3USSA

Crystal structure of cysteine dioxygenase from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure, Kinetics and M ssbauer Spectroscopic Studies of a Bacterial Cysteine Dioxygenase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Putative uncharacterized protein
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3ussA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ussA02
2XNDH 3LZZA 2ZKLA 1JUHA 1CAXA 1DZRA 3UKVA 1UW8A 5E16A 1OFNA 1EYBA 5BY5A 4Q0VA 3H7YA 5BV6A 3EBRA 4XFGA 4HMZA 3USSA 4YNIA 1CAUB 3D0SA 2Q30A 3IDCB 4HN1A 2Z69A 3OD0A 3GBFA 4I0BA 5E1RA 3H3ZA 2UYBA 4WZCA 4UBGA 2Y0OA 2PHDA 4QX5A 4IEYA 4XFFA 5BPXA 3H1YA 4YRDA 3RZZA 1DZTA 4AQ6A 3LA7A 4L11A 3KGZA 3OTFA 3PLQA 4PJYA 1E79H 1PMIA 4OFGA 3MDPA 5KHGA 3MZHA 5FLIA 2KXLA 4IEWA 1O5UA 4E2QA 5FPXA 1CAVB 5I0SA 4Q0SA 5K8SA 2O1QA 5JR7B 4RD7A 4KWJA 3QOPA 3PJSK 4KWKA 3QACA 3B02A 2ATFA 3E6BA 1XRUA 3MYXA 3ES4A 3E5UA 3SCGA 2CGPA 3GYDA 1Y3TA 2XKPA 4H7LA 4I09A 4GULA 1NE4A 2K9ZA 3H7JA 1FT9A 3M3IA 4IEOA 4WBBA 1O5LA 1X82A 4HZFA 3BCWA 3I54A 3ACLA 2D93A 3I59A 3ZDSA 3SXWA 1JEKA 1IPKA 1UD1A 3IIAA 1NYWA 4I01A 5CVRA 2UY9A 1OD5A 2XL7A 3BPZA 4F8AA 4QGNA 3BALA 3SCHA 4MV2A 3KCCA 3U11A 1BSHA 2IXKA 2B9UA 2UYAA 1EPZA 1QWRA 4Z82A 2V09A 3EQEA 2HKXA 2GC1A 3ELNA 4XF3A 2BNMA 4XFCA 5EZWA 2VQAA 3G7DA 1O3SA 5JCTA 3FZ3A 4O9EA 4BYYA 1UPIA 3CF6E 4LUMA 4XFBA 4YSFA 5LEKA 4AVBA 3EHKA 3IBMA 4MUVA 2XLAA 3NKTA 1I5ZA 3CJXA 2XGXA 4UBHA 4E2GA 1ZRDA 1ZZCA 4IEPA 4FT8A 1GQGA 2BNOA 3NL1A 2XL9A 2VECA 3IWZA 1Q5OA 1RUOA 4P9GA 1J1LA 2IXCA 4MGYE 1X8EA 4O9GA 2UY8A 1Q3EA 3CEWA 1AQTA 2XKOA 3DL3A 3LA3A 3ETQA 3H9AA 1I6XA 2PAKA 1SFNA 2GH2A 1NE6A 3FE5A 4QM9A 1ZZ9A 3H1MA 3JZVA 1ZX5A 4KU7A 4R52A 4AVCA 3VHRA 2V7QH 2ET1A 3HQXA 4FAHA 3CLPA 1ZRFA 1YHFA 5F1RA 3KMHA 2PTMA 2JDIH 5FLJA 1QY4A 2PAMA 5AVPA 4ONUA 1YFWA 3C3VA 4IEVA 5I91A 3S0MA 1ZZ8A 2E9QA 4HLTA 3EJKA 1J3PA 1YUDA 1ZREA 2Q1ZB 4XEZA 2XLFA 3NVCA 5EFUA 1HW5A 4JTOA 2P17A 4I0AA 2E5YA 4Q0PA 5BUVA 5KBFA 1VP6A 2DCTA 3D82A 4MZUA 4Q29A 2Q4SA 4D7TA 3D0JA 5LRRA 3I7DA 4AQ2A 1X8MA 4BIFA 3EO6A 5FPZA 2OPKA 3LA2A 4AXOA 2OZ6A 1DGWA 3CL1A 3RPQA 1OI6A 2QVSB 4ZU5A 4HVOA 5I8YA 1CX4A 4DINB 2XLGA 2C0ZA 5KHIA 2CK3H 4I3PA 4OLLA 3IDBB 1O7FA 1TQ5A 4BHPA 5JSRA 4X6QB 2GZWA 3N4MA 1RTVA 4HVRA 2D5FA 2D40A 5HI0A 1Y9QA 4HSJA 4HN0A 3OCPA 1RC6A 3FJSA 4XFHA 4EV0A 3PNAA 3U0ZA 2PA7A 3M70A 4FBFA 5I0UA 2F4PA 4DJGA 3RYPA 4MH0E 2QCSB 1RL3A 5KHKA 2QE7H 1UCXA 3UKTA 5D1IA 3R6SA 2GC0A 1RGSA 4TLFA 3FFQA 2OZJA 2N7GA 5LEJA 1OMIA 3DN7A 3OGJA 4QM8A 3E5XA 4XETA 1QXJA 2ETEA 4EWAA 5C6CA 4XF9A 3KGLA 1ZNPA 4JVAA 4ORFA 1LKNA 2O8QA 4L2NA 4XFAA 3MPBA 4IERA 4Q0QA 1EY2A 1CAWA 4XFIA 4PIYA 4A2UA 4EROA 3KSCA 2B5HA 4F7ZA 4CYDA 1WGPA 2QDRA 4K8FA 4D7SA 4HSLA 2QJVA 3ROUA 5LRSA 2PQQA 1FXZA 2GC3A 4Z07A 3FWEA 3HT1A 2K0GA 4MGIE 4HBNA 4IETA 5J7MA 4LLOA 4UXAA 4QGMA 4WVZA 5I8TA 1IPJA 3NSTA 1ZZ6A 1ZVFA 3L2HA 5FQ0B 4META 2Q0AA 3HT2A 2FQPA 4AVAA 4MX3A 2WC2A 3U10A 4LA2A 2PHLA 1VJ2A 1G6NA 2E5TA 1QXRA 3E97A 5FQ0A 3OF1A 3TNPB 4LUKA 1J3RA 3O14A 2B8MA 2CV6A 2HJIA 3H1WA 1O3RA 2BNNA 1LB2A 1Q43A 5CU1A 1VR3A 1SQ4A 4LULA 4KWLA 4ZU4A 5C8WA 4IEXA 4XF4A 3PVBB 1XE7A 3LOIA 3I59B 3NJZA 4LTAA 3SHRA 2PYTA 4X6RB 3DV8A 2IC1A 2BGCA 2XHKA 1O4TA 2GC2A 1RUNA 4N9IA 3H8UA 2IXLA 2H0VA 1CGPA 4KL1A 4Q0UA 4LA3A 2MNGA 1YFXA 4I2OA 4ZU7A 1CAXB 2Z2SB 3H50A 3SCFA 3WW4A 4FAGA 1IFPA 2EVXA 2OA2A 4IEUA 2H6CA 1YFYA 5KHJA 3S7IA 2D5HA 1U12A 3EFFK 4YARA 5FLHA 5FDBA 4B29A 4JTNA 1X7NA 3LAGA 1ZZBA 3WW3A 3S7EA 4JV4A 2WSSH 2MHFA 5JSPA 5CADA 4QXKA 3TNQA 1ZRRA 1L3JA 1PM7A 5I0TA 5JAXA 1LR5A 3NW4A 1O3QA 2EAAA 4QMAA 2IXJA 5J48A 1ZZ7A 4XF0A 3ST7A 4LEJA 4N9HA 3E6DA 1CAVA 4NVPA 4J1WA 2EA7A 3FHIB 3ES1A 2PFWA 2W6JH 3H3UA 3LWCA 4PIZA 4MGZE 3RDIA 2OYZA 1ZRCA 1YWKA 4J1XA 4QGLA 5T3NA 4PIXA 1J58A 1NZCA 1O3TA 2GAUA 3FX3A 4I02A 1CAUA 1WLTA 3DKWA 1J59A 5I8SA 1UIJA 5I93A 1LRHA 1WA4A 3RYKA 4E2SA 5JSOA 2CAVA 2I45A 5BXXA 1FS0E 1DGRA 1H1MA 1YFUA 2GU9A 4IESA 4KU8A 3WW1A 3UKNA 2PAEA 2BEOA 4EWEA 4XF1A 4HVQA 3CO2A 1GQHA 2IXIA 3BU7A 3HIFA 4YYOA 4EWDA 3SMHA 2VPVA 2H6BA 1XE8A 2BYVE 5KHHA 2CAUA 5J3UA 3WW2A 1SEFA 1YLLA 3BB6A 4R8HA 2ET7A 1EP0A 2IXHA 4BH9A 1NXMA 1V70A 1FI2A 5FCCA 5I0RA 4IEQA 4MGKE 3E6CC 2QNKA 4IEZA 3E5QA 3RNSA 1J3QA 2FMYA 1CAWB 1UIKA 1BSNA 4YXWH 1H1IA 2ZCWA 2WFPA 2MPFA 3RYRA
chains in the Genus database with same CATH superfamily
2MJZA 3LZZA 1OVRA 2JENA 4KI5M 1JUHA 4D6SA 1RHI2 5KLVE 2YB7A 3NNMA 1AXZA 5DDJ2 1AVYA 1REEA 1Z7S3 1YJ9P 3CZJA 5FY9A 1JMBA 5ACA3 1FAVA 1DX7A 4KH9A 5H9QA 3POYA 1SQPK 3J7LA 4FPJA 1E57A 4FOWA 4FPOB 1W28A 2ARAA 1TE1B 2HLOA 4LGDE 1Q90D 3CMEP 2RG4A 4IV3A 2E74C 4LOSA 1KQGB 4Y99B 4HMZA 3USSA 4XFGA 3LIDA 1L0NJ 1FE6A 1HKDA 1CAUB 1H8TA 1IG3A 3AKSA 3H8RA 4GDOA 2OYHB 3WG1A 4YZ5A 1NQDA 1IJDB 5BNPA 1AL21 2GN3A 2VMDA 3PURA 1T6GC 1Z78A 1G9CA 3BIWE 5A33A 1T3UA 4WZCA 4KJMA 5AVQB 2CDPA 2WWJA 1KQLA 2H43A 1KDMA 2PHDA 4QX5A 4XFFA 1UOFA 5BPXA 3VDAA 2ADEA 5IK7A 3I97A 4W4ZA 4N8MA 4U3FD 4RQPC 1OF4A 1SLTA 2E6VA 2MEV2 4SLIA 1STMA 1UZYA 3H0OA 3OTFA 2FYUD 3WDYA 3WF0A 4OFGA 1BGYD 3FHAA 2KI7B 4M3LA 4TTGA 4Q2FA 1ST8A 4B7EA 2K9YA 4BQ2A 4RHV2 1ZW0A 1HQNA 5FPAA 4F83A 5I0SA 4Q0SA 1QF3A 3CCMP 5K8SA 3D8CA 3OGSA 4KG8A 3WP5A 2DDUA 3U75A 1SQBE 1FMD2 1AF9A 2NPSB 1DLCA 3AYCA 3QACA 4FPEA 4GH4A 4EN0A 4JGYA 5KXDA 2BV4A 1XRUA 5D21A 5FZBA 5H2FH 3ES4A 1M7LA 4L74A 1SQVD 2D6LX 1KXGA 5DQ0A 2CGPA 2FXMA 1Y3TA 4RR3C 4P9YA 4TT3H 2ARBA 2RS13 4Q27A 5FMOL 4M0NA 2GM4A 4BRYA 4E4SA 2IYPA 5JPMB 1GOGA 1O8SA 5AW3B 1HV1A 3O1TA 1NE4A 2VXJA 4B4RA 3H7JA 2WO1A 4D7YA 2DUPA 3TEZA 2BOIA 3M3IA 1EPWA 2WZ7A 3M0AA 1WW6A 3FX0A 2A6VA 2P1BA 2Y6GA 3KT4A 3IDAA 1DD4A 3OPZA 4IEOA 1O5LA 3ITKA 3K51A 2A6WA 3HMYA 4N90A 2D93A 1VPHA 3DPRB 2G19A 4FO9A 1ND2C 1QOOA 5EHDA 4GKYA 2GN7A 3FWLA 2CNAA 1PX4A 1GD2E 5JXJA 1JY3N 2QJKB 2BASA 2B9VA 1IS4A 1SFCB 1JZ4A 3CCJP 4XQ4A 4AZZA 4XMIA 4YG0A 2OXBA 3WDVA 3HEIA 3UL2A 4CP1A 1EDLA 4AHZA 3INAA 4YZ1A 3NJYA 3BCCG 4XC9A 2QQVA 2A7AA 3JCUH 2R041 2ZBJA 2HYKA 3MGNA 1O3QA 4MV2A 4OQ9A 3Q9OA 4BXSV 3ZR5A 3PHMA 1LENA 2TEPA 1SQXG 4WM7A 2XOMA 3N9LA 5CISA 1B35A 4CP2A 3E1F1 2HKXA 1N3QA 3VHPA 4ES8A 4P14A 5ISLA 5FWEA 1C8M1 2W1SA 4LBNA 1DGLA 3ZFGC 4H13B 3DF0A 2ZA9A 4QU2A 3K4ZA 3W68A 5AW4B 1OPMA 2ZZJA 1YQ4C 4AYCA 1HRI1 2HPCB 1BEV2 2VQAA 4GWJA 4HXCA 4H14A 4DFSA 2XB6C 1O3SA 5JCTA 3FZ3A 3BKZA 4Q8LA 1LOCA 3LW5J 1V6NA 3R4DB 5E79E 5AVSB 3MO4A 4LUMA 4XFBA 2EICA 3WP4A 1FAYA 3H1HJ 1AR93 1UKRA 4M3CA 5LEKA 2QM8A 1K5JA 2WL1A 3WP6A 2AR6A 2BGPA 3N7JA 4AF9A 2ENRA 3MIBA 1M06G 1I5ZA 1YTZI 4UBHA 4BQ3A 4PF5A 4E2GA 2CU5A 1VALA 1OQ1A 1PIV3 4YW5A 5A3MA 4NJ4A 5C5UA 3AC0A 2GP3A 5FMOS 1GQGA 4R9BA 3IWZA 4B86A 3FXDA 1Q5OA 1YI7A 4JF7A 4I2LC 1LOEA 1RF1C 1FNZA 4QPIA 4Y4YA 2V5DA 2ZHKA 3L70E 1BKZA 4L92A 4P9GA 2KLVA 2JDAA 4W50A 3MD0A 1OWAA 1B35C 3CC7P 1LULA 3HRNA 4H13C 1HRV1 4ONUA 5FZ7A 1WCSA 1X8EA 4O9GA 2ZT9B 1HJGA 2VC9A 4FFGA 2Q1KA 1S4CA 1N7LA 2KLUA 3CCQP 1NGMB 1BHGA 1Q3EA 3C7FA 3S6PA 1NUKA 1BDCA 2VAUA 5FYBA 2XKOA 1JY2P 4H55A 4U36A 1F2NA 2VZOA 3ETQA 3HD7C 3CCVP 2YBPA 3U1XA 4IFFA 3WY6A 3I3MA 5ERLA 4IOIH 4HJGH 1ZRTE 1SFNA 3RWNA 2P10A 4LJHA 3NKGA 4LT5A 4D6TD 5GJ6A 3L71E 2WZR3 4KU7A 4S2DA 5F37A 1ZYBA 1EUUA 2ET1A 4FAHA 5FKCA 2DVDA 1GR3A 1YHFA 2NMNA 3I3DA 3KMHA 5F1RA 2BCCG 2P1JA 2ZHNA 5C3OA 1BE3D 1CPMA 3RMYA 1G9BA 4AVTA 1EC5A 1QY4A 2PAMA 3TEYA 3KDPB 2DTWA 5DUXA 3OUIA 4AGGA 1NLRA 5I91A 3MLJA 1B35B 3S0MA 3OGVA 2OKXA 5IK4A 3NNFA 4G4FA 1UZVA 1ULDA 4R9DA 1S72P 4W7ZA 2WSEJ 1UX7A 4Y22B 3VBRA 3ZPOA 1EZVG 2WNVB 1X50A 1SQVE 3FL7A 4OULA 3Q5RA 3GF6A 5LATA 4KWUA 1W6MB 3HN3A 4Q0PA 4BLIA 4JDMA 1RUF3 3WNXA 1EZVE 1W0OA 5K0UB 1BYHA 3V2NA 1M90Q 3IDEA 4OI0A 2FDGA 2NLRA 4WY4C 3GLMA 2VCBA 2PGDA 1WT6A 4DO0A 5J96B 2R3SA 5TISH 5CJ4A 1L4AA 3AE5C 1DQ2A 4RGKA 4WVMA 4CTEA 1Z56A 3I2DA 2WT1A 3I7DA 1GFF2 1UXZA 4CUCA 1JZ7A 3MICA 4XE9A 3AE1C 4DY3A 4Z92B 1QJY1 2W08A 1VBE2 3EO6A 2OPKA 2YKOA 4GOFA 2WA4A 3DXTA 1HB4A 3GHMA 2CYFA 4AXOA 1VPCA 2M8RA 1RUI2 3CL1A 3HD7A 4OHVA 2LM3A 4CE8A 4N53C 1N8RQ 1OI6A 2QVSB 1W06A 4AI3A 4D8MA 2SBAA 4GMP0 2JE7A 2WNVC 2CWMA 4QQHA 4UFLA 4UB8E 1KFUL 1CZVA 2WN2A 2K9JA 2LR2A 1ZRTD 3H1LJ 1AX2A 1OVPA 4S2FA 5KHIA 4WZFA 3L74J 2CK3H 2OTLP 4I3PA 4EN7B 5DN2A 4CUGA 1JOPA 1WCQA 4BHPA 5FOBB 3WDUA 1S0FA 1SLAA 2B87A 3IPVB 1RUH1 1FATA 1R082 2GZWA 1QJX1 4FPLA 4PLOA 3RK3E 4UYBA 2FDHA 4GA9A 3A0NA 3U37A 1RTVA 2A06D 3JCIA 1WMEA 2D5FA 4HVRA 2RS32 3AJZA 4I3GA 1RMU1 5L7OB 1Y9QA 5DMYA 1XQNA 2W46A 3OCPA 1RC6A 2DU0A 4GB32 1D4M2 3O1MA 4V2VA 1AR92 1DGRN 2KYVA 1RXFA 4L75A 2WSFJ 4BWOA 4ZONA 3PUHA 3ZX7A 1HRI2 3M9HA 4FP2A 4LBQB 1UNBA 3I2HA 3RYPA 4QQOA 4YW3A 4A7ZA 4AFMA 1ND2A 2GNDA 4N53B 5EPAA 1W99A 3JD73 1RL3A 3NQHA 1AX1A 2JO1A 5KHKA 3I2GA 3MIEA 4BWNA 4R4MA 2JXAA 5HXVA 2MEV1 4A7PA 1QDCA 1W8ZA 1R5SA 2I74A 1IO4A 5BU5A 1G1JA 2VVFA 4GWNA 2Y6JA 2A3WA 3FFQA 3MV01 5CYYA 3M3OA 4XHBA 4BB3A 4GT1A 4LE4A 4AGRA 1PIXA 1RQVA 1PO13 2VMIA 3GDBA 2KXPB 1VRH3 4MXWB 3VBUB 4HK9A 4ZMDA 3WQ0A 3VDCA 1BCCG 4XJZA 4JKLA 1R092 2W9XA 5M1BA 3RZKA 5C6CA 5KKZB 1SQXE 1OLMA 2VZUA 3KGLA 1KV4A 1S0IA 4MYEA 2XONA 1ND3A 1ZNPA 2VBBA 5DUWA 3VL8A 3M9BA 4CP0A 1W5CE 1CZSA 1PVC2 2ZHMA 4JVAA 4LIVA 4Q4Y2 2JDKA 2BPA2 1UYZA 1GNZA 5BYNA 3GZEA 2XVGA 1JY3P 1QOTA 2OW4A 4EE2A 4PIYA 4EROA 1QJU3 3KSCA 3BCCD 1WCUA 4NWVA 3CD6P 3L73E 2E53A 2KNCA 2Y34A 1H6XA 1UY2A 2DBNA 4DB5A 1JHJA 5GZDA 5T52A 2HEWF 3GMAA 4UFIA 2K9JB 3CIHA 2QDRA 2VNRA 3NFQA 4D7SA 1C4RA 3CBNA 4L99A 2V7QJ 3VP8A 4LBJA 4Y1ZA 1VQ8P 3WDTA 1VBD1 1DFQA 4PDWB 1P84E 3VBOC 5CJ0A 1FXZA 3PIGA 3RS6A 1J1EB 2QA4P 1W0NA 2K0GA 4A7YA 1MUUA 5H9PA 4LC1A 4C8DA 2VZ3A 3ZSKA 1K04A 1UZZA 3LPGA 3OB8A 1OUXA 5GTIE 2VULA 3AEDC 5A6QA 4QGMA 5GLZA 2ZGPA 2DF7A 1EDIA 1VE0A 4GKXA 1FOSF 2JG9B 4AW7A 4EN6B 2WYSA 4PQ9A 3A7OA 1GSLA 1KS5A 1RUC1 1FJPA 2V4AA 2QDNA 3MIFA 4PCRA 4XUQA 1PGW2 4XUPA 1ZVFA 4FQ4A 3TNUB 4Z1VA 4META 1AR62 1KILC 4QKFA 5KAFE 1JUNA 3GGLA 2Q0AA 3NAPA 4RGGA 2J1SA 1X0TA 4KG0A 3P3NA 5DG1A 4J25A 2VZVA 2W1QA 2HODA 1OUSA 3PJYA 4GQ7A 3G3ZA 3SSUA 3ZSJA 5BNNA 3JQXA 3SKVA 1Q8QA 2HYXA 1S0BA 4PDWC 5AVAA 2E74D 1MS1A 2WO3A 4QPGC 1PM4A 1MQTA 5LB6A 1MPXA 2M5AA 3HUSC 1W8HA 3E97A 4CCKA 3RK3C 5DPNA 1OC1A 2R7EB 3Q1MA 1TME2 2VOXA 3OF1A 3TNPB 3LW5H 1YQ8A 1RIRA 2B8MA 5CFDA 3H1WA 2AC1A 3RVHA 5BNNC 1O3RA 1MZ6A 1GDTA 3CZUA 4AG4A 3AE8C 5JUVA 5FYZA 3ZXEA 1VR3A 2GDFA 5HV4A 1US2A 4GZ9A 4XCAA 1MZ5A 1QLED 2FBWC 1RUE2 3HBKA 1KILB 1ASJ2 4FFIA 1WMKA 4Y99C 5A3NA 3VBOA 2AEZA 4MO3M 5FP8A 4CCCA 4NE9A 1Q56A 4B1MA 4Y4RA 1NYHA 3D6YA 4N6JA 4CSWA 4PT6A 3HNMA 3N7NA 3TAYA 1LWUC 2IC1A 5FZCA 3R05A 5LBCA 3V4QA 3LKJA 3ZFGA 1NTMD 1AQ5A 2BGCA 3BN6A 4CP9A 3MUDC 3A4UA 4AGVA 3IN6A 1Y9MA 3ZSLA 1BQPA 3H8UA 5T5JA 3Q8BA 1XYOA 4DXZA 4HKLA 4WVVA 4Z2WA 1VAVA 2VZTA 1A02J 2P3KA 2WLPA 4RQPB 1X36A 3MZWB 4QX7A 1GOHA 3ZIWA 4FOQA 4EZ4A 5FZKA 2PP6A 4LA3A 2ZMLA 1SFCD 1HXS3 3AE9C 1PO12 5IVCA 3ZFEA 1AVOA 3NV1A 5BNNB 4PLMA 5A7OA 2Y0EA 4ZU7A 1KYOI 3H42B 4CU9A 1UU5A 2IFRA 1S3JA 1AYN1 3CWBG 2HWB2 4MVTA 3WW4A 5F5AA 4OI2A 2WAOA 2EVXA 2OA2A 4LHKA 5IVJA 2P2UA 1F9KA 1YYNA 1GYKA 2CL2A 1AL0G 1CJPA 2N1TB 1JU3A 1PK6B 2NPSC 2QQIA 1JTHB 1GZWB 2FDIA 3VP9A 1JO5A 1H4GA 2NP0A 3BATA 2VNVA 1VRH1 3U4XA 2BCCJ 2YU2A 3FN9A 5EXOA 4YARA 1SQQK 2F4LA 2W95A 3K48A 4QWNA 4RR3B 5FDBA 1VQ6P 2C4XA 2NYYA 5A3WA 5CCGC 2WN3A 3BOPA 3PTYA 4LO8A 1CJDA 4FP3A 3PTZA 3I2IA 4JGZA 4NMIA 5FTTC 3ZXGA 4D3WA 2WNVA 3QWOC 4LKFA 4AFBA 2VOTA 3HNBM 1RUG2 3CCEP 1PM7A 3MW2A 1T6BX 1KD1Q 4N43A 1S2EA 2BOJA 3ZFFA 1WWYA 5JIUA 4XIOA 5FXXA 3NJXA 3E7KA 2HG5D 2XKMA 2VO5A 1PNGA 2VVDA 4Y20B 3DPRC 5A7QA 4QMAA 4XTMA 2KK7A 1ND2B 1QJU1 2IXJA 3OEBA 2HFED 4P9IA 2CTVA 1SQQJ 1NTMK 3QH9A 2R49A 3OOXA 4X8NA 5DAVA 4ITCA 1H8VA 4XF0A 1RUI1 3ST7A 1OZHA 4ZZ8A 4XIKA 1LTEA 1VIWB 3OYWB 1W9YA 1SFCC 1SQPG 3V65A 5BNOA 1LJ2A 4QQLA 1CAVA 2N1TC 2NMOA 2QQLA 3KHBA 4YLZA 2EA7A 5C70A 1JZ3A 4AI0A 1V00A 3T4HB 4FTEA 3BTZA 2W6JH 4OHYA 3AP6A 5FUIA 1SQQE 2CPBA 1N1YA 2RS52 2ZAHA 5LK5A 1JYNA 3MI8A 1H2MA 1J1DC 3UIAA 3MW4A 2QJYC 3LDRA 2ZACA 1QGKB 4YTPC 4RS5A 4YGEA 1YQ6A 2YROA 2P3IA 1OLQA 3NV2A 5LWBA 4J1XA 4GOEA 1ZA4A 5LY2A 4PIXA 1N86A 4GKGA 1O59A 2GAUA 3HWJA 3ZIXA 5F7UA 5IYYA 1K05A 2J42A 4GALA 5FZEA 3S9OA 4D94A 5IAXA 1TVGA 3ZFGB 5I93A 2R32A 4XHXA 1YYCA 5AVRB 3RYKA 3TN92 3W58A 5JSOA 1NTZK 5BXXA 5C8WA 4JBZA 4A6SA 3FBMA 1RUC3 3E1IA 5IK5A 1IFNA 1QEXA 2LW8A 2WAAA 1H9PA 2PAEA 3T2TA 5AVWB 3UKNA 3WCRA 4I1LA 2E43A 3VL9A 1EXIA 1VB4A 4Z1MH 1NY72 4PJ0E 2D6OX 1G9AA 2GSYA 4K21A 4DOUA 5DDJ3 2A45I 3POBA 1ONAA 3H1LG 3GZAA 2WT7A 2DCZA 2IXIA 2QTWB 4NHMA 4NHKA 2Q3EA 1MS5A 2OT7A 1N7SA 3WUVA 3LF7A 1J83A 3UT0A 2VPVA 2ZGRA 2H6BA 4L9BA 4D6TJ 3M1HA 4FPKA 3ZOIA 2RV9A 3THCA 4OI1A 4PBPA 3WW2A 1CPNA 1RF1B 4LKEA 2LS6A 5F3GA 1GANA 3J8F3 3VKOA 3HE5B 1KEXA 2ET7A 3VZLA 2P6HA 5IVEA 1OF3A 4BH9A 5FMCA 1B09A 2ZT9C 1NTZE 3MUDA 4K1ZA 2FYNB 3NNGA 1IC2A 1WZXA 4QX8A 2P37A 2BWAA 1GOFA 2JICA 5FZ0A 4MGKE 2VUCA 2HBUA 4PV1C 4IEZA 3H8XA 2K2SA 4Y1XA 3HD7B 5FREA 3RNSA 2FMYA 2V4VA 3V0BA 2POHA 2ARXA 3USUA 2JE8A 3AZXA 4I30A 1OVVA 1WD4A 1AZDA 1H0TB 1CZQA 2ZAEB 2C9NY 1W8NA 3N36A 2OTKE 4AQTA 2RS53 4CDWC 1MR5A 2KA3A 4ZXKA 2LXCB 5GLUA 1DZRA 4AFDA 4YPJA 3KF5A 5A3TA 1UW8A 4UW5A 5E16A 5DAXA 5KAIE 4Q0VA 1FC2C 4Z2AA 2ORXA 3H25A 1VQKP 3H7YA 4OGQD 5BV6A 1L7LA 3ECQA 3EBRA 5TISE 3MW3A 3PUIA 1LP1B 3AZZA 3D0SA 5C4WB 1FV3A 1ZMEC 2JKBA 4HN1A 4CCNA 5B5EH 2Z69A 1W6PA 4PV1B 2V4HA 3GBFA 4K7JA 4OMCA 3RFRA 3H3ZA 1S1CX 2UURA 4IE5A 4UBGA 2Y0OA 1LJ7A 3T08A 3WF1A 3IIIA 1AJKA 4IE6A 3CWBD 1KILA 1YI9A 3G4SP 5IAVA 1XJAA 1BK1A 2WWWA 1PZ8A 2A45G 3L74D 3IN9A 3FLPA 1OLRA 4FXKB 2N1TD 3PLQA 1H9WA 3LB9A 1RQUA 4GB33 3TSIA 5DAQA 2JD9A 4LIUA 2Y8KA 2YFZA 3GALA 1PP9J 2WPQA 3MUY1 2P7JA 1AR71 1O5UA 2ZGLA 2OYIB 4HONA 4DZGA 5A3UA 2HWC1 2HWD1 2R3CA 2WT7B 1NWQA 5CCHA 2XV5A 3IF4A 1LNQA 5KAIH 1H30A 1YHQP 2VW0A 3KZ4C 1SDWA 5A80A 3CCSP 1UY3A 4RD7A 5FRAA 4B3NA 2FBEA 3PUSA 4CDUC 2QRXA 2VZRA 3B9CA 3ME2A 2OARA 3EXUA 3IAQA 2BEQD 1DU3D 3ACHA 3E5UA 3SCGA 3D5OA 3GYDA 1LT9A 1MKMA 1LOFA 1WA6X 1XXNA 4KWKA 5L9RA 2JDNA 1MS8A 4I09A 1N73A 2WYFA 1PZQA 1BK0A 5APWA 4YWAA 5LA2A 3L75J 1AV1A 1SLQA 1IOAA 4GWIA 1RF0A 4COYA 2WITA 2AH2A 3S57A 1KFXL 1UN1A 5JSRA 4HL0A 4EYYQ 3KT1A 2PXJA 3S5QA 1X82A 3BRTB 4HZFA 2JX9A 5JI7A 2X10A 3ACLA 2FMDA 3B4SA 2IYOA 5C8CC 4R4LA 2E26A 2OIIA 3AP5A 1V6JA 3M3EA 4XXAA 1Y9BA 1AUYA 1KS4A 2AENA 2ZX4A 4LKSA 4XACA 4RL7A 3RK2B 5JXGA 1NTKD 3ILFA 2JIJA 5A7NA 3B93A 4I01A 4UW6A 3MIGA 3PU3A 2VL4A 1OD5A 1GWMA 1EDKA 4CDUB 2XL7A 4FTSA 1JY2N 2WNEA 5JXHA 1W2TA 5DZGA 2Z79A 1E5RA 4Q4X2 2O3JA 2ZZQA 4Q4V2 4AWDA 3SCHA 3FLRA 2ZJCA 3U11A 3BCCJ 4LLFA 1RMU3 2VQTA 2B9UA 2Y6HA 4LBQD 1EPZA 3M9QA 3CMAP 1LOFC 4Z82A 2V09A 3CQOA 3EQEA 4FSJA 3K5BA 3I3BA 5FFOC 3VBUC 1H8TC 2XUMA 3TGUG 3VOPA 5AVTB 1SMVA 3ATGA 1BCCJ 2YPJA 2W27A 1WW7A 4IXLA 4XF3A 5EIYB 2FKWB 5KKZC 1BE3E 1QXPA 5APYA 1S9KD 4XFJA 2GNMA 3G7DA 2JB4A 5FZOA 1LU2A 2IUWA 1TME3 4O9EA 3DGTA 1BLZA 1UPIA 3O5SA 2EAKA 4YSFA 5FZFA 3ACGA 4Q8KA 3EHKA 1TNRA 4MUVA 5E88A 2A6XA 4CDWA 2N1TA 5JDBA 1FZBA 5KTBA 4HH2A 5E79H 2XLAA 3MBWA 3NKTA 5GZFA 1I3HA 3W5MA 2E75C 2P67A 1LHNA 1X33A 2WFF1 2X53S 1U5IA 2XGXA 4BPZA 3HUSA 1FOD3 2BRTA 3L4FA 1ZRDA 3PH0A 3WT3A 4XZUG 1ZZCA 3GHGA 5FUPA 2RM21 3GNEA 5K4LA 4TZDA 2VOWA 3NL1A 4GIQA 4NHYA 4Q4W2 2ZEXA 3E1RA 1BJQA 4UFJA 3OW2O 2XJUA 4NAMA 2DCJA 2B88A 3HAGA 5APQA 1P84I 1DIWA 4LE3A 1GNHA 3L72J 4LHSA 3GXUA 1K9MQ 1LHUA 3M2MA 4MGYE 1Z7S1 1J1EC 4TXWA 3VBOB 5ACA1 1GU4A 5C9AA 5KWRA 2Z5WA 1HIXA 3CEWA 1AQTA 1EXJA 2RJ2A 4S2HA 1A34A 4Q4V1 3RZHA 4ZKPA 3B5NA 5KLIC 4QX0A 4RSUA 3VBSA 5KHJA 2JG9C 1S0GA 2JDZA 2VOKA 3DYMA 2D6MA 2A5ZA 3VMZA 1GUIA 2GH2A 3AMNA 3KCYA 1HF9A 2ZXXA 1NE6A 2B39A 2YMZA 4QM9A 2V5YA 3FUOA 3JZVA 3L71G 4E4ZA 1QOSA 2P3YA 2M5AB 5JR2A 2D3SA 3WX5A 4AVCA 1C5IA 3UGHA 4BM8A 2V7QH 2VUJA 1LHOA 2I1KA 5FYIA 1ZRFA 1RMU2 1T6AA 2P34A 2X09A 1L2PA 2W6AA 2V73A 3ZFEC 1M8OB 2YG0A 4UI9L 4ZZ5A 5CFDB 1QJX2 5FLJA 1VQMP 3BPSA 1HTLC 5AW5B 4OUMA 1YFWA 3C3VA 3AVRA 3GBGA 1GWKA 1K73Q 1L7RA 1PO23 4ZNCA 2QZ3A 3IZOA 4Q4X3 5KR7A 1ALYA 3D70A 3EJKA 1J3PA 4QAWA 1ZREA 2JEEA 3V0AA 2KSJA 2BBVA 4XEZA 4AL9A 1NTMJ 5EFUA 5FJHA 3TOJA 2AYHA 2PQSA 4LR4A 1BDDA 2MKVA 5KJ7A 1HW5A 1CQ9A 3VZNA 5JZGB 4K20A 1LWUA 3VD4A 1YIJP 3U14A 1UU6A 2VBDA 1UXXX 2PFXA 4MZUA 4H7MA 2IZ1A 5AFEA 3M8LA 5EJ1B 5FZ4A 5APUA 4W7YA 1Y7BA 1JZ2A 3LEGA 3D0JA 1QHDA 1ZXGA 1SFPA 4IDZA 5LRRA 4RJTA 4WM8A 3SFEC 3LSEA 1VAKA 1ZM1A 3EWKA 2ARCA 5APSA 3I2KA 4AI2A 5A6ZA 4QKNA 2JJLA 1QJZA 3T3YA 1X8MA 5APXA 4BIFA 2VR4A 2FFDC 5GLWA 2WSCH 3G9RA 3N9MA 4E8CA 4CVUA 1JY3O 2FYUK 4ZS2A 1LWUB 5FPBA 4W6WA 1DGWA 3G71P 3ZYPA 1UO9A 2XVLA 1X8YA 2AXCA 2E76C 3SEPA 4DS0A 1S1AA 2OQQA 2VD7A 4ZU5A 2BCCD 3JBG1 1DG6A 4HVOA 5DAPA 5F5IA 3MP7B 1G86A 3PU8A 1H2LA 4YW2A 1FZEA 3RZGA 4QB2A 3OA7A 1RUG3 3WG3A 1URQD 3F89A 2R063 5JZGC 1W6MA 2XLGA 2VZQA 1NU1K 1SCRA 5CMZA 4LBKA 3Q5PA 1GU3A 4U3FJ 3WINE 1MV8A 2JECA 1KD7A 2GMEA 4IW3A 4IFMA 2KSEA 1NCQB 2H88C 4JYCA 2FYUJ 1USEA 1HB1A 1TQ5A 3I3QA 2RH0A 3NAPC 1BGYJ 3KYQA 3CHXA 4IL6E 1ZR2A 4LITA 4D69A 2BUKA 4YXDC 1NJIQ 5LA9A 3O6QA 2D40A 4JQRA 3ZN6A 2PRRA 4I7ZB 1AX0A 1ZP0C 1PK6C 4AEJA 5IATA 1SACA 3AEBC 3AYAA 4V1PA 3VN4A 2FFDB 4EV0A 1COV2 3WP3A 4FBFA 2L91A 1GICA 2KS1A 5I0UA 3H32B 3I2FA 3OGGA 2B7YA 1C8M3 2E76B 4MHUA 1D4M3 3I8TA 4CCJA 1SQVJ 1PV3A 1WW4A 4Q1PA 5EYXA 1PL5A 2WSFH 4ASKA 3TYJA 2QE7H 2Q6QA 3CDZB 4DEVA 4TSVA 1UCXA 4A3XA 3RJ2X 5KLVD 1W6PB 1OX3A 1AR61 3GBWA 2GC0A 2G3AA 5ANNA 3H1HG 3TEWA 2WFF2 3Q8AA 5T50A 1NTKK 1AR91 1N2DC 2NRGA 2OZJA 1N73C 2VNGA 3ON7A 2FY8A 3PIJA 5A32B 1OMIA 1EAH1 3DN7A 5J98B 1W05A 1DEEG 2L9LA 5KC6A 3GCWA 1XNKA 3NWKA 2DYCA 2M3EA 1KMIZ 3E5XA 3PVNA 2EIGA 4K6BA 4QPYA 4BQXA 5FMDA 4N3YB 3MGUA 1C1LA 1JTHA 4H44D 1GZWA 5LZ6A 4I7ZC 5FYHA 3RI9A 4XF9A 5IFTA 3BU0A 1H88A 1DGWX 3FMGA 2YGLA 2A3YA 1OHFA 3RSJA 1Y43B 3SH4A 5IVVA 5FZ3A 3RZJA 2O8QA 1J1DB 4E8DA 1ODNA 2JWPA 1Y4WA 2QJYB 1NKGA 1M1KQ 3AJYA 1I5PA 3MPBA 1A6CA 3POGA 4IGOA 5FZ1A 5FZGA 4D6QA 3TN91 2DVFA 4ZY9A 1MEC2 1L0LD 4A2UA 5C3PA 2HH9A 1DQ1A 3J8F2 3FGAD 3ZXJA 1GK6A 1TMF3 2ZX1A 1PPJG 1IKPA 1DYPA 1ODMA 1VBA1 1W03A 4UOJA 3RK2D 4F7ZA 4LO5B 1JCCA 2B9BA 4URAA 4HPKA 2B42B 1W3VA 3J8F1 1GZLA 1DQ5A 5E89A 4IUGA 4ZKTB 1TU3F 1FZCA 4CYDA 1GMJA 2G9FA 3OBTA 1JZ5A 4X8PA 2DFCA 4HSLA 1NOHA 2PLV2 4NAOA 2Q1MA 1PZ9A 5AVZB 1RF1A 1UZWA 1IKQA 1BBT1 1C3HA 1SQBD 2A1XA 2A75A 4G9SB 4U2AA 4LORA 1SP4A 4P9WA 1I9RA 5HCFA 4Z07A 4PD4D 3BUCA 3I5CA 1LHVA 3HT1A 2YO3A 1JS9A 2HWF2 4HBNA 5HCAA 1UZ0A 3SKJE 5C7GA 1TEIA 1TG7A 1COV3 5JOZA 2QG4A 3I2JA 2IVIB 4P00B 1PO21 1RYYA 1VMHA 4W65A 1J2JB 5I8TA 4JQ0D 3T1LA 1WRGA 3ZR6A 1YQ5A 3KZIH 2OPWA 1Y9GA 5FUNA 2O0OA 2I2SA 2ZXEB 1E5HA 1LGNA 3NSTA 4PI0A 3WNMA 1JYVA 3CPWO 1AL22 2Y9YA 3H1JG 2AEYA 3VYIA 5CFCA 4YZ4A 4QQ2A 1IS6A 1QJU2 2WPSA 1GZTA 2W5FA 3AVSA 2FYNC 1VQ5P 1DYKA 3DECA 5AVYB 2D98A 3OGRA 5DDJ1 3CXHE 1H89A 3MFCA 1X22A 5FY1A 3L71D 5A32A 4L0PA 3N9OA 4YG3A 2WC2A 4AVAA 3NRUA 1LTBC 3BASA 4OZXA 3P6BA 4C91A 1ZR4A 3U10A 1PMHX 5AW7B 3C8XA 3ZXAC 1ZN5A 3TF5A 1L0LK 1YRZA 2FZ1A 2PHLA 1JOCA 4D6TG 3A0HE 1SFYA 1VJ2A 4LA2A 4RFT0 5EV7A 4BRYB 2XH6A 1K12A 4DPNA 2RJKA 2E5TA 1QXRA 2VBPA 4HG6B 2VE1A 1SLLA 2ADDA 5FQ0A 1FPN1 2HLEA 5DUUA 4CDWB 1PGSA 1FMD1 1W04A 2CV6A 4SBVA 1HRV2 1PGQA 4BXLA 1LOBA 1MEC1 1POV1 2NN8A 4H3WA 1UU4A 2G8YA 3U1AA 1EDJA 4QB1A 3LFIA 4UFKA 4XDOA 1NOVA 5CU1A 3WHTA 5ABJA 1V6LA 5FP7A 1SQ4A 4CDQA 1HGVA 2E42A 2R061 4KWLA 4LULA 3S1KA 2BU9A 5C3RA 5GZGA 1AJOA 5M0TA 4CDXC 3PVBB 2WRAA 1XE7A 3P1IA 1FX5A 4LPLA 3G6EP 1OA4A 3N9PA 2R071 2WPRA 5F2SA 3CC4P 3I59B 1JYXA 1RUD2 2W92A 3P8MC 1V9U2 4AQSA 3ABVC 5KJ7D 1HLCA 1MQTB 3DV8A 4X6RB 3WG4A 5JOYA 2QFEA 3A0KA 3JSVC 1DYOA 5BVZA 1F15A 1L7QA 3USUB 1OXZA 4XW3A 4ISQA 1O4TA 2BFUL 2GALA 5C9AB 4HKWA 1OVUA 2VU9A 4JRLA 1RUNA 2OX0A 2E31A 3A0BE 2V72A 3T0AA 5FY5A 5K0UC 1RUE1 1R083 1CGPA 2R30A 3H1JE 4KL1A 1KITA 2JDYA 3K4DA 4Q0UA 3H1KE 4RFRB 2K37A 4IL6X 5D2AA 5AFBA 1SLIA 1HJBA 2ZGQA 3ZYGA 3POJA 2NPSA 3BVCA 4RESB 1EZVD 2OYIC 5CBOA 3CC2P 2EF6A 2RE9A 2Z2SB 1AL23 1WLDA 1W8UA 3H50A 4FVVA 4IEUA 4FAGA 1OH3A 1XNCA 2RDQA 2YC2A 4CDXB 1NY71 2D5HA 3IKWA 4LQRA 1NTKJ 1EAH3 1A8MA 1UIXA 1FPN2 3PUAA 4XUTA 1U12A 1HDKA 3EFFK 4N78D 4FOVA 4Y3OA 2ZAAA 5FLHA 2IBZG 2WNUA 2XJTA 2SPZA 3WW3A 2ZEZA 1ZZBA 4DUXA 2XDVA 4QXBA 1L0LE 3NTNA 4JV4A 2WSSH 4RYDA 1FYUA 5C9AC 3VN0A 3T09A 3ILRA 4EI2A 1AR73 3H1LD 3PJQA 4OUEA 3HE4A 1M56D 2KP8A 2WIIB 1JBCA 2HWD3 4H44B 1L3JA 3QH7A 1QJFA 4RGAA 4ZPIA 4CPGA 1JODA 4KBZA 4GODA 1AA0A 2EXJA 1WMFA 5J1XA 4BJ0A 3F95A 2A06E 4Y33A 1W90A 1WCKA 3ITQA 3T0BA 4COUA 3UNPA 5FYYA 2R1DA 1LR5A 5F32A 5C8CB 4BZ4A 4LBQA 1BCCD 3R4SA 3VUOA 4BQYA 4NPMA 4BDVB 3VBHC 1TMF1 3RK2C 2VMHA 3HBZA 2WNUB 3LEKA 3MHZA 4LEJA 4N9HA 3LIHA 2FHRA 4Q1RA 1OW7A 2VH9A 4W6XA 1VBB1 5AW1B 1WCDJ 1NVOA 2CY6A 4CCLA 3ES1A 2PELA 3B94A 3HJRA 1FOD2 2WZPP 1UKGA 1BEV1 1Q86Q 4CDQB 3OBRA 2HYNA 1XNDA 2DWRA 1BBT3 2OQ7A 1VBD3 3CNAA 2OTJP 2BFUS 2C1FA 2W94A 3LCPA 1K45A 2FCVA 3PDQA 2Y6LA 4MXWA 1CONA 4QGLA 2AEMA 2NPIA 2UU8A 2WS92 2ZTNA 4IV1B 2QIWA 1OT5A 1IZNB 1N1VA 3V2RA 4H44C 1YJWP 1CAUA 1H8TB 5GTHE 1WLTA 1X9PA 2WA3A 4I02A 4CCOA 1UIJA 3EB7A 5FO9B 3R4YA 1NLSA 3QLQA 1NCQA 2OYHA 2CAVA 2EIEA 2RKLA 2W1UA 3HQUA 1PP9G 1FS0E 4NIAA 3ASIA 5E8AA 2WWSA 1DGRA 1YFUA 2GU9A 4XDPA 4LBMA 3U4SA 3X29B 4XXPA 5C4WC 4FTBA 3VBHB 5TJHA 2CGNA 1K3IA 2FYUG 2WNUC 4IV3C 1KFNA 1PX3A 4JCKA 1L0NK 4YVWB 4LO6B 1UY0A 4BMEA 4YGBA 5L36A 3OJAB 1L4AD 2JJ6A 1EQ7A 2E75B 1SVFA 1NTZJ 1IFDA 2XR4A 3RL0C 3B5LB 3CX5D 4OHXA 4Q4Y1 1SLBA 4O9BA 1PVC3 1G8WA 1ULFA 3HIFA 2ILMA 2EXKA 4XOGA 1VQ4P 4XUNA 1X9VA 3M0DA 4YYOA 4EWDA 3MHVA 1XE8A 2R44A 3OAKA 4YM3A 3K3NA 4IV1C 4CEWA 1SEFA 4UB8H 5CB7A 5FAXA 3H1KG 5G04L 3HNYM 1NU1J 3RGBA 1TME1 4ASMB 1V6IA 1F4HA 1FPN3 1FV2A 1V9U3 1WMDA 2CGOA 2HWD2 3D3AA 4DUWA 1T2KD 5AC92 1V70A 1FI2A 4NPEA 2GUSA 2HEVF 2QQMA 1W9SA 4IEQA 3H1IJ 5I0RA 2XVKA 3E6CC 2G9GA 2R062 2QNKA 4TLGA 4AAXA 3BIEA 3HE4B 1VRH2 4EJRA 4DRVA 5A6YA 1W6NA 4UW3A 2WUHA 5KLIB 1Q8PA 4YFZA 1MZEA 2RM23 2WS91 5FZDA 4NHXA 1R093 3B00A 3C7GA 4OVEA 3POEA 1UIKA 4ZXEA 4YXWH 2HWE3 2ZCWA 3L35A 2MPFA 2WFPA 2YDEA 4NWWA 3PUQA 4QT6A 4Y1VA 2E76D 2XNDH 2TBVA 4AVVA 2ZKLA 5AW6B 1VL2A 3V6IA 1S0JA 1WUVA 3CXHH 4XBNA 4H0LC 1NZIA 1Q8VA 5FZIA 2DCYA 1JYWA 2FD8A 2ZYDA 1D4VB 1BXHA 1FJKA 3ZFEB 1S0CA 5CFDC 1EYBA 1E5WA 1QQP1 3JUUA 5BY5A 5EP9A 4FFHA 1SFCA 4QHOA 5CCGD 3SFDC 5FXVA 4HANA 2A71A 1KYOH 3N7MA 1L4AB 2FZ2A 3AMHA 3LOBA 4YNIA 5C33A 2ZX2A 3CU7A 2Q30A 3KF3A 3IDCB 3P8CD 2NPSD 4I0BA 5E1RA 4GD4A 5J36A 3WF4A 1HN1A 4WM7B 1IFJA 1ZOYC 2LKMA 2C5DA 4GXLA 4IEYA 5J09A 3AMPA 4FPGA 3H1YA 3T30A 1URXA 1HX6A 4MOAA 5DZEA 3L73J 2WQ8A 3B69A 3RZZA 1DZTA 4HOOA 5EYYA 4EN8B 3MF9A 1UY1A 4L11A 5IFPA 5F3EA 2C0XA 4Q4X1 1OD3A 2XBO1 4H0LB 5KHGA 1F5JA 4Y24A 1HH0A 3K46A 2AZ5A 4E2QA 1REFA 1CAVB 1TNFA 2RJLA 5JIAA 1LTIC 2O01J 1DCSA 3VMXA 1N1TA 2QKDA 1V6OA 3GW6A 4B4QA 4AEKA 2O1QA 3H1JJ 3J7HA 1R1A1 5FZLA 4KWJA 3QOPA 4BQWA 3PLNA 2ID4A 2ATFA 3S5AA 4A45A 3AXDA 3E6BA 2HWC2 3MYXA 1GK4A 3AKPA 1LTJC 1TMF2 3N9NA 5JVVA 3VD5A 1W6OA 1NCRC 2B87B 3MIWA 2VQ0A 2ZX3A 5FZMA 3B71A 2XKPA 3RGUA 2NM1A 3Q8EA 3IMMA 1CVNA 2JG8A 4H7LA 4WM7C 1QQP2 1DP0A 5KLVJ 4COWA 5T5OA 5AC93 1S55A 4GULA 1KJLA 1NCQC 1RJ7A 4R4ZA 4BQ1A 4CEYC 4WY4D 2WQ4A 1GZ9A 1LTGC 1FT9A 5IWFA 2WABA 1T2XA 3J7NA 5CAZA 3UYJA 3W9AA 2R0FA 3KHCA 4WBBA 4AI8A 2ZGUA 4QU1A 3VDBA 2W39A 3BCWA 3I54A 2HWF3 5AW0B 3ZDSA 3L2YA 1W6QB 3L70J 1IPKA 2A6YA 3RJRA 1UD1A 4EDFA 1DQ0A 3IIAA 2XMLA 3KD4A 1RJ8A 1YJLA 4QX3A 1LAJA 3VKFC 2KD7A 1NYWA 2XWBB 4B7KA 5KLVK 1PHMA 2YFUA 3CL3D 2JG9A 2E75D 2SLIA 2FDFA 2J58A 1RHI3 5FZ6A 3ZYBA 3AX4A 4RQPA 2CDOA 5FO7B 3TGUE 1HWTC 3KHUA 2GA1A 3KV5A 4YM1A 3U07A 3W20A 4A42A 4L76A 1U5XA 1VBC3 2IVJA 1D7PM 3BALA 2IBZD 1UF2C 5CKQA 1RY3A 1UOBA 3CWBE 1BSHA 1EV12 2IXKA 2UYAA 1N73B 3HE5A 3T2PA 1KB9I 3ORJA 3W59A 2WPVB 4B4PA 3BI3A 1CWPA 4JPZB 1IG0A 1QWRA 3H1HE 1AFOA 1KGYA 1PGOA 4KQ7A 1CI6B 3ELNA 3HVDA 4TYSA 4DRRA 1PVC1 3UETA 3RWKX 2YMYA 3SQOA 4FOYA 3A7QA 3GJBA 3WQBA 2QUOA 3JD71 2BNMA 3OY8A 3THPA 2VTXA 4XFCA 5EZWA 1O4ZA 4YW7A 1N47A 5FYUA 3S30A 1K5MC 1PGW1 5EFWB 4LMFA 3HR9A 4IL6H 5DAWA 3MEPA 4HYTB 1RUF2 2P3JA 1IFIA 3RBZA 2Y60A 4H13D 2WT2A 1V9U1 3TYYA 2KB7P 1MS0A 1OQEA 4BYYA 2XWJB 2L5GB 2AREA 1LCLA 1LTTC 2AXTH 2KS1B 1KB9D 1Q7YQ 3KCXA 2E63A 3Q8FA 5CG8A 2QVAA 1W8OA 3CKHA 3ZYHA 2VVEA 3CJXA 1X9TA 3CLQA 3L36A 3AZWA 1LECA 4QPGA 5FK7A 5CBLA 1OA3A 4MADA 4CU8A 4Y20A 5IHRA 1SQBK 2VECA 4IGPA 4OH8B 2JP3A 1DIPA 1LOGA 2HWE1 2RMU1 1I1EA 2XJPA 1W9FA 1PGJA 5LK7B 1J1LA 1QU0A 1NT0A 1JYCA 1LP1A 1QKQA 1H2KA 3K2OA 3L71J 5C4WA 5JOWA 2RR13 2YBSA 1U5YA 4XJ9A 1LT9C 2DUOA 3TN93 5CCGA 1VBB2 4JGZC 1QQP3 1PPJE 2BERA 1HJ0A 1VAMA 3DL3A 3LA3A 3NAPB 4KMQA 4OHZA 1LNSA 5IVBA 4NRMA 3SH3A 1NXD1 4DIQA 2H8PD 1QVFO 1E5IA 1GKBA 2DVGA 4M4PA 3VLBB 2WO2A 2PAKA 1URQC 3UV9A 4AOCA 2VRSA 1SHWB 2Z4EA 3FE5A 3QCWA 2ZYAA 3BRVB 1JOBA 2LALA 1HVVA 2C9AA 3L72G 4JC1A 1AJYA 3ZO0B 1A3KA 1NTME 2X8KA 3VHRA 1W2NA 2YBKA 2X5IA 3JCUE 1D0GA 2PHTA 3CLPA 4IE4A 2D44A 2Z42A 5LCWL 1XU1A 2WT0A 3B01A 1JYTA 4QHBA 4XMAA 3AL6A 1YTZT 5AVPA 1FNYA 4L73A 1LODA 1OA2A 3V2QA 5GTIH 2LXBA 2K46A 1S4XA 1Z0HA 2E9QA 2P4EA 3KQRA 3KV4A 4HLTA 4YGCA 1UOJA 2QQUA 2WZ8A 1XOYA 3JD72 4RR3A 5T55A 4MGTA 1LT9B 1KC8Q 3H3LA 3SISA 2XLFA 3NVCA 4XYXA 2FCUA 2BVBA 4JGZB 1G9FA 3JC22 2VCMA 5FP4A 4JTOA 4UFMA 3T2QA 2JIGA 3UESA 1F5FA 1RUD1 1VB2A 3AXEA 3VD3A 1JXNA 1N1SA 1D7MA 2DCTA 2JR8A 1OBNA 2ZGKA 4Q29A 4D7TA 4D0QA 5JI9A 4LHNA 3KV6A 1UMHA 4CCDA 3FUQA 3ZM8A 2WBKA 3DYPA 4M3CB 3L75E 4WB4A 3L73G 4XUOA 1YQ3C 3N7KA 4O7XA 1KORA 3JB8A 5DG2A 1KYOD 2ZOEB 3K3OA 2GMPA 4CXWA 1SDDB 1U7MA 4XA4A 1U7JA 5FPZA 3AECC 3T2OA 1MQTC 2WTYA 2OZ6A 5CIRA 2KUBA 3ACFA 3AZVA 2C9LY 3DPRA 1DDLA 3QD6A 1RE3C 1SQXJ 3ZDMA 3RPQA 1JY2O 1NTZG 2J1EA 4XDQA 1POV3 5I8YA 1CX1A 2RS31 3ZYFA 1IS3A 2ZVNB 5IUQA 3WLUA 3ZN4A 4DINB 3S7EA 5F6KA 3L70G 2W8ZA 4FXGB 3WNLA 1JN2P 5BNPC 4PBOA 3A0HH 2YY1A 3DUIA 5A1FA 2W87A 2ZGNA 3WU2E 1RHI1 2XHNA 1EV11 2RDRA 4JKKA 5HPOA 4X6QB 4MXVA 4HETA 3N4MA 2WZR2 1XYPA 5K9YA 1PP9D 3ZXKA 5CG9A 1SPPB 1VDFA 4UWDA 4FFFA 2E7TA 5H9RA 3PL0A 5HI0A 4CCMA 4HN0A 2X5IB 1C8NA 1RUE3 5IVYA 2QQNA 3M70A 4TWTA 1IS5A 5FJKA 3IM0A 4DJGA 4AI9A 2Q7CA 5LW9A 1HXS1 5F5CA 1AYM1 1NA1B 1YBKA 1ULGA 1H6YA 3O12A 4MH0E 4OZOA 4E4DX 2QCSB 1ULPA 2VJXA 1JW6A 1PIV2 2J1UA 1M57D 2VW1A 2OUHA 2WLQA 1WLWA 3OYWA 1WMXA 3NJVA 4R9CA 1YJNP 1IQAA 1CD3G 1QH6A 3UKTA 5D1IA 5BNPB 4IFDK 3BYWA 3R6SA 2O01N 2O8OA 1SS1A 1F31A 2EIDA 2XJSA 4TLFA 5L9BA 1T3JA 4EOTA 4YVSC 4UF0A 1EUTA 3OGJA 2R042 3AMQA 2XQXA 2WFF3 3J26N 1SQQG 4P9LA 4BMBA 1JZ6A 4QKDA 4CEWC 2KNCB 3Q3DA 1QXJA 4AK3A 1W9TA 1NO4A 1P8JA 3TGUJ 3AEGC 3LDKA 4EWAA 2Y0CA 1SQPE 3R0RA 3IB3A 5LBFA 3OG2A 3V56A 4M3CE 1CZTA 3ZLIA 4CDXA 4E27A 4LHLA 3I49A 4LKDA 2W0XA 4N7UA 5FYCA 3P8CE 1LKNA 3CI9A 1O6UA 2YZ4A 3DYOA 1NA1C 1A02F 4O65A 1M4WA 4PJ0H 1NTZD 4K3UA 2RR11 1EY2A 2DUQA 1CAWA 1Q8SA 2D7FA 4XFIA 4A44A 2B5HA 1NAYA 2HEYF 1C8M2 2XBO2 5DXDA 1KRIA 2HPCA 3L74E 4Q4V3 4XURA 1AR81 1IZ3A 3KQGA 1F8VA 3OD4A 4YVSB 2Q8EA 2DW3A 2YMKA 4OWFA 4KGGA 3A22A 1S5LH 2WKKA 3MLLA 1WGPA 3EMRA 4K8FA 4K8RB 4NPLA 4W8JA 4YW4A 1GMMA 2WZR1 4URTA 2YXQB 3WV6A 4CEWB 3WXPA 2QJVA 4IV3B 4YVWC 3ROUA 4ASVA 1XNBA 3H1ID 1OPOA 1GW4A 3CX5H 1SQBG 3V64A 3FWEA 4MGIE 4A3ZA 2JEMA 3GJAA 3T1MA 2H89C 3RL0B 1N3OA 2YPDA 4JQTA 1NKNA 2F17A 5B4XA 1JMUB 2QJPC 4UXAA 4WVZA 1S2KA 4E9KA 3JXSA 2PHWA 4GAZA 5JPNB 1ENSA 2YC0A 4UB6E 4CXYA 2J1VA 1NAFA 4RO0A 2DFBA 3R4UA 3KVAA 2OYIA 5GLVA 1UMZA 1PK6A 3M3QA 3H1KJ 4H0LD 1ZZ6A 3THTA 1RUD3 1UMIA 3OUHA 4Y5TA 1CW5A 3TBDA 3CCUP 1K5MA 1BE3G 2G9ZA 4OYUA 4WY4A 1OH4A 1QNYA 3I4IA 4C46A 1J1TA 5LA1A 2WVRA 3EQ2A 3U1CA 4FPFA 3CJIA 1UX6A 3L72D 4GJZA 5F2WA 4UF0B 4MX3A 1QNWA 3IAPA 5T5PA 4AYUA 2Y6KA 4YM2A 1AXKA 1DQ6A 2LUWA 2QBXA 2QZ2A 5EWSA 2ZXQA 3ZPYA 1WLCA 5FP3A 3WOGA 1NTKE 4KNCA 1G6NA 5JWPA 1K42A 2VUAA 2JDUA 3OPTA 4O61A 2JDPA 4GH4C 3WNOA 1L0NE 3BCCE 5B66H 3J4UH 3SITA 3VKNA 3GHGB 3O14A 4PD4H 4TN7A 4UT5A 3IFMA 1K8AQ 2RM22 2ZGTA 4BIOA 2BNNA 2K1AA 3O1VA 2I07B 2RS33 1LB2A 1Q43A 3LIEA 3NXSA 1NHLA 2IFWA 2Y38A 3ZN6B 2YIUB 4ZU4A 2X29A 4OGQC 4XF4A 5CA6A 4DXRA 1OW8A 1ZBA2 1L4AC 3Q5SA 1JNMA 2JB8A 3SH5A 2A6ZA 3OEAA 1P84D 5HXMA 2IWGB 5HBAA 4LTAA 2JWDA 3AE4C 1V6MA 4PD4E 2PYTA 3H1JD 4UW4A 3RZLA 4K35A 1QJX3 3WEZA 1AHSA 2XHKA 1LGCA 2R072 2EXHA 2GC2A 5FZHA 3UJQA 5CCHD 5F9TA 1XTGB 2ZEYA 4PDWA 2IXLA 1VMFA 2VUDA 5FYVA 2BW8A 4FCAA 4RN5A 1QMJA 5EJ3A 1NCRA 1GU5A 2ZYGA 2W90A 1OIPA 5IJRA 1W6OB 4PV1D 3EYPA 1YFXA 4I2OA 1H2NA 1YI2P 5B4NA 2VG9A 2BP6A 4NPFX 2W52A 4K3AA 4NPRA 1C5HA 2IPPA 3VBFA 1AYM2 1JB0J 3S4RA 5CEHA 2MEV3 4AR2A 2CWSA 1KILD 1VF5D 5GALA 1AR63 1S2BA 2H6CA 5K7PA 5IK8A 2J1RA 3L70D 1GW3A 3OBZA 2TNFA 3VBSC 4NIGA 4UB6H 3UGGA 4L97A 1DHKB 1GV9A 1VBD2 2BWCA 3T97A 3AFKA 1LT1A 1PO11 1LTJB 3AYDA 3AKRA 4LBOA 4AEDA 1NCRB 2RMZA 2DVAA 1DBNA 2J1TA 4M0HA 4RHV1 2WSEH 1YC61 3M91A 2XBO3 1X7NA 3LAGA 4B29A 4QHZA 2XUEA 2Y6FA 1L0LG 2W6BA 3TWIA 2QQKA 4MG2A 4CEYB 1GZCA 5CADA 5FWJA 1JU4A 1Y47A 4PI2A 4QXKA 1N3PA 3APBA 3CX5E 4DMIA 4HPKB 5JXIA 2HWC3 1DD3A 1XB9A 5IT6A 1MVQA 3TK1A 3CCRP 2WO7A 2YUEA 5JAXA 3U59A 4YM0A 4XJAA 4NIIA 4P5HA 1U57A 3WQ1A 1RE3A 1SBDA 4NRQA 2FXPA 4JHTA 1SCSA 2D6NA 2TUNA 3BTYA 2A3XA 5A3LA 1H8AA 1JI6A 3KVBA 5FMBA 1OKOA 4UAPA 3MUZ1 1AR83 3E6DA 5H2FE 3AEAC 3MF6A 1R64A 5FYTA 5KXBA 1ZBA3 4J1WA 4FI9A 4DXSA 3U78A 1RVF3 3H1HD 1GL2B 3L37A 4PIZA 3VBHA 1YQ2A 2ZMNA 3RDIA 4CRQA 1POQA 1ZBE3 3C7OA 4S2GA 4WM8C 3AP4A 2IFMA 3AKTA 2F6BA 2HWF1 3H6PA 2O1JA 3WF2A 1VQLP 2ZGOA 5T3NA 1W2UA 2ZPXA 1J58A 4DCKA 1W9WA 2PHXA 3K75B 1BBT2 1XSRA 3FX3A 5F3IA 5IW0A 3LQCA 5K0UA 5KXEA 3DKWA 1HB2A 3ZXFA 3IT8A 4Q5OA 4CU7A 1F35A 2PHUA 1LRHA 3NV3A 4I0WB 1AR72 4N43C 1ULEA 5A1LA 4E2SA 3WNNA 1SLCA 5ANQA 3VKLA 4CXXA 1H1MA 3WUUA 1K5MB 1QGLA 2R5BA 4IESA 2RDNA 4KU8A 4RA0A 1F4AA 5EJZB 3IMNA 1C28A 1RE4A 1CN1A 2BEOA 2DBIA 1HBWA 3AEFC 2HWE2 4XF1A 5FY8A 4XJ8A 2HODB 3CJIC 4EWEA 5JLVA 1RB8G 4Z8BA 3ZN5A 3VDDC 2BJSA 3L9JT 3ABZA 2DV9A 1ENQA 3F5HA 2QEXP 2XJQA 2RDSA 2YU1A 3DKQA 4YG6A 1GQHA 1GL2C 4HKZH 2RMU2 3GZTB 1UY4A 4XE5B 2HWB3 3H1LE 3BU7A 1L0LJ 4WM8B 2C24A 5F39A 3VGIA 5AW9B 3MPPG 1PGL2 3SC7X 1W39A 2DCKA 1UL9A 4YZ3A 4YRDA 3WVJA 4BISA 3AE7C 1YLLA 3CMGA 1L0NG 2YKQA 4OVNF 3HN1A 4XQWA 1US3A 1LTAC 1NLQA 4OHWA 1EP0A 3KLSA 2IXHA 4WVMB 3WZ1A 3NO8A 1BE3J 4Y1YA 3ZYJB 1NXMA 3ZKUA 2XJRA 4CEYA 2I8DA 1NTKG 1CI6A 2VTXJ 3WD5A 1KFMA 3ZFFB 1NG0A 3FFZA 4OI4A 1SQBJ 4BXFA 1YCIA 3OY8B 5A3PA 3E5QA 1J3QA 1PIV1 4C7NA 1XU2A 4IE7A 3P5BA 3ZSEA 1KTMA 3K4AA 4QDQA 2ZHLA 5TSWA 1JTZX 1URQB 3VDDB 2Q9IA 1LESA 2RR12 1HXS2 3AL5A 4ISRA 2VMFA 4LO7A 1GL2D 1SQVK 2AGSA 5FY7A 2C9KA 2Z4FA 4PHZA 1YXWA 3I56P 4OUSA 1XNTA 3RYRA 4BOWA 5CFCC 1RHZB 5GLTA 1OFCX 3O6QB 4R9AA 1CAXA 2ZMKA 1GL2A 1ZLLA 3UKVA 3O1UA 4NUBA 3HD8B 3VHNA 4EYUA 1OFNA 2KR2A 5CZKA 4ZKUA 1R081 5LRSA 4U7JA 3POFA 5F8PA 2O14A 3IR9A 5DJTB 1SQVG 3WU2H 1GQPA 1RVF2 4Q4W3 1W0PA 4HKOA 4NO4A 4A4AA 3V0BB 1CSBA 4QX1A 1NU1G 4DXTA 2DU1A 2RS12 1AYN3 2Z5HA 1XC6A 2OYOA 3FC0A 4DZOA 2Q8DA 3OD0A 5BNQA 2AEFA 1LOAA 3QH6A 2PLV3 2UYBA 1PNFA 2JG8B 1JHNA 2BCCE 1HQWA 1G2CA 4N53A 1S5LX 3RK3D 1XBFA 3C2UA 3D4KA 4AEDC 4DY5A 1Q2NA 4AQ6A 2A70A 3LA7A 3W21A 3O1SA 3KGZA 4PJYA 1E79H 3AMMA 1PMIA 2R0HA 4RHV3 3MDPA 5FV3A 3KQ4B 1P84H 2BGOA 2D6PA 3A23A 5FLIA 3MZHA 1JZ8A 1IHMA 2KXLA 2E7QA 3FLTA 3MLKA 1N7SB 1AR82 4IEWA 3WUCA 5A7WA 3C8VA 2WQYC 5FPXA 1CESA 2JE9A 5FZAA 3RG0A 5JR7B 2G1MA 1FZFA 1NKZB 1PMJX 3PJSK 1S9KE 3A3YB 2ZFCA 1SPPA 2RVAA 3B02A 3EFGA 2FYZA 1VQPP 3C7EA 4DUVA 5J37A 2CSGA 2D2CC 2WDBA 4JHZA 1NQJA 2PHRA 1LGHB 1GLHA 1LU1A 3HD7D 3VMAA 2HBTA 1RUI3 3V5BA 1MACA 1OURA 2BQPA 4K1YA 4XCBA 2JKVA 5D8AA 3T0DA 3FWNA 1LEDA 3I2OA 3BVHA 4WV8A 3BGAA 1SQPJ 3PMEA 1SQXK 2Z5IA 1KN7A 1QJY3 1LGBA 1LTJA 1RXGA 2VGDA 2K9ZA 3GM8A 3K77A 2VQUA 1RVF1 1U5ZA 3NNJA 3PVOA 1EZVI 1IK7A 3WCSA 4ES9A 1UYPA 4DEQA 5FZ8A 1BEV3 5IVFA 1PZ7A 3LPFA 4RS5C 1OFSA 1ULCA 4UFHA 1VBE1 1CR7A 3KZIE 1VF5C 5CKMA 1OOPB 3I59A 2X5IC 4XZPA 1OW6A 3SXWA 3TGUD 3H1IG 4KT0J 1JEKA 1RUG1 3VBFC 2WZEA 2WNOA 2GP5A 3OBAA 2FDJA 4MHRA 2PHFA 4P08A 4BK4A 1C1FA 2JDHA 5CVRA 2UY9A 2W68A 3NMDA 3OSDA 3P7KA 1S0EA 2PN5A 3HTKA 1BCCE 3Q2YA 1EV13 3AM2A 3BPZA 4F8AA 1RUH3 4QGNA 4ET7A 1RE4C 2W91A 4U3FE 2A73B 4JDNA 4XPVA 2YV8A 2NZ9A 3KCCA 3AB0A 1HB3A 1GP5A 1YJKA 3V0AB 5E6HA 3MIHA 3CXHI 3IPVA 1OOPA 3ZYRA 2BZDA 3VTPC 1PGL1 4HFSA 2GC1A 1AYN2 1ENXA 2HWB1 4J6GA 4Y26A 4MLOA 1D4M1 4KGQA 2ZVOB 1UWWA 1HJFA 3POSA 1PFIA 1R8EA 1VF5B 3H32A 4KHXA 4XBQA 3VZMA 5A7PA 2W83C 5FXWA 5A6XA 2N9YB 3VBFB 1T8ZA 1QH7A 3ALQA 3H1IE 1CIWA 2B46X 5A7WB 3CF6E 1MS9A 2VMEA 4NHLA 3WUDA 4JRAA 3RBXA 3DEMA 3IBMA 4V2WA 1JM0A 4AVBA 3O1PA 5L8RJ 3VKMA 4AEDB 2Y33A 3LSDA 3B8EB 5GM0A 1YEWA 1IK9A 3SLIA 3T4VA 3CX5I 1JOJA 2OGUA 1VMJA 3PMSA 2N9BA 4EIJA 2E32A 3HOBA 3H1KD 4FT8A 4IEPA 1R091 2BNOA 2XL9A 4BCUA 1KB9E 4QXCA 4MGSA 1RUOA 1FBMA 2BEZF 2RS51 3A0BH 2AUYA 2IXCA 1UYXA 5D8AB 3D71A 5AVXB 1JH5A 2UY8A 1R1A2 2ZGMA 3AP9A 1DEBA 2OQ6A 2ZJSE 4LXLA 4Y22A 3R2PA 2EXIA 3BOWA 3VBRB 1BVP1 1H1AA 2PMWB 4G3YC 3LEIA 3WDXA 2QJPB 2BTVC 3H9AA 1W2OA 3M0DC 3AFGA 1DF0A 2RHPA 3NNLA 4Q4W1 1I6XA 2B89A 3AE2C 1W2EA 4W80A 1CIYA 5EQUA 4NN0A 4Y5SA 5H9SA 1IGOA 3N35A 4IV1A 4NRPA 3POIA 4ASLA 2XG3A 1ZZ9A 3H1MA 2D97A 3L72E 1ZX5A 5HCBA 3ZXLA 2GH8A 1YQCA 4QB6A 4R52A 1MFTA 3HQXA 5FYSA 2WSCJ 3LE0A 5J48A 5FY0A 1NU1D 2IX7C 2PTMA 2BVVA 2VOVA 4C7NB 4LNVA 4C0HA 4M00A 3II6A 2JDIH 3WF3A 5L9VA 3RQ0A 5DJUB 1R1ZA 2R6QA 4YVSA 4IEVA 4CCEA 4CZSA 3WDWA 1ZZ8A 2M3BA 4K40A 5D8AC 2UWAA 1YUDA 2Q1ZB 3AZYA 5F3CA 1O4YA 1WW5A 1GTWA 4A41A 1QDOA 4NOTA 4HT1T 1HN0A 3ZKYA 4GH4B 2P17A 1LHWA 1KILE 2E5YA 3KS7A 2ERFA 4I0AA 1VP6A 4XABA 5FZ9A 5BUVA 4ATEA 5KBFA 3GHGC 1KQFB 3D82A 1O3TA 2Q8OA 2Q4SA 1XE0A 5K5GB 1SZBA 3ACIA 4L8QA 4QKBA 1E5SA 3TNUA 3WR0A 4M3CF 2NZ2A 4Y28J 5LY1A 1BMV1 1WBLA 3RRDA 2YIUC 3AEEC 1MVEA 1W8WA 2LROA 4OGQB 2VNOA 2ZS6B 4AI1A 4AQ2A 2GNTA 4B8EA 1QL2A 4BQ4A 2DURA 2D2CD 1DLLA 3KV9A 2VTFA 2P5BA 3URFA 5AC91 5L73A 3SWKA 2XPJA 3DXUA 3LA2A 1SBEA 5A3OA 2NQYA 5FBZA 2R1BA 2VM9A 1PPJD 1L0ND 1A8DA 1ULOA 4JKMA 1W6QA 3LDBA 1W6NB 3RZMA 3ZMNA 1RUH2 3MV11 4YFWA 5HCHA 1VBE3 4N7IA 3JQWA 5FPUA 1MEC3 2UWBA 3NMBA 1PVXA 1A78A 1CX4A 2LTNA 5F5QA 2FXOA 2ORZA 2J22A 3C7HA 5FBJA 5LBEA 3HQRA 2KIKA 4FQZA 1FZCB 2IZWA 5BU8B 1BVVA 5FXZA 1MZ9A 2C0ZA 3L73D 1BZWA 4NPDA 3FBYA 4E4HA 3B7MA 2R073 4OLLA 3IDBB 2WSUA 1M1JA 1O7FA 3BODA 3UGFA 2K3RA 4ARXA 2C0WA 1ASJ1 1REDA 2IDBA 3PVEA 1HQLA 5SV8A 2Y64A 1HV0A 4XTPA 1U0AA 4XAAA 3O0WA 4FPHA 1YIPA 1SQQD 2YO2A 5B5EE 4JGYB 4HSJA 3VBSB 2QQJA 2XNXA 1Z7S2 4YZ2A 4OCTA 3FJSA 4XFHA 5ACA2 3U0ZA 3PNAA 2PA7A 2YGMA 3KWVA 1VBC2 3B5ND 4Y5Z0 1QIQA 2F4PA 1KZUB 3VZKA 2EIBA 3VZJA 3AP7A 2QJKC 3IAOA 3GCXA 1HRI3 3BTAA 3VD7A 2YHJA 4COVA 4MGQA 1OQDA 4C7RA 1FDIA 4RKUJ 1FDMA 1D0HA 2WJSA 5KC5A 1FZCC 2J5UA 3M4FA 2GUVA 4OMDA 1RGSA 1XTCC 2E7AA 3JB4C 5JZGA 2OUJA 5C39A 2H7HA 1G2CB 2UWJE 2N7GA 3FHQA 4AHXA 4LBLA 5LEJA 4YW1A 1AVBA 5SV5A 5C5TA 3GF7A 1UOGA 4QM8A 3W67A 3VMYA 4EN9B 3D6EA 3WNKA 2K88A 4U3FG 2R16A 4GMP1 4QD2A 1FOD1 4QPIB 3A2AA 4XETA 4CDUA 4DNYA 1D2QA 1RITA 1W2BO 4AHWA 2WQZC 3ETPA 3B3QE 1PGPA 2ETEA 4JGYC 2H0BA 3LGRA 1VQ7P 4JYBA 5FY4A 4N78E 1IFMA 1XSQA 4ATFA 3AE3C 3BTXA 2RMU3 2P6CA 4C1WA 4LOTA 1RUJ1 2XDJA 4ORFA 4R4XA 3WNPA 4L2NA 4XFAA 5APAA 2Q5TA 1EAH2 2FCTA 3I3EA 3T97B 1HRV3 4D6RA 5C3QA 4IERA 2AEJA 1BCXA 4Q0QA 2P58A 3VDDA 3PTRB 4HB1A 1IQDC 5GZEA 3O8ZA 2FYUE 5APVA 2QQOA 3VBUA 4CPBA 4DOJA 4WVWA 4N43B 2VXRA 3POWA 1KQRA 2VMGA 1ZBA1 1VBB3 2YXSA 1PO22 1SBFA 3OUJA 4PD4I 3LD8A 4YW6A 3TEXA 3GHNA 3LFMA 5HV0A 4OQ8A 2ITAA 1APNA 4QPWA 3UJOA 1VQNP 1ZBE1 2W1WA 4QPIC 5A33B 1JYIA 4MSVA 1YITP 3W5NA 3GZUC 4WBAA 3WMM0 3CJIB 4GJYA 2R5DA 2PQQA 4EZHA 2GC3A 4XVHA 5JMOA 2UWCA 4BE3A 1VBA2 4CDQC 3ENRA 4YPCA 1HUCA 1MS3A 1NH4A 4IETA 1J84A 5J7MA 2I1JA 4LLOA 4H2AA 3SNMA 2FDKA 4P02B 2VCAA 1FZGA 4ZHNA 1QL1A 1GNYA 1IPJA 1SG3A 2M0BA 2Q5UA 2XXZA 2KZIA 1O8PA 5FPLA 5T54A 1YNAA 1URQA 2X05A 4AAPA 1NTMG 3M3CA 3KT7A 4XJWA 2C6SA 3L2HA 5FQ0B 5T5LA 2CPSA 1RUF1 2VZSA 2YC4A 3A21A 4AE2A 2XQRA 1R5LA 2XU6A 4P9XA 4P5YA 2GNBA 4GWMA 1QVGO 3MIDA 3HT2A 1N7SD 3DCQA 1RUJ2 2J1AA 3ZFFC 2YNYA 1YO8A 5I0DA 2FQPA 1JMMA 5AVUB 2A45H 4Q4Y3 4NR1A 5FYMA 3RI8A 3ZDVA 1ZRIA 4CP9B 2GMMA 3KXDA 4PLNA 2Y26A 4AVSA 5LA0A 1BMV2 3ZMOA 4PF1A 3RL0D 3CCLP 1Q82Q 4NROA 4BLJA 3JU9A 4EQVA 1BGYG 3ILNA 3I55P 3G6JB 2ZT9D 1W8FA 3VV1A 3VD9A 2WR9A 1OVSA 3J9SA 3RL0g 2OS2A 5CFCB 3CWBJ 4LK7A 4LUKA 4M4RA 2XZRA 1J3RA 1UYYA 3N7LA 2HJIA 4WWIA 4AFCA 3JBG3 4BQ5A 5B66E 4MN4C 4WY4B 2ZGSA 3WUTA 1OXCA 1W8TA 2CHHA 2JD4A 2E51A 1WKYA 2O01H 3N4XA 5L7OA 3O1OA 4CA9A 3O0VA 2D6KA 3RMXA 1BGYE 5A1AA 1GP6A 1KQSO 3GG2A 1GBGA 1ND3C 2D3PA 1RH5B 1MS4A 2WS93 4IEXA 3OJBA 4INDA 4KBBA 5C71A 3H8OA 4NIHA 3LOIA 1X79B 5DZFA 2YKPA 3WSOA 3NJZA 1NAEA 4HK8A 1WBFA 2B4KA 2VCCA 1ASJ3 3PP5A 2P2KA 4P9JA 3PHLA 3SHRA 4ARYA 5GKAC 5LBBA 4C0BA 2BDRA 3AKQA 2VZ1A 4K9SA 2JG8C 5KAFH 4DT0A 3P3PA 1Y8AA 3VZOA 3WG2A 1QJY2 2Q8CA 4N9IA 5JOXA 3UK9A 5A70A 4F3JA 2H0VA 5LASA 3P32A 1SQPD 3F2ZA 4W6YA 2KZJA 4JX0A 3L75D 1KB9H 2MNGA 4C1XA 3KM5A 1AYM3 3LEMA 1YIFA 3N9QA 1ZV8A 1UIIA 1AXYA 2VMCA 5APTA 5FOJB 3AYEA 1CAXB 1N7SC 1XPWA 3ZYIB 4QQPA 4ZS3A 5CCHC 3SCFA 1KDKA 2D3RA 3C1LA 2WWUA 1IFPA 2PLV1 1OLME 4AHYA 5ABJC 2ES3A 1ND3B 4XBLA 3THDA 1YFYA 5L7OC 1VLNA 3S7IA 3O1RA 1H0BA 4LO4B 5C8CA 2LRPA 2W47A 1G1IA 2Q3IA 1SQXD 2D2CB 3WQ7A 3A5TA 2B45X 2J7MA 1VQOP 3ZXDA 4GMP3 1UAIA 2QE3A 5BNOB 2W3JA 3NV4A 3SWFA 2D43A 3GF3A 2JDMA 2ZX0A 3M7AA 4JTNA 4XAEA 1WD3A 4GIFA 4GB31 2MHFA 4C90A 3O0XA 4IE0A 4XQDA 5JSPA 4PQQA 3TRSB 3TNQA 1ZRRA 1XNAA 1HGZA 4AQRD 2J59M 2JWAA 3AE6C 1NX9A 1POV0 1RUJ3 5F6LB 3TB0A 1RUC2 2Y0IA 4RS5B 2QQPA 1FZAA 5I0TA 3C9IA 1PP9E 4IL7A 1R1A3 2HR3A 3M06A 5CNAA 4AEMA 4CUAA 5G05L 1H4HA 1OOPC 3NW4A 2EAAA 3JBG2 1DQ4A 2IBZE 3Q8CA 3VHOA 4IGQA 4BK5A 1W2AX 4CU6A 1ENRA 1ZA7A 2VY0A 4M01A 3V4WA 1ZZ7A 2QQWA 1VBA3 5CBNA 5AVVB 1D2SA 2ZEWA 5ABJB 1OKQA 2RS11 1G7YA 4NVPA 2O1KA 4COZA 5KLVG 1USDA 1O91A 1OSGA 2VW2A 3FHIB 3V2PA 2PFWA 2IFNA 3H3UA 3LWCA 3VB9A 1JUIA 5AW8B 1IPSA 1KJRA 4MGZE 5B2GB 5BNOC 1DZQA 1FU1A 3SWYA 3B5NB 1GWLA 2OYZA 2QSIA 5CHXA 1Q8OA 2AXTE 1YWKA 1ZRCA 1G9DA 2XJVA 4CUBA 1JCDA 2WMMA 5KJ7C 3PRJA 4ASWA 1ZBE2 4LLHA 5AW2B 1NZCA 3AK0A 4NIDA 1QJEA 2C26A 1TZOA 2E33A 1COV1 3J7MA 2YXRB 4Q26A 4QXHA 1J59A 5C3SA 5DABA 2Q1FA 5I8SA 3MTUE 5CKNA 2ZKNA 1WA4A 1KYOE 1M1JB 1MZFA 5L19A 5KXCA 3CXHD 2I45A 4B1LA 2A06G 2DTYA 4I6MC 1UQXA 1V6KA 2VZPA 3L74G 2R043 1C57A 4A6OA 1VBC1 1VQ9P 1Q81Q 1UPSA 3WW1A 5JMCA 2PAJA 3SEEA 1NA1A 2IZ0A 4HVQA 1NU1E 3HTKB 1FOSE 1V0AA 4JAAA 2FFDA 3CO2A 4A7KA 4IQPA 3ZSMA 5FKBA 4FPYA 2QM7A 1LEMA 3LIGA 2JKXA 1LTSC 2Y0DA 2AACA 1DH3A 1ACCA 4BA6A 2KOGA 3MFAA 4CPBD 2OVUA 4YGDA 4LK6A 5FIXA 3OPWA 3SMHA 3B5NC 2BBAA 5DUVA 4FPCA 4QX2A 3KPEA 4XJUA 2BYVE 5KHHA 2CAUA 3B9IA 1H0TA 3HPNA 5J3UA 1RINA 2RN0A 3BB6A 4R8HA 2Y9ZA 4JZRA 1RF0C 1MFZA 3QBQA 2E74B 4YVWA 2YYOA 1S0DA 2EALA 4AFAA 4Y1UA 1T2KC 1FMD3 2WSVA 4D6TE 2DVBA 1M1JC 3O7OA 2WINB 4JDOA 3N3HA 4XILA 5FCCA 5FZOB 2W2IA 5A7SA 3VBRC 4QDRA 5FP9A 3WHUA 1GP4A 3ZVXA 2ZABA 2OYHC 4DQAA 2KM2A 1XYNA 3KB5A 1QX8A 3D6ZA 5GTHH 5FR3A 4BU2A 1S5LE 3TDKA 5FK8A 2G4IA 3FXEA 4AUWA 1CAWB 1FDOA 4QDSA 1VRBA 4QPGB 5GZCA 1BSNA 1H1IA 3HUSB 5FPVA 5FO8B 3RK3B 1W3XA 3L75G 2IBZI
chains in the Genus database with same CATH topology
3LZZA 2JENA 1JUHA 1RHI2 5DDJ2 1AXZA 1REEA 1Z7S3 5ACA3 5H9QA 4KH9A 4ES8A 3POYA 4FPJA 1E57A 4FOWA 4FPOB 1TE1B 4IV3A 4XFGA 4HMZA 3USSA 1HKDA 1CAUB 1H8TA 3AKSA 4YZ5A 3WG1A 1NQDA 1G9CA 5BNPA 1AL21 2GN3A 1T6GC 1Z78A 3BIWE 5A33A 4WZCA 1KDMA 2PHDA 4QX5A 4XFFA 5BPXA 4RQPC 4YRDA 4SLIA 1SLTA 2E6VA 2MEV2 1UZYA 3H0OA 3OTFA 3WDYA 4OFGA 4Q2FA 4B7EA 4RHV2 1HQNA 4F83A 5I0SA 4Q0SA 1QF3A 5K8SA 3D8CA 4KG8A 3WP5A 1FMD2 1AF9A 3AYCA 4EN0A 4FPEA 3QACA 5KXDA 4GH4A 4JGYA 1XRUA 3ES4A 2CGPA 2D6LX 1KXGA 1Y3TA 4RR3C 4P9YA 2ARBA 2RS13 4Q27A 5FMOL 4M0NA 4E4SA 5JPMB 1HV1A 1NE4A 4B4RA 3H7JA 4D7YA 2DUPA 3M3IA 1EPWA 3KT4A 1WW6A 2A6VA 3RWNA 3OPZA 4IEOA 3VKNA 3W59A 1O5LA 3K51A 2A6WA 3HMYA 4N90A 2D93A 3DPRB 4FO9A 1ND2C 1QOOA 4GKYA 2GN7A 2CNAA 1IS4A 4XQ4A 4XMIA 4YG0A 3WDVA 4CP1A 3UL2A 4AHZA 3INAA 4YZ1A 2A7AA 2R041 2ZBJA 2HYKA 4MV2A 3Q9OA 3PHMA 1LENA 2TEPA 4WM7A 1B35A 4CP2A 2HKXA 1N3QA 3VHPA 4P14A 1C8M1 4LBNA 1DGLA 3ZFGC 3DF0A 2ZA9A 4QU2A 1OPMA 2ZZJA 1HRI1 1BEV2 2VQAA 4H14A 4DFSA 2XB6C 1O3SA 5JCTA 3FZ3A 4Q8LA 1LOCA 1V6NA 3R4DB 3WP4A 4LUMA 4XFBA 5LEKA 1FAYA 1UKRA 1AR93 4M3CA 3WP6A 2WL1A 2AR6A 3N7JA 2ENRA 3MIBA 1M06G 1I5ZA 4UBHA 4PF5A 4E2GA 1VALA 1OQ1A 1PIV3 4YW5A 5A3MA 5FMOS 1GQGA 4R9BA 3IWZA 1Q5OA 1YI7A 1LOEA 4QPIA 4Y4YA 1FNZA 2ZHKA 1BKZA 4L92A 4P9GA 5KXEA 1B35C 1LULA 1HRV1 1WCSA 1X8EA 4O9GA 3S6PA 1Q3EA 2XKOA 4H55A 4U36A 1F2NA 3ETQA 3WY6A 1SFNA 3NKGA 4LT5A 5GJ6A 2WZR3 4KU7A 4S2DA 1ZYBA 2ET1A 4FAHA 2DVDA 1GR3A 1YHFA 2NMNA 5F1RA 3KMHA 2ZHNA 1G9BA 1CPMA 3RMYA 1QY4A 2PAMA 2DTWA 5DUXA 4AGGA 5I91A 1NLRA 3S0MA 3MLJA 1B35B 4G4FA 1ULDA 4R9DA 5C4WC 4Y22B 3VBRA 2WNVB 1X50A 4OULA 3GF6A 4BLIA 4Q0PA 1W6MB 4JDMA 1RUF3 3WNXA 1W0OA 1BYHA 3IDEA