPA 2UYBA 4A7PA 3C9IA 4FFIA 2D43A 3ZDVA 3ZXAC 4CPBA 3V56A 1POV3 4QWNA 3D82A 3BTZA 2A6WA 3DXUA 3HUSA 3G4SP 4ZXEA 1HDKA 4QHBA 1MS5A 4JHZA 1SFCA 1CD3G 1HVVA 1SQQE 2Q6QA 2G8YA 3I2DA 3D3AA 4DY3A 4C1WA 4LE3A 5I0DA 4A4AA 1S1CX 4D6RA 4RD7A 3VD7A 4UI9L 3M3QA 2DFCA 3AZVA 2IPPA 3VP8A 3OUIA 4XABA 1O4YA 2YY1A 4AQ6A 2E51A 1AR83 1HW5A 2RMU3 3H1HE 4LMFA 2KB7P 3RL0D 3GJBA 2HYXA 1ZX5A 3SC7X 1NAFA 4Y5SA 2VZVA 2Q8DA 3SFEC 1UIJA 3POSA 1UIKA 3JBG3 1NLQA 3QH9A 2Y0OA 3AZXA 1X9VA 3MIEA 1LU2A 4K20A 2KZIA 3NXSA 4XEZA 2OPKA 1CW5A 4K3AA 4DIQA 2D6NA 2JWPA 4HXCA 3CIHA 2XGXA 4CEWB 3OPZA 5LWBA 4JGYA 2RMU2 5HXMA 3BATA 5HPOA 1M8OB 2IBZD 1O59A 4R9BA 2QBXA 2VZQA 3DECA 1L3JA 2K9JB 3WDXA 2P10A 2WN3A 4YVWC 5KR7A 1LTIC 2RJLA 2VVDA 2BPA2 3FX0A 1OKQA 3JBG2 2FYUJ 2MEV3 5FZEA 2HLEA 3RL0B 5AW7B 2ZX2A 1T2XA 1AYN3 2DUQA 1S5LH 4NOTA 2TUNA 1JOCA 3WX5A 4QX1A 5LK7B 2QCSB 2OYHC 3WF2A 3M2MA 1F2NA 1ZMEC 5KAIE 4HVOA 4XC9A 3T4HB 1OFSA 4UT5A 2E76C 2QM8A 4Y4YA 2PAMA 3H1JD 3NKGA 2MEV2 1YFWA 3RL0g 3HBKA 4H55A 1LEDA 4XE9A 5K5GB 1JY2P 1W6NA 4R9AA 1QY4A 3Q8FA 3T08A 1IZ3A 4PV1C 1W8HA 4LBOA 1OMIA 4QPIC 2BGOA 1UYXA 2NPSA 1K5JA 1HRI3 2EXHA 4PBPA 1NX9A 4OZOA 4INDA 1RE3C 1W8FA 1E79H 1HJGA 4GH4C 5JDBA 4K8FA 3ZYPA 2OQQA 3RYKA 1IFPA 1QXPA 2GM4A 4GKYA 5KAIH 2VTFA 1VBD3 3VN0A 5LRRA 1I5ZA 1RXGA 3PLNA 2WSFJ 2Y6HA 3WNKA 3WEZA 1EYBA 5DZFA 5CFCA 4AEDB 5FYMA 1BCCE 4DEQA 1LTGC 3VOPA 4XIOA 2BWCA 4BIFA 3H1HD 3T1MA 1BE3J 3PVOA 1Q82Q 4DY5A 2NPIA 1JXNA 2VZOA 1RF1A 4M3CA 1PVXA 2X05A 2E5TA 1OUSA 1BQPA 3WF3A 4N6JA 4MHUA 1GW3A 1LTAC 2W94A 2PLV1 4I30A 3VMAA 2K88A 1NY71 3HQRA 2ZYAA 5LY1A 4LA3A 4AHYA 2DF7A 2R061 4OCTA 1MR5A 2CU5A 5FPVA 1B35B 5F2WA 1X82A 1RTVA 2O3JA 1JTHB 4ZU7A 2Z42A 1L2PA 5JVVA 1RE4A 2WYSA 2JDNA 2LRPA 2FFDB 3WHUA 1HRV3 3SITA 1JZ8A 1QGLA 2B9UA 4CU7A 2IZ1A 1U5YA 1ZM1A 5F3IA 1NTKJ 3VN4A 4DNYA 5BNOA 2BEQD 1G8WA 3QH7A 2FXMA 2WLPA 1ZA7A 2XLFA 2PELA 4AHXA 2WABA 4CSWA 3VKMA 3LIDA 3MLJA 5GZFA 5AW3B 4GMP1 5AW8B 1TNRA 4SLIA 5A33B 4RHV3 2QFEA 5CFDA 3WT3A 4AYUA 3QBQA 4BIOA 4QX8A 3UT0A 3WNXA 3ACLA 2E26A 5EP9A 1R1A3 2WZ7A 1NTZG 4HLTA 4XUOA 4QXKA 5F8PA 4Q8LA 4JRAA 1W6OA 3FUOA 3IZOA 3T2TA 1UOFA 2QTWB 4Q4Y1 1JHNA 4TLGA 1PO23 3HR9A 4J6GA 2JDHA 3I3BA 1XE8A 3E5QA 3K51A 1W6QA 4RKUJ 3BTAA 1N2DC 1KXGA 3ST7A 3POGA 2NRGA 1QU0A 2C0XA 3VBSA 1UZVA 3DYPA 1PVC3 1BBT2 1R1A2 1GOGA 2NN8A 1MUUA 4EYUA 3AEEC 4LKFA 3U78A 4ZNCA 2FCVA 3B93A 3R4UA 4UW6A 2D3PA 1PO22 5D8AC 2VQUA 5KHJA 1BCCD 3LW5J 2GMPA 2VMGA 1GZ9A 4AFDA 1PVC2 3C8VA 4KL1A 4L74A 2ET1A 1X50A 2UU8A 5A7PA 5BPXA 3EXUA 2XVLA 5GLUA 1SLQA 2UY9A 3HNMA 1DU3D 2R5DA 2DCKA 5FFOC 5FOBB 4IDZA 1KC8Q 2BVBA 1QDCA 1RUJ2 2ZX0A 2VZ1A 4OYUA 1BEV1 2YGLA 3FE5A 2XG3A 3ACIA 1H8TA 1DEBA 2WSUA 1QIQA 4YGBA 1EPWA 2OTKE 1IK7A 5FZ4A 1VPHA 4OMCA 1S2BA 3TNPB 5F3CA 2HWD2 4LTAA 4NHLA 2IFNA 4PDWB 3QH6A 2OT7A 1Z7S2 4RFT0 1XYPA 5CBNA 5HV0A 4M3LA 3I2JA 1ND3B 2UY8A 1BDCA 2A75A 3V64A 2YIUC 3NV1A 4DUXA 5KXEA 1BCXA 2MHFA 4YW5A 1MS8A 3CF6E 1EZVG 3HPNA 2RVAA 4HBNA 5KKZC 2IYOA 2WA3A 2ZTNA 3SEPA 2WPVB 4C7NB 1W9WA 3VBOC 1XBFA 1TVGA 4DOJA 4H7LA 2N1TD 2B9VA 2UWCA 4Z8BA 1PFIA 1PGW1 3MHZA 2XJSA 2QDNA 2X10A 4OGQC 3HQXA 5C6CA 5JZGA 5FUPA 4OFGA 4IV3B 3LA7A 1NU1J 4MHRA 1UY3A 4FP2A 1EDIA 3DL3A 3L2HA 3THDA 1RUG1 5A3OA 2RS51 2RJKA 5FMDA 1OF4A 3L70D 3M3OA 1PGPA 1O4TA 2DBNA 2WS92 4IUGA 4YG6A 4IV1A 1YQ3C 2WSCH 4Q4V3 2AXTE 1UD1A 1PP9J 1X9TA 4C7RA 4CDWC 1LTJA 4CTEA 1X36A 5C9AC 3TBDA 1VIWB 2IWGB 2N1TB 1GQHA 3CX5E 2RS33 4QHOA 1PGQA 2R3CA 2R072 3M4FA 5HBAA 2C6SA 1EAH1 1SLTA 4XHBA 5T54A 3VBRB 4WM7B 1WMEA 4B4QA 5F7UA 4ZMDA 1I5PA 3EQEA 5JOXA 5BV6A 5FYTA 1K45A 5FBZA 2XJQA 4XBQA 3D6EA 4R4XA 4TSVA 1YJ9P 1NLRA 2H6CA 1GP6A 5DJUB 5FYYA 4CEYA 1R64A 5LATA 4NPMA 1LP1B 3VMYA 2W52A 2RS32 1Y7BA 2HKXA 4NN0A 2KR2A 2BBVA 3UV9A 2B45X 2DCJA 3GLMA 2AXTH 1VMFA 2KI7B 1YFXA 4IEWA 1FC2C 2XZRA 1N73A 2F4PA 1VBB2 5EFUA 4HVQA 2WT7B 1YXWA 2H7HA 3V6IA 3RZJA 1N7SB 4UAPA 3PTYA 3OOXA 3SNMA 2WL1A 3CX5H 1DLLA 5IAXA 4FPKA 1HB4A 1W9SA 1LAJA 1AR91 5FRAA 4I2LC 3AEGC 4I0BA 1T3JA 3BOPA 5KHKA 1RUF1 2GN3A 2LROA 5KLVJ 1WW4A 1DH3A 1IFNA 4Q5OA 1GQPA 1Z0HA 3OEBA 1BGYG 5FMBA 4B86A 3VL9A 3ZFEB 4BWNA 5AC91 1T2KD 4JGZA 4MXVA 3H8UA 1FDIA 3RMYA 1V6JA 1QJX2 5CADA 1QJEA 2ZXQA 1W6PB 1AL0G 5FO7B 1Y43B 4XF4A 5F3GA 3VDDC 3U0ZA 2RS12 1OPOA 3I2OA 2CAUA 2J59M 5A7WA 2DVGA 1JYXA 1SQBE 1UYPA 2P3KA 5FDBA 1RUC1 2PHXA 4QQOA 1A8DA 5DPNA 3CCEP 3UGHA 1VQ5P 3HE4B 3CX5D 5ISLA 2JDPA 2ARXA 2ZHKA 4WY4C 2WO2A 5JI7A 5CEHA 2Y0IA 1VQPP 2ZAHA 3V65A 2QKDA 4I7ZB 3PVEA 4BRYA 1KYOE 3OG2A 3C2UA 2A71A 3LA3A 3JD72 4A42A 4EN9B 3IR9A 1ULOA 2OYZA 3VHPA 4QAWA 2Y9ZA 4XMIA 4K3UA 3T2OA 1W9FA 1YNAA 3Q8CA 3C7EA 2HBTA 5AFBA 1H6YA 2BEZF 3IPVB 3UL2A 4RQPC 3A3YB 4BISA 1YFUA 3MUDA 1Q56A 5DN2A 5CKMA 3NNLA 2QE7H 1O3TA 3I2FA 3AP4A 3CJXA 2J1UA 3A21A 2GNMA 2YUEA 4DZOA 2PHFA 3ZFFC 2OYIC 1PK6B 4PIYA 2LALA 2WZEA 4EWEA 1C3HA 3LFIA 2VOTA 4BLIA 3F2ZA 1LTBC 4LIUA 1K8AQ 4YVWA 4E2SA 3KVAA 2HYKA 1KYOH 1RF0C 4L2NA 3P8MC 3W21A 3KS7A 5J09A 3L37A 1ZRIA 3MIDA 2CHHA 4LPLA 2DTWA 3ENRA 2LUWA 3KV6A 2WSVA 3UNPA 2GU9A 4IGQA 1ACCA 2YMZA 4RFRB 2JE8A 4GODA 2DTYA 4AWDA 4LO8A 3TN93 3SISA 4I01A 4MN4C 3L4FA 1HXS1 5GLVA 1V9U3 5J98B 4PT6A 4COYA 4YZ5A 1SPPB 1DGLA 1RUE1 3ZXFA 1GSLA 5JSPA 1DFQA 4W8JA 4QPIA 1UOGA 5FLHA 1K5MC 4AR2A 1UPIA 5LBFA 2ORXA 4AGGA 4BA6A 3ZYGA 3QWOC 3W9AA 4GH4A 3D4KA 1D2QA 3ZKYA 2Q7CA 1SQBD 4ES8A 5IFPA 5C4WB 3WHTA 5A1FA 1OI6A 4KQ7A 2ZKNA 4YSFA 3WCSA 3H8RA 5LZ6A 4YGCA 3OAKA 5EIYB 1OLME 2VO5A 3H0OA 3MDPA 1PX3A 1RGSA 1J1EB 3I54A 3USUB 1Y9QA 1KYOD 1IPKA 2E74C 2D98A 5FMOS 1ZBA3 2XQRA 4X6QB 2Q3IA 3H1ID 1OOPC 2HR3A 2F4LA 2XHKA 5A7OA 1C28A 1POQA 2OX0A 4QKDA 4KH9A 2W6AA 4WVMA 1YIPA 1C8M1 1FPN2 1A78A 1ZBA2 2JDAA 1AR71 5GZCA 3HE5A 4CA9A 2W6BA 4KU8A 2DUOA 2O8QA 2ZABA 3AFKA 3U1XA 4JPZB 1G1IA 4G9SB 4M01A 4H7MA 4YVSB 1RXFA 5IJRA 1YQ6A 4ISQA 3MBWA 1ZZ6A 2V5DA 3FBMA 1KB9E 3S9OA 3THPA 1IQDC 4LBKA 2ZVOB 4MGIE 2BW8A 4CPGA 1PHMA 5DDJ1 1D0HA 5F1RA 2VMEA 1CZTA 1GOHA 2XXZA 4E2QA 3SKVA 3S7IA 2GNTA 3OCPA 3BPSA 3A22A 1DP0A 3I59B 4XJWA 4JDOA 4DXSA 1UZ0A 4OVEA 3LPGA 1KYOI 4G3YC 3UESA 5A7QA 2VMIA 4OI2A 1JUIA 1LJ2A 4Q26A 2IXHA 2ZJCA 1FOD1 3H6PA 2OIIA 1KQLA 3L74J 1QKQA 4XCBA 5EJ3A 1ZW0A 2M3BA 4LEJA 2W1UA 5DUUA 1QJU1 4LUKA 5DG1A 1QQP1 3CZJA 3VL8A 1ODMA 1OVRA 2C9LY 3BALA 5LASA 1NOVA 4IERA 3O8ZA 3KHBA 1O7FA 3O1RA 1XSQA 3VHNA 3AYDA 2GNDA 3TWIA 1M7LA 3D70A 5JAXA 4L0PA 2E7AA 3ZFGB 2BCCE 4QPGB 3HD7B 5ABJB 3ABVC 3TB0A 3OGRA 5FP4A 2KYVA 4FPJA 4BMEA 1XTGB 5CJ0A 4JF7A 1CPNA 2FXPA 5LW9A 1OW8A 4D6TG 1DZRA 3T0AA 3VDCA 3RRDA 4LBLA 1SQBK 1LWUC 3L72G 5EWSA 2JX9A 2ES3A 1NTZE 5L36A 1G86A 1RUNA 1PV3A 3DKQA 3T4VA 1LGNA 3NWKA 1QVGO 4L99A 3AMHA 2GC0A 3BB6A 1H9WA 5FTTC 1OA2A 3LB9A 3MICA 2YMYA 1I1EA 5FKBA 5F3EA 3U4XA 2PAJA 2QA4P 3P3PA 1FU1A 2O01H 1NA1A 5KJ7C 1VMJA 1E5WA 1OA3A 3GXUA 4NROA 1N3QA 1WW5A 2XUMA 4LR4A 1G9CA 1EUUA 2R3SA 1AXKA 1LT9C 3MUZ1 2ZEYA 1U12A 3M8LA 1KB9D 2M3EA 5BXXA 1SBEA 2VD7A 5F9TA 1AR63 1MS9A 2VY0A 4XAAA 3CXHE 1RHI1 1MKMA 4B3NA 4MGTA 3B3QE 2WYFA 5A3PA 2E75C 4CUCA 1AVYA 2WNVB 3MLLA 2VTXA 4HH2A 2R0FA 3KZIH 4UFLA 1ENSA 4BQ4A 4EN6B 3VBOA 3GF6A 1W8ZA 5FXVA 1YJKA 1ZNPA 1AR62 1DX7A 4Y22A 2LTNA 4GJZA 4E27A 1RUD2 2ZGQA 2BP6A 5J1XA 4LKEA 4LBQA 5H9RA 4QU1A 2VBPA 4AI3A 3TAYA 1MPXA 1SFPA 4L76A 5FQ0B 1FBMA 4N43A 2B87A 2C9NY 1ZZ9A 3CXHH 3AKSA 3K5BA 1EDKA 1UMZA 4QXHA 1H8VA 3OB8A 1VRBA 3M9QA 3E97A 5AW4B 1K3IA 1ULCA 4NHYA 4N90A 3KYQA 1M1JC 1R081 5HCAA 1DGWX 5A6QA 1FMD1 1AJYA 4LUMA 2HWE1 4FSJA 1UWWA 4CDWA 1W6MA 5FY8A 4CCEA 4TXWA 4MVTA 5C9AA 1SFNA 3ZN6A 1S4XA 1FZCC 5D2AA 2Z5WA 4PJ0E 3RBXA 1L0NJ 4YW6A 5BY5A 1RHZB 1VJ2A 3CCMP 2G9FA 3PLQA 3L75E 1VRH1 3Q5PA 4PJYA 1AV1A 1LT1A 4JTNA 2JE7A 3VLBB 4ATFA 1NTZD 1SLIA 4AVCA 5KXBA 1O3SA 5FYCA 1O5LA 1F9KA 4IL6E 3O12A 4O61A 5LY2A 3SKJE 1Q8OA 4EIJA 2VTXJ 5I8YA 2FCTA 3I3MA 2HH9A 1HWTC 4P9GA 1UMHA 1UO9A 2GA1A 2FYUE 1QOTA 3CWBG 3HVDA 1ZR2A 3W58A 4X8NA 3VZLA 3N9MA 1AR81 2KIKA 3AJYA 1GU3A 3AMMA 3OY8A 2J5UA 1KGYA 5IWFA 3KV9A 1WRGA 1C1FA 4DMIA 2YNYA 2L9LA 4OULA 3I5CA 1O8SA 1WCSA 3K48A 4P14A 3LA2A 1SDDB 1IS4A 4FTBA 1YIFA 3AEFC 1E5IA 1NKZB 3F95A 4WM8B 1XYOA 3WP3A 4YW4A 3TEYA 2VZ3A 1SLCA 5CZKA 4IL6H 1PL5A 4S2DA 4K1YA 2B39A 5T3NA 5KLIC 2L91A 5K0UB 3VBUB 3PRJA 2EIEA 5GALA 4Q4X1 4AVTA 1CI6A 1XU2A 1HKDA 1VR3A 4JYCA 3IDEA 3ZXDA 4SBVA 4GDOA 4AAPA 4AL9A 4M0HA 4OI1A 2P2KA 1W2AX 4MGYE 2ZX3A 3BIEA 1URQD 5H2FE 2G9GA 3ZSLA 3RQ0A 2FYNB 2JDIH 3GJAA 1K42A 5C70A 1LOEA 5CKQA 2YHJA 2QZ3A 2HEWF 4FAGA 5CG9A 1OC1A 5KXDA 3FWNA 3AXDA 3FZ3A 1JYVA 3D0JA 1EZVD 4Y26A 3LE0A 5FP8A 1AFOA 5EJ1B 2PLV3 1SEFA 2DURA 2H8PD 2QJPB 4WY4A 3ZM8A 4PD4D 1HRI1 5K8SA 1FAVA 1BLZA 3CXHI 4RGGA 3SH5A 5FZKA 2FZ1A 2VMHA 3BOWA 1BGYE 4YZ4A 1AQTA 4WZFA 1QOOA 2FFDC 3H1LJ 1URQB 1BVP1 4CDQB 1Y9GA 3VBFB 4AVAA 3O6QB 1SDWA 4E4SA 4RQPA 1VBD1 1OBNA 3AE6C 2E9QA 4B1MA 4DUWA 2PLV2 2XQXA 5H9SA 5JXJA 3I55P 1XQNA 1NY72 5SV8A 4LO5B 3KV4A 3MIWA 2R062 4NIDA 2FDFA 4TZDA 2VG9A 2AR6A 1Q90D 2E5YA 2RMZA 1NTZK 4XFHA 4RS5B 2VAUA 2OYIA 5CCGA 1OVSA 4PQ9A 5EZWA 4Y20B 4HFSA 4GMP3 1ASJ1 1LHWA 5IVVA 4JC1A 4HONA 1T8ZA 4P9IA 3HAGA 2CGNA 4BPZA 2M8RA 3OJAB 3CCRP 1RF0A 1RINA 3SH4A 1D4M2 4CCKA 3WW3A 1P84E 1WMKA 3UYJA 2D5HA 2KS1A 1UZWA 4DEVA 4Q4Y3 4U7JA 4X6RB 5CG8A 4CYDA 2SBAA 2YBPA 2XUEA 1LOGA 3ZSKA 1UIXA 1D4VB 4GKGA 3HUSB 4PIZA 5IVYA 1HRV1 3MZHA 2LM3A 2BQPA 1S0GA 3KD4A 1UY4A 1LB2A 2FDJA 2QRXA 2XR4A 4AI0A 1VQLP 4YWAA 1MQTB 1YUDA 1FE6A 4Q4Y2 4U3FG 2D93A 3FUQA 3V0BA 4QQHA 1IFDA 4XUNA 4LT5A 4MO3M 3WD5A 1L0LG 4OZXA 5AW6B 5JOYA 1HN0A 5C8CA 1SQVG 2QQOA 3AL5A 1VBA1 2H0BA 2ZGTA 1DGWA 4IEXA 1P84H 1RJ7A 4NR1A 4RHV1 2VUAA 4QT6A 3PMEA 3SWKA 4HSLA 5I8TA 2GP5A 1Q81Q 3K4AA 1X0TA 3CCVP 2W2IA 4CDXC 1A3KA 4AEKA 4YM0A 1UN1A 2EXJA 5EPAA 1WCDJ 2W91A 4AFMA 1BJQA 4KI5M 4LO4B 1FJKA 1ENRA 4B7EA 1QXJA 2M5AA 1SMVA 2P3YA 1BGYD 2HWC1 5EJZB 5A3NA 1WKYA 5L9BA 1BEV3 3AE2C 1OOPA 1ZRCA 4QX5A 3TSIA 3M9HA 3N7NA 2B5HA 4UFHA 4LBMA 4XXAA 4PDWC 4A3XA 5AVUB 1UAIA 1RUH1 2R7EB 5APQA 4TLFA 3I3EA 3S5AA 4N7IA 1ND3C 4GULA 3KCXA 3LW5H 4HT1T 4BK4A 4YXDC 1JCDA 1BEV2 4UB8E 1GNZA 4LHKA 1G6NA 2ZZQA 3WLUA 1WBFA 1GOFA 4IFFA 2WTYA 4LIVA 1KMIZ 1PZ9A 2VMFA 3HEIA 4DS0A 3Q9OA 4PF5A 2VZUA 3KSCA 1CZQA 3NVCA 3OBAA 4MSVA 1FDOA 3M9BA 3ZYJB 2I74A 5L9RA 1DIPA 2V72A 1P84D 1SQQG 1SQPJ 2K1AA 5DABA 1OUXA 3AE3C 2D97A 2P17A 3A7QA 1RUG3 4CU8A 4JAAA 2RS53 4RR3C 1D2SA 3OGVA 1ZRTE 4COUA 1VDFA 3VKFC 2JDKA 4B8EA 4HKWA 1GTWA 5AVPA 1J1DB 1PGW2 3JB4C 3A2AA 1YI9A 5FBJA 4I02A 4UB8H 4P00B 3GF3A 1LRHA 2UURA 5E89A 2HWB1 2N1TC 1HJ0A 2WNEA 3R4SA 2CPBA 1FDMA 1RUG2 2QZ2A 5GTHE 2RS52 3T09A 1KJLA 1NKGA 2PN5A 1W90A 1GKBA 3J7LA 1U7MA 1GU5A 1HTLC 2X5IA 5HCHA 4UFMA 1C5HA 1UOBA 4XFGA 4NIHA 4EQVA 1BMV1 2ENRA 1J2JB 5CA6A 3WNNA 4UFJA 1GDTA 4LKSA 2VZTA 3A4UA 3MW2A 2WFF1 3E1IA 1OH4A 5DMYA 2VZPA 2IFRA 1EAH2 2BYVE 1CQ9A 1IFMA 1W0OA 4GAZA 1P84I 3GYDA 4JQ0D 1XU1A 1MVQA 1LWUA 4Q4V1 5ANQA 5GTHH 4KWLA 4XF9A 2WITA 3DGTA 2FD8A 5C39A 2KM2A 3P3NA 4LOTA 4EOTA 1HJBA 2O01N 1AR93 1DQ2A 1W8TA 5EYYA 1MZEA 4KMQA 3JSVC 2AGSA 4JGYC 4P5HA 2YDEA 1W2TA 3L71J 1VP6A 3WF1A 2G9ZA 4ITCA 1NXD1 2VCAA 5KJ7A 1KQRA 1VQ9P 2FHRA 1VQOP 5B5EE 3SXWA 2KLVA 4QX3A 2P3IA 2JJLA 2V09A 2XDVA 1JI6A 2YV8A 3LEGA 1LT9A 2JG9B 1AR92 3SWYA 3HT1A 1VPCA 5K4LA 5AC93 4XJ9A 3S5QA 3G71P 3I8TA 1RUF2 5T5LA 3URFA 1DQ0A 3M0AA 1QL1A 3L72E 3O1VA 1ZRTD 5AW9B 2QNKA 4OWFA 3WDYA 1ZRRA 4WBBA 5APTA 5CB7A 1W2NA 4UF0B 2OUJA 3CHXA 3RZMA 1RQVA 5AC92 1FXZA 2XU6A 3E1F1 4PLMA 5B5EH 1SQXG 2VL4A 2JDYA 4KWJA 1KILE 2WMMA 4BDVB 4I7ZC 1T2KC 3LPFA 2WVRA 2E31A 5GZDA 3BODA 1FT9A 1JTZX 1GU4A 4HVRA 5FY9A 4QGNA 4LE4A 4XDQA 5TJHA 5B2GB 1S4CA 4AG4A 2I07B 2B8MA 2WWUA 1RUC2 4L92A 1ZYBA 2VXRA 2YO3A 2DCTA 4Y99B 4LO7A 2IZWA 3K2OA 2P6HA 2JB8A 4CEWA 2Y38A 1KQFB 5CFCC 2JD9A 4GB31 2GC3A 2JKXA 1PK6C 2P67A 1TU3F 3O1MA 3VKLA 2K9JA 1G9DA 1QDOA 4XUTA 1Y3TA 2AXCA 3LF7A 1Y8AA 1UL9A 2I45A 2EALA 1O6UA 3OGJA 4D6SA 3CLQA 1H9PA 3N3HA 3O1PA 3U59A 2JG8B 4D6QA 5FPXA 4YM1A 5AVXB 2FDIA 1CIYA 5JWPA 4JQRA 4LHLA 2ZEWA 1JODA 5BYNA 2Q0AA 4YM3A 5M1BA 5JOZA 3FXDA 2YPJA 2P58A 5FY7A 3NV3A 3WY6A 1ENQA 1WLDA 3CNAA 3LQCA 2D3RA 3GBGA 3K4DA 1L4AD 3EWKA 1UYYA 2JDUA 4D6TD 4W7YA 2PA7A 2R5BA 2C0ZA 1RUE3 3W59A 3L72D 3FLTA 2X53S 3H32B 5FPLA 4XBLA 3SHRA 4AHZA 2EAKA 2Y26A 3DYOA 4I0AA 4YARA 5GTIE 5C4WC 3A0BE 3G6JB 3NAPB 2E42A 5DJTB 3ZYIB 1HXS2 3WG1A 3HBZA 4YXWH 1GW4A 2XL9A 3TK1A 2YG0A 4ZXKA 4BQ3A 3CWBE 1RUE2 1C8NA 4ZY9A 1Y9BA 5FAXA 2ZS6B 1KILD 2ILMA 5FY4A 1NCRB 1GZWA 4A7ZA 2PGDA 1AL21 4N7UA 4AEDA 2R30A 4DRVA 2DVBA 3WU2E 2IVIB 1L4AB 5IVCA 2Y8KA 2WJSA 3VBSC 1M06G 3TN91 1ULPA 4AVSA 1LNSA 3R05A 4FXKB 1AJKA 4YPCA 1V9U1 1OFCX 4KG8A 1DDLA 4MGQA 5GLWA 3V0AB 1VB2A 3CL1A 4IETA 4QKFA 1YHFA 3LGRA 4D0QA 3A0BH 4W6WA 5K7PA 4RSUA 1B35A 4AI8A 5APYA 1AR73 4AEMA 4XQDA 1CJDA 3K3NA 4JBZA 2UWBA 1JTHA 1KILB 4YVSC 2SLIA 1Q8SA 1WWYA 4GKXA 2FFDA 2YBKA 3F89A 2BVVA 1C8M2 3WU2H 4I1LA 3BTXA 3E6DA 2TNFA 2EAAA 1UZZA 2CPSA 4YGDA 2Y34A 2FMYA 2PXJA 1RH5B 1AR72 4J1WA 3GZUC 4LLFA 5DDJ3 1GLHA 3WQ1A 3KZ4C 3S4RA 4N78D 3H1JJ 5A7SA 4EROA 1H8TC 1YC61 3ES1A 3MV11 2WWJA 3GHGB 5HXVA 5A33A 2DVDA 5TISH 1Y4WA 3I4IA 5CAZA 3B71A 2W0XA 5A3UA 2WNUB 5DDJ2 1L7RA 4JGZB 2AENA 3T0BA 3KMHA 1DZQA 3H1KG 2VW2A 1U5IA 5KC5A 2W92A 3NMBA 2CV6A 3DUIA 1SQQJ 3WR0A 3SLIA 5FKCA 5DAQA 4Y1UA 1QJU3 4LOSA 4H3WA 3P7KA 5APAA 1D7MA 1LHOA 1QQP3 5AVWB 5FUNA 3CWBD 4NHXA 5A80A 5F5AA 4AGVA 1FOD2 3AJZA 3O0XA 4M4RA 5E1RA 4Q27A 3ZFGC 4BU2A 1JY3O 2VW1A 4QPGC 4GWNA 5A3LA 3J8F1 4FTEA 3UGFA 3H1HJ 4OHXA 3WOGA 1QJU2 1UY0A 4F83A 2Y6JA 4BOWA 1VQMP 5T5OA 3H25A 1S55A 2OPWA 1PNGA 1TMF1 5CBOA 2GDFA 4Y4RA 1G2CB 1VQ4P 1KD7A 4BMBA 2OS2A 3EFGA 5FPBA 4F8AA 2BUKA 4Y5Z0 2BNNA 3ETPA 4XF1A 4ZU5A 2HEYF 1T3UA 1HX6A 1MS4A 2VCBA 4MGKE 3L9JT 4AQ2A 1LGBA 3JCUE 3O1TA 1NHLA 2B88A 4H13C 4K21A 4U3FE 3WQ7A 3U1AA 3U37A 4PDWA 5EV7A 4EYYQ 1IS3A 4GWJA 1L0LE 1ODNA 5KAFH 4UBHA 1RHI3 1ND3A 1SQVE 4E9KA 1GP4A 2KXLA 3RZZA 1N73C 2W6JH 3RNSA 3L73G 4K1ZA 5IHRA 4EZHA 1NT0A 4C7NA 4O9GA 1XXNA 3WXPA 2WPQA 2OYHB 3BCCG 3B69A 2RN0A 1NYWA 2GUVA 4N53B 4WVWA 2E76B 2Q1MA 3R4YA 1H0BA 1MS1A 4NIAA 1OQ1A 3TEZA 1RHI2 4RL7A 4IV3A 1M90Q 4NAOA 2BNMA 4PV1B 1FZEA 3IN9A 5C7GA 1DG6A 5EQUA 3ALQA 4QPIB 4QDQA 5FMCA 5J37A 4KBBA 3ABZA 1OD5A 4A2UA 4ARXA 4YFWA 4M4PA 4NIIA 1US3A 3I97A 3TF5A 2OQ7A 1UF2C 1FZGA 3AZZA 3B9CA 3HD8B 4GH4B 4E2GA 2OUHA 4OVNF 1R083 4I3PA 1FMD3 1XB9A 1ZBE1 1BCCJ 2HWE3 5E79E 2TBVA 4BXSV 3BRTB 2N1TA 1QX8A 3NL1A 1REEA 2ZOEB 3T1LA 4O65A 3KPEA 3VBRA 3FMGA 4WM7A 4ZHNA 2QE3A 1VRH3 2N9BA 3CQOA 5LBBA 3AYAA 3VDBA 2IX7C 1R082 3OGGA 3LFMA 1FMD2 1NTMG 3B5ND 1H4GA 4L11A 5IVBA 4L97A 2HWE2 1HGVA 1UU5A 1LP1A 1MFZA 4BHPA 2VBBA 2VNOA 2N9YB 1OW6A 4AI9A 2OKXA 4CP2A 1CGPA 5EXOA 2JWDA 2D6LX 3AYCA 2WT7A 1VRH2 1O4ZA 4YRDA 2KLUA 1XSRA 5E79H 4MUVA 1S0JA 3PL0A 1N3PA 1S5LE 4U3FD 2KUBA 5I8SA 5FWEA 4C46A 4EWDA 4R9CA 4WM8C 1LOFC 3MUDC 2XKOA 1L0LD 5FZMA 1OIPA 4URAA 4CCOA 1SQVD 4OHYA 2W9XA 4NRPA 1OX3A 1NZIA 2E63A 5APWA 2BTVC 3BIWE 5FMOL 3EJKA 3B5NB 1AR82 1ND2B 1LNQA 5BU5A 5FZ9A 5FZIA 1DGRN 3WQBA 3ZLIA 4Q4X3 3U4SA 4J1XA 3BASA 3P8CE 4C91A 4OI0A 3U1CA 5HV4A 3ZFEA 3RWKX 3O0WA 3APBA 5I0RA 1BBT1 5CJ4A 3CCQP 3GZTB 1XE0A 4Y28J 2BGCA 1W6PA 3L70J 2TEPA 1VAVA 2BEOA 2ZFCA 1L7QA 4F3JA 2PHDA 4LITA 2C5DA 4RJTA 4CCDA 3TGUE 3VUOA 2WAOA 1WLTA 3S6PA 4Y1XA 1ZXGA 5IW0A 2W83C 4ZKTB 1XNCA 3ZVXA 3B00A 5T5JA 4ZKPA 1Z56A 1YBKA 2X29A 1AYN2 3LEMA 2ZXXA 2BASA 2W08A 3HE4A 3Q3DA 2QJPC 1JMUB 3MHVA 4WWIA 2A6VA 2EIGA 5EHDA 4GXLA 2Y6FA 5D8AB 2V4VA 5BU8B 2PHLA 4KG0A 2PTMA 1DYKA 1M1KQ 1Y47A 1IK9A 2RDQA 3USSA 1SQQD 3D6YA 4CDQC 3N9OA 5SV5A 1YJNP 3MF9A 4QHZA 4FPEA 5DUWA 1T6GC 3RZGA 4CP9B 3EQ2A 2P34A 2XVGA 2VNVA 2CGPA 1QNWA 2IYPA 3H1LE 3POWA 2A45H 4EZ4A 5FXWA 3AP9A 4UFIA 3TNUB 5HI0A 1Z7S1 1HRI2 4IL7A 1FYUA 5CYYA 4FVVA 4R52A 3MGNA 2RR11 3A0KA 4RS5C 3C8XA 3VD4A 2QQLA 1PK6A 4YW3A 1QJFA 4UFKA 1TG7A 5AVZB 4KNCA 1OFNA 4TN7A 3HTKB 2R44A 1SQXE 1ASJ3 4Y3OA 1VBD2 3C3VA 4Q4W1 2WSCJ 1CONA 1LENA 2K0GA 4ZU4A 2A06G 1F5JA 1K73Q 4LHNA 4QX0A 2HFED 3EO6A 2P1JA 3QACA 3EYPA 2LW8A 3FLPA 2V7QH 5BNPB 4QDSA 4OMDA 3P8CD 1LODA 3U11A 1ASJ2 5KKZB 3ITKA 4GT1A 2GC2A 3V4QA 1L0LK 1AXZA 1NJIQ 2W68A 1MQTC 3PHLA 2IXIA 3K77A 1O5UA 1SQVK 4EDFA 1SPPA 5AW1B 2P3JA 2XWJB 4A6OA 4Y22B 2E53A 1FZFA 3GZEA 2FY8A 2R6QA 4UW4A 2I2SA 4FPCA 1QNYA 3WCRA 4FOYA 2BCCG 4X8PA 4R9DA 2R071 3NNMA 1QVFO 3POEA 3WDWA 2DV9A 2DCZA 1CAXB 1HRV2 1VBA3 1KZUB 5D1IA 5C4WA 1UXZA 1PPJE 3RGUA 4LKDA 5J48A 3H1MA 4XILA 3OPTA 2XJUA 4YZ2A 1VBC3 3HN1A 3PURA 1GZCA 2VCMA 4HK8A 1KDKA 3IN6A 3N7MA 2J1EA 3D0SA 1SFYA 1GK6A 5F5CA 1JZ4A 1JYCA 2WLQA 2VULA 2W87A 3WUTA 3EMRA 1HB1A 3AEAC 2HWC3 1VBA2 4JQTA 5FV3A 1ALYA 2WDBA 4OHWA 4K6BA 4Y24A 4RHV2 4BQ2A 2VR4A 3SCHA 4XZUG 4MLOA 1N8RQ 2JDMA 4LLOA 3J7NA 1QXRA 5AVAA 1FV2A 5FJKA 5AVQB 1RUH3 3M7AA 2ZMKA 1PX4A 1PNFA 1F31A 2K46A 3CZUA 4XTMA 2M0BA 1GWLA 2HWC2 3POYA 3NQHA 4FPGA 1SQQK 3TNQA 3UKTA 2RM23 1Z78A 2FXOA 2VMCA 2YMKA 1JUHA 4YVSA 4BQYA 2D7FA 1NQJA 1HF9A 1SQXD 4AW7A 4QQPA 2PHWA 3T97B 1RUH2 5F5QA 2A45I 5IK4A 5E88A 4DCKA 1W99A 3AE5C 4HOOA 3RDIA 2CAVA 1NE4A 1BHGA 5C3QA 2CDPA 2XJPA 1N1SA 3FHQA 2KA3A 3PMSA 1A34A 1NA1C 2GNBA 3I59A 3I2GA 2D2CC 1J1DC 3RZLA 1VALA 3FL7A 2XL7A 2J7MA 4HKOA 2QIWA 4E4DX 5FR3A 2NMNA 5T5PA 4V1PA 2HWB3 4AYCA 4FPLA 4DO0A 3M70A 3HRNA 2OVUA 5DAPA 2KSJA 1U0AA 4A45A 1QOSA 5AVVB 1VB4A 1AVOA 2YC0A 3OYWB 2A6YA 3NV4A 2QJKB 1SQBJ 1H2KA 2ZPXA 3JD71 3L75G 2PRRA 3SFDC 1EDLA 4CUAA 3VDDB 5L7OB 2JD4A 1YQ4C 1W0PA 3RVHA 2HWB2 3ZFGA 3AP5A 4QPGA 3Q5SA 2XWBB 3U14A 3H1WA 3B01A 5ABJA 3ZMNA 4FAHA 3N9NA 2WFF3 1XNBA 3OUHA 2K3RA 3PDQA 4YNIA 4N43C 3WP6A 5H9PA 1XTCC 3H1IJ 1KITA 1TZOA 4Y1VA 4AFCA 2FYUG 1JOJA 1CJPA 2PQSA 2HEVF 2VJXA 2ZMLA 1BMV2 4AQRD 1WZXA 1OZHA 1CAWA 1NQDA 3H1KE 4CP1A 4YW1A 2KNCB 4R4ZA 3S7EA 4L9BA 2WFF2 1N7SD 4C1XA 4RN5A 2RDRA 3NKTA 2JB4A 1V6NA 4DPNA 4LBJA 1OLMA 2C9AA 3Q2YA 2YBSA 3KWVA 3POBA 4NUBA 4I3GA 3E7KA 5J3UA 4HN1A 4Q4V2 2WUHA 3ZFFB 2VNRA 1GMJA 3LD8A 3J7MA 2JG9C 2XJRA 1NUKA 1V6KA 3N9QA 2R1BA 3LIEA 1CESA 3MUY1 2Q8EA 3WUVA 2LKMA 2WT2A 1ZN5A 2ERFA 2ADEA 1PGSA 1GMMA 3PIGA 4IL6X 2WNVA 1OXZA 3EFFK 1HB2A 3WG3A 5LEJA 4EJRA 2YFZA 4XQ4A 3WMM0 5JXGA 1SQXK 2P2UA 2K37A 3AVSA 1GL2D 1HV0A 4AFBA 2OARA 5LBCA 3BI3A 2ZEXA 3AMNA 3VD5A 1EC5A 1X22A 2O1QA 2XNDH 3RS6A 3L2YA 4JRLA 2ZYGA 4CXYA 1KS4A 2QQUA 2HPCB 4XFFA 1BE3G 1M4WA 4QQ2A 3DKWA 5FQ0A 5IFTA 3PUAA 2IXJA 4A7YA 4MZUA 2HWF3 3N7KA 2ZHLA 4EWAA 3B94A 3ZX7A 2ZGLA 2MKVA 2XV5A 3BCWA 1K5MB 3WW2A 3CKHA 2OQ6A 5L9VA 4BZ4A 3HQUA 4C0HA 1YWKA 2O8OA 2O1JA 2HODB 1RMU1 3PJYA 4D7YA 4O7XA 1NWQA 1HH0A 4NO4A 4Y99C 1W2EA 1WD4A 2WC2A 1GL2B 2ZT9D 3L73E 1ULDA 4JCKA 3NNGA 1FPN1 4CCLA 3BCCE 3HIFA 2GMEA 3JU9A 5AW0B 4GB33 1Q3EA 3ECQA 4HYTB 2Y60A 4PF1A 5FOJB 4KJMA 1JW6A 5FK8A 4DOUA 1YJLA 1K12A 4ES9A 1R8EA 2Z4FA 1NTKG 1L7LA 3H1KD 4FPHA 1GV9A 2HBUA 2XDJA 1GZTA 1IZNB 3H3LA 1CZVA 3II6A 5FUIA 2YZ4A 2LS6A 1MACA 1UKRA 1BSNA 3W5NA 4OUSA 2JG8C 4NHMA 4GB32 4GD4A 1JHJA 1NVOA 3FLRA 3Q8AA 1AF9A 1FAYA 1AX2A 5FLJA 2WT0A 4GALA 2ZT9B 1K04A 4JX0A 1W8OA 2V4AA 1DQ4A 1FX5A 4K8RB 3C7HA 5CVRA 3PIJA 1NCQB 5J36A 3AX4A 2RKLA 3AE4C 1D7PM 5IATA 4WM8A 1FZBA 1LOFA 5AVTB 3ATGA 4DFSA 2P7JA 3VMZA 4W4ZA 4JZRA 3I3DA 1ZVFA 3RK3C 1A6CA 4ASKA 1PZ8A 5FZ1A 1A02J 3CC2P 3HMYA 1LESA 5K0UA 2YU2A 1J58A 2JENA 3SEEA 3KQRA 3ZXLA 4PQQA 3NJYA 1NTME 5FP7A 3AB0A 3NAPC 5CCGC 4BCUA 2YU1A 1VQ8P 4HZFA 2Q30A 2QQKA 2H43A 1N3OA 3IWZA 4JVAA 1VBE1 1AUYA 3GGLA 3IDCB 1COV1 2XOMA 1NCRC 3GBWA 3VGIA 3ZSMA 1FZAA 4IEUA 3RG0A 1LGCA 1IO4A 3A7OA 1AL23 2X8KA 1RUOA 1L4AC 5A1AA 2HJIA 5AW5B 1SHWB 2W1QA 3C1LA 1PIXA 2C4XA 1XNTA 1IFJA 2O01J 1JCCA 1EDJA 2Y9YA 5FZOB 5BUVA 3RZHA 1SZBA 3AE1C 2MNGA 3L73D 5FYSA 2YGMA 3SCFA 2IC1A 3U75A 1AL22 4AQTA 3BCCD 2YFUA 2DYCA 3H1YA 3DN7A 3NMDA 4NPDA 3M06A 2QQIA 4B7KA 4QGLA 1NTZJ 1RC6A 5C8CC 4E4ZA 3TN92 5LA1A 3DEMA 4O9EA 1URQA 1V70A 4XETA 4CDQA 1OPMA 3VBFA 1I9RA 1V9U2 3O6QA 3WNPA 4QQLA 2DDUA 5FO8B 5BNNC 1KEXA 4FPYA 4MH0E 4P9JA 2E75D 1PGL1 2WZPP 3H9AA 1QH7A 1X7NA 1LGHB 1NAEA 4XBNA 4HPKB 4MV2A 2H0VA 3IKWA 4RS5A 2KD7A 2QEXP 4FXGB 5IYYA 1CR7A 2A70A 5C3OA 4Y20A 3KQGA 1W3VA 3MIHA 1QHDA 1RL3A 4BWOA 1PGJA 1NU1G 2WNUC 1Q5OA 1CAVB 1BDDA 5GZGA 1LT9B 1OHFA 5F32A 3P32A 1RUD1 1AXYA 4OLLA 4IE7A 3KT4A 4ZZ5A 1J3RA 1EP0A 1QEXA 1NTMD 3PVBB 1Q43A 3I7DA 2E75B 2WRAA 3RYRA 3OD0A 1PP9G 3M1HA 4AI1A 5GJ6A 4AK3A 1REDA 4Z92B 3O1OA 4KGQA 3ELNA 1QL2A 4D3WA 1MQTA 3KF5A 4BB3A 2YXSA 4LGDE 2YB7A 3BYWA 3EHKA 4EN8B 2VOXA 4LO6B 2PHTA 1AYM1 3AMQA 3J8F3 4S2FA 1USDA 2D5FA 2AEZA 5LA9A 5KBFA 3WUUA 1IKQA 1S3JA 1QJY1 5JXIA 2V5YA 4CP0A 1UX6A 4ASLA 5A6XA 3ZYRA 3OF1A 2MJZA 3HD7D 1H0TB 5C5UA 1ONAA 2A06E 5C3RA 2UWJE 4XFAA 1S0CA 3LOBA 1P8JA 2ZGOA 1TMF3 3AK0A 3J8F2 1M1JB 3CJIB 3MFCA 4QB2A 3NNJA 3L75J 4E4HA 5F39A 3AYEA 5APUA 5JI9A 3J9SA 1BZWA 4LHSA 1GANA 2J1VA 4ASVA 1FZCB 4WZCA 5F5IA 1FS0E 4HB1A 5CCHD 2X5IC 1X9PA 2HLOA 1Q86Q 3MLKA 2B9BA 5FY0A 2IXLA 3N7JA 1TMF2 1PMIA 4FCAA 3VYIA 4I2OA 1IPSA 3WDTA 1I6XA 3TEXA 4LA2A 5KLVG 2XLGA 3VBHB 1JB0J 3KF3A 1J3QA 4NWWA 3IDBB 2VC9A 2B4KA 1XE7A 4XUPA 1NLSA 1UYZA 3AE9C 5ANNA 5KHIA 1R1ZA 1S0DA 4N53C 4QPWA 4CCCA 5FYUA 3BTYA 3T30A 5DAXA 2BZDA 1G1JA 1F8VA 3PU3A 2N7GA 1V6MA 1VF5D 1RJ8A 4C90A 3KZIE 1OQDA 1KN7A 1FI2A 4OUMA 2CNAA 4Y1YA 4XF3A 1AX0A 4A44A 3H50A 3BVCA 3WSOA 1GNYA 3G7DA 2ET7A 1WMDA 1SCSA 1LOAA 5KLIB 4HN0A 2ZZJA 4ISRA 4XURA 4IW3A 4Z07A 4IOIH 5AW2B 3CMGA 4GWIA 4HANA 3V2NA 2DU1A 3R2PA 3BVHA 4FQZA 5C71A 2IBZI 2Y64A 5FZLA 2WIIB 1W2OA 3ROUA 3FN9A 4HETA 3D6ZA 5JMOA 1ZBE3 1H1IA 1Q8VA 5AVRB 1VMHA 3NJXA 2JKVA 4AOCA 3AL6A 1NTMK 3LIGA 2AC1A 1GZWB 2XNXA 3RJRA 1VF5B 1BK1A 5LB6A 3CEWA 3IAOA 3UKVA 2XBO1 1MZFA 2A06D 2J1SA 4BJ0A 3AEBC 4CU6A 4Q8KA 1X8YA 3IT8A 4XJZA 1ZBE2 2JDZA 4OI4A 2JEEA 1F5FA 4W6XA 1JY3N 3T3YA 1BGYJ 5FLIA 1B09A 1NAYA 1LOBA 4FFGA 4E8DA 4COVA 2ATFA 4NAMA 3U07A 3RGBA 4S2GA 4ZONA 1FV3A 1WCUA 3NV2A 5I0UA 2VPVA 3NFQA 3ETQA 1QGKB 4HSJA 3MFAA 5FZ0A 4S2HA 2JO1A 4DT0A 3POIA 4QD2A 4CDUB 1X79B 4KWKA 3FHAA 4I0WB 1VLNA 1ST8A 3O7OA 2BCCD 5LCWL 1MV8A 4Z82A 1UPSA 4CEWC 3B5NC 2YYOA 2CL2A 4UBGA 1D4M1 1ND2C 3PJSK 1J59A 3S1KA 1S2EA 2DU0A 1F4HA 3NSTA 2CY6A 3B7MA 1LCLA 1J84A 5CIRA 4RYDA 1TNFA 2BJSA 3AKTA 3AEDC 1WMFA 1QLED 2JG9A 2WZR1 1OLRA 1YHQP 3RL0C 1R091 1BBT3 1Q8QA 4F7ZA 4IE5A 4IE0A 4Q2FA 1YI2P 4M00A 1UNBA 3RZKA 4NRQA 2CWSA 2JR8A 3IFMA 2Y6KA 3GDBA 2QDRA 1GICA 2GZWA 3L70E 2YO2A 3PH0A 4UF0A 2WQZC 5FYHA 4P5YA 1JBCA 3CXHD 3AMPA 3E6BA 3K75B 4BM8A 1OSGA 2WWWA 2JKBA 2XH6A 4PLOA 4Q0VA 5J7MA 3PU8A 4UXAA 3IM0A 4XFCA 1XOYA 3CCUP 1U5ZA 1IHMA 1E57A 2CWMA 5EYXA 5FJHA 1NE6A 4M3CF 2W8ZA 1RUJ3 4FOVA 1SLAA 3IAQA 1CWPA 3AVRA 3AZWA 5C8WA 2IVJA 3HN3A 1VAMA 2WR9A 1RB8G 4PI2A 3N35A 4GOEA 4GMP0 2FKWB 2ZCWA 2HWD3 4AEDC 2VVEA 5FK7A 4YW2A 4CDXB 1N47A 1Z7S3 1VAKA 2EVXA 3NO8A 2RR13 5FZFA 3IBMA 3WF4A 4AVBA 3EBRA 4CXWA 2VZSA 2FDGA 5GKAC 1UY2A 2VW0A 1E5SA 3C7GA 5L19A 2OXBA 1R5SA 1BE3E 3WP4A 4ORFA 3PUQA 4P02B 3AECC 2AYHA 1V6LA 4YZ3A 4Q4W3 5A1LA 3PUIA 3LKJA 2YPDA 1US2A 2GH2A 2JG8A 2RR12 4MXWB 1HLCA 1B35C 3VDAA 3WP5A 3LCPA 3L75D 2A5ZA 5BNPC 2Q1FA 1WUVA 5IVJA 1W28A 3H3UA 3VZKA 1KTMA 3RSJA 1DGRA 2JP3A 3DPRB 3CCJP 4K7JA 1VL2A 3GW6A 2DW3A 2WS93 1W9YA 1JY2O 3OD4A 3L74G 3GHNA 2Y0EA 4FT8A 4Q4W2 3VKOA 4XJ8A 4CPBD 1GWKA 3OBTA 5I0TA 1KORA 2WSFH 3ZDMA 3NNFA 3HOBA 2FYUD 2QQVA 1CAUB 3T2QA 2Z79A 3H32A 3JQWA 2ZAEB 2GALA 1APNA 3Q8EA 2H6BA 4IGPA 1SFCD 5IAVA 1NTKE 3FJSA 5DZEA 2R073 5A3TA 3NAPA 2WINB 4RR3B 5FO9B 2VOKA 1AQ5A 1W9TA 5JMCA 5B66E 4OQ9A 4C0BA 1KQGB 3BRVB 5A32A 2ADDA 1OVUA 1OWAA 3D5OA 1JO5A 3E1RA 1NCRA 3E5XA 1LECA 2ZEZA 3TYJA 5FZ3A 1S0EA 4LLHA 1GK4A 1BK0A 2AEMA 1YYNA 2ARAA 4XJAA 2ZGKA 3N9LA 3CU7A 3H7YA 3FXEA 2BDRA 1CN1A 1L4AA 4XQWA 1DD3A 3THCA 4M3CE 1N86A 2KSEA 1VBB3 4P9LA 1X8MA 3R4DB 3QOPA 2J42A 3MIGA 3F5HA 1SFCB 4DXTA 1MS3A 2CK3H 3V0AA 5LA0A 3NRUA 2I1KA 3E5UA 4CCNA 3E6CC 2A1XA 1W5CE 4GJYA 2D3SA 3UK9A 5B66H 3VKNA 2AEJA 1C4RA 1JMMA 4R4MA 5JLVA 1KILA 4FI9A 3PUHA 1LEMA 1BE3D 4XIKA 1EQ7A 4JDNA 3OBZA 1N1VA 3BUCA 1JMBA 1VBC1 3MD0A 1GBGA 3M3EA 2VQ0A 5BNNA 1WA4A 1W06A 3AKPA 1RIRA 2W1SA 2FMDA 3OEAA 4H44D 2PFWA 1TQ5A 1QJX3 4JGYB 1KQSO
chains in the Genus database with same CATH topology
1KDMA 1C8M3 2W08A 4GQ7A 3ZXGA 1OA3A 1RUI3 2VGDA 4QPYA 1AX1A 1N3QA 2VQAA 1BVVA 1WW5A 1JEKA 2XUMA 4LR4A 3VZJA 1G9CA 2A6VA 2EIGA 4GXLA 1AXKA 5D8AB 3V0BB 1U12A 4KU7A 2PHLA 3O0VA 3M8LA 4KG0A 2RS13 5BXXA 4DINB 2PTMA 2WNUA 2XJVA 1SBEA 3KT7A 1DYKA 2OZJA 5KHHA 5F9TA 1AR63 1MS9A 2VY0A 2XJTA 1RHI1 2AUYA 5KC6A 2GH8A 4XXPA 1HQWA 3USSA 1EV12 4CDQC 3RYPA 4AF9A 2B46X 5C8CB 5SV5A 3AZYA 3N7LA 3ZPYA 4B3NA 3B3QE 4CDUA 3MF9A 3PNAA 4OHZA 4FPEA 5DUWA 2NP0A 1T6GC 2WNVB 3MLLA 2ZMNA 4YYOA 2P34A 1Q8PA 2RM21 2XVGA 3INAA 3MGUA 1RUI2 4COZA 1IOAA 1RVF1 2CGPA 1QNWA 2R0FA 2D6MA 2NQYA 3POWA 2Z69A 2HWF2 3AP9A 5BNNB 1DF0A 1ENSA 4EN6B 3VBOA 3AKQA 5HI0A 1Z7S1 1HRI2 3GF6A 5L7OC 4IL7A 1FYUA 3JD73 1YJKA 4FVVA 4R52A 2R49A 1YO8A 1ZNPA 2RR11 3A0KA 4RS5C 5KHGA 1AR62 3B02A 1ZBA1 3BPZA 1TME1 4H14A 1DZTA 1PK6A 4D7SA 2VVFA 4Y22A 2LTNA 4YW3A 4IV3C 1W6NB 4E27A 4PBOA 1RUD2 2ZGQA 1WD3A 1NXMA 4KNCA 4Q0UA 1OFNA 5IK7A 4XFBA 4LBQA 5H9RA 1OOPB 4FBFA 4AI3A 3TAYA 1YFYA 5FQ0B 1ASJ3 1XNDA 4N43A 2OZ6A 4DJGA 1VBD2 3C3VA 4Z1VA 3VHRA 2P37A 2EF6A 4Q4W1 1CPMA 1ZZ9A 1CONA 2WQ4A 1LENA 2K0GA 2DUPA 3AKSA 4Q0QA 4ZU4A 4YGEA 1F5JA 1FOD3 1UMZA 1QH6A 2GC1A 1H8VA 2BFUS 3WUDA 4LHNA 3E97A 5IT6A 1QWRA 1ULCA 2E6VA 3EO6A 4N90A 3AKRA 1G9AA 1R081 1PM7A 3QACA 4IXLA 5HCAA 1DGWX 1FMD1 4LUMA 2EA7A 2HWE1 1DIWA 3FLPA 4FSJA 2V7QH 2D6OX 4CDWA 5BNPB 2YROA 1CVNA 1W6MA 1DQ6A 2QUOA 4YFZA 4MVTA 1LODA 5C9AA 3U11A 1ASJ2 4NWVA 1SFNA 1ZZBA 2PHRA 2ZACA 3ZN6A 1LHUA 1BXHA 1SLLA 2GC2A 2ZKLA 2Z5WA 4COWA 1AXZA 5BY5A 1OQEA 4XJUA 4EN7B 1VJ2A 3VBRC 5LRSA 5CFCB 2W68A 1MQTC 4WM7C 2IXIA 1PIV3 2G9FA 3PLQA 1O5UA 2V73A 1VRH1 5K9YA 2P3JA 4PJYA 2NZ9A 2XWJB 1GQGA 4Y22B 4WVZA 4JTNA 2JE7A 3VLBB 4ATFA 5JZGC</