3USSA

Crystal structure of cysteine dioxygenase from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structure, Kinetics and M ssbauer Spectroscopic Studies of a Bacterial Cysteine Dioxygenase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3ussA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ussA02
5FQ0A 2I45A 4QGMA 3WW2A 3E97A 2Q4SA 2D5FA 2GH2A 1SQ4A 1RGSA 3BCWA 4BYYA 3I59A 4F7ZA 4YNIA 4KWJA 4XFHA 4FT8A 4Q0UA 3TNPB 2XLGA 1ZX5A 3E6DA 3U10A 5JSPA 2XGXA 4MGZE 4JVAA 4DJGA 3MYXA 5LRRA 1GQGA 1DGRA 3H1YA 4FBFA 1VJ2A 2EVXA 1ZZCA 2D5HA 2WC2A 1J3RA 5I0UA 3DKWA 5FLHA 2C0ZA 1CAUB 4XF4A 2MPFA 4LUMA 4META 5FLIA 3LA2A 4N9IA 4XFIA 4J1WA 3FX3A 2PTMA 1NE6A 4YARA 2PAKA 5T3NA 4D7SA 4N9HA 4MX3A 4MH0E 2PA7A 1O3QA 3I7DA 2IXKA 4QGLA 4EV0A 4PJYA 3ZDSA 5J48A 2Q1ZB 4MGKE 1YFXA 3IDCB 3EHKA 4R8HA 4UBHA 2Q0AA 2GC0A 4QX5A 4IEWA 1PM7A 2BNOA 3HIFA 5JAXA 2CAUA 3KMHA 2QVSB 1NYWA 5KHIA 3QOPA 1E79H 3MPBA 2E9QA 4P9GA 4WBBA 3BALA 4IEUA 5J3UA 3R6SA 4L2NA 3E5QA 3HT1A 2ET1A 2IC1A 3UKVA 3NJZA 4LUKA 3CLPA 1UIJA 3ELNA 2PFWA 3D0SA 2UY8A 3L2HA 4EROA 4MGYE 4XETA 1SEFA 3S0MA 5FCCA 2UYBA 2IXJA 5K8SA 4ZU5A 1WA4A 2GU9A 1DGWA 5LRSA 5KHKA 4X6RB 1J58A 3SHRA 3LWCA 1Y9QA 1EY2A 3FE5A 3LA3A 2ZKLA 3ES1A 5FPZA 3SCHA 1G6NA 1ZZ7A 1RC6A 2WFPA 1EP0A 3H3UA 1CAUA 1CAVB 4YRDA 1XE8A 4XFBA 2Q30A 3CEWA 5JR7B 5C6CA 1RUNA 2B5HA 4Q0QA 5FPXA 4AVBA 3HT2A 4I0BA 4IESA 4B29A 1JUHA 4UBGA 2VECA 5F1RA 1FI2A 4H7LA 2PYTA 3E6BA 5I93A 1LB2A 1YFUA 4IEXA 3RYPA 3RYKA 2V09A 4EWEA 5AVPA 2H6CA 5HI0A 5JSRA 3EFFK 2DCTA 4XF0A 4XF1A 3EO6A 3FZ3A 5EFUA 5FLJA 1NXMA 2EAAA 1LRHA 2KXLA 1VR3A 1QY4A 1V70A 3SCGA 1WLTA 1OD5A 3D82A 1OMIA 2Y0OA 4D7TA 4XF3A 3UKTA 3RYRA 2K9ZA 1O3RA 4RD7A 2K0GA 4LA3A 4CYDA 4I02A 4O9EA 2UY9A 3DN7A 3KGLA 3U0ZA 2PHLA 4LEJA 5LEJA 1GQHA 2OYZA 1O4TA 5CU1A 3BB6A 4E2QA 1ZZ8A 1ZNPA 1X7NA 1XE7A 2MHFA 1J3QA 2OZJA 3OCPA 3KGZA 1J3PA 1RUOA 1O5UA 3OGJA 4MZUA 1O3TA 1SFNA 3H1MA 2W6JH 3NSTA 3GYDA 1NZCA 4Z82A 3H9AA 5LEKA 5EZWA 3NL1A 2XLAA 3RPQA 3OTFA 2WSSH 3PJSK 4HSJA 1UCXA 4JTNA 5KHHA 2OPKA 3FHIB 4NVPA 3RZZA 2XKPA 4O9GA 4IERA 1ZREA 1ZZ9A 2CGPA 1YUDA 4AXOA 2F4PA 4K8FA 1CAVA 1JEKA 4OLLA 4Q0VA 1BSHA 1CAWB 4IEPA 1AQTA 2E5TA 2BYVE 1X8MA 4HN1A 5FQ0B 2OZ6A 2XLFA 4LULA 4QXKA 3IBMA 1YLLA 3H7JA 2GAUA 1I6XA 2O8QA 4J1XA 2GC1A 1X8EA 2XL7A 1WGPA 2P17A 5I8TA 2VPVA 1O3SA 3MZHA 4YSFA 3G7DA 1TQ5A 4Q29A 2ATFA 2ET7A 4HLTA 4I01A 3U11A 4KWKA 4WVZA 1X82A 3LAGA 3PNAA 4IETA 1O7FA 2CV6A 1EPZA 1OI6A 1H1IA 2QE7H 5I0RA 4IEZA 2BEOA 3BU7A 2H6BA 4PIXA 3E6CC 4YXWH 5E1RA 4HVQA 1Q3EA 5I91A 4I2OA 1EYBA 3ES4A 2D93A 5BUVA 4AQ2A 5D1IA 4PIZA 4KU8A 1H1MA 1UPIA 1HW5A 1UD1A 3HQXA 4XFGA 4YYOA 4MUVA 3OD0A 5FDBA 2GC3A 1ZVFA 3SCFA 1I5ZA 4QMAA 4BH9A 1XRUA 2FMYA 4I3PA 4WZCA 2VQAA 4R52A 2PQQA 1OFNA 3ROUA 1YWKA 2XKOA 4XFFA 2JDIH 4AVAA 1NE4A 5JCTA 2IXHA 1IPKA 4MGIE 3E5XA 4IEQA 3FFQA 1LR5A 3H1WA 5KHGA 3ST7A 2FQPA 2QNKA 1Y3TA 4AVCA 4HZFA 5BPXA 1CAWA 1Q5OA 4HVOA 4HSLA 2IXCA 3CJXA 4LLOA 5CVRA 4XFAA 3S7IA 5E16A 1CX4A 2XNDH 1J1LA 3SXWA 1YFWA 3QACA 2B8MA 1ZRDA 4OFGA 2QJVA 3MDPA 3TNQA 2CK3H 5I8SA 1Q43A 3SMHA 5BY5A 3IWZA 3M3IA 1CAXB 5BV6A 4LTAA 4JTOA 4AQ6A 4F8AA 2EA7A 3H7YA 1ZRFA 5I0TA 1VP6A 1L3JA 3H50A 1CGPA 5KBFA 2V7QH 2IXLA 5I8YA 2UYAA 2E5YA 2BGCA 4BHPA 4MV2A 1IPJA 4HMZA 3IIAA 4GULA 3RDIA 2QDRA 4IEVA 4ZU4A 2H0VA 3ACLA 2IXIA 3KSCA 1ZRCA 2PHDA 2XHKA 5I0SA 3KCCA 4KL1A 4XEZA 1FT9A 3NW4A 2HJIA 1UIKA 5JSOA 3BPZA 3CF6E 3DV8A 3UKNA 4EWDA 1RL3A 3OF1A 4HVRA 2GZWA 4UXAA 4E2SA 3ETQA 2ZCWA 4HBNA 3WW4A 2MNGA 4X6QB 2XL9A 5CADA 3I59B 4A2UA 3EBRA 3VHRA 4FAHA 4XFCA 2ETEA 3CO2A 4IEOA 4QGNA 1LKNA 4KWLA 4ZU7A 3CL1A 4I09A 4ORFA 3D0JA 3E5UA 1QXJA 2Z2SB 1IFPA 3LOIA 1FXZA 3PLQA 3FWEA 2N7GA 4QM9A 1ZZBA 1ZZ6A 2CAVA 3B02A 4Q0SA 1PMIA 4I0AA 1RTVA 3WW1A 1DZRA 3WW3A 1QWRA 2PAEA 4QM8A 2Z69A 3O14A 3EJKA 1YFYA 2BNMA 4Q0PA 3C3VA 1ZRRA 3USSA 3PVBB 4TLFA 3M70A 4EWAA 4DINB 2BNNA 2O1QA 2PAMA 4Z07A 3S7EA 4LA2A 4JV4A 1J59A 1CAXA 3JZVA 3FJSA 2QCSB 3LZZA 1YHFA 4FAGA 4E2GA 4BIFA 4ONUA 3RNSA 5J7MA 3GBFA 3EQEA 1BSNA 1O5LA 3N4MA 1FS0E 2OA2A 3H8UA 5BXXA 2B9UA 2GC2A 1DZTA 2D40A 5KHJA 3NKTA 3H3ZA 3NVCA 3LA7A 3I54A 4IEYA 1QXRA 4XF9A 4L11A 3IDBB 1U12A 4KU7A 4PIYA 1UW8A 5C8WA 3DL3A 2HKXA 4HN0A
chains in the Genus database with same CATH superfamily
1DCSA 1TMF3 5J37A 1HRI1 3E97A 3MHZA 2HWB1 2Q4SA 2PFXA 3OGVA 3CJIC 4C7NA 2G4IA 3RJ2X 3ZFFC 4QB2A 4U7JA 3LIHA 2XBO3 5I0UA 3CCJP 1AJOA 4XJZA 3RZJA 1BE3J 2KZIA 2Z4FA 1YTZI 4WY4A 2PRRA 3U1AA 1YTZT 5KXEA 5J96B 2QQOA 2IFNA 3PTYA 4UW4A 1KV4A 3LEIA 1E57A 3A0HH 1TME2 1VAMA 3WDYA 3TEWA 2HR3A 2UWAA 2MEV1 4QDSA 4PJYA 2VOKA 4MGKE 1NU1E 1YFXA 4R4XA 2ZBJA 5EHDA 5J1XA 4IEWA 4ZS3A 4XJAA 2A70A 5KHIA 4HONA 1USDA 5J3UA 3KT4A 3LF7A 4URTA 1K04A 2JB8A 4QKDA 1W9FA 4LUKA 3Q5RA 1N8RQ 2R49A 5AVZB 5SV8A 1C5HA 4YPCA 3RZHA 2W2IA 1LODA 1UOBA 4ZU5A 1E5SA 2RM21 3DPRC 4DB5A 4R9CA 3MF6A 1J58A 3FLTA 1SLLA 3JXSA 3GJBA 2ZJCA 5LA1A 4IE5A 5A32A 1O4YA 4JYBA 2Q9IA 2D7FA 1SLQA 5D8AB 4RSUA 2AACA 5JIAA 1JUHA 3EWKA 2VECA 4UBGA 1COV2 3ZFGA 4GWJA 4UW5A 2VCBA 4YZ5A 5FWEA 1XNBA 2NPSB 1RVF1 1WW7A 1Z7S3 4P9JA 2KXLA 1WBFA 4FP2A 3A7OA 2QJYC 4YPJA 1VBA1 4I02A 2PHLA 4U36A 4AGVA 4COZA 4C90A 5CCHD 5APYA 2ZX2A 4JGZA 4XDQA 4B4RA 1MQTC 2DWRA 1G2CA 2K1AA 1NU1D 1F4HA 1SP4A 3AE5C 4Y26A 1NZCA 5FMBA 2PLV3 3UJOA 4UB6H 3ZOIA 1QDCA 3HBZA 3A23A 4WV8A 2XKPA 2ZT9D 3QBQA 5A6XA 2CGPA 2VQUA 2RG4A 1Q8VA 1I5PA 2RJLA 1NKNA 2CPBA 3W9AA 1IOAA 2RMU1 2D3RA 1R64A 3ASIA 4NPEA 2VTFA 2HODB 1WGPA 4XMIA 3ON7A 1ZA7A 5IK7A 3SWFA 2W92A 2DUOA 3LDBA 1W6MA 4WY4C 2ATFA 3VMYA 5GZCA 3I2KA 3PNAA 2E43A 2GMMA 1LOEA 1RQUA 3KHBA 4GJYA 3ZPYA 4XDPA 2WR9A 3WP4A 1UPIA 3OD0A 3T0DA 3H1JE 1OA4A 5EPAA 3BODA 4KH9A 5F37A 1XSRA 5SV5A 5BNPA 1JO5A 4R52A 2WMMA 1GZTA 4IQPA 4QHOA 3M3CA 3CQOA 1AL0G 1LCLA 2ZGLA 2GUSA 1UU5A 2A45H 1F31A 1Y3TA 2B7YA 5L7OB 1RB8G 1Q82Q 1T2XA 3DXTA 5LASA 1VBA3 1CX4A 1YFWA 1S5LE 5H2FE 4NIAA 4NMIA 5K5GB 1BVP1 4ES8A 5ISLA 3KWVA 5K9YA 5GZFA 5I8SA 3TF5A 4FFIA 4CZSA 4COUA 1NTKE 2BGCA 3M3EA 3OAKA 2DCJA 4LO5B 2EIEA 2WSUA 3ZFGC 2OQ6A 5FYMA 4XILA 3MFAA 5JPMB 3M0DA 4EWDA 3SWYA 5KAFH 1NO4A 4UXAA 2EXIA 5FZ9A 1IS6A 1UKGA 3WNKA 3GZTB 2BP6A 3THPA 4GB32 2WPRA 3ZMNA 3CL1A 4I09A 5LK7B 3MW4A 2DUPA 4HANA 4Q4Y2 1QKQA 1WCQA 4IGOA 2YC2A 1U5XA 1BBT1 2ID4A 2ZXQA 3MZWB 2VZ1A 1OQEA 2BNNA 1LWUB 2ZXXA 3OG2A 5DJTB 1SQVK 2KA3A 1UAIA 3BI3A 4L8QA 3S1KA 3VUOA 1LTJB 2WS91 5GKAC 3JQXA 2FCTA 3AXDA 1UZWA 5C3OA 3NVCA 4Q1PA 3H8OA 4IEYA 4V1PA 5A3NA 2H88C 3HE5B 4XUPA 3LIGA 4Y99C 3DL3A 4WWIA 2QZ2A 4LOSA 4FPJA 1MEC1 1BEV2 3VHPA 1OVUA 1HB3A 4HOOA 4BYYA 3VDCA 1NTKD 2VMCA 3V4WA 4LBMA 2WSFH 5FYVA 1VRBA 3ZFFB 3T4HB 1RUI1 3C7FA 4FVVA 4IV3B 4Y1ZA 5A3MA 2N1TB 3G71P 3TN92 2ZGSA 1LTAC 3MHVA 1C8M2 1DQ2A 1LGHB 2FFDA 5BNPC 1VALA 3CMAP 4M3CB 3EHKA 1L0LG 4R8HA 5FOJB 1S0CA 1WD4A 2Q7CA 1JW6A 2ZX4A 1NX9A 1ST8A 2AR6A 2QJPB 3H1HG 3EFGA 5B4XA 4DMIA 2H89C 2BEQD 5JZGA 4NIHA 2ZEZA 3RI9A 4EROA 1RYYA 4XETA 4FPKA 4DIQA 2Y64A 3GW6A 2FY8A 1RMU1 4WM7B 1W8NA 1KQRA 2QKDA 1VBB3 3AVSA 2G19A 1NVOA 1MUUA 3M7AA 3SCHA 4N53A 4JQTA 1LGNA 1CAVB 3M0DC 1A3KA 3HNMA 4AVBA 3AKRA 3GXUA 4I0BA 5I0DA 3RL0C 3I3QA 3SKVA 1JI6A 5AVAA 4QX1A 3VBFA 1YQCA 1SQQJ 4BQXA 4XUOA 4SLIA 4IGPA 1H4HA 4AHYA 1NXMA 3JD71 2IWGB 3R4YA 4B7EA 5FIXA 3O1VA 2A06D 1D0HA 5EJZB 4MG2A 2V5DA 1L7QA 3MF9A 1JCCA 2BVVA 2RS11 1NTMJ 1RY3A 5CU1A 2A6VA 1X7NA 5L73A 2CWSA 4P9LA 3OCPA 2J1EA 2IZ1A 2BERA 3X29B 3B9CA 1D7PM 2N9BA 5F5IA 1HBWA 4AEDA 3NXSA 2OYHB 3H32B 3PJSK 4DUWA 1KXGA 4LBKA 1SQVE 4IERA 4DXRA 4NPMA 3T3YA 1CAWB 1SQPK 1HN1A 1UXZA 2JDYA 1FAVA 5IFTA 1Q8SA 2R5DA 3L73J 5JIUA 4PF5A 2O8QA 1MS5A 2EF6A 4OI1A 4LHSA 1JHNA 4PV1D 1GW3A 2WINB 1JY3P 4YSFA 1JYWA 3H1KE 1EXIA 4EN7B 1ULGA 4RGGA 3L75G 2AEFA 1V6MA 1LJ2A 1SPPA 1Q3EA 2VJXA 2J1TA 1H6XA 2FFDC 4CEYB 2QA4P 1ZP0C 1XPWA 5E6HA 3IN6A 2XZRA 1SQXK 4Z1VA 4HKLA 4XVHA 4F3JA 1UWWA 1W8UA 5KKZB 1AV1A 1CJPA 5BNOB 3AP6A 4CEWB 1YITP 1FV2A 1W2BO 3R4DB 5EXOA 5JZGC 1W8TA 4B86A 1BCXA 2ZVNB 3AL6A 3Q8EA 2IXCA 2IBZI 3WLUA 1NY71 1PIV2 3AE8C 3O1RA 2QJVA 2ZEYA 3SNMA 1K05A 1NA1A 1LGCA 1SQBJ 5T5LA 4PLOA 5FP7A 5BV6A 4LTAA 3AE4C 4BK4A 3ZKUA 3ZO0B 4YVSA 1SQVD 3AMPA 3KV5A 1X9VA 2RH0A 2FXPA 1NQJA 3NV4A 3SEPA 1OA2A 1FJKA 2J1VA 2XHKA 1RUF3 3KCCA 4LORA 2XONA 4XIKA 3VBFC 2P3YA 1EDKA 2YUEA 5AVVB 1BQPA 2A45G 4HBNA 5DZFA 2X53S 3UESA 4OHZA 3KCXA 1JTHB 2W0XA 4JGYA 4B1LA 2Y8KA 5LA2A 4FOQA 1L4AD 4NPFX 1A8DA 4XYXA 3J7MA 2HWF3 3PRJA 2PHXA 4R4LA 1PP9D 3GG2A 3L72E 4AHWA 4XZPA 3M3QA 1ZZ6A 4BMEA 2J59M 1QHDA 1KJRA 1HB2A 5TISH 1GNZA 3RWKX 4TTGA 2VTXA 3RZLA 3O1PA 2FD8A 1DP0A 1J59A 4Z1MH 1CAXA 3T1MA 2XHNA 2BCCE 4RESB 4BIFA 1BGYE 3BCCE 2ZVOB 1QJX2 2YMYA 4RR3B 5BXXA 4YLZA 4LC1A 5A3PA 4I0WB 2JG8A 3UT0A 2JE8A 3WSOA 3G4SP 4D0QA 3ZXEA 1H6YA 2GNDA 1U12A 3AKPA 4NO4A 3ZPOA 4C7RA 3TDKA 1ZBA3 1KYOE 4BQ1A 1SMVA 2B87B 1K9MQ 2YXQB 3HE4B 5JSPA 3ZXFA 4ET7A 1ZZCA 1VMHA 2WWWA 1VQ5P 2GP5A 3M9QA 4LE4A 4QQLA 4N9IA 3RMYA 2DTWA 2PAJA 1O3QA 1RJ8A 1LOBA 2ZMLA 1IJDB 5L9RA 5HCAA 3AEDC 2VZOA 1L2PA 1SQXE 2BNOA 4AW7A 1VBC3 4WBBA 1LTTC 2WT0A 1H9WA 2LROA 1VL2A 3UKVA 3PUQA 5DJUB 1K8AQ 4LLFA 1NA1C 1NCRB 1VQNP 2G3AA 4R9AA 5C9AB 5FXWA 1O91A 4UFJA 4R9DA 2BCCD 4YVSC 3N9PA 1OWAA 1BGYD 3BCCD 2JB4A 4YW2A 3RK2D 4Y1YA 5CFDC 3RGUA 3LA3A 4W65A 5A7PA 4Q4W2 2PHTA 3H3UA 5FUNA 5FK8A 4XACA 3AKTA 1ODMA 2YO2A 1KYOD 2V73A 3PVOA 2XUEA 4AQTA 3RL0B 1SQPD 1VF5D 4HL0A 2R073 4FQZA 3LFIA 5D2AA 1QDOA 2DCTA 1X33A 3EO6A 5A3TA 4YM3A 1VR3A 2JDPA 3CCRP 4OZXA 1FOD2 1NLQA 2Y0OA 2HEVF 4A7YA 1FDIA 4D8MA 5LA9A 3ZYRA 2K9JA 3DN7A 5K4LA 1LJ7A 1ZZ8A 2E75D 2XQRA 1LESA 2VOXA 2XWBB 1RUOA 1GL2A 5APTA 4M0HA 3ZSJA 3WF4A 4ZKTB 1SQXD 1EXJA 1H30A 3NL1A 3CKHA 3GCXA 2ZYAA 1QL1A 1LP1B 2JG8C 2E6VA 2Q8OA 3D71A 1HRV2 1KDKA 2F4PA 3MV01 4NPDA 1AR91 4Q0VA 1BSHA 2W8ZA 5APUA 2XU6A 3AMNA 2ZFCA 5AVYB 1IPSA 2W87A 1LT9B 1S2KA 5AW9B 1PGOA 2Y6HA 2D2CC 2GSYA 4XBQA 5I8TA 3U59A 2QEXP 2HLEA 3DF0A 2BVBA 1CZQA 2WT7A 2W6AA 1H1IA 5FO9B 1LTBC 4YVWA 5I91A 4CU8A 3ABZA 2CU5A 2ZZQA 4NIGA 5AW1B 1MZ6A 4XCBA 1NKGA 3LDRA 4B4QA 3S4RA 2FMYA 3KPEA 3CCQP 2BOIA 5JCTA 4Y4YA 1W0PA 4OCTA 5JI9A 2FKWB 4CP9A 3LIEA 3ST7A 2IZ0A 2FQPA 3KDPB 4HZFA 2VMFA 4D3WA 1VBD2 2M8RA 2JG9A 4V2WA 1EZVG 5E16A 4XW3A 5FY1A 3FUOA 2B8MA 4FOVA 3S5QA 1CR7A 4YW5A 5BY5A 3SFEC 3M3IA 2W94A 3WNNA 4A44A 5D21A 1EPWA 5CAZA 5A3UA 5A80A 1REEA 3H50A 5KBFA 4XAAA 4LK7A 3CCEP 4LMFA 4BWNA 4ZU4A 2VUAA 5IK8A 1ND3A 2C4XA 5FRAA 2Y9ZA 1YQ8A 1NAYA 5B66E 1KDMA 2XJTA 3OF1A 3JCIA 3U75A 1DFQA 1R1A1 2KZJA 2ZABA 3WW4A 2MNGA 3L74G 1R091 2ES3A 2V4HA 4GKGA 5H9SA 4GOFA 2I8DA 2YC4A 2WA3A 3V65A 3M4FA 3O1UA 2W52A 4ORFA 3D0JA 3M0AA 5GTIE 1IFPA 3USUA 3LQCA 4LO6B 3ZSKA 5IVCA 2HWE1 3I2GA 4CDXB 3ILFA 4N3YB 2WT2A 1GL2C 3ZN5A 3GGLA 3Q8BA 1N1TA 2OYOA 4HYTB 4EWAA 1JYTA 4EN8B 4FPHA 3WU2H 3JBG1 1JH5A 4OHWA 1K42A 3I49A 1OURA 1Q8PA 3APBA 2D40A 2BFUS 5B4NA 5CCHC 5E8AA 1RXGA 4Y5SA 5LBCA 4CCLA 1LULA 1S0DA 4RHV2 3WDTA 4QGMA 4Y5Z0 2A3YA 3VD7A 3N7NA 1UOGA 5C3RA 4DY5A 5H9RA 1RHZB 4QU1A 1TMF2 2OPWA 3LDKA 4H13C 1J1EB 1XU1A 1VJ2A 1J3RA 1SPPB 1MPXA 2D6KA 4YVWC 3WUCA 4PF1A 2NYYA 1JY3O 4AQRD 4FFHA 2PTMA 2XBO2 1RUG2 1KN7A 4PDWA 4D7SA 4CPGA 3KV9A 4JC1A 1SG3A 1AYN1 3C7GA 3MLJA 4B7KA 1FE6A 1R093 2C6SA 1L0NG 1KJLA 2JG9C 2RDSA 2RS53 2XJUA 3K4ZA 3N36A 1HLCA 4AI8A 3GDBA 1UKRA 1JZ7A 2ZGMA 4GIQA 1UU4A 5GTHH 1OLQA 2E32A 1U0AA 1NTZG 3WP6A 4EQVA 3S0MA 3O7OA 3BRTB 4QPWA 5LRSA 3N7KA 3WUUA 3LWCA 3I97A 4O65A 2HWC2 4Q4X3 5CFDB 1GP6A 1L0LK 2IUWA 1VQ7P 1ND3C 4XFBA 4AK3A 4ZY9A 3E7KA 4D6SA 5C6CA 5FZOB 1KZUB 4AEKA 1BXHA 3UGHA 2BOJA 1MV8A 4QB6A 3Q8CA 2IX7C 1FPN3 1VQOP 5I93A 2R16A 5AVPA 1H2NA 1NTMG 2WZEA 3KHUA 3L9JT 2D44A 1AXYA 5FPUA 1SVFA 3GNEA 4CDQB 3JU9A 4CUBA 1Y7BA 2VG9A 4LO8A 1KB9I 3POYA 1G9DA 2WNVB 3ZR6A 1GZWB 2PN5A 2A71A 4AGGA 3VN4A 3U0ZA 2VRSA 5AW8B 1Z7S2 1CQ9A 1UYXA 3PUAA 1RQVA 2AXCA 4AYUA 3WD5A 2JDHA 2E63A 1W3XA 3SITA 4XUQA 4TZDA 1OHFA 3FHIB 4YG6A 1CD3G 3LEMA 1AYN3 4FTSA 4K1YA 4JHZA 3JB4C 4AVTA 1SFCB 1A78A 3WCSA 3JQWA 4H44C 5FY7A 1VRH3 4HPKA 3BRVB 2GAUA 1GFF2 3B69A 1N7SB 2XL7A 3ACFA 3DYOA 1CI6B 2R061 5JXJA 2IVIB 1OW6A 4FOWA 1TQ5A 1FZBA 2R043 5JMCA 3CWBJ 4ARYA 1SQVJ 2RDQA 4OWFA 1U57A 1X9TA 4PIXA 1JZ8A 5ACA1 2FYNC 2YBKA 1W8OA 3ZXKA 2FHRA 3AMHA 1PMHX 3HQXA 4CCCA 3WG1A 3B7MA 1OFNA 2GUVA 4UI9L 1YWKA 1NJIQ 4AF9A 3MO4A 1SDDB 5KAIH 1GTWA 3QH9A 1RINA 2Z79A 3U4SA 2Q6QA 4K9SA 3U1CA 3FC0A 3S7IA 1DBNA 1PP9J 1NCQC 3P8MC 1WKYA 1Z0HA 1PPJG 5FTTC 4LO7A 1ZXGA 1W6PA 3N9MA 3IWZA 5HBAA 3H42B 3W68A 1VBA2 4AQ6A 3MLKA 3VYIA 2EA7A 3W59A 5IFPA 1H9PA 2IXLA 4BQ3A 2JWPA 4OI4A 4WVWA 4K21A 3OPWA 4KL1A 1N3PA 2HJIA 2VCMA 5GLTA 4UFMA 2Q8EA 3GLMA 2TBVA 4ITCA 3RBXA 2YBPA 4NN0A 2WZ8A 1RUD1 2XR4A 3EBRA 2ZGRA 4GJZA 1M8OB 4W6YA 3HTKB 2JDUA 1LTIC 1PMIA 4NWVA 1DZRA 2JDZA 4D6RA 1FZCA 2Z5IA 1LHUA 3VBRA 3MUY1 1UYYA 3VB9A 3BATA 1VB4A 4X8PA 3RNSA 3GBFA 3S30A 1FS0E 2B9UA 1Y9MA 5LZ6A 2E74C 1PZ9A 3AYDA 3MUZ1 2YKQA 1D4M1 4CCKA 3FN9A 3TNUA 2P2UA 2HKXA 2WO3A 3WF1A 3A3YB 3BPSA 1W2EA 3WMM0 5JXIA 2D5FA 5M1BA 5T5OA 4BRYA 1S0EA 2ZOEB 4GKYA 2ZT9B 2QQUA 1BGYJ 3BCCJ 4A3XA 1L0LD 3WHUA 1JM0A 1GU4A 3VKMA 1WRGA 5A7NA 5A1LA 3WU2E 4QPIA 4I1LA 4NRQA 3H1HD 2YMKA 2DCZA 3POFA 1QJFA 3HUSB 1AVBA 1SQPJ 5APVA 1RJ7A 1WWYA 5A3LA 3K77A 1N1SA 3VKLA 4H7MA 1NAEA 1N47A 4Z8BA 5C4WB 1Q8QA 1JOBA 2NN8A 2GNMA 2PHWA 4EIJA 1DQ0A 3E5QA 2WDBA 1V6OA 2BQPA 3KCYA 5IUQA 2QZ3A 2VZTA 4BQ4A 4BQ2A 3L75E 1ULOA 5LCWL 3RQ0A 2DU0A 3I5CA 4FTEA 2VXRA 1SQXJ 1P84H 2WFPA 1NG0A 1XE8A 2P6HA 1QH7A 1VBB2 2PQSA 4IE4A 1U5ZA 1DX7A 3E6BA 1LB2A 4IEXA 3RYKA 1DF0A 1QMJA 3ZDVA 3EFFK 1H8TB 1EV11 3ZM8A 5AW7B 3D70A 2J1AA 2WWSA 1S0BA 1JBCA 1ODNA 3ZFEB 3OW2O 3ZYHA 2F6BA 1ASJ3 5EP9A 4XF3A 1VBE1 4LQRA 4CTEA 1FZCC 4DZGA 1Z56A 3VBRC 1FMD1 3VBOB 4DT0A 3RS6A 1O3TA 1QJZA 1BCCG 3ZXJA 1SLAA 1WUVA 4A7PA 4GA9A 1AR61 3AP9A 4QX8A 3M9BA 3HEIA 3BU0A 5CG8A 4ATFA 1RUC3 4H44B 3L75D 4LULA 1VQLP 4GH4A 2BUKA 1AR81 2PGDA 4RS5B 3ZR5A 3VBUB 2V5YA 5FMOS 1W8FA 3VBHB 2XMLA 3A0NA 1QOSA 4AI1A 4MLOA 1S1AA 3O8ZA 2DCYA 1GOGA 5I0RA 4QPIC 4WZFA 1J1TA 1A02J 3O0XA 1VB2A 4FPFA 5AVWB 2NRGA 4EJRA 2VZUA 2GA1A 2GC3A 3CXHH 1OIPA 2ZHKA 4AHZA 1SCRA 1K3IA 1KS5A 4IFMA 5BNNB 1PO13 2E33A 4GDOA 1HX6A 4CP1A 1RUJ3 3ZSMA 3OY8A 4YM0A 3FHAA 1NCQB 4QT6A 3T08A 3II6A 3AMMA 2QTWB 4F8AA 5FYZA 5C3PA 1CGPA 2AUYA 3HQUA 1AYM1 2WQYC 1KITA 2D3PA 5F39A 4QPGB 1QX8A 1AR63 4NHYA 3TYYA 4XEZA 1FZEA 1MR5A 1XOYA 4QDRA 4MO3M 1H1AA 3UGFA 2DVAA 4BXSV 1W39A 3KXDA 3VZNA 3RMXA 3NAPA 4X6QB 2XL9A 2WNUA 1RUF2 2DBIA 2ETEA 4KBZA 3WNMA 1POQA 3VKFC 3NJVA 2BGPA 4XCAA 1AR83 5FZ6A 3INAA 3KVBA 3LOIA 4IV1A 1FXZA 2Y9YA 2JDAA 1GU5A 5JLVA 5BU8B 3N9NA 4NE9A 5F7UA 1VF5C 1ZYBA 1ZLLA 1H2LA 3KZIH 3AM2A 2HWF2 1QWRA 1PZ8A 2A45I 1W8ZA 2VL4A 4FOYA 1JZ4A 3MIGA 2O1QA 4XC9A 2XJPA 4ISRA 5KC6A 5DUWA 1XNKA 5F8PA 3PIJA 2OGUA 1DZTA 5KHJA 2E74B 3LA7A 3I54A 2QJKC 2GM4A 4URAA 5FP4A 3IAPA 2ILMA 4HPKB 4GH4C 1DIWA 2WSVA 2J1SA 3B3QE 1C28A 5A3WA 2KS1B 2VBBA 3WW2A 3RSJA 1F15A 5TJHA 2KK7A 4U3FG 1R081 2ZGPA 4OH8B 2WYFA 2QFEA 5H9QA 1ZV8A 4CUCA 1ZBA2 4HFSA 4MN4C 5KLIC 2P3KA 1JHJA 3LEKA 5FLHA 1FX5A 5FY0A 4XF4A 3T0BA 1AJKA 4PQQA 2YKOA 3S9OA 3AFGA 3U14A 4CXYA 4LKFA 3VD4A 2AXTE 2WPSA 2ZXEB 1QF3A 1ND2A 4YW3A 2WFF3 5J48A 2Q1ZB 3MD0A 4Y3OA 3H6PA 2QVSB 1APNA 4WM8A 2ZYGA 2ZEWA 1UMZA 4DRRA 3NO8A 4ASLA 4KGGA 3LD8A 5L36A 4PI0A 3L2HA 4K8RB 1VBC2 3FMGA 1W6PB 4LHLA 2JXAA 1WA4A 2GU9A 3V5BA 1IFDA 1M1KQ 4PJ0E 4CSWA 3LW5J 5DPNA 4FPEA 4KWUA 3VD9A 1L0NK 2IBZG 2X5IB 3OPZA 1VAVA 1SCSA 4HXCA 4IESA 4Q4V1 5F1RA 3ATGA 1DYOA 4A6OA 4KT0J 1PNGA 1LNSA 2WNUC 4MGTA 1JZ3A 4XF1A 2IVJA 5LWBA 5KTBA 1NTZK 1EZVE 2C9KA 1JYIA 2WITA 2EAAA 1LRHA 1LTEA 4IV1C 4JX0A 5FZ4A 2R072 1D0GA 1QQP3 3WV6A 1UU6A 4N7UA 3TYJA 1R083 2JECA 4RD7A 1H2MA 1J84A 1R5SA 2E53A 2QIWA 2UY9A 1WA6X 5HCBA 3B00A 5LEJA 1C8NA 1UL9A 1J3PA 2OYIA 3OGJA 5IWFA 3NSTA 1L4AB 2QG4A 1NTMK 4A6SA 2W5FA 4JDOA 2WRAA 1JUNA 2D43A 1WW6A 1XSQA 3AJYA 4H0LD 4CUGA 5IT6A 3P3PA 3VZJA 4QKNA 3L74E 3HBKA 4UB8E 3CWBG 1AR71 5APSA 5D8AA 1URQD 4LR4A 4LBJA 3CPWO 1LT1A 3Q2YA 5FYUA 5CYYA 3HPNA 3BN6A 1X8EA 3PIGA 2NPSA 2ZMKA 4BRYB 1REFA 1P8JA 5FY4A 1N86A 3MZHA 4Q29A 5AC91 4AFMA 4G9SB 4NR1A 5T5JA 1WBLA 2G9ZA 1TU3F 1OI6A 4YXWH 2Y0EA 1RUE3 1SZBA 3VP8A 2P67A 4I2OA 3ES4A 1PVC1 1ND2C 1AL21 4KU8A 1UD1A 3WUTA 1EZVD 4Q4V3 1I5ZA 1M06G 4XPVA 3PTRB 3AJZA 1E5RA 2HLOA 2YXSA 2FXOA 2IPPA 3FHQA 3CCVP 4WM8C 5A1AA 1MVQA 2W1QA 3L4FA 1RF1C 2QNKA 3TEZA 1X22A 3O0VA 1NT0A 1UXXX 4LLOA 2R0HA 4LBQD 2A5ZA 3QACA 2KSJA 2Q3IA 3EB7A 4KMQA 3TNQA 2HODA 2LXBA 2QE3A 3POJA 4JTOA 1G7YA 1WW5A 4YWAA 3H7YA 2XJRA 5IVVA 3AYCA 2HBTA 4HB1A 3TWIA 3L74D 4JBZA 4GULA 3RDIA 4W80A 3KSCA 3A0BH 2FDHA 2KUBA 3WQ0A 1STMA 1M1JB 1UIKA 2XV5A 3CF6E 3PLNA 1MACA 3A22A 5T52A 1L0NE 2GZWA 1OD3A 3DUIA 1HXS1 3RK3D 1PIXA 2A6ZA 2JP3A 4PD4E 1VPCA 3JSVC 3VLBB 3KQ4B 3DECA 3I2FA 3RK2B 1TE1B 4CCDA 4IEOA 3PH0A 4P08A 1FZFA 4QGNA 4COVA 4Y1XA 1KFNA 5KJ7D 1HJ0A 1NTZE 5FO8B 3CU7A 1PVXA 1RIRA 5L7OA 4QXCA 4ZPIA 3OBTA 3OUIA 1XU2A 2XVKA 1SQQE 1LHNA 4I0AA 1VF5B 3HD7D 2OYIC 1S5LX 1L0LJ 5DDJ1 2Z69A 2DURA 3NJXA 2R1DA 2JDNA 1DQ5A 2YV8A 3H1HJ 3FJSA 1G9AA 5J7MA 3ZXGA 3HR9A 3I2IA 3VHOA 3PU8A 1EAH3 4N90A 1NTME 1JUIA 2WQZC 2IFWA 5D8AC 5CB7A 3IFMA 2RR13 5JDBA 2E75B 3RL0g 4AZZA 1OOPB 2B9BA 2NPSC 1PGQA 3WXPA 3K51A 3ECQA 1RF0A 1WZXA 4JYCA 5FZ1A 4JKKA 3VP9A 4XFHA 5FY8A 4P9IA 1HV0A 3E6DA 3O1OA 1ZOYC 5F6LB 3AEBC 1O8SA 4ES9A 3MPPG 1JZ2A 2IZWA 3VDDA 2C0ZA 2VNVA 3L35A 1FV3A 5EIYB 1I3HA 2B89A 1L0ND 3V4QA 3HQRA 4J1WA 4PD4D 1NE6A 3I3DA 2VZPA 1MS4A 5DQ0A 2WPQA 1DQ4A 1LWUA 2NLRA 4ZXEA 1S0FA 4NHLA 2XQXA 1YI2P 1AX0A 2VXJA 5A7SA 3POWA 2KSEA 1LTJA 2HWD3 2GC0A 2ZTNA 5F32A 1Z78A 2JIJA 2VU9A 1NTZD 5FMCA 1NYWA 4NIDA 2VC9A 2E9QA 4IEUA 5DG1A 3MLLA 4Q5OA 3G9RA 2ZGQA 3HE5A 2WQ8A 4LITA 1OVSA 2ZAHA 5T55A 1R092 4XTMA 1REDA 2JKVA 1YEWA 4BM8A 3ZYJB 1DYPA 1O4ZA 5FMDA 3SH5A 1S5LH 5H2FH 2RS52 1T3JA 2Y34A 5CCGA 3CX5E 3WNLA 3TBDA 4ZZ5A 1COV1 1LU2A 4CDWA 2R1BA 1NTMD 5C7GA 3ZFFA 4W8JA 3ZYIB 3FE5A 3UL2A 1JCDA 1OF4A 1EP0A 2WIIB 2Q30A 4BDVB 4H55A 4IV3A 1LOFA 2N1TA 1DIPA 3MIHA 1OUXA 2B5HA 3OA7A 3FGAD 4Q4X2 3UNPA 1SQBE 3OBAA 1PGW2 4ZHNA 4FTBA 5HI0A 1HVVA 3H0OA 3L75J 2FYUG 1WCSA 4M3CA 1QIQA 3OJBA 1FPN2 4TSVA 2XUMA 3WDVA 4IV1B 1LOCA 2ADEA 5L7OC 2J1RA 4YFWA 2H0BA 2VZVA 2X10A 2HEYF 3O0WA 3K3NA 1EC5A 3B5ND 1GQHA 4HK9A 2KB7P 1ZMEC 1OH3A 3AE7C 4NROA 1US2A 5GM0A 1Q2NA 1IO4A 5CBNA 4WM7A 3H9AA 5LEKA 4KI5M 5C70A 1OVRA 2HYNA 4L99A 3TK1A 5FZ7A 1DEEG 3P32A 1VMFA 3D5OA 2KI7B 4BA6A 2RDRA 4NVPA 2Q1MA 4HG6B 4O9GA 3TGUJ 5FKBA 1CAVA 4N43B 3OUJA 5GLVA 1S4CA 5C71A 5FJKA 1QJEA 4ISQA 4AAPA 1HF9A 1IFJA 2XLFA 4UFIA 1AYN2 1RF0C 2XXZA 5HXVA 3VMXA 3CX5D 5AW5B 1W2OA 3H1IJ 4PI2A 1JOJA 1VRH2 3VDDC 2CTVA 4OMCA 1JY3N 2E42A 4KWKA 4WVZA 1FOSE 4QU2A 3ORJA 3ZLIA 4IEZA 2ZS6B 2H6BA 4LT5A 1J83A 1TG7A 2R042 2IYPA 5C3QA 2LM3A 5IJRA 1Y9BA 4QAWA 4YG0A 4F83A 1LTJC 2VOWA 3MW3A 2OUJA 1XRUA 2OYHA 2VQAA 5B5EE 3H32A 4CUAA 2D6MA 2KR2A 4NAMA 4IEQA 1UZVA 1PPJD 1ULDA 2OQQA 3KYQA 1RF1B 1TNRA 2Q1FA 5FMOL 1CAWA 4XFAA 2O1JA 1J1LA 2OQ7A 1ZBE3 5CCGC 2AZ5A 3WUVA 2RJKA 3NNLA 4QQHA 1YIPA 3GHGB 5EYXA 4CDWC 1UY2A 1HV1A 1RUG3 1ZRFA 5I0TA 2HG5D 4MGSA 1D2SA 4IV3C 1LOFC 1HB4A 4OUEA 2N1TC 1V6KA 1N1VA 1ZRTE 4YGEA 2P5BA 4GB31 3O6QB 4EOTA 3IMMA 1PX4A 4CEYA 1OA3A 3DV8A 4Q4Y1 5CBOA 1PGL2 5CFCB 4MYEA 1DHKB 5BNOA 4CEWA 2QJPC 4ZU7A 4L73A 3D6ZA 1W2NA 2ZEXA 3FWEA 2P7JA 2CAVA 3WVJA 2HWC3 3UK9A 3RGBA 2OYIB 2AREA 2NMOA 5LBFA 4W7ZA 4WM7C 4Y24A 3UJQA 2FZ1A 3POEA 3W20A 1QEXA 4RA0A 1YHFA 1Y4WA 3THDA 4BCUA 4E27A 1BSNA 2VD7A 3A0BE 5FZBA 1ULFA 4I3GA 4INDA 4PQ9A 2QM7A 2KP8A 3SH3A 5GZGA 1BHGA 3JCUE 2Q5UA 2Y60A 3WT3A 4MXWB 3I8TA 2HYXA 3L71J 3OBZA 1HRI3 1JTHA 4CPBA 1PK6B 2HWB3 1DG6A 2KLVA 3RVHA 2ZX1A 3B5LB 1ZRTD 3ZKYA 4OHVA 1BCCE 2GN3A 3TEYA 3LPFA 5FYSA 1GNYA 1AA0A 5GALA 2PHRA 4XFIA 1PZQA 3WDUA 4MX3A 2OYHC 3I7DA 4EV0A 4IL7A 3W21A 2MEV3 4AWDA 4QQ2A 3D3AA 4RR3A 1E79H 1IZ3A 3P5BA 4H2AA 3V0BB 4LBOA 4IE7A 1QL2A 5FZAA 2EICA 3ELNA 3PJQA 3CD6P 1SLTA 1BDDA 1LEMA 2YC0A 4AFAA 4DY3A 3CDZB 2BBVA 2B87A 2SBAA 3HE4A 1C1FA 4YXDC 3SHRA 3KD4A 4XQ4A 2RM23 5C5TA 4OUMA 2YKPA 5AVSB 3V2RA 1IGOA 4LPLA 1EY2A 2BTVC 2VZRA 5L19A 2VZSA 3WQ7A 1W2TA 1U5YA 3PUIA 5IHRA 1XTCC 2HFED 4CEYC 2LS6A 4K35A 4PBPA 3R4UA 4WY4D 3H1JG 2PYTA 2WO7A 4HK8A 2AYHA 4AFDA 2BBAA 5KKZC 3C1LA 3H3LA 5BNOC 3VOPA 4CEWC 5EFUA 1OUSA 5FLJA 1RVF3 1IFMA 5FV3A 3WUDA 4O9BA 3VGIA 1BCCD 4XUTA 3IN9A 3V2NA 1T2KC 2WSCJ 2ENRA 5ERLA 4GT1A 4RGAA 2NZ9A 3ZYBA 4RYDA 2OYZA 2L91A 5DAQA 1ASJ2 1NCRA 1XC6A 1J3QA 2XJVA 5C9AA 1PO21 2AGSA 4QHZA 1MZEA 3IB3A 3QH7A 2NZ2A 3K4AA 5EZWA 4DXSA 1KC8Q 4HSJA 3NV3A 2OPKA 2W9XA 1GU3A 4BE3A 3VBSB 2P6CA 2ZAEB 1JEKA 3I55P 2LXCB 1Q90D 2GNTA 2B46X 3D6YA 1KRIA 2JJLA 1FDMA 4YW4A 1KYOH 2RMU3 2P17A 1H0TB 4FP3A 3A21A 1DGRN 1RUC2 5CKNA 3VDDB 3VZOA 5DAWA 5AW2B 2JX9A 1EUTA 1LEDA 1X82A 2YFZA 3FXDA 4OGQD 2FDIA 2UWCA 3L74J 5CIRA 4AAXA 5E1RA 2IYOA 3WNXA 3KF5A 4A4AA 3PJYA 4AQ2A 3J8F1 4RR3C 4WZCA 3G6JB 1PIV1 1LP1A 1CN1A 1VAKA 1DLLA 3O5SA 2HBUA 2J58A 3DCQA 1C1LA 1NH4A 2VOVA 3T09A 4CDUB 2AH2A 4Y28J 3CBNA 1HQWA 1PGSA 4OQ8A 1PO12 1YQ4C 2AEJA 3AC0A 1LT9A 3WCRA 1W05A 1RUJ2 2P1BA 4AR2A 4CDWB 1YYNA 3WHTA 1S2BA 1VBE2 1PO23 1JB0J 3Q8AA 3N7JA 2A06E 4CP0A 1OVVA 5FK7A 1S3JA 3PVEA 1KS4A 1ZRCA 3OGSA 5C5UA 3BUCA 5JVVA 1I9RA 2WTYA 4FSJA 2PHFA 3D4KA 1AR62 2RV9A 3VHRA 3M1HA 3CO2A 2P37A 1FC2C 2D6OX 2E26A 4GMP1 3O1MA 2W3JA 3PLQA 4AHXA 3LPGA 2YBSA 1W9YA 3DYPA 3TSIA 1NCRC 3S57A 2FDGA 1QJX1 4P5YA 5C9AC 1BBT3 5IAXA 1AR82 4QXBA 4O7XA 3USSA 1NKZB 3PHLA 5F5AA 5A6QA 1TZOA 1L0NJ 1R8EA 1W2UA 2QCSB 3LZZA 5A33B 2Y6LA 2VCCA 3OJAB 4ONUA 3J8F3 1V9U1 2WBKA 2QQIA 4WVMB 2WS93 4U3FD 4J25A 4IXLA 3KZ4C 1NTZJ 4D6TJ 1GW4A 4KU7A 2NM1A 1S0IA 4GZ9A 3HD7A 2WO1A 4BZ4A 2FDFA 2BJSA 3FBYA 5FQ0A 4YW7A 2ZHNA 4IUGA 5FUPA 3ILNA 3BCWA 4YNIA 3RL0D 4Q8LA 1MEC3 2LRPA 2ZKNA 4LIVA 2XGXA 2RE9A 5KXDA 3MYXA 4FBFA 1QJY1 2SPZA 3G3ZA 1CAUB 1K5MB 1RUI3 4CDXA 1RH5B 1FZAA 2M0BA 2WZ7A 3GF3A 2M3EA 1AYM2 2YGMA 3CWBE 4XTPA 3V64A 4UBHA 2CAUA 2WZR1 4P9GA 1MZ9A 2FCUA 2GDFA 2ITAA 2BGOA 2WFF2 2ET1A 2IC1A 5FZLA 3NJZA 4GMP3 1O6UA 1LT9C 2OARA 3VV1A 1EUUA 2C9AA 4Q4W1 4UFHA 4IE6A 4MGYE 2H43A 3NV2A 3H1KG 2IFRA 2VVEA 5K8SA 2IBZD 1HIXA 5FZHA 3MTUE 1ENRA 3CCMP 3MW2A 4S2DA 1RMU3 1XYPA 5FPZA 1PP9E 2O1KA 2RS31 1RITA 1Q7YQ 2J22A 1V9U3 5J36A 1RUNA 3T2TA 4W6WA 3ZDMA 2QDNA 2FMDA 1K45A 4B29A 1O8PA 4NPRA 1YFUA 5B66H 1YCIA 4KG8A 5FPLA 1KQSO 4K6BA 1XJAA 4YZ1A 1V70A 3JD73 1WCDJ 5K0UB 2K0GA 4GQ7A 4CYDA 5GTIH 1GP4A 3TGUG 4L9BA 4I7ZB 4EN0A 2RS13 3HOBA 4E9KA 1QQP2 1XE7A 4ASMB 2VCAA 1HRV1 1R082 1YHQP 3T30A 1O5UA 3CWBD 5IAVA 2FYUK 3H1IG 3RZGA 3OTFA 2WSSH 2VW0A 5CFDA 3A4UA 1GICA 2ORXA 2M5AA 4FQ4A 1AXZA 4GWMA 4OULA 2E7AA 5FZOA 3HD7C 2QQMA 2WZR3 5LW9A 2Z5HA 1KFUL 1FJPA 1P84I 2LW8A 3FLPA 4QXKA 5FZKA 1LAJA 4CXWA 1SHWB 4I2LC 4CDQA 5EV7A 5JWPA 3L72G 1YXWA 4AGRA 2WNVA 3M8LA 1GZWA 1GK6A 1YNAA 4DCKA 2ET7A 4DOJA 4CDXC 4P5HA 1WMFA 2YXRB 1UMHA 1F5JA 4XA4A 2RS33 5GZEA 2CWMA 2BCCG 1C3HA 1EYBA 2VOTA 3J26N 1HW5A 1V6LA 4GWNA 2QQPA 4YYOA 1IC2A 2NMNA 3VZLA 3A2AA 1GANA 2CGNA 2WNEA 5CKQA 2LALA 1W0NA 1RUE2 3LW5H 2BEZF 2IFMA 4Q4V2 2AEYA 1Q5OA 1SFCA 4HSLA 4S2FA 2UWBA 2OTKE 3QH6A 4K3UA 2ADDA 3AMQA 1SQPE 1AXKA 4XURA 4J6GA 1IHMA 5FXZA 5GLWA 1G86A 1N7SA 1WT6A 1DU3D 1CI6A 4K7JA 2JD4A 3I3BA 1J1EC 4U2AA 4D6QA 2G9FA 4BISA 4HMZA 3PP5A 1PNFA 3ACLA 1YJLA 5FJHA 1UY4A 4LHNA 3NW4A 2AEZA 1MKMA 1S1CX 4K1ZA 2WWJA 2WLQA 4YZ3A 3ETQA 2VO5A 4TN7A 2VMEA 1JY2O 3T2OA 1CIYA 4FO9A 1G8WA 1QXJA 3NNFA 1AR72 3CXHI 3UV9A 2K9YA 3IM0A 1OF3A 3V0AB 1DZQA 1CPMA 2Z5WA 1HJBA 5DAPA 2P1JA 1NUKA 3EJKA 2R5BA 1YJNP 3PVBB 3M70A 2PAMA 4CCJA 1A34A 2B4KA 3WINE 3L71G 1F8VA 4B3NA 1O5LA 4RHV1 4MVTA 2GC2A 3B5NC 3POGA 2W1WA 1H8AA 3IDBB 4NHKA 4C0BA 1TMF1 3TAYA 1EAH2 3SEEA 4RL7A 2WUHA 4CDQC 2I45A 3PUHA 2WNVC 1SQ4A 4RFRB 1RGSA 1VQ4P 1DEBA 2RR12 4KWJA 4FT8A 4TLGA 3N4XA 2XLGA 2XBO1 4JVAA 3AE9C 4H0LB 3LOBA 4G3YC 3HTKA 3CL3D 2XJSA 3ZYPA 1URQB 4META 4PLMA 5M0TA 3RZMA 4BLIA 4N7IA 2PAKA 5T3NA 4B4PA 4N9HA 1KFMA 3OYWA 3CCLP 2W46A 3ZSEA 2RJ2A 1SFCC 4ZMDA 4ZS2A 3N3HA 5JOYA 3BVHA 3AE1C 4UYBA 5CCHA 2ARAA 1HXS2 2HWD2 1BCCJ 3GZAA 1N7SC 2UY8A 4L0PA 3AE2C 4XDOA 5KLVG 1CVNA 4D7YA 3KLSA 3F95A 1GKBA 4KQ7A 4XOGA 4X6RB 1Y9QA 4Q1RA 3NNJA 1GQPA 4WB4A 2D2CD 3WDXA 2FYUD 2BW8A 2H8PD 3N35A 4B8EA 1E5WA 1DGLA 3HT2A 1JU4A 5JUVA 3OEBA 4V2VA 4EN6B 3HUSA 1XNTA 1UMIA 1RUH1 4NRMA 1Z7S1 1JMBA 5C4WA 4LBLA 1CZSA 2KNCB 1BLZA 3D82A 3PTZA 2UU8A 1XNDA 3SKJE 2CGOA 1C57A 1ZNPA 4OUSA 5J98B 3RK3B 1YI7A 3MBWA 3KGZA 1A6CA 2VNGA 5DZGA 1GD2E 2GMPA 2PLV1 5E79E 5DAXA 4ASWA 2YIUB 1RE3A 2R32A 3LSEA 5B2GB 1N3OA 5GLZA 5ABJB 4W7YA 2YROA 1NXD1 4IOIH 2AEMA 4UF0A 1CZVA 5FBJA 5FP8A 4IEPA 1GWMA 3HD7B 3ZXAC 3VZKA 1AR93 3Q1MA 4XUNA 4M00A 3AP4A 2GNBA 4HN1A 1JODA 5FQ0B 3FFZA 1S9KD 1POV1 1ZRIA 4M4PA 1H8TA 3W5NA 4JDNA 1NTKK 1KEXA 1SLCA 1OQ1A 1LTSC 2J42A 3ZFEA 2G1MA 4XJ9A 1KQFB 2X29A 4M0NA 3AX4A 4HLTA 3IR9A 3LAGA 1O7FA 2CV6A 2O0OA 2BEOA 1KB9E 3DGTA 4GKXA 4P02B 3VBOA 2QVAA 2D93A 1U5IA 3PL0A 4PIZA 1IG0A 2JENA 4MUVA 1YYCA 3VDAA 1GL2D 4I3PA 3RZKA 1AJYA 2K88A 4CP2A 2XNXA 1IS5A 2JDIH 1XNCA 1RUH3 1SFYA 3FFQA 5F3GA 3CCUP 2VQTA 3AZVA 5BPXA 5FYIA 5CVRA 4JF7A 5C8CB 3MDPA 1JMUB 3KS7A 4KGQA 4RS5A 3VBUA 4DEVA 2ZT9C 3POSA 3ZMOA 3VBHA 3WG3A 1ZBE2 3T2QA 5IW0A 4FPGA 2QDRA 4IE0A 5FPVA 5F3CA 4QX7A 1Q81Q 1R5LA 3K75B 4H13D 4U3FJ 5LK5A 3KVAA 2WLPA 3HUSC 4NRPA 1UOFA 2W47A 4TWTA 4D94A 2ZCWA 3AKQA 1R1A3 1W6OB 1HWTC 5C4WC 3I59B 4FAHA 1CPNA 3W67A 3WP3A 1POV3 1LKNA 5BNNA 5E89A 3KM5A 4CCEA 1KB9D 5F2WA 3HN3A 3PUSA 1ZZBA 1JOPA 3B02A 3FBMA 1R1ZA 2B45X 2HWE3 5A7WB 2PAEA 4D6TG 1NCQA 4KBBA 5EWSA 4RN5A 1RE3C 1MZFA 4LA2A 5A3OA 1PX3A 4Y20B 4E2GA 1W6NA 1SBDA 3A7QA 1AX1A 4LHKA 3KT1A 5EJ1B 2M5AB 3JBG3 4QPGA 4C46A 4K3AA 3B5NB 3WNOA 3THCA 3ZXLA 4XF9A 3HNYM 3G6EP 1UW8A 4E4SA 5AW6B 2ARBA 1H8TC 3GBWA 4QKBA 3R0RA 3M9HA 3IZOA 3LEGA 3ZFEC 4NAOA 4LLHA 3TNPB 1XYOA 3IPVB 5BU5A 3VKNA 3H1LG 4QPYA 4BMBA 1HRI2 1VQKP 2JD9A 3JC22 2HWB2 3NQHA 3N9LA 3VBOC 1NLRA 2PXJA 2Y26A 3OUHA 3RG0A 5FR3A 2I07B 3ACHA 3KV6A 1Q86Q 2K2SA 1KD1Q 2IXKA 4QGLA 3EYPA 5G04L 1IG3A 3AZZA 4ATEA 5KR7A 3HIFA 1HN0A 3ABVC 4OGQC 2X05A 4B1MA 3CZJA 5DN2A 2MEV2 3N7MA 1IZNB 1K5JA 4AI0A 4YW1A 1SLBA 1IKQA 4JGZC 2KYVA 1B35A 2R7EB 4RS5C 5DXDA 3H8XA 2KS1A 1BDCA 1HQLA 3VBUC 3VBHC 1AVYA 2ZHMA 1VBB1 4H44D 3FWLA 1H89A 3H1JD 3UIAA 4LKDA 2POHA 2BASA 3MUDA 4DO0A 4YGDA 1G6NA 5A1FA 1RC6A 3PMSA 2RM22 3T97B 2R3SA 2W6BA 2W68A 2D6PA 4H7LA 2CSGA 3RYPA 4A3ZA 2H6CA 5A7OA 3HAGA 3WR0A 2O8OA 3BOPA 3L70J 1WMDA 4BWOA 3ZXDA 5BNNC 3B94A 1QY4A 3SCGA 1KILE 2CYFA 3CJIB 3MIWA 1DGWX 1KQLA 3FXEA 3PHMA 3UKTA 3RYRA 4LO4B 4X8NA 4Q8KA 3M2MA 2WO2A 1H88A 4BJ0A 3KGLA 1RVF2 1OFCX 3B01A 3CIHA 5FBZA 2HH9A 1O4TA 4CA9A 3BB6A 4L97A 4JKMA 3ZYGA 2UWJE 3KV4A 4OVNF 4EDFA 4AI2A 5F2SA 1GP5A 4QPGC 2WABA 1FU1A 1XXNA 3L36A 1GOFA 1L0LE 2VZ3A 5EYYA 2X5IA 2O01J 5FPAA 2DW3A 3CC7P 4C1XA 2OZ6A 3H1HE 3IBMA 3R4SA 4YGBA 1ENQA 5FY9A 3KHCA 4NHMA 5FO7B 2GC1A 3EQ2A 2Y0DA 3DPRB 2R063 5FZFA 3FWNA 2UURA 3T0AA 3DYMA 3J7LA 1BYHA 2QQVA 3U11A 4JPZB 3SLIA 5KWRA 2RMU2 1M57D 1W8HA 2WJSA 3A0HE 2OIIA 2J7MA 1TNFA 5GZDA 4DZOA 5ACA3 3OYWB 5D1IA 1H1MA 5FDBA 3V2QA 1L4AA 3SCFA 2WN3A 2AXTH 1KILD 2PQQA 1SBEA 2OTLP 2HPCB 4MGIE 3E5XA 3ITKA 4JZRA 2QJYB 3PURA 4HVOA 3RRDA 1B35C 3CMGA 5JOWA 2E74D 1FNZA 4OFGA 4XHXA 4W50A 1YJ9P 4XAEA 1K12A 3MUDC 1MQTB 3ZX7A 3SSUA 1JXNA 4BLJA 1OVPA 4PJ0H 5EJ3A 1ZM1A 4IEVA 2E31A 1YI9A 3C7OA 1RUF1 2D6NA 2WSCH 4GAZA 1PO22 1D2QA 4PV1C 5JSOA 1RL3A 4N78E 3OGGA 1A8MA 4LKEA 4BQ5A 3AEEC 1HJGA 2OUHA 1JNMA 2Y33A 4R9BA 2X09A 2XJQA 1RUD3 4GALA 4XFCA 4C7NB 2HWF1 2Y6FA 4XMAA 3MICA 1HH0A 4XIOA 4FPCA 4MADA 1FBMA 2N7GA 4WY4B 3GZEA 5JI7A 4D69A 5IVEA 2XH6A 3AP7A 4Q0SA 2VBPA 3O14A 3I3EA 2JKXA 4TLFA 3NWKA 4UB6E 3S7EA 3JZVA 1PMJX 3E1RA 3W5MA 1BBT2 4YM2A 2E76D 2VTXJ 2OA2A 4UF0B 3LFMA 1VPHA 4JAAA 1UY1A 2X5IC 2ZZJA 1NWQA 1UY0A 3Q5SA 1HB1A 2BZDA 4JKLA 4Y1UA 1VDFA 3MEPA 1ZBA1 3OPTA 2VH9A 1D4M3 3J8F2 3IAQA 2DYCA 4GODA 1M1JA 1QJU1 1DLCA 2FCVA 4UB8H 2RHPA 2WS92 2PP6A 3MIEA 4EE2A 3ILRA 3FLRA 2WSEJ 3TGUE 1CIWA 5BYNA 1W04A 3OGRA 5FZDA 4DJGA 1OXCA 4N53C 2EVXA 4M01A 3DKWA 1NYHA 3LGRA 3T2PA 1MEC2 4LUMA 5AVXB 1AVOA 5A32B 2FYUJ 2L9LA 3H1IE 4N78D 3QCWA 2FBWC 4K20A 3ZFGB 2YPJA 3VL8A 1L4AC 3LE0A 2C9NY 1W5CE 5DMYA 3ZDSA 1RUI2 5FWJA 4KNCA 1VBC1 3H1KD 3HJRA 5E88A 4ZKPA 3NMBA 5IVYA 4OGQB 2GH8A 1PL5A 5CJ4A 2EALA 4XJUA 2XPJA 1MFZA 1OPOA 2YFUA 4MGQA 2VNRA 3MV11 5F3EA 1UIJA 1OOPA 1RHI1 1LTGC 4JGZB 3D0SA 1UY3A 3TB0A 2WVRA 4LGDE 4YM1A 5A6YA 1GSLA 1JN2P 1G2CB 2JDKA 3O12A 1JYXA 3OB8A 4AEDC 5DUUA 2BWCA 4DNYA 3CZUA 5C39A 4CE8A 3WNPA 1QGKB 3KT7A 1U7MA 3LKJA 1PGPA 3I2OA 1OSGA 1F2NA 1RMU2 5FZ0A 5KAFE 4Q0QA 1F35A 5AW4B 1H8VA 2R3CA 2R071 1FI2A 2WNOA 4EZ4A 1FYUA 2V09A 1BE3G 5FYBA 4Y99B 2W08A 4GOEA 3TGUD 1WD3A 4C91A 1V9U2 1QJU3 3CC4P 1SACA 1BZWA 4AQSA 4PD4H 5KLVK 1EV13 1XBFA 5FZIA 2ZJSE 1MVEA 1T8ZA 1W6MB 1HJFA 2V72A 1O3RA 4QX3A 4KJMA 3GJAA 2JEEA 3L2YA 2ZX3A 3H1ID 1VBE3 4LEJA 1VMJA 1W9SA 5T54A 3JD72 1PV3A 1FMD3 2I74A 1SFNA 5AVQB 1N1YA 4BQYA 1W6NB 2VMDA 2DBNA 1XTGB 3AP5A 4IGQA 3U07A 4QDQA 5BNPB 1QJY2 2RS12 1J2JB 3AB0A 2VMGA 2N9YB 5IK5A 3L72D 4OLLA 1M1JC 5LA0A 5G05L 3CNAA 4P9YA 2AENA 5FYTA 1X8MA 2DVBA 1MS9A 3RK2C 1I6XA 1W99A 1GNHA 2P3IA 1ZN5A 4J1XA 4CU9A 2L5GB 1X8YA 1RHI3 3V6IA 2WZR2 4LIUA 2XWJB 1O3SA 2DU1A 5FZ8A 4RGKA 3G7DA 3ACGA 2YMZA 1NU1J 1EPZA 3R05A 3MP7B 5FPBA 3L71E 4XBNA 2W27A 4HETA 5FZMA 2VUJA 2RVAA 4AI3A 1S2EA 1ZVFA 4COWA 4JGYC 1WLDA 3HRNA 5EFWB 2TEPA 3VDBA 1BMV1 4Q2FA 2DF7A 3AL5A 3BTZA 3I4IA 2RS32 4AVAA 1NE4A 3ALQA 2JWDA 4AVVA 2YU2A 3C9IA 3IDEA 4ZXKA 2E75C 1H0BA 4YFZA 4N43A 1OOPC 1SFPA 1UOJA 3CI9A 4JQRA 1S0JA 1X36A 1B35B 1IK7A 1ZRDA 2PELA 4W6XA 3I2HA 4FXGB 1YIFA 1NHLA 1SS1A 2P34A 2JKBA 2MKVA 2LTNA 1A02F 3CX5H 3WG4A 1E5HA 1L3JA 1NY72 4I6MC 1GOHA 1KYOI 1V6NA 4UFLA 1AYM3 1X79B 3HD8B 1HQNA 2YNYA 3IKWA 3GCWA 5F3IA 1FT9A 2BFUL 4MHUA 2I1KA 4PV1B 4HVRA 3VL9A 3BTYA 3RI8A 2KIKA 2NP0A 5KXCA 5CADA 3F5HA 1GBGA 1WCKA 2ZACA 4Y1VA 1W9TA 5J09A 1OC1A 1RF1A 2CPSA 5KLVE 1VQPP 3L71D 3WQBA 4H14A 3WW1A 3V56A 4ZONA 1YFYA 4Q0PA 1S72P 1IKPA 2JR8A 2W90A 3H8RA 3C2UA 2FFDB 3GHGA 1LOAA 4PCRA 1XB9A 1UZYA 2QBXA 4FAGA 2JE7A 2A3XA 2Y6GA 5C33A 5JOXA 3EQEA 5FYYA 3IDAA 4XE9A 1Q56A 3O6QA 4NWWA 5JZGB 2A73B 2YYOA 4NJ4A 2Q8DA 4LNVA 3VTPC 1LHWA 4LXLA 2QQKA 5CFCA 5A6ZA 2P2KA 4NOTA 2BWAA 2VGDA 4Q0UA 4OMDA 3U10A 2ARXA 1YRZA 1PZ7A 5FXVA 2NPIA 3H1JJ 1DGRA 2WC2A 4DPNA 5CA6A 4N53B 3ACIA 2JE9A 3THTA 1ONAA 2GMEA 3MGUA 4GD4A 4XQWA 4YARA 2O3JA 1UPSA 3QLQA 3VBFB 4MH0E 5IYYA 1UIIA 2R44A 4QKFA 1F4AA 4N43C 5B5EH 4Z2WA 5KLVD 1M7LA 3QOPA 5DAVA 2RS51 3MPBA 2M3BA 2OS2A 3RWNA 2WKKA 4A7KA 5CBLA 4IFDK 3O1TA 1NTKJ 1G9FA 4S2HA 3ZN6A 4RKUJ 3WEZA 2CY6A 1DDLA 4MXWA 3RK3E 5F5CA 3J9SA 3S6PA 2Q3EA 5ANQA 2UYBA 3BIEA 2VAUA 3ZYFA 1PK6A 4Q4X1 1TVGA 4AEDB 2I2SA 5APXA 5L9VA 1PGW1 2VM9A 3L70G 1OLRA 2XVLA 2WZPP 4AFCA 1K73Q 4NIIA 3J7NA 1WMEA 2OW4A 1FPN1 2MJZA 5FY5A 4CCNA 3SISA 4BIOA 4L74A 4E4DX 1JY2N 2LR2A 4IL6X 4IW3A 5JSRA 1AQ5A 3AKSA 1QH6A 2FYZA 3NFQA 3CC2P 1CW5A 2DV9A 4XJWA 2V7QJ 1LENA 3V0BA 1OMIA 2GP3A 3ME2A 4LK6A 3K46A 4LA3A 5IVJA 5TISE 1NAFA 1OPMA 4MXVA 2ZA9A 3GHGC 3ZIXA 4E8CA 4MZUA 3H1MA 1X50A 2GALA 4ASKA 1V0AA 2BDRA 4Z2AA 3K3OA 3I56P 2B9VA 4RQPA 1H2KA 1YUDA 5IVBA 4R4ZA 1U7JA 1HDKA 3BTXA 4XBLA 1JYCA 1VRH1 5CFCC 2E5TA 1GDTA 3C8VA 5CISA 1AR73 1USEA 1GLHA 1YLLA 3SQOA 3JCUH 2VMIA 1NA1B 2Q1KA 5FYHA 5IATA 3O1SA 1AR92 1AFOA 4BXFA 2A3WA 4RJTA 2R041 4YVSB 2X8KA 4D6TE 2VULA 1SQQG 2XKMA 1GZ9A 3PDQA 4UAPA 5AC93 3H25A 3P8CE 4I30A 1NZIA 1G9BA 1JU3A 4BB3A 2E51A 2ORZA 5CMZA 3HMYA 5L9BA 1RE4A 4XFGA 1PVC3 1AL23 3P3NA 3LB9A 4JGYB 4P9XA 4XQDA 4IL6H 3CHXA 1OT5A 4NHXA 5FAXA 2A6WA 4BOWA 3H1WA 3VBSA 4DOUA 5KC5A 2ZYDA 2P10A 4FFFA 2EIBA 1OQDA 4HKOA 1QNWA 2QQWA 2YZ4A 1RUH2 3H1LE 4AE2A 4C8DA 1IK9A 2W39A 2ZMNA 5CEHA 1PK6C 5FUIA 3W58A 3K5BA 1Q43A 3IT8A 3EMRA 1H0TA 1WLWA 1CAXB 1TME1 1KILA 2NPSD 3L73G 2K3RA 3VD5A 1PGL1 2UYAA 4MV2A 2Y6JA 5JR2A 1EDIA 2H0VA 3C8XA 2JG8B 5L8RJ 1F9KA 3LSDA 4TXWA 2PLV2 3VMAA 2A7AA 3BPZA 2WQ4A 3WF2A 1ZA4A 5FZCA 4PHZA 1UNBA 1HXS3 4MHRA 4A2UA 4D6TD 3AFKA 3MIDA 3WP5A 2D2CB 4A45A 2F17A 3HNBM 3E5UA 1EDJA 5F9TA 1D4VB 3P8CD 3DEMA 2G8YA 1R1A2 2BV4A 4CDUA 1EQ7A 5TSWA 4K40A 1NLSA 2C26A 4PDWC 1JYVA 5DDJ3 2O01N 5DABA 3ZIWA 1GR3A 1Y8AA 5FOBB 1W6QA 3AK0A 3M3OA 2HWE2 3WG2A 1YO8A 2DDUA 3UETA 4RQPC 1T6BX 2FDJA 3N4MA 1LECA 1UZ0A 1SQBG 1GMMA 1HKDA 2F4LA 1KMIZ 3H1KJ 1VQ9P 3B4SA 3H1LD 2TUNA 1LOGA 1JMMA 1ULEA 3JBG2 2PHUA 3KQRA 2YB7A 2GH2A 3AECC 3AEAC 4F7ZA 4AI9A 2VVDA 2YG0A 5APAA 3VKOA 3URFA 1T6GC 1PPJE 5LRRA 1GQGA 5JPNB 1TME3 4DQAA 4JDMA 2RN0A 4EYUA 4Y33A 4ARXA 1MS8A 4Y4RA 3LA2A 4BK5A 5BNQA 1RE4C 1PFIA 1IQDC 4WBAA 3B71A 3FX3A 3QWOC 3MFCA 3T1LA 2PA7A 2XDJA 5A33A 3P6BA 1DD4A 3VBSC 1MS0A 1CESA 1F5FA 1PM7A 4WVMA 4BPZA 2QUOA 1VQ8P 3BALA 5CG9A 4YTPC 1CONA 3BKZA 3R6SA 1CZTA 4L2NA 2K9JB 1V00A 1DQ6A 3NKGA 4UW6A 2PFWA 1G1IA 5LATA 2C1FA 1GL2B 1KILC 1SEFA 2IXJA 2SLIA 2AC1A 5FP3A 2V4AA 1UIXA 3U78A 1COV3 1JOCA 2EIDA 3ES1A 1OFSA 2O14A 4M3CE 2Y38A 1ZZ7A 4EI2A 1CAUA 1K5MA 5JOZA 3VN0A 1IQAA 5JR7B 3NTNA 3L72J 4Y22A 5FFOC 1OLME 1QXPA 4DEQA 1ASJ1 2YHJA 3BOWA 3U1XA 4TT3H 2DVGA 2CHHA 4MSVA 4AYCA 4GIFA 1OXZA 1WLTA 4CDUC 5LBEA 2BCCJ 2JWAA 2WT7B 1HGVA 3BASA 4D7TA 5DUVA 2K9ZA 2DTYA 4H13B 4OI2A 1ACCA 4G4FA 1S0GA 4YVWB 5JXHA 1YIJP 2NQYA 3N7LA 3TOJA 2OKXA 1HUCA 2W6JH 2YU1A 3GYDA 2WAAA 2BU9A 4Z82A 2PMWB 4OI0A 5CCGD 2XLAA 1YQ3C 1NGMB 4OHYA 4A41A 2BRTA 2G9GA 1UCXA 4JTNA 3MI8A 1GZCA 5KHHA 4WVVA 3RZZA 4QQPA 1ZREA 4CP9B 3D6EA 4K8FA 4AL9A 1RUC1 1NU1G 2JG9B 1AQTA 4LKSA 1AX2A 2BYVE 1BVVA 3WZ1A 5AW0B 4YZ2A 2N1TD 3F89A 5LB6A 1LHOA 2DUQA 2WL1A 1QVGO 2E76C 1PHMA 5K0UA 3D8CA 4I01A 4P9WA 4FPYA 3NV1A 2QE7H 1ND3B 1W3VA 3BU7A 3E6CC 2R062 2Y0CA 4L76A 4AOCA 4CCMA 5AVUB 1KTMA 4LBNA 4PT6A 2KXPB 2JDMA 1PO11 3ROUA 2XKOA 1SBFA 2WSFJ 1BEV1 5ACA2 3T4VA 4QD2A 4AEMA 1RUJ1 3ZN6B 3USUB 1QGLA 5GTHE 2ZHLA 2DCKA 3K4DA 4TYSA 3NMDA 1BJQA 2KLUA 1CJDA 1NQDA 3JB8A 3DKQA 1UQXA 2XVGA 2EXKA 2KOGA 3LCPA 3TN91 2V4VA 3SMHA 3CLQA 3NJYA 1C8M1 2Q5TA 5ANNA 5HPOA 1T6AA 2OTJP 1W03A 2XOMA 2RDNA 1K5MC 2E7QA 3JUUA 5I8YA 4A42A 2E5YA 2EAKA 1IPJA 1S4XA 5FZGA 1BKZA 4PBOA 1KGYA 2PHDA 1RXFA 2JJ6A 4FXKB 4GB33 3WF3A 1IS4A 4IL6E 3UKNA 2VW1A 1W90A 3GMAA 4Q4Y3 1AHSA 2W83C 2B39A 1QOTA 1FNYA 2DFCA 4ZZ8A 2WWUA 2VVFA 1DD3A 2Z2SB 1XE0A 2A1XA 4QM9A 1YQ5A 1RUD2 5T5PA 2O01H 2P58A 2Z4EA 1RTVA 1N73A 2BNMA 3GALA 3C3VA 4PDWB 2FYNB 3VD3A 2WN2A 4XXPA 3GBGA 3GM8A 3NRUA 1ULCA 2R6QA 4RQPB 3R2PA 1BE3E 1JY2P 4OHXA 1V6JA 1UO9A 5APQA 1FAYA 1NOVA 1BEV3 1QXRA 3KB5A 3C7EA 5AVTB 5KLVJ 2HEWF 4PIYA 2QM8A 5C8WA 1NOHA 3VMZA 1ALYA 1Y47A 2OXBA 4YG3A 4RO0A 1QU0A 1PGJA 1D4M2 1OH4A 4GMP0 1ENXA 1ZX5A 5K0UC 3TN93 1OKQA 2JICA 2CDPA 2CNAA 1C8M3 1X9PA 1ZR4A 3H1YA 2D5HA 1QOOA 4I7ZC 3DXUA 4QXHA 2H7HA 2MPFA 3V0AA 2DVFA 4E4ZA 2JIGA 4QHBA 1NTKG 1T2KD 1KFXL 2A75A 2VNOA 1X0TA 2WFF1 4N6JA 1DYKA 2W1UA 1JZ6A 4DRVA 5KAIE 1OW7A 3WY6A 4JQ0D 1DH3A 5IK4A 3RBZA 3K2OA 1GYKA 3HT1A 4S2GA 1MS1A 3I2DA 3CLPA 2D98A 4CCOA 1XNAA 4OVEA 3J7HA 4R4MA 1KILB 2A6YA 5GLUA 3SWKA 1DGWA 1QNYA 2QRXA 3HVDA 4CPBD 1BE3D 1G9CA 2ZKLA 3U37A 3BGAA 1Q8OA 5DZEA 1URQA 4YRDA 1H4GA 3CEWA 3AYAA 2ZGNA 2A6XA 5BVZA 4AVSA 5FPXA 3NNGA 4FFGA 4A7ZA 4M3LA 1OZHA 1UYPA 1JS9A 4FCAA 5FZEA 4EWEA 4QWNA 1YJWP 1BK1A 4XF0A 5CNAA 2VW2A 1BK0A 4YW6A 1QQP1 4BXLA 2FBEA 4HT1T 4DUVA 4U3FE 1C4RA 1QJU2 5JMOA 1JTZX 4BU2A 2TNFA 2FXMA 5FZ3A 1EV12 1N73C 1T3UA 5T50A 2GN7A 2C0WA 3A5TA 2XG3A 4YZ4A 2OZJA 1LU1A 5AVRB 1DQ1A 2HYKA 1W6QB 2VBDA 2A06G 3MIFA 4XJ8A 2RKLA 2WAOA 2WSEH 1M4WA 1W9WA 2E7TA 4E8DA 2EXHA 1WW4A 1TEIA 1FMD2 3IIIA 3B93A 2ZAAA 3LIDA 4H3WA 4LBQA 1N7LA 4ZKUA 1GWLA 2DFBA 4DXTA 3AZYA 3H7JA 3GHMA 1FATA 1HTLC 3GF6A 4C1WA 2Q8CA 3J4UH 2E76B 2VPVA 4OZOA 3FX0A 2J1UA 2XDVA 2KNCA 3TEXA 4Z92B 3FUQA 3SFDC 1RHI2 1VIWB 4DXZA 4LE3A 1RUE1 4UT5A 4GXLA 1IFIA 2VMHA 1WMXA 4LJHA 1KORA 5FKCA 5DG2A 1B09A 2IBZE 1AZDA 3NAPC 4QMAA 3KQGA 1WMKA 3IMNA 2QQJA 3UGGA 5KJ7A 3POIA 4XFFA 3HN1A 2IXHA 1IPKA 2YY1A 1PIV3 1SLIA 1I1EA 3CMEP 1LR5A 3OOXA 5ABJA 5KHGA 3OSDA 2WT1A 3Q9OA 4NPLA 1SQQK 3PMEA 1GMJA 2OT7A 5AFBA 3SC7X 2P4EA 5JXGA 3SXWA 3M91A 2W1SA 2C9LY 3L37A 4RFT0 1FZCB 5HV4A 4Q26A 3VBRB 3C7HA 3AZWA 4LOTA 2VY0A 4H0LC 3IAOA 1ZW0A 3PU3A 5FP9A 1P84E 1OBNA 1URXA 3BYWA 4P00B 1URQC 1QLED 3IIAA 1GWKA 1JYNA 4FI9A 3B9IA 5LY1A 2C0XA 3ZN4A 3TNUB 4ZNCA 5I0SA 2VUCA 4Y22B 4QX0A 3EXUA 3H1LJ 1SQVG 4E2SA 1IS3A 3U4XA 1YQ2A 3AVRA 3BIWE 1UN1A 4Q27A 1J1DC 4KWLA 1HGZA 1UYZA 1M56D 5CKMA 3QD6A 3AXEA 1UF2C 4UFKA 5C8CA 3WW3A 3L70E 2JO1A 4Y5TA 3AE6C 5FYCA 4QPIB 1QJX3 1UZZA 1ZRRA 3M06A 3AEGC 4DINB 3I3MA 3VHNA 4ASVA 4Z07A 4QX2A 3ZSLA 4JV4A 1W28A 1PP9G 3S5AA 1EAH1 5E79H 4KHXA 2W95A 4FPLA 2FZ2A 1OX3A 3AZXA 1LGBA 3KF3A 1EDLA 2YO3A 1W8WA 2RR11 1FOD1 1L7RA 2ZX0A 4L11A 2IDBA 4UW3A 4HN0A 1AF9A 2XB6C 1BMV2 4JHTA 3GZUC 1YC61 2ZGUA 1W6OA 2VQ0A 3I59A 1P84D 4MGZE 3E1F1 4BQWA 3RJRA 1MZ5A 1SQBK 5CHXA 3RK3C 1QJY3 3VZMA 5FLIA 2J5UA 3POBA 1EZVI 1KQGB 5A7WA 4OQ9A 3FL7A 1KB9H 3CXHE 2ZGKA 3I2JA 4UOJA 2P3JA 2YIUC 4HKZH 2R0FA 4CVUA 3MIBA 4MOAA 3P7KA 5KJ7C 2HWD1 4Y20A 3IDCB 1XQNA 1UX7A 2Q0AA 5ABJC 4QX5A 3GF7A 5JAXA 4EYYQ 1PM4A 3KMHA 3NNMA 5DUXA 3BVCA 3B5NA 1D7MA 2VE1A 5HCFA 3L70D 4L92A 2K46A 2KM2A 2KD7A 3OD4A 4EZHA 3ITQA 3OBRA 3K48A 5A70A 1CSBA 4Q4W3 4FPOB 5H9PA 5FCCA 1OW8A 1S55A 3V2PA 5KHKA 3IPVA 4JRLA 4IFFA 3HWJA 5K7PA 1QVFO 4AEJA 3ZVXA 3AYEA 5F5QA 4HKWA 3WF0A 1LNQA 1JZ5A 1XYNA 1W06A 1YJKA 1BGYG 2QJKB 3BCCG 1E5IA 1VBD1 1Y43B 1FOD3 4DUXA 3Q5PA 2YPDA 4GH4B 1ULPA 3FZ3A 2ARCA 1N3QA 3ETPA 4DS0A 3N9QA 2B88A 1KD7A 5F6KA 1V6IA 5FREA 1OD5A 2QSIA 1SQPG 4CXXA 3RFRA 5KLIB 1FZGA 5C8CC 3KZIE 2CL2A 4O9EA 1SDWA 2D97A 1N73B 3CXHD 3L73E 1O59A 4M4RA 4E2QA 4YGCA 2C24A 1VQ6P 2YDEA 2MHFA 1HRV3 1VE0A 2WA4A 1MS3A 2CDOA 3RPQA 5HXMA 1CWPA 1IFNA 1ZZ9A 2ERFA 4AXOA 2LUWA 1CX1A 4QB1A 5AW3B 1WLCA 4GWIA 5AFEA 4NUBA 1VLNA 3T97A 1YBKA 3OY8B 2EXJA 1SQQD 1SQXG 2K37A 4SBVA 3WQ1A 4E4HA 1GUIA 2W91A 5HV0A 1N2DC 1UX6A 4EN9B 1G1JA 4CU7A 3MGNA 1M90Q 3CJIA 2YGLA 1C5IA 4JRAA 4PD4I 4IETA 2Y6KA 5FXXA 2R30A 2FDKA 4AG4A 4DFSA 2QQLA 4HVQA 1NU1K 4COYA 2WYSA 5BUVA 5C3SA 2LKMA 3CCSP 4UWDA 1GV9A 5AC92 1W0OA 4BH9A 3NAPB 1VBD3 2WNUB 1WCUA 4QQOA 5LBBA 4P14A 3IF4A 2FYUE 3WOGA 1PVC2 1AL22 3TRSB 4AVCA 2I1JA 3L73D 3CJXA 1Y9GA 2VZQA 1ZBE1 2XNDH 4IDZA 1POV0 1OLMA 3OEAA 2CK3H 4PLNA 4XZUG 5KXBA 2JEMA 4KG0A 1AUYA 1OKOA 1RUG1 2B42B 2DVDA 2BPA2 2Y0IA 5IVFA 3B8EB 3Q8FA 3DPRA 1VP6A 5EQUA 4AFBA 3PVNA 2V7QH 4CRQA 4BHPA 5APWA 4N8MA 5HCHA 2IXIA 5A7QA 3SH4A 1ZR2A 1GK4A 4XE5B 2EIGA 3A0KA 4O61A 1LHVA 4HH2A 3E1IA 4CU6A 4HJGH 2OVUA 3WX5A 2QQNA 1FOSF 3WDWA 1US3A 4M3CF 2HPCA 4XHBA 1J1DB 3AEFC 3P1IA 2ZGOA 2HWC1 2VUDA 4C0HA 3BTAA 2WPVB 2VR4A 2D6LX 2C5DA 2Z42A 4JCKA 1SFCD 1YQ6A 1SQBD 1ENSA 4QM8A 5LY2A 4OYUA 3UYJA 1L7LA 1LWUC 1S9KE 2ZGTA 3F2ZA 1VQMP 5CJ0A 2ZPXA 1MQTA 1ND2B 1N7SD 3Q3DA 1FDOA 4XXAA 1W2AX 3N9OA 3GHNA 3H8UA 5DDJ2 5CZKA 4RHV3 1GZLA 4LBQB 3NKTA 4W4ZA 4WM8B 3H3ZA 4XABA 2OX0A 4L75A 3CX5I 4XFJA 2D3SA 3ENRA 4AUWA 1MFTA 2RMZA 3AE3C 5GJ6A
chains in the Genus database with same CATH topology
4BZ4A 1TMF3 3FBYA 5J37A 5CFCA 1HRI1 5FQ0A 2P2KA 2ZHNA 3E97A 2HWB1 2Q4SA 4NOTA 2D5FA 3ILNA 3BCWA 2BWAA 4YNIA 4Q8LA 1MEC3 2VGDA 3CJIC 4Q0UA 2ZKNA 2G4IA 3U10A 2XGXA 5T5OA 2RE9A 3RJ2X 5KXDA 1S0EA 1YRZA 1PZ7A 2ARXA 2ZOEB 3ZFFC 4GKYA 2NPIA 3MYXA 1DGRA 2XBO3 4FBFA 2WC2A 4DPNA 5I0UA 4N53B 1QJY1 4A3XA 5CA6A 1AJOA 4XJZA 1CAUB 2JE9A 1K5MB 3THTA 3WHUA 1ONAA 2GMEA 5KXEA 5J96B 1RUI3 4CDXA 3VKMA 3MGUA 3PTYA 4UW4A 4QPIA 1E57A 4XQWA 1TME2 4YARA 1VAMA 1UPSA 2DCZA 3WDYA 3QLQA 3VBFB 4MH0E 2UWAA 1AVBA 2MEV1 4PJYA 1AYM2 2VOKA 4MGKE 1RJ7A 1YFXA 2YGMA 4R4XA 4XTPA 3V64A 2ZBJA 5A3LA 4UBHA 1N1SA 3VKLA 4H7MA 4IEWA 1N47A 4XJAA 4Z8BA 5C4WB 1Q8QA 2CAUA 4N43C 2A70A 4Z2WA 5KHIA 2WZR1 3QOPA 2RS51 2NN8A 3MPBA 4P9GA 3RWNA 2GNMA 2GDFA 2PHWA 2WKKA 5J3UA 4A7KA 3KT4A 5CBLA 1DQ0A 2WFF2 4URTA 3E5QA 1G9FA 2ET1A 4S2HA 1V6OA 2IC1A 3ZN6A 3NJZA 4LUKA 4GMP3 2BQPA 3KCYA 3VV1A 2CY6A 1DDLA 2R49A 2C9AA 4Q4W1 4MGYE 2QZ3A 5IUQA 3NV2A 5SV8A 1C5HA 4MXWA 3J9SA 3S6PA 2IFRA 2VVEA 1LODA 5K8SA 1HIXA 2UYBA 4ZU5A 2RM21 3DPRC 1PK6A 3RQ0A 4DB5A 4R9CA 3MF6A 4Q4X1 1ENRA 1J58A 2DU0A 3FLTA 3MW2A 2I2SA 4S2DA 4AEDB 1RMU3 1SLLA 4FTEA 1XYPA 1PGW1 1OLRA 2XVLA 5FPZA 2WZPP 2VXRA 2ZJCA 4AFCA 2WFPA 1NG0A 2RS31 1RITA 1XE8A 1WMEA 1V9U3 5J36A 1QH7A 2OW4A 1O4YA 1FPN1 1VBB2 5A32A 3T2TA 4W6WA 1RUNA 2D7FA 2QDNA 2FMDA 5D8AB 4RSUA 5JIAA 4B29A 1JUHA 4UBGA 2VECA 1U5ZA 3SISA 1COV2 3ZFGA 4BIOA 3E6BA 4E4DX 1LB2A 4NPRA 1YFUA 4IEXA 4UW5A 3RYKA 4YZ5A 1DF0A 5JSRA 1XNBA 1QMJA 3EFFK 1YCIA 1H8TB 3AKSA 1EV11 1RVF1 4KG8A 2WWSA 1QH6A 1JBCA 1S0BA 1WW7A 1Z7S3 4K6BA 4YZ1A 4P9JA 4XJWA 2DV9A 3ZFEB 2KXLA 1WBFA 1V70A 4FP2A 2F6BA 1LENA 1ASJ3 3JD73 1WCDJ 3V0BA 1OMIA 1VBA1 5K0UB 4XF3A 1VBE1 3ME2A <