3USSA

Crystal structure of cysteine dioxygenase from pseudomonas aeruginosa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
196
structure length
196
Chain Sequence
SILRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Crystal Structure, Kinetics and M ssbauer Spectroscopic Studies of a Bacterial Cysteine Dioxygenase
rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 48
structure length 196
sequence length 196
chains with identical sequence B
ec nomenclature ec 1.13.11.20: Cysteine dioxygenase.
pdb deposition date 2011-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3ussA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ussA02
3H7YA 3H7JA 3ES1A 2IXIA 3LA7A 3S7EA 5I0RA 4L2NA 3U10A 4NVPA 5CVRA 2QDRA 4HN1A 3OF1A 3EFFK 3N4MA 3CEWA 4PJYA 3H1MA 1Q5OA 2CAUA 4MH0E 2PAMA 2CK3H 2ET7A 3GBFA 2F4PA 4YNIA 2XL9A 4R52A 3USSA 3IDCB 4IEYA 4KL1A 5BPXA 4HN0A 3EHKA 4XF1A 1QXJA 1UPIA 4F8AA 4XEZA 1WA4A 3RDIA 2GU9A 1HW5A 1ZRCA 4HBNA 4QM9A 4IEOA 4LA3A 2B8MA 3EQEA 1RL3A 4DJGA 2GH2A 2VQAA 3I59B 1EP0A 4HSLA 3KMHA 3HT2A 4QGMA 3L2HA 2IXHA 4XFBA 2QCSB 1EY2A 1E79H 2H6CA 4Z07A 4AVCA 2BNOA 4FBFA 5JCTA 3ROUA 3H1YA 3BALA 2N7GA 3UKVA 2FMYA 3OGJA 3NSTA 4XFHA 4OLLA 4YSFA 3RYRA 2UY8A 1O3SA 1GQGA 3FJSA 3E5XA 4KWLA 1O3TA 3E6DA 1UIJA 1L3JA 3MDPA 4HVRA 5AVPA 4HVQA 5F1RA 1YUDA 5KHJA 2PQQA 1H1MA 1O5LA 2Q4SA 3RNSA 3I59A 4IEPA 5I8YA 5KBFA 5J3UA 3NJZA 4UXAA 4EWDA 4Q0PA 3H8UA 2E5TA 3NL1A 5FDBA 1RGSA 2XHKA 1SQ4A 3SCGA 1IPKA 2UYAA 4IEVA 1NE6A 5LRSA 3H3UA 2OA2A 3C3VA 1X8MA 3G7DA 4I02A 1Y9QA 4LUKA 2WSSH 4XF3A 2ATFA 2XL7A 3LZZA 4LEJA 4XF0A 3IBMA 2MHFA 4MGZE 2JDIH 3PLQA 1CAUB 4XF9A 4WZCA 3LWCA 3S0MA 5LRRA 2PAEA 1SEFA 3KGLA 2FQPA 3QACA 1O3RA 2HJIA 2GC2A 2XKOA 4I09A 3I7DA 3MYXA 3H9AA 4WBBA 2CV6A 4HLTA 5EZWA 2PHLA 2I45A 2B5HA 2B9UA 4K8FA 4LULA 4F7ZA 2BEOA 3R6SA 1G6NA 3FWEA 1H1IA 2PAKA 4AQ2A 5BV6A 3KGZA 5FLIA 2XLFA 4BIFA 1JUHA 2EAAA 2CAVA 4LTAA 1LRHA 4B29A 1ZRFA 5BXXA 3OD0A 3PVBB 1NZCA 1CAUA 1XE7A 3ELNA 4ZU5A 4R8HA 4PIZA 1V70A 2D5HA 1QY4A 4EWAA 2D40A 1ZZBA 2XNDH 2GC3A 4IEXA 4AVAA 3H50A 2XLAA 5CADA 1O7FA 1UIKA 3FFQA 3U0ZA 5I0SA 4E2GA 2QNKA 4AVBA 2ZCWA 4HSJA 2Z2SB 5I0UA 4BHPA 2D5FA 2PHDA 3WW2A 4ZU7A 2PFWA 5FCCA 2MPFA 2ET1A 4JTNA 4BH9A 1EYBA 1XE8A 3CO2A 2H0VA 4IEQA 3LA2A 4AXOA 4N9IA 1DZRA 1OD5A 4D7TA 5E1RA 5I8TA 4HZFA 1UD1A 3KSCA 3H3ZA 1DZTA 5JSRA 1J59A 4LA2A 3I54A 1Y3TA 2Q1ZB 2KXLA 3RPQA 4DINB 1X82A 5I93A 1EPZA 3TNQA 2IXJA 1ZREA 4YARA 4FAGA 1ZZ6A 3FX3A 1DGWA 2EA7A 5KHGA 1J58A 2IC1A 1U12A 1PMIA 3EO6A 4QGLA 4O9EA 1DGRA 4HMZA 3SMHA 3MZHA 3SCHA 4MGIE 1VP6A 1J1LA 1ZZ7A 4XF4A 3UKNA 1YWKA 5FLHA 1J3QA 2QVSB 2C0ZA 3NW4A 1OI6A 3E5QA 3LA3A 3BB6A 2GC1A 1ZX5A 3ACLA 2OPKA 3OTFA 4YXWH 1FXZA 3D0JA 1TQ5A 4HVOA 3D82A 1OMIA 4JTOA 1RUOA 3RYPA 5CU1A 1LR5A 5HI0A 1Q43A 4X6QB 5JAXA 5LEJA 2EVXA 3IDBB 5I0TA 4EV0A 3WW3A 1ZZ8A 1X8EA 2E9QA 3B02A 1O3QA 2OZJA 3D0SA 1OFNA 4MX3A 4I01A 4J1WA 4X6RB 5T3NA 2IXLA 3EBRA 5EFUA 3LOIA 3RZZA 4MUVA 1CAXB 4Q0UA 4Q0SA 2OZ6A 1ZZ9A 1BSHA 4Z82A 3PNAA 1AQTA 4QX5A 2WC2A 4UBGA 2XLGA 1YFWA 2XGXA 5KHKA 5C6CA 2Z69A 4META 1FI2A 3FE5A 1PM7A 2QE7H 2UY9A 3BCWA 4KU7A 1CAVB 1BSNA 1RTVA 4D7SA 5KHIA 4O9GA 4MV2A 1Q3EA 4L11A 2ZKLA 4GULA 5D1IA 4KWKA 3SCFA 3IWZA 1IFPA 1JEKA 3GYDA 4ZU4A 4OFGA 1CAXA 3HT1A 2UYBA 3CJXA 4J1XA 4QGNA 2W6JH 3CLPA 3EJKA 3LAGA 3DN7A 2GZWA 4E2SA 4IETA 3M3IA 4XFAA 1RUNA 2ETEA 2V7QH 1CGPA 3FZ3A 3ETQA 3S7IA 5FPXA 1VR3A 1CAVA 3HIFA 3RYKA 3BPZA 3UKTA 2CGPA 5JSPA 3JZVA 3SXWA 3ST7A 4YYOA 3WW4A 2MNGA 3E6CC 1ZVFA 1QXRA 4A2UA 2Q0AA 1GQHA 2K0GA 3OCPA 4IEZA 3CL1A 3SHRA 4I2OA 5FLJA 2E5YA 2QJVA 5K8SA 1CAWA 3WW1A 4FAHA 2Q30A 4KU8A 5LEKA 3FHIB 4N9HA 5FQ0A 2VPVA 2BGCA 2BNNA 4H7LA 1ZRDA 5I91A 2O8QA 1QWRA 4QXKA 1FT9A 3CF6E 5JR7B 4IEWA 2DCTA 4MGKE 3VHRA 4I0BA 4Q29A 4EWEA 4IEUA 1YFUA 4LUMA 4RD7A 1NYWA 3HQXA 5J48A 4I3PA 4EROA 4WVZA 1CX4A 1I5ZA 3E97A 1NXMA 4QM8A 2PYTA 1RC6A 5KHHA 1WLTA 3DV8A 4CYDA 2D93A 1FS0E 3O14A 4QMAA 2IXKA 4XFIA 3E6BA 1SFNA 1UCXA 1J3PA 4JV4A 2GC0A 5I8SA 4XFGA 4MZUA 3IIAA 5BY5A 3DL3A 4MGYE 2BNMA 5J7MA 4ORFA 1ZZCA 3U11A 1ZNPA 1YFYA 1XRUA 5C8WA 1YLLA 3PJSK 5FPZA 1O4TA 1J3RA 4XFCA 1NE4A 5BUVA 3NVCA 4LLOA 4PIYA 2Y0OA 4XETA 4XFFA 2OYZA 2GAUA 2XKPA 5E16A 3TNPB 1YFXA 2WFPA 1YHFA 4I0AA 4AQ6A 4Q0VA 1O5UA 2K9ZA 1X7NA 4JVAA 4YRDA 4FT8A 2H6BA 3BU7A 1I6XA 4PIXA 4Q0QA 4E2QA 2HKXA 3KCCA 2P17A 2BYVE 3ES4A 3E5UA 1VJ2A 4BYYA 1IPJA 2IXCA 4UBHA 2VECA 2PTMA 3ZDSA 3MPBA 4IERA 1LB2A 1UW8A 3NKTA 4KWJA 1CAWB 1ZRRA 1WGPA 2V09A 3DKWA 2O1QA 4P9GA 3QOPA 5JSOA 4IESA 4ONUA 4TLFA 2PA7A 5FQ0B 3H1WA 3M70A 1LKNA
chains in the Genus database with same CATH superfamily
2XJRA 5I0RA 2WA3A 4Y1XA 4CZSA 1SQVE 4UW5A 2XONA 4IL6X 3WNXA 1BGYJ 3V2PA 3TB0A 2W6AA 2R7EB 2NPSB 4YVWC 3BGAA 2F4PA 3EB7A 3B4SA 5BNOA 3M06A 4WWIA 2R3SA 1FZCC 1PO12 3JD71 3N7MA 5A80A 3S6PA 4PF5A 3I59B 1LOAA 3RMYA 1BK1A 1AJYA 2YU2A 4W6YA 3V0AA 3JBG2 2QG4A 3OBZA 1QJZA 3K4ZA 3BALA 1VBA1 2DFCA 4CSWA 1PGSA 5GLTA 4ZZ5A 3AL6A 3H1IJ 2CHHA 2XB6C 4HKLA 3WG4A 3V0BB 4NMIA 3ZKYA 3AP9A 1BBT3 4QWNA 3ZYRA 2W92A 4YTPC 1GL2C 1PK6A 1KS4A 4GH4C 3THPA 1ULOA 2JG9A 4IEVA 1AL0G 3WZ1A 3THCA 3VBUA 3HBZA 3GGLA 3LZZA 5T5OA 3MO4A 1W6PB 1B35A 2WNUA 2C6SA 4QX1A 5AC93 1Z78A 1VRH1 1LHOA 4RGKA 1YQ3C 2A3WA 3POWA 3FXEA 1NKGA 1GWMA 4LKEA 2JX9A 3ETPA 3U4SA 1QJY1 1AX1A 1LP1B 2PAKA 1H2KA 2BCCJ 4B29A 5APUA 1SPPB 1L4AC 2QUOA 1KTMA 2WSUA 2XNXA 2D5HA 4CDQB 2VL4A 1QX8A 5DZGA 1VQ4P 5I0SA 4E2GA 3MUDA 5I0UA 2WSFH 3AMMA 2YC0A 4W8JA 2MPFA 1TU3F 3E1IA 3NMDA 1XE8A 3AFKA 4L9BA 1TNFA 1IS5A 4OI4A 3U37A 4E4HA 5I8TA 2UU8A 2ZXXA 4NIDA 4TWTA 4NOTA 2YUEA 4M0HA 1S55A 2ADEA 3CC2P 5FYYA 1A8DA 2HWE1 1AHSA 3AEGC 5LBFA 4U3FG 2OYOA 2Y9YA 2J1SA 5DG1A 2LRPA 1OLQA 1L2PA 2EIEA 2X29A 3HPNA 4NUBA 1JCCA 2RMZA 1QJX3 1BK0A 2G9ZA 4GDOA 3LB9A 1RF1A 1YQ2A 2YPDA 2OPKA 2WQ4A 1RUG2 1JU3A 3SWFA 2RJLA 3ZKUA 5D21A 1JZ5A 4GJYA 5FKCA 2M0BA 4QQHA 5I0TA 3W5NA 5IJRA 1Y9GA 1IZ3A 2JDMA 2YY1A 1OFNA 1ASJ1 2YV8A 4Q4Y1 1GP5A 2JP3A 2XJQA 4YW4A 1GNZA 4NR1A 3LOIA 3T30A 1BKZA 2AENA 2JECA 5K0UA 3H6PA 2Z69A 4MXVA 2P7JA 4QXBA 2H0BA 3HD8B 3M2MA 5GZDA 4LT5A 2QJPC 4H44C 4Q26A 1BDCA 3LF7A 3EYPA 4K3UA 4KBBA 1SQBK 4EYYQ 4UFLA 3GHGC 3L73G 2DFBA 2GNMA 3FC0A 3DPRB 5GTIH 4QGNA 3AZYA 2ZJSE 1W8WA 3DEMA 4XFAA 2P58A 3OBTA 1T8ZA 3FZ3A 4P14A 5DJUB 4PJ0E 3OYWA 5DPNA 2W91A 1NGMB 1M1JB 1N73B 1ZVFA 2VVFA 3W20A 1IS4A 4LHSA 4NAMA 2HR3A 1XQNA 3VDDC 5FOJB 2R042 1IK9A 3PJQA 2WO3A 2C0XA 3LFMA 2L91A 5FP3A 2ZFCA 3VL8A 4FFFA 2OYIA 2FYUD 2B45X 1QWRA 2I1JA 4NAOA 1SLQA 4AVSA 2GM4A 1PP9G 1NYWA 1AR61 4DMIA 1XYNA 4XJ9A 1IFJA 2ZGMA 4WVZA 4L74A 4UB8E 1NXMA 1URQA 5L9BA 4YG6A 2R0HA 1K42A 3VUOA 2ZGQA 2IXKA 3SH4A 3VMXA 3C1LA 1PPJD 2V5DA 2R3CA 1MQTB 2YBSA 1LTJA 1O91A 5KXCA 2KZJA 5AW6B 3KV9A 4FCAA 3POBA 2IFNA 3HTKB 4WV8A 5F6LB 4DO0A 4IE4A 3CMGA 3Q8EA 3DYMA 2ZGNA 3PDQA 4OQ8A 2HPCB 2Q8DA 4GMP1 3SNMA 4B1MA 2QM8A 1I6XA 2ZHMA 4UB6E 1FJKA 2YYOA 3ES4A 2WZPP 3E5UA 4LLFA 1A34A 4XDQA 3U1CA 1HB1A 1T3JA 3CWBG 1WLDA 3WLUA 2OT7A 4WM8B 3I55P 4BQXA 4IESA 2OX0A 4LO5B 1JCDA 3H1WA 1BE3G 3KDPB 5FJKA 2B46X 3K75B 4AHXA 1YC61 1C8NA 4HETA 1RXFA 2IPPA 5C3RA 3NQHA 3L72D 1GW4A 5KKZB 4HK8A 1RJ8A 1S2EA 1L0LD 3I3BA 1CIYA 3T09A 5JXHA 2GU9A 1HW5A 1W0PA 3ZFGA 2B87A 4IE0A 2KK7A 1BDDA 1U57A 4OHWA 3VZJA 1HGVA 1LGNA 4YW6A 1VB2A 1W8TA 2FMYA 4YSFA 4JGYC 2V5YA 1OT5A 1AX2A 5A1AA 3OAKA 3X29B 3LIGA 2HWD3 2QJYB 2HWB3 2KR2A 1S0IA 3CMEP 1KB9H 1OVRA 2KI7B 3H1HJ 5HV4A 5A3MA 1AR83 2IX7C 3LPFA 3TN92 1PIV2 4KBZA 1NE6A 2GN3A 2I2SA 4XILA 5I0DA 1CJPA 4FOQA 2AGSA 4AYCA 4Y20B 3CX5H 1JXNA 3AZZA 1VMJA 5LRRA 1SEFA 2P6CA 3KCYA 4E8CA 5FYSA 2P4EA 2BBAA 4BIFA 5IAXA 5F5QA 4ZNCA 3H8OA 2Q1MA 2JDNA 4UOJA 1SQXE 1ALYA 2ERFA 4DUVA 2RG4A 2HYNA 3WUUA 1DH3A 5BNPC 4N90A 1PZQA 1NCQC 2VU9A 3N7KA 4IV1A 2CWMA 1VBC3 4ZXKA 2YIUB 4BH9A 2B39A 1N47A 4HB1A 2O0OA 3RK2D 4OVNF 1BGYG 1KD7A 3CCSP 1AR72 1N3PA 4B4RA 1JOBA 5F5IA 4FPJA 2CDOA 1PMIA 3RBZA 1E5RA 3KF3A 3SCHA 4UWDA 4C1XA 1DP0A 1U0AA 2WS93 2AXTE 5A33B 3LGRA 2VMEA 2QVSB 1U5XA 3AMPA 5KAFE 1UOFA 3Q9OA 4FP2A 2GC1A 2SBAA 1VLNA 4HVOA 2DVAA 4CUBA 3H1IG 4Z2WA 5CMZA 5KR7A 1RUD2 1H2LA 1SQVJ 4AFCA 2E9QA 3R05A 2OZJA 1G2CB 5GZFA 4WY4A 2YG0A 1ULGA 3A0HH 1PVC2 4XJ8A 2Y8KA 5A7SA 1ZZ9A 5FP4A 2KP8A 1UMHA 1FC2C 2VQTA 4YVSB 3RWNA 3RK2B 1S5LE 5ANQA 5LY2A 1DQ2A 1GNYA 3AC0A 4NE9A 3GYDA 1GQPA 1G86A 1W9TA 3MLLA 1VAKA 4RS5A 4EIJA 1GZCA 4JRLA 5L7OB 5L19A 4NHKA 4QXHA 3IFMA 2ZZJA 1Y8AA 4JRAA 3RYKA 1JY2N 2WT1A 4BJ0A 2G9GA 2EXKA 4JKMA 3MHZA 4RQPC 2Y0EA 3OCPA 4GOFA 2ORXA 5EIYB 3L73D 1VBE2 1P8JA 3WW1A 1FAVA 1YEWA 5IVFA 4BRYA 1W06A 3GNEA 2DU0A 3TAYA 3F2ZA 2VPVA 2BNNA 2P1BA 4K1ZA 2JDHA 4AWDA 5I91A 3NJXA 2WPVB 2OUHA 3CF6E 4N53A 4MGKE 1W6OA 4MO3M 1ND2B 3VHNA 3I5CA 1ENQA 3KT7A 2JKBA 1S0FA 2J1RA 2WIIB 1G8WA 4Y26A 4TZDA 2P5BA 3ZLIA 5LW9A 4LGDE 2ZGRA 5FTTC 2O01J 1H6XA 1UCXA 4CCNA 4OYUA 3H8XA 5I8SA 2J1EA 1FV2A 3RS6A 1E57A 1NCRA 3M1HA 4XA4A 1F15A 3K4DA 1RF0A 1YLLA 4FPGA 1PP9D 2PQSA 2ZA9A 3ACFA 1GNHA 1MFTA 2A6ZA 1MZ5A 4XETA 2R5BA 4P5HA 4LK6A 3L4FA 4CEYA 3T0DA 2DVFA 3M9QA 4E4ZA 4MHUA 3ITQA 4HL0A 3F5HA 1CJDA 2G1MA 5JWPA 3FUOA 1VJ2A 1NTZE 1LENA 3Q8CA 2R071 5IVBA 1NTME 4KWJA 3ZFFA 1SACA 2W94A 3J7MA 4CXWA 5AFBA 3K77A 3II6A 4AG4A 1USEA 1IGOA 4LR4A 3OF1A 1PMJX 4AQRD 1AL23 2VRSA 1Q5OA 4BQ2A 3IAOA 5L8RJ 4YNIA 3KT4A 3ZXDA 2FDGA 5BPXA 4XEZA 1SQQJ 3MLJA 3RDIA 1IKPA 3CWBD 1VBB1 1D4VB 4XMAA 5DMYA 2VQAA 1W8HA 1LT9B 2IXHA 1WCKA 1FZFA 4CUGA 3POJA 1WW7A 1XNTA 1HQNA 2PHUA 2KB7P 1H8TB 5TISE 1XTCC 2VCMA 3GZEA 3TBDA 2ZGTA 1JY3N 4JQ0D 4HJGH 3IMNA 4HVQA 3H1JJ 2ZYDA 1GU4A 1VQKP 3I59A 1TZOA 1T3UA 4UAPA 3OGSA 1N7LA 2WZ7A 2DURA 2ZX2A 2AZ5A 3O1SA 3P8CE 5CKQA 1NLRA 3KZIE 4HONA 1AYM2 5DUUA 3FBYA 3ZYHA 1JYCA 4XF3A 4V1PA 4DUXA 1XSRA 2BP6A 5FMOS 3IZOA 2JDIH 2JB8A 5FYUA 5G05L 1D0HA 3KT1A 4F3JA 1OHFA 1LTBC 3WINE 5AVXB 5JOWA 2AEYA 3QD6A 4Y5SA 3VZKA 3FWEA 5AW8B 2OQQA 2LR2A 1NJIQ 4M01A 2L5GB 4M3LA 2BBVA 3Q3DA 5FZ9A 3T4VA 4L75A 4RESB 1XE7A 2WFF1 4XZPA 4EWAA 2NPSC 2GC3A 5EWSA 2HODB 3Q1MA 4OCTA 1HV1A 3WG3A 4ZPIA 5IHRA 2Z2SB 5FCCA 1LT1A 1LP1A 4GMP0 4XTPA 1WD4A 1GOGA 1SG3A 1YHQP 3ENRA 1NG0A 1SDWA 1VIWB 1UD1A 2NPIA 4Q4W3 4A45A 4QPGB 2XJTA 1X79B 3L71E 1C1LA 2E76C 1HTLC 3DECA 1ZP0C 3VN0A 3I2KA 3MZHA 5F3IA 5FZ4A 1NAEA 5FLHA 3HQRA 3AJZA 2JDAA 3LA3A 4FP3A 2W0XA 4XCBA 3GJBA 1FOSE 2WPSA 5FK7A 4EV0A 1WW4A 2Y6GA 4NPLA 2W46A 3BTZA 4I01A 3OPWA 1H2NA 5ACA1 2VE1A 4Z82A 5AVZB 3AMQA 2PMWB 2JEEA 5KHKA 4Y1ZA 3WUCA 1OVSA 1QU0A 1RITA 1UY3A 1CAVB 1PO23 3A0BE 2V4HA 3GMAA 4CDQC 4GULA 1SQQK 2VD7A 1GP4A 3JQXA 3L70J 1EZVE 4H7MA 1NKNA 3V64A 5C7GA 3T3YA 1JU4A 2W6JH 4S2GA 1QJU3 3DN7A 3DCQA 3N7LA 4LKDA 3UESA 5IYYA 1ND3B 3K51A 4N43B 1P84H 1MS1A 3ZDMA 2YC4A 2VUDA 1WLWA 4JBZA 1G1JA 3EXUA 2E5YA 4A7KA 1CONA 1CAWA 3WU2E 1DF0A 3NV2A 2MEV3 4I6MC 3BTAA 2O8QA 4M3CF 2AYHA 3J4UH 1OVVA 4YG3A 3AP4A 4I0BA 3AE1C 5FBJA 1EDJA 1BMV1 1N73A 3CD6P 5J48A 4P9IA 3KHUA 3OPZA 2LXCB 3ZSEA 2PRRA 5IAVA 5AW1B 1W3XA 2QEXP 2GMPA 2QQKA 2POHA 1W8NA 3C8XA 4JV4A 1RUF1 3AMNA 2VC9A 3NO8A 2A73B 3VBFB 2EXIA 2RS51 2P34A 5IVJA 1ULFA 5EYXA 2Q3IA 1SQVG 5FPZA 4L99A 4Q27A 1MS4A 5A7NA 2VR4A 5LB6A 1XU2A 3TNPB 3S30A 4YWAA 4GD4A 1MQTA 3WNLA 2RS11 4E4DX 4XHXA 3DPRC 1IPJA 5HCAA 4AFMA 2WNVB 1E5HA 1BVP1 2RM23 3HTKA 4AL9A 1JZ3A 1OPMA 4XPVA 2V09A 1YQ6A 4Z1VA 4GWNA 2JIGA 3M4FA 3MIFA 5FQ0B 1APNA 3M70A 3FWLA 3I8TA 2HPCA 2DBIA 1OF4A 1M1JC 1N73C 2C26A 1SQPG 3PU3A 2C9LY 4OUMA 3U10A 2QDRA 2YFZA 5EJ1B 4AUWA 3CCJP 2NQYA 5C9AA 4A42A 2D6LX 2DVDA 5CG8A 2N1TA 5FO7B 3WP4A 1FZGA 2WSCJ 1OF3A 3PU8A 5CCGD 1QXJA 4QKDA 3WF4A 4WM8A 1HRV1 2IFRA 4HBNA 4BE3A 1TEIA 1PMHX 4K1YA 4B4PA 3KMHA 2YGMA 4EDFA 2H6CA 4W80A 3PTYA 4E9KA 2HWF2 3N9NA 5G04L 1GQGA 2Y6LA 4XUQA 3BVCA 1C8M2 1MQTC 5AVPA 4XIOA 1JH5A 1AVYA 1KMIZ 4Y99B 3HMYA 5FYBA 2OTJP 4NIHA 1FPN3 4D6SA 2BOJA 4Q4X3 3M3CA 1IPKA 5LRSA 1PO11 3NNFA 1JBCA 2VQUA 4LUKA 3POGA 4NPMA 1TE1B 4JF7A 3JBG1 4LBOA 1F4AA 3WMM0 2B42B 1UU4A 3CZJA 4AI9A 5A7PA 1H8VA 4OZOA 2A71A 3RZKA 5EP9A 2VAUA 3A23A 2B9UA 1W8ZA 1K9MQ 3TEYA 4XBNA 4W6WA 3WOGA 4R4ZA 1TNRA 3EFGA 2P6HA 4CCJA 5KKZC 1S4XA 4IEXA 1O7FA 1NY72 2QNKA 2KZIA 1D7PM 4HXCA 2VOKA 3LE0A 1KRIA 1F4HA 2BTVC 4QQPA 5FY1A 2FCUA 1ZM1A 4XE5B 4N9IA 2YGLA 3ABVC 3IN6A 3FL7A 5B66E 3LFIA 3MLKA 1EPZA 1Q8SA 2PHWA 1RUC3 1DGLA 4PV1D 4YFZA 2Y0CA 1NTZJ 5J36A 1K5MC 2XKMA 2ZMNA 1UMIA 1PNGA 2FYUE 1R082 3BB6A 3SKJE 3POSA 2WZR2 3B5ND 1VE0A 4ASLA 4GT1A 5CU1A 5HI0A 1Q43A 1KILA 1V9U3 3FGAD 1CPNA 3LW5J 2RS32 1O3QA 2PHXA 1QQP3 2Y64A 1YJWP 2WPQA 2UWBA 3GZTB 4X6RB 1PVXA 2JO1A 3UETA 2VNVA 5A33A 1PPJE 4UFKA 3B71A 2R32A 2DTWA 4N78E 1VPHA 2ARAA 3AP6A 5LK7B 1FI2A 2ZXEB 2VZQA 3QH6A 5KJ7A 5EFWB 2KNCB 5FR3A 1G2CA 4KGGA 3WNOA 5KXBA 1LWUB 1VBD3 1RUG1 3I3MA 4EZ4A 2YIUC 1U5YA 4AI1A 1DGRN 2DVGA 1VBA2 1H2MA 2VZ1A 4PV1B 1OXCA 3IPVB 5GM0A 5KLVG 5TSWA 3FHQA 4COYA 4QU2A 1YI2P 3WW4A 1V6MA 4XE9A 1HQLA 2AXCA 4PHZA 5AW4B 1WCSA 4WM7B 2FBWC 3L72E 3QH9A 4LHLA 3PUIA 3VDCA 5A70A 5C8CA 2Y6KA 1IQDC 1L0LE 4BQ4A 2PLV1 1FT9A 3AZWA 1L0ND 1YJNP 2WTYA 1OA4A 4LUMA 1VRH2 1MEC2 1E5IA 5DZEA 4LE4A 3JQWA 2PYTA 4AI2A 1S1CX 3LPGA 1UYPA 2BASA 3OW2O 4PDWC 4ES8A 4XFGA 3IIIA 1W8UA 2OPWA 3DL3A 1ND2A 2ZT9D 1YNAA 1FU1A 1H1AA 2R041 4LXLA 3FLPA 3L9JT 3ZDVA 4XFCA 5GLWA 3VBRB 4YM0A 4YVSC 3RK2C 2DF7A 3I3EA 2YU1A 1U5ZA 1R093 3BRTB 1FATA 2YPJA 5F2SA 2P17A 4P9YA 3MIHA 1UO9A 2FFDB 2RJ2A 3T2OA 1UOGA 5L7OC 1IZNB 4ITCA 2KYVA 3CCMP 1EV13 4O9BA 1BHGA 2IWGB 4RKUJ 3CI9A 1CI6A 4D6TD 4AAXA 2D3SA 2IXIA 3AKRA 4QHZA 2D6MA 4ZZ8A 4LBJA 3LD8A 1NTZK 1RE4A 4BQ1A 3WCRA 2E31A 2JIJA 2KD7A 3ZR5A 4KJMA 1AXYA 3IDCB 2FMDA 3V4WA 2BW8A 3VBOB 2TBVA 2LM3A 1ZOYC 1JYVA 2K9YA 4HG6B 1D0GA 3EQEA 5DDJ3 2GH2A 5F3EA 3THTA 5F7UA 5FXZA 3WQ7A 5FIXA 3HT2A 3ZYJB 4DNYA 1LTGC 2R062 1PGW2 2TUNA 2G9FA 5JXGA 1H6YA 2BNOA 2XOMA 3BN6A 1SQPD 3UKVA 2ZT9B 3UL2A 2FXMA 1REDA 1VQNP 1T6AA 1KC8Q 2E7QA 4RHV2 4ZS3A 1Q90D 5FY4A 5CEHA 5FZ3A 4CDUC 3HEIA 4IEPA 1SQXG 2XJVA 1AZDA 3VBHA 1SQ4A 4FQZA 1X8MA 2Q3EA 2YZ4A 3UGFA 3WUTA 4XF9A 4YZ3A 2ZAHA 5F39A 4A41A 1GANA 2BUKA 3Q8AA 5J09A 2C1FA 4QX2A 1Y4WA 4XJAA 3C2UA 1HKDA 3JCUE 1R1A3 3M0AA 5JUVA 3I7DA 1FJPA 2PHLA 2K1AA 3OPTA 4LHKA 1G6NA 3I4IA 4QPIC 4HOOA 3T2PA 3POFA 2SLIA 1RUH2 3CC7P 3NAPB 3PVBB 3KPEA 3QCWA 1X0TA 3VLBB 3H0OA 2G8YA 3H50A 3TN91 1PIV1 4JHZA 4CPBA 3WW2A 1WWYA 1X9PA 3GZAA 2JENA 4B8EA 1VQ6P 1LT9C 4DEVA 4FOYA 2WT2A 3VL9A 3O0XA 3ABZA 4HZFA 3OY8B 4BPZA 4KT0J 1H8TC 5JSRA 1YBKA 3CCVP 2HODA 1DHKB 1W90A 1UY4A 3I2IA 5T50A 1RUI3 1UNBA 4YM3A 1GU3A 4LK7A 5APAA 1DYOA 5FYTA 4B7EA 1VP6A 5GZGA 5A3PA 3MHVA 3RL0D 4YGBA 2BDRA 5FPLA 3TGUD 1G1IA 3KV5A 3QLQA 4JTOA 1OMIA 1GV9A 4R9DA 2JWPA 1ZW0A 3ZSMA 1X8EA 1BCXA 1CD3G 1AR71 2IYOA 5CA6A 4IV3C 4J1WA 2YKQA 5EXOA 1VL2A 4Q4V3 2WRAA 3NV3A 5EFUA 1SLTA 1D2QA 5CJ4A 3B94A 4QQOA 4GH4B 3C7EA 3WF2A 1AQTA 1TMF2 1C28A 3ME2A 2E43A 4UW6A 4META 5F37A 1R64A 5FZAA 1EAH2 1PP9E 4MV2A 1LHVA 2ORZA 4KWKA 1XTGB 3LKJA 3AZVA 4FOWA 1STMA 1DFQA 3ITKA 1ENSA 1RUD1 3W58A 2GA1A 3BTYA 5C33A 4E2SA 2ZJCA 1AR92 3RG0A 3M3IA 1LJ2A 4GB33 2XU6A 1AYN2 5FP8A 2YKPA 1CAVA 4AGGA 1LGHB 1PVC1 4QPGC 2XWBB 3VBSB 4YLZA 4BK5A 3E6CC 3CJIC 3RL0B 4CA9A 4CCLA 3A2AA 4QKBA 5FYMA 1UMZA 2VXJA 4GJZA 1VQOP 3HRNA 3FHIB 3LDRA 5E79H 1ND3A 2HWC3 1UXZA 4HK9A 4N43A 3PIGA 1OVUA 2MKVA 4IOIH 3ZSJA 4A44A 1FOD2 3T2QA 1EUTA 3HOBA 5KLVD 4EWEA 4GODA 2I74A 3PJYA 1XPWA 2LKMA 1W9YA 1Q8QA 3E97A 5CYYA 4QM8A 1C1FA 1NTMG 1MFZA 1PGOA 2ZEWA 2D93A 2B7YA 4Y4RA 3JD73 3KZ4C 3POEA 3IDEA 2GC0A 1OQDA 5APYA 2YXQB 1JYWA 1XRUA 1VBE1 2X5IC 4NROA 2YFUA 4F83A 2GUSA 2LW8A 4LLOA 2QQUA 1VBA3 2Y0OA 2O01H 4BMBA 2HBTA 3HE4B 2OYZA 2MJZA 4RYDA 2GAUA 1WMKA 5KAIE 4JKLA 4FT8A 2VMFA 4L92A 3VBFA 1JY3O 4W7YA 4OWFA 4S2HA 3BCCE 3CXHD 5HV0A 5BVZA 4FFGA 4N43C 1SFYA 2BWAA 1ZBA2 1MZ9A 1PZ9A 1JS9A 3WUVA 3LA7A 4AGVA 1FBMA 4C7NB 4H44B 1LHNA 1VF5D 2PELA 3CEWA 1VRH3 2WO2A 3VV1A 2VNGA 2CK3H 4CP1A 1UZZA 3JB4C 2WNVA 1I3HA 2VNRA 4LQRA 1TG7A 3L75D 1QJY3 2YHJA 4BISA 4MG2A 1H9PA 1H9WA 2WPRA 3BU0A 4ZKUA 3WDTA 2VUJA 1E79H 3O7OA 4FBFA 3ROUA 5B4XA 1HJGA 2ARXA 1N7SD 1O3TA 3E6DA 1Q86Q 3IAPA 3VBFC 2ZX0A 3OJBA 2OQ6A 3RZGA 1NU1K 1SQBD 4S2DA 3P3NA 4URTA 2E32A 2R44A 2JDZA 2WITA 4IGQA 4JX0A 2E5TA 2XUEA 2KS1B 4JGZA 3TOJA 2EALA 1SMVA 3MIBA 3UV9A 3G7DA 2HWE3 1I9RA 2ATFA 2QQOA 1JMMA 4RJTA 1YQ4C 1XU1A 3CL3D 1J1DB 4WZCA 2RDSA 3J7LA 1KITA 3WDXA 1FMD2 1UKGA 2WNVC 1VAMA 3L72J 1VF5B 3MYXA 4NHMA 5F32A 2VM9A 1SQXD 3ACHA 1L0LJ 3K46A 3AYCA 3SITA 4Y5TA 3L71G 5GTHE 2EF6A 2VVEA 5BXXA 1SLAA 2W2IA 3D6EA 1ASJ3 1RHZB 4Q4Y3 1V70A 3POIA 5H2FE 2XNDH 3DF0A 3WP6A 1LCLA 4D7YA 1AYM1 3I2HA 4QDQA 2A3XA 1M56D 2ZCWA 4AW7A 4FPKA 1W9FA 2WBKA 4P02B 3WQBA 1ZBE2 2BCCD 4CUCA 2VZUA 1UY1A 2NMOA 1K5JA 4Y4YA 4PLMA 4CE8A 4D94A 3MIDA 1HUCA 1YI7A 4CDXC 5F5AA 1FDIA 3B00A 4IQPA 2IBZI 1HQWA 3P32A 3I3DA 1J58A 3IF4A 1RE3A 4Y99C 4QX7A 5FZKA 4BLJA 1DGRA 1YTZI 5ABJB 5B5EE 1QVGO 2H43A 3I97A 3AKSA 1EZVG 3VN4A 4UB6H 2E6VA 5LEJA 4AEDA 5AW7B 1S0JA 3BIWE 4LORA 2XBO2 5APVA 2VJXA 4B1LA 1M8OB 4AQSA 5JI9A 1AR63 5C3QA 5CCGC 3J8F2 3U4XA 1FDMA 2JWDA 4UBGA 2BV4A 3R0RA 1WRGA 4AEMA 1YIJP 4GWIA 2CDPA 3MIGA 1KYOI 1Y7BA 1X9TA 3TYYA 1UL9A 3H25A 4G9SB 1KD1Q 1S0DA 2ZZQA 2ZGUA 1O8SA 2WVRA 1CIWA 3WX5A 5GALA 5AW0B 1U5IA 4GMP3 3FFZA 5JXJA 4PI2A 3ST7A 3MFAA 5BNNA 2V4VA 2FYNB 4WVMB 3QWOC 1LWUA 4DFSA 2A45I 1OOPA 2JR8A 4UYBA 3PMEA 5CHXA 1DBNA 4U3FJ 3WT3A 2ZEZA 2I07B 1X36A 3MF6A 4O65A 2CY6A 1RUJ2 4LBQD 3BRVB 1OURA 2GMEA 4A3XA 3C7OA 4DCKA 3RRDA 3V56A 1REFA 1QNYA 3MUY1 3ZXKA 2W08A 4D6QA 3AE6C 1CPMA 1PV3A 1W6MB 1JO5A 2Z5WA 5GLUA 1NTKE 4C91A 1NE4A 3F89A 1AVBA 4KH9A 3VTPC 3H1LG 3VMZA 1O5UA 1QH7A 1NTMD 1V6KA 4YRDA 5LK5A 2H6BA 1LWUC 4Q0QA 3JXSA 3KCCA 2BYVE 1W6NB 2CPSA 4BYYA 1K04A 1RVF2 3I49A 2A6YA 4EZHA 3L73J 3GZUC 4FXGB 1OKQA 4PV1C 1MS3A 2O1QA 2XUMA 4MYEA 3POYA 5LATA 4Q5OA 1QLED 2Y6FA 3ES1A 4JPZB 4AI3A 1AA0A 4EN9B 2JJLA 4BOWA 4RR3A 4HN1A 2QQVA 1USDA 1BJQA 1AXKA 4LBQB 1HDKA 3B5NC 2CAUA 1HIXA 4ISRA 4WM7C 1UOBA 2AXTH 3WF0A 4CCMA 1J84A 5KAFH 3NXSA 2B8MA 2A70A 4AFAA 3J9SA 2QCSB 5APWA 3EMRA 1QXPA 3WD5A 2VCBA 2WSCH 1PP9J 5C4WB 4QU1A 1JI6A 1GWLA 1WMFA 2E26A 3L36A 3MV11 1OA3A 3AEAC 3HD7D 3WNMA 4XXAA 1GFF2 3NNLA 5J3UA 1IK7A 3NJZA 1RUE2 4AI0A 2W27A 3HQUA 4ATEA 1S5LH 3VBRC 3ZYBA 4HKWA 4XHBA 2D7FA 4Y1UA 4SBVA 4LIUA 3ZMNA 2QQPA 1J1EB 2MHFA 1OVPA 1GP6A 4LBNA 5K9YA 4FTSA 2FFDC 1W5CE 2HWF1 3RJ2X 4FPYA 4Y33A 2DU1A 1WMEA 3TWIA 2I45A 4EN7B 5EQUA 4GQ7A 1C8M1 2NP0A 1G9BA 4K35A 3CWBJ 2QVAA 1FYUA 1M06G 1UN1A 4R9BA 1ZRFA 1WKYA 3GW6A 4X8NA 4PD4D 1TME2 4AVAA 3VD7A 1GBGA 4E8DA 1MZ6A 3U0ZA 3VBOC 2FYUG 1WW6A 3Q5RA 5JPNB 4MGQA 3AXDA 2ET1A 3O1VA 3RK3D 1OQ1A 3L71D 3HD7B 3P5BA 1IFIA 3NAPA 1YJ9P 4LA2A 2ZT9C 3I54A 4PQ9A 3ZFEA 3I2OA 2KXLA 3GM8A 4DINB 3GALA 2A06D 3N36A 3W67A 2WQ8A 2FDHA 1G9CA 1ZREA 2A7AA 1PPJG 1R8EA 2BGOA 1DGWA 3AP7A 4WBAA 5JZGB 3O8ZA 4CDWC 5A7WA 1AUYA 1N86A 1OLME 1CN1A 3DGTA 2EIBA 2L9LA 3HVDA 4MGIE 3GHNA 2CSGA 2WJSA 2FHRA 4P9LA 4EYUA 3OY8A 1J3QA 1NY71 1TVGA 4M4RA 3OTFA 1L0NE 1GZWA 4XACA 1RUOA 4YVWA 5A1LA 3IR9A 4D69A 1HLCA 1BEV2 2YBKA 2BRTA 1CZSA 1MR5A 4W7ZA 2QQNA 1FZCA 2GMMA 2QQMA 2OYHC 5IT6A 4MVTA 2HH9A 1MS8A 1UU5A 1H0TA 5FMBA 4M3CB 1W03A 5FBZA 4CRQA 2FDIA 3LW5H 3V2RA 2W90A 2SPZA 3BCWA 1EZVD 3OUIA 1JMUB 3RK3B 5KHIA 3L72G 5FPVA 1ZBE3 1R081 1BCCD 2B89A 1L0LG 2ITAA 2WZR1 4OFGA 1GL2A 4GH4A 4PF1A 5FYVA 2RS31 1C4RA 2QTWB 1UPSA 2X10A 2OXBA 1VR3A 5TISH 4NIAA 2XVGA 4L73A 1OIPA 4D6TE 1YTZT 5LA9A 1PZ8A 1C5HA 1OH4A 2ZMLA 2R073 4N7UA 2Q30A 3RVHA 3KZIH 3RJRA 2DCTA 1OFSA 4YGEA 2RMU2 1ZR2A 1L4AA 2ZYGA 4P00B 1T2XA 1YFUA 2P3JA 4AHYA 1DEEG 5HCBA 3ZOIA 1ENXA 5FZDA 3MIWA 3N9QA 2E76B 1WD3A 4LITA 1SQPE 4P08A 2C9NY 3URFA 4FPHA 2ZGKA 3A3YB 1VBB3 5CB7A 4K3AA 4MZUA 3IIAA 4AVTA 2BNMA 5J7MA 4ORFA 1D7MA 1OA2A 1LNSA 4YFWA 3K3NA 1XB9A 2GUVA 1NAYA 3OUJA 3T0AA 4PLNA 1Z0HA 3SFDC 4IFFA 3KQGA 1YYCA 2WFPA 5CBOA 1RMU2 4IE7A 3IMMA 4YPJA 5FUPA 3NJVA 3S1KA 1MEC1 2IXCA 1S3JA 4HPKA 3ZDSA 5FXVA 4GIFA 2K9JA 2D98A 2YO2A 1RB8G 1JM0A 4NHXA 3VBSC 1S72P 1CESA 3ZN6A 2CNAA 3RL0C 3SISA 3H1LD 3K3OA 3V65A 1KEXA 4OVEA 5DAPA 3KHCA 3AEFC 4XFBA 3USUB 2WFF3 5IFPA 5FJHA 2F4LA 2D3RA 4Y3OA 3C9IA 3GHGA 1PX4A 1ULCA 3E1F1 3I3QA 3HE5B 2Q9IA 4GALA 2Y0IA 4KQ7A 1H1MA 1FZBA 2VZOA 5I8YA 2H8PD 1W39A 1Q8OA 3WQ0A 4Q0PA 3SQOA 1DQ0A 5JOZA 2UYAA 3DYPA 3VDDA 5FZEA 3TGUE 1E5SA 3ORJA 2J1TA 2R061 4CU6A 1PGW1 4EQVA 1LTIC 1O3RA 3VZNA 2DCKA 5FY8A 1HWTC 2KS1A 4K8FA 3R4YA 1L7LA 4RHV1 5GZCA 1YI9A 5BNOB 4K9SA 4AQ2A 4UW4A 4ET7A 3D6YA 4JDMA 4NO4A 4OUEA 2PLV2 4MLOA 3V0AB 1XC6A 1YYNA 1V6NA 2H7HA 5ACA3 4AVBA 4JAAA 1WLCA 2PFWA 2TNFA 2IZ1A 3LEIA 4JTNA 1M57D 2GNDA 4W4ZA 1RYYA 5DAWA 3WDYA 3INAA 3ZSKA 1J59A 4CXYA 3VD5A 5A32B 1LODA 2PFXA 4AFBA 2Y6HA 4P9XA 3WEZA 2JG9B 3WNPA 2BFUS 3AEEC 4YARA 2R1DA 4FAGA 5JOXA 5CJ0A 3VBUB 2E74D 2FDFA 1RUH1 1W0OA 2VOVA 2WNUB 1YIPA 2FZ1A 4BK4A 2JWAA 2W9XA 1JYTA 3MV01 4YGCA 3VKNA 4GWJA 3I2DA 4NWWA 3D0JA 3FLRA 1IOAA 2BJSA 5KLVE 1KB9I 2TEPA 3FN9A 3SC7X 1J1DC 3ECQA 1DGWX 4N78D 3U1AA 1VF5C 3CLQA 3ZXFA 4ZKPA 1RIRA 5ABJA 4Q0UA 3CX5I 3AFGA 1Z7S2 3MGNA 3AE9C 1OBNA 4JGYA 5SV8A 1HRI2 4O9GA 1RUF3 3M91A 1A02F 4KI5M 3RI8A 2RS53 4J1XA 5JIUA 2VMIA 2AC1A 4BDVB 2XVLA 2WT7A 4XABA 1N7SC 1DIPA 3W21A 4IETA 2E74B 3CXHE 1NA1B 3ETQA 3S7IA 3HIFA 3N35A 4D6RA 1A78A 3DXUA 1QDCA 1HBWA 3JZVA 1W8FA 1RF1B 1UZ0A 2RS13 1COV2 1NKZB 4XFJA 2Q0AA 1TMF1 3L70D 2CYFA 2WT0A 5CCHC 4B86A 4QT6A 1WBLA 4BQ5A 3VOPA 4KG0A 4MGTA 4DQAA 4UFIA 2GNBA 2WA4A 3M9BA 1EAH1 3SEEA 2RV9A 4QB6A 1W6QB 1KJRA 1KFNA 5IVEA 1NH4A 1VQ5P 5CNAA 5FREA 4BQ3A 3ZSLA 4XBLA 3L75E 5ABJC 1K12A 3LEKA 2BVBA 1ZXGA 3N3HA 4QPYA 4IEUA 2WMMA 2YO3A 4BIOA 3OUHA 1EXJA 4OQ9A 1AR91 5BNPA 1NUKA 3BCCG 1URQD 3VP9A 5ANNA 4HANA 1NCQA 5DUXA 1AYN1 3CBNA 1AJOA 3BODA 4QMAA 5CKMA 3S57A 1HRV3 3CZUA 3PTRB 2ZAAA 1V0AA 2DUPA 1K5MB 2Q5UA 4G3YC 1MS9A 1C57A 5IATA 4QQLA 1SQBE 4DXTA 1KORA 4QQ2A 4FPFA 3RMXA 1HXS1 3M0DC 1UYZA 3MF9A 3N9OA 1ULPA 4AQ6A 1FOD1 3CHXA 2ZYAA 2CWSA 3OYWB 1W2UA 1BZWA 3V2QA 2HKXA 1QOTA 3ZXJA 1ZRTD 1W6MA 2GDFA 5B66H 2VBBA 4P9GA 1PO13 4ONUA 4UW3A 2K2SA 3ILFA 5FZ0A 3W68A 1IQAA 1L0NJ 2H89C 1KYOD 1D4M2 2FYNC 3JBG3 1MV8A 2N9YB 1EPWA 2WO7A 1XOYA 3HNYM 1Y9BA 3KWVA 1JY2P 4MH0E 1BYHA 3B8EB 1URQB 2PP6A 2XPJA 3EHKA 3T0BA 4Y22A 5A7QA 3CC4P 4AHWA 5BU8B 1DU3D 4DXRA 4HSLA 4QGMA 1LTJB 1GSLA 3CCEP 1EY2A 4XC9A 4GKYA 3MUZ1 1NO4A 2BCCE 2RDRA 4DB5A 3OGJA 3NSTA 1RH5B 1O3SA 2Y34A 2VMCA 1ZBA1 1GMMA 5H9QA 1UIJA 2Y0DA 5F1RA 5J37A 4YW5A 1W99A 1QJEA 3CMAP 3KVBA 3W9AA 2WZEA 4EWDA 1LTTC 3P8MC 1JZ4A 3H8UA 1CX1A 4RQPA 2VZTA 4YW7A 1JYNA 5C4WA 1Y47A 2QZ3A 3UGGA 3GF3A 4D6TJ 2CGOA 1ONAA 4HFSA 1RXGA 3UT0A 1OQEA 4PDWB 4AEJA 1BBT2 1JOCA 4WB4A 1SLIA 2HJIA 4I09A 2O3JA 1R5SA 4L76A 2B5HA 4AAPA 4JKKA 1AV1A 2BFUL 3FX0A 1URXA 2W87A 1JUHA 3ZFGB 2B87B 1JZ7A 1KQSO 5LZ6A 1O8PA 4Y5Z0 5AC92 4ZU5A 2R1BA 1IC2A 4QX0A 1YJLA 1ZZBA 4K8RB 1SQPJ 5A3NA 2Q6QA 3BTXA 2PHDA 4JDOA 3MW4A 2ZGPA 1PGL1 3LSDA 2BEQD 4YM1A 1FMD1 4AXOA 1QOOA 1NX9A 2J58A 2W6BA 3UGHA 4K40A 3RPQA 5FZ6A 4AE2A 5C4WC 4BWNA 2OVUA 1RUG3 2YBPA 4COVA 3WVJA 2GN7A 2EA7A 3KHBA 3UK9A 4QGLA 1HB2A 5IFTA 4HMZA 3SMHA 2G4IA 4OI1A 2DCYA 1RINA 3R4SA 4YM2A 1OX3A 3E5QA 2WDBA 3V6IA 4OH8B 3WCSA 1J1EC 1POV1 3C7GA 2WL1A 1ZBE1 4COWA 4WY4D 4MX3A 1QJX2 5T3NA 2PLV3 4CDUB 3WNKA 2D6PA 4E4SA 4MN4C 4XJZA 1CAXB 4XDPA 3B9CA 3T97B 5FPAA 3TNUB 1UX7A 2JG8C 2LROA 1CR7A 4KU7A 2Q7CA 2WZ8A 2Z4FA 4ZXEA 2JE9A 2IFMA 3ILNA 5HPOA 1H4HA 4R4XA 1R5LA 4IL6E 5FYCA 4ZU4A 4L0PA 4RO0A 2UYBA 2VO5A 2R043 2O8OA 1RUNA 2E63A 1V6LA 4QPIB 3HD7C 2XBO1 1GOHA 2ID4A 4TT3H 4UF0B 5CFCC 3O0VA 4GWMA 1LOCA 5IVVA 2MNGA 3KCXA 3TGUJ 3J8F1 5CBLA 1VDFA 4NPRA 2K0GA 4A7PA 1YCIA 4QPWA 5JZGC 3MICA 1SVFA 4W6XA 1WUVA 1NTKG 3D8CA 4L8QA 5GJ6A 2J59M 5AVSB 2ZS6B 2BGCA 1SQVK 1OH3A 3SKVA 3T4HB 2HEWF 5L73A 1LGBA 2NPSA 1F2NA 3HQXA 4K20A 4EROA 1WBFA 2R49A 2Y6JA 3JCUH 2VZSA 2WQZC 4QHBA 4Y28J 3JSVC 1EDKA 3HUSC 2DW3A 4DZGA 5FY5A 3E6BA 5F3GA 2OTLP 5BY5A 2O14A 4OGQD 4QHOA 2Q1KA 2AEZA 4R4LA 3U11A 1ZNPA 2QKDA 3LIDA 2K46A 3PJSK 1JMBA 4DRVA 4RS5B 1SQPK 3RK3C 3VZOA 2EICA 2A1XA 2WLPA 3BCCD 3F95A 4ATFA 5LCWL 1YHFA 3V0BA 1RUJ1 1XYOA 4IV3B 1GLHA 1JODA 2KM2A 1X8YA 3GBWA 4FPEA 5FWEA 5FZ8A 4QX8A 3AP5A 2AACA 1QDOA 4O61A 3ZN5A 2XR4A 2GSYA 2KLUA 1S5LX 1W6PA 2HEVF 4L2NA 4N53B 5KLVJ 1W6OB 1IJDB 4W50A 1UAIA 1OFCX 1P84I 1Q56A 4PD4E 4R52A 1X22A 3BYWA 1YXWA 3KB5A 1GW3A 4M3CE 4BXSV 1SPPA 5CFDC 4RGAA 1PNFA 4CDQA 1K8AQ 1RVF1 1NCRB 5DJTB 3RK3E 4OGQB 5APQA 3NNJA 3CJIB 3WP3A 5B4NA 3TN93 1RY3A 3L74D 1PIV3 3IB3A 3S4RA 4YZ2A 1KDMA 1W2EA 2D43A 2R30A 1HV0A 2A06E 1L3JA 4CEYB 2VTFA 1HJ0A 5JXIA 3OEAA 1PGQA 1O5LA 1ODMA 4AVVA 4KNCA 4EN6B 5KBFA 3A5TA 2WN3A 1L7RA 3DUIA 5EJZB 5FDBA 1BVVA 1LOFC 4XQ4A 2VULA 3WDWA 4TTGA 2W3JA 5DUVA 2VBDA 3M8LA 1JN2P 3HE5A 4MGZE 1UYXA 3PLQA 2HWD2 2HWB2 3S0MA 1GKBA 4NPEA 3WF3A 1W28A 3A0NA 3ON7A 4DIQA 2W1UA 3MIEA 2D6NA 4WBBA 1AR82 1XYPA 3EQ2A 2VNOA 5FAXA 3L75J 2X5IB 3CNAA 2FD8A 1NOVA 2Y60A 2J5UA 3KGZA 4A4AA 1LRHA 4RFT0 1RUE1 1AR73 5HCHA 1NLQA 5TJHA 1L7QA 2P37A 3FFQA 1VQ8P 5LBCA 1BCCE 5E88A 1L0NG 4I3GA 2ZGOA 5M0TA 1QNWA 4CP9B 1SQBJ 3PIJA 1GR3A 3KSCA 4R9AA 1Y3TA 2RR11 3NTNA 2QBXA 3DPRA 3TEXA 4GKGA 2ZACA 1RUD3 1VBC2 4MGSA 4XOGA 2DDUA 4ASWA 5C5TA 1TME1 4BU2A 1ULDA 5C39A 3UKNA 3VB9A 1PVC3 5FOBB 1M1JA 5KAIH 1H30A 5A32A 2JDUA 1SQXJ 1DQ5A 3SWYA 5E79E 2KUBA 4BQYA 3HNMA 1K45A 2C9AA 1H88A 2LTNA 3WW3A 1E5WA 3MTUE 5A6ZA 5JPMB 1DLLA 2WS92 2WWJA 1LULA 2WLQA 2E33A 5BNOC 2P10A 5KLVK 3D5OA 4D6TG 1MS5A 2D2CD 2Q5TA 3D3AA 1AXZA 1WCUA 3GJAA 1Q82Q 1BSNA 3PVOA 3JC22 5AW5B 1IO4A 4AI8A 4PBPA 3VKMA 1KXGA 2QIWA 3PVEA 2PHFA 3I2FA 4LBKA 1VBE3 1Y9MA 1DLCA 1BEV1 4YZ1A 4D0QA 5DAVA 5ERLA 1NU1D 2ETEA 1N3OA 5CAZA 1F35A 2J1VA 3KV6A 1PK6C 5E8AA 2CGPA 2ADDA 2B9VA 3M3OA 2M3EA 2JG9C 3VBUC 4ZY9A 2FXPA 4CPGA 3H1LE 1NAFA 1VAVA 4PT6A 3S5AA 2W8ZA 1W2BO 1B35C 2WNUC 4LO6B 3U59A 4N9HA 1DQ4A 1NA1A 2ZMKA 4TSVA 2VMGA 2RHPA 4NRQA 3OGVA 1US3A 2YROA 3KM5A 1GZTA 5IWFA 4CDXB 4LO7A 4QAWA 4AR2A 2D2CB 5C5UA 4XJUA 2D97A 3O1PA 1VQPP 1PGJA 1W6QA 3H32B 4I7ZB 2YMZA 5C3OA 2HYKA 1J83A 5KLIB 1NTKD 4KWUA 2R5DA 1S0BA 3FUQA 2VQ0A 1SQQE 5GTHH 3MUDC 2Q8EA 1KB9D 1FAYA 1W2OA 3L37A 1PM4A 5H2FH 5D2AA 1Q7YQ 2GNTA 4XFFA 2XKPA 4B4QA 2WKKA 2IFWA 2RMU1 3VDBA 3CX5D 5A3TA 1K5MA 3ZYPA 2WR9A 1KQFB 3UJOA 3H1JE 3W5MA 1POV0 1UW8A 3NKTA 3UIAA 2E74C 1CAWB 5L9VA 3BOWA 1NA1C 1WGPA 5A1FA 5APXA 5BNQA 2ARBA 2VVDA 4Y20A 4JHTA 4LTAA 4ZS2A 3VZLA 1RF1C 4BA6A 1X50A 4BM8A 4DS0A 1T2KD 5JOYA 3HNBM 2N1TD 2JDYA 5EJ3A 1XNAA 3GBFA 1B09A 2DUOA 2VMHA 2Y26A 2HEYF 5B5EH 3RI9A 5A3OA 1MZEA 1RMU1 1SQXK 4N8MA 5JIAA 4IEOA 1NHLA 3TGUG 2ENRA 3TRSB 2JD9A 1V6OA 1G9AA 1ST8A 5M1BA 1KFUL 5K0UC 1V6JA 1AL22 1AYM3 1AX0A 2UY8A 1XNKA 2B9BA 2OS2A 1YUDA 1NTMJ 2PQQA 1DX7A 1MKMA 3K5BA 1UWWA 2C5DA 3ACGA 1QIQA 3AE5C 5F2WA 3H1KG 3SCGA 2ES3A 2P2KA 3H3UA 5FYIA 5KWRA 1RQUA 4ZONA 2WSSH 2X53S 1UIIA 5GZEA 4KG8A 3CIHA 4C46A 3AE3C 3QACA 3RFRA 4R9CA 5C9AB 1JYXA 2N1TB 1JHNA 4F7ZA 1SCRA 1RQVA 2FCVA 2KLVA 2OYIC 1CVNA 2CAVA 2D44A 3VGIA 4JQRA 4MHRA 4FSJA 3NJYA 3ELNA 4PDWA 2D6OX 2VZPA 2D40A 2RKLA 2B4KA 1URQC 4EOTA 3AYEA 2VXRA 4O7XA 5L9RA 5FKBA 3AYAA 2E51A 4YW2A 2QM7A 4UI9L 4YVSA 2UWJE 1XNCA 4CU8A 1LTJC 5CISA 2H0VA 3GHMA 3H3ZA 4FPCA 5FUNA 3I2JA 4Z2AA 3U78A 4YGDA 1X82A 3B5NB 1LHWA 3MGUA 5EV7A 1JOJA 4XAEA 5L7OA 3L70E 4PBOA 1DQ1A 3EO6A 1X33A 4O9EA 2VCAA 1JZ6A 3U75A 3Q5SA 5T52A 4NHLA 1AJKA 3JUUA 4DPNA 2G19A 1JZ2A 3APBA 4Q4W2 2WYSA 2VG9A 5F9TA 1US2A 4YXWH 5IK5A 4J6GA 1KILD 1SLCA 3U14A 4JZRA 3PUQA 3VMYA 3N9LA 2IBZE 3IAQA 2GH8A 4CU7A 4NPFX 1UZYA 5LA2A 2IXLA 4ZMDA 3ACIA 2XDJA 2OZ6A 1W2NA 4R4MA 3PNAA 4XZUG 2ZXQA 5FXWA 1HF9A 4IL7A 2XLGA 3ZFGC 5IUQA 3G6EP 5C6CA 2BGPA 5J96B 1GK4A 5KJ7D 3L71J 1S0EA 3G3ZA 5FMDA 2B88A 4Q2FA 4CDUA 3L75G 1F5FA 1CAXA 4RFRB 4A7YA 3R4UA 1NWQA 3AX4A 1VB4A 3NNGA 1OZHA 3T97A 3GLMA 3TNUA 5FO9B 1ZRTE 1PO22 1LOEA 5AVRB 4CVUA 1I1EA 4YYOA 4C0HA 1KS5A 1NTMK 3PTZA 1Z7S1 3C7FA 3U1XA 3ZYGA 3AE7C 3SHRA 1KYOE 2P1JA 2DCZA 1DYKA 3MI8A 1SQBG 1QJU2 4FAHA 3VKFC 1KILB 1DZQA 4CP0A 1HRI1 2VW0A 2D3PA 4QPIA 2ZKNA 2Y33A 3N7JA 3N9PA 4NWVA 1UIXA 4UF0A 2K88A 3ZXAC 4LLHA 3CCUP 2KXPB 2XMLA 2WSVA 1F8VA 1I5ZA 3ZR6A 2IZ0A 3H8RA 3ZPYA 3DV8A 3PLNA 3PHMA 3CDZB 1LJ7A 4XFIA 4CDWB 2MEV2 4Q8LA 1XNBA 4U3FD 1LT9A 1COV1 1BCCJ 3NWKA 1RHI1 4MGYE 1H8TA 4IV1C 5C8WA 2WAOA 4A6SA 3H42B 4PQQA 5FZ7A 3BKZA 4B7KA 3MFCA 2E7AA 2K9ZA 4Y24A 5J1XA 1OLRA 2OYHB 3ZIWA 3TK1A 2OUJA 4K21A 5JMOA 4YXDC 3P6BA 3I56P 5AFEA 5KXEA 2Z5HA 2VZRA 4XUOA 3K48A 1QHDA 2PHTA 3TDKA 2BCCG 3KQ4B 3QOPA 4GA9A 1SFCD 3V2NA 1F31A 5KC5A 2PA7A 3S5QA 3CCLP 2JKXA 5C8CB 1SP4A 1YQCA 2BEZF 1N1YA 5FY7A 4IV3A 4TYSA 1GZ9A 2VZVA 2HWF3 5APSA 3PMSA 4H3WA 2RM22 3L2YA 2KA3A 1LTAC 1C8M3 4QM9A 4WY4C 1RL3A 4XW3A 4FVVA 2UWAA 3A21A 5HBAA 2WINB 3L2HA 4Z07A 4BXLA 5JCTA 1ZYBA 1FDOA 3H1YA 3TEWA 2H88C 3KLSA 4KWLA 4YZ4A 2E7TA 4HVRA 1LOBA 3LIHA 1D4M1 3OB8A 4BB3A 3K2OA 1W9SA 3G9RA 1SBEA 4QPGA 4QB1A 2P2UA 2YNYA 2YXRB 4RS5C 3RSJA 3CJIA 5B2GB 1LNQA 2LXBA 5FK8A 1LGCA 4I02A 3NNMA 1SFCB 3L35A 2ZX4A 3OBAA 4XF0A 3IBMA 1EQ7A 3OJAB 1CI6B 4OI0A 1A6CA 3H1LJ 3LWCA 2VGDA 2PAEA 2WWUA 1H89A 5CKNA 1FPN2 2GC2A 4XUNA 5FZHA 1HH0A 4Q4X2 1ODNA 3KQRA 1H1IA 1W8OA 5FZOB 3NRUA 5BV6A 3H1KD 2W52A 4URAA 3GCWA 4N53C 2PXJA 3DXTA 2CTVA 2IVJA 4ASKA 4L97A 4D8MA 4OZXA 3AE8C 5DG2A 2FDJA 2KSEA 2XLAA 4LO4B 2VOXA 4CPBD 5IK7A 3VKLA 2WO1A 5J98B 4CCEA 4LHNA 2J42A 4WVVA 4E27A 2X5IA 3RBXA 3WG1A 4M4PA 1PIXA 3WHUA 3TYJA 1SLLA 1BBT1 1NCRC 4IEQA 1GTWA 4OGQC 2BQPA 1RF0C 1P84D 3JB8A 1BE3D 2WSEJ 3MBWA 1R083 2CPBA 1JNMA 2WZR3 3VBHB 1HXS2 4CEYC 2RS33 3CCQP 4QDRA 1EDLA 2QFEA 4MXWB 5AC91 1JUNA 1CZTA 5CZKA 4CP9A 3J7NA 1J1LA 1VALA 3AJYA 3R2PA 1XSQA 2HLOA 3NW4A 3ZFFC 1TQ5A 3RYPA 5ISLA 1RUC2 1MACA 1S9KD 4RGGA 1ZZ8A 3ZM8A 1ZV8A 4IW3A 3CPWO 1UY0A 4G4FA 1T6BX 4GAZA 3RZZA 4MUVA 4OHXA 3PH0A 4Q0SA 1UX6A 3CCRP 2XHNA 1M90Q 3VHPA 3O1MA 3FE5A 1V9U2 3A4UA 2WWWA 1QQP2 2V7QJ 1SCSA 1O6UA 3HAGA 3WF1A 1YRZA 5FPBA 3HT1A 1LAJA 4AZZA 5D8AB 1C3HA 2ZAEB 3MP7B 1SZBA 2FYUJ 1FX5A 1QJX1 5KC6A 2QQLA 3WP5A 3BPZA 2ARCA 5JSPA 1VQ7P 3SXWA 3HR9A 2DYCA 3SH3A 1MEC3 1VBD2 4Z8BA 3U07A 2AREA 1XXNA 4WVWA 4XVHA 4FOVA 5FQ0A 2QRXA 4H7LA 1LHUA 3PL0A 3B5LB 2KIKA 5FWJA 4QXKA 2VW2A 4I30A 3PUSA 4YZ5A 3LEMA 5LBBA 1OW6A 1UZWA 4XQWA 1BGYD 1QGLA 4N6JA 2DVBA 1PX3A 2RDQA 4CUAA 4DXZA 3SH5A 3L74E 3LQCA 2KOGA 3J7HA 2OW4A 3H1HG 3A7QA 2W5FA 2HLEA 2QQWA 1ZZCA 3A22A 5CCHD 1GK6A 2I8DA 3QBQA 1C5IA 4CDXA 2O1JA 2J22A 1PZ7A 3CXHI 1DDLA 4XTMA 2XV5A 1PGL2 3H1ID 2QSIA 3H32A 2EIDA 3MPPG 5LBEA 4FQ4A 2JICA 4PJ0H 2VOTA 1LB2A 1FNZA 1S0GA 3IN9A 4H13D 4D3WA 2NRGA 1ZRRA 4QD2A 5DAXA 1R092 5FZCA 1GWKA 2A06G 4XQDA 1NOHA 2R063 4NVPA 3AL5A 4PJYA 3H1MA 4AFDA 2ZHLA 2ET7A 3VD4A 1N7SB 2VUCA 5CCGA 4RHV3 4TN7A 4B3NA 2HBUA 4OHVA 1EV12 1ZRCA 2K37A 4UB8H 3G6JB 1JUIA 3WG2A 3AZXA 2EXHA 3FHAA 5GTIE 4DEQA 1R1ZA 2YKOA 2VZ3A 2C0WA 4AVCA 2DCJA 3BUCA 3PUHA 2Z79A 4OHYA 2D2CC 2IUWA 3C7HA 3NKGA 3E5XA 4I7ZC 5HXVA 5KLIC 5DDJ2 5KHJA 5LASA 1IG0A 3WHTA 1MVQA 1W0NA 2YMKA 5LWBA 3NL1A 2QZ2A 1K3IA 4H13B 5FYHA 4AF9A 3ZN4A 5K4LA 2QJKB 4Q1PA 1Y9QA 4XXPA 3VP8A 2JDKA 1BCCG 1S0CA 2XL7A 3LEGA 4NHYA 1OD3A 3AE2C 3N7NA 1RUH3 1FOSF 3IKWA 4K7JA 4NIGA 2FYUK 3CXHH 3H9AA 5FZIA 2CGNA 4LC1A 4LIVA 2CV6A 2M5AB 3T2TA 3UNPA 2BEOA 2A6VA 3R6SA 1CSBA 4JQTA 4SLIA 1MS0A 2XLFA 2EAAA 4RN5A 4GIQA 3OD0A 3S9OA 1IPSA 4C90A 3V4QA 3GG2A 2YDEA 4R8HA 1R1A2 5CADA 5APTA 2NYYA 3O0WA 4N7IA 2AR6A 4HSJA 4BHPA 2D5FA 2LUWA 3AM2A 1W2TA 1QH6A 1KGYA 2CU5A 2HWD1 4BCUA 4J25A 2HWB1 4X8PA 2KNCA 3LA2A 1OD5A 2R6QA 3P1IA 1NU1E 2XWJB 5FMOL 1AR81 1D2SA 3C8VA 2Q1ZB 1J1TA 5IW0A 5I93A 5JLVA 4JGZB 1ZZ6A 1OC1A 1IFDA 1KZUB 4DY5A 1GU5A 1W3VA 3IPVA 2ILMA 3BIEA 4DT0A 2QA4P 5KTBA 1YQ8A 3KYQA 4Y1YA 3O1OA 4XF4A 1YWKA 1FNYA 4YG0A 4LJHA 5FZ1A 4CU9A 2P3YA 3DKQA 1TMF3 3B5NA 4JYBA 3SLIA 1UU6A 4WM7A 4X6QB 1RUI2 2VCCA 1L0LK 1EAH3 5A6XA 2XQRA 1XJAA 4LBMA 1WA6X 1T2KC 5LY1A 2FXOA 3EBRA 5C9AC 2VW1A 2N1TC 1AF9A 2FZ2A 1VBC1 1JTZX 5K5GB 5A6QA 1JZ8A 4WM8C 4QX5A 2WC2A 1AR93 1YFWA 3WNNA 1YITP 1KB9E 1AYN3 1IHMA 4IFMA 1OUXA 4CEWB 2ZGSA 3N4XA 5EYYA 4H2AA 4EI2A 1WMDA 4L11A 2ZKLA 5DXDA 2W1QA 1DD4A 4Q4V2 2AEMA 5DZFA 2M8RA 1HB4A 3CX5E 3VBRA 1W05A 1HXS3 2GZWA 5FZFA 1CZVA 1ZRIA 3HJRA 5FPXA 3RZLA 2WS91 2RVAA 1FOD3 1F9KA 4U36A 1KFMA 3D71A 2FFDA 1GQHA 2WABA 4IEZA 3T1MA 3CL1A 4I2OA 4IE6A 1H0BA 1SQQG 1AFOA 2K3RA 1OLMA 1AVOA 4CCKA 4AEDB 4GB32 2QJYC 4BMEA 1GICA 4Q29A 4Z92B 4H0LD 3WXPA 5DABA 1W9WA 4I3PA 2GP3A 1X9VA 5KHHA 3H1JG 3VBOA 1YO8A 4CYDA 1T6GC 1ENRA 1HN0A 2IDBA 4GXLA 4QDSA 2HWC2 2CL2A 4FPOB 3MZWB 3B3QE 4P5YA 3RQ0A 2Z5IA 1NVOA 1ZBA3 4AEKA 5IK4A 4HH2A 3JD72 4CDWA 1X7NA 4BXFA 3BU7A 5L36A 4E2QA 1NYHA 3V5BA 5BNNB 5E89A 3H1HD 3OBRA 2PTMA 2RR12 3LSEA 4LE3A 2WNEA 4BQWA 1OOPB 3DKWA 3A0HE 4JC1A 3AK0A 4TLFA 2JG8B 2E53A 1LKNA 3H7YA 2W1WA 5T5JA 3S7EA 2ZEYA 2OYHA 1MZFA 2AEFA 3VD9A 2BU9A 1KQLA 3MD0A 3T08A 4H0LB 1KILC 5FZMA 4IEYA 4NIIA 4UFJA 2BOIA 1UPIA 4F8AA 4YPCA 4P9JA 3O5SA 4DJGA 2BZDA 3WDVA 2C9KA 4FXKB 1QF3A 5JDBA 5LA0A 5CFCB 3M9HA 1VQLP 2N7GA 5EHDA 3WV6A 1M7LA 1JTHB 2AH2A 2Z4EA 1GOFA 5T5LA 3BCCJ 1XBFA 3DYOA 1QJY2 1ACCA 5KJ7C 5FFOC 4Y1VA 1FMD3 4LOTA 4LNVA 1I5PA 1GYKA 2W83C 2BVVA 1REEA 4U7JA 1RGSA 2XHKA 1G7YA 1RJ7A 4IL6H 2W47A 1OUSA 3HUSB 2EIGA 5FP9A 4XJWA 1CAUB 1KILE 4ARXA 4RR3B 1IFMA 2ZPXA 3KGLA 4YW1A 2YXSA 1AL21 2XKOA 3O1UA 3HN1A 1LEDA 1LECA 3LCPA 4PD4I 4HLTA 1VQMP 5EZWA 4JCKA 4QB2A 5FMCA 4RL7A 2N9BA 2WSFJ 2HWE2 1N1TA 4CXXA 1SQVD 5C8CC 3D6ZA 1POV3 1SFCA 3PRJA 4DRRA 3L70G 1PGPA 2YC2A 3ZO0B 3R4DB 2HYXA 4PIZA 1QY4A 2XJUA 3M3QA 3L74J 3A7OA 5T55A 2UURA 1QL2A 5FZOA 1PHMA 3AYDA 4LBLA 1ZN5A 1OKOA 2IBZG 5JI7A 4PI0A 4XIKA 5E1RA 1ND2C 1ASJ2 3O12A 4Q4Y2 2E75D 5CIRA 1IS6A 3MW2A 4AHZA 1KN7A 5A3UA 3P7KA 3RZHA 4IUGA 2LALA 3THDA 3OOXA 4BLIA 2ZOEB 1Q81Q 1ZLLA 2XBO3 5CFDB 4OUSA 4MADA 3VBSA 1NXD1 1S4CA 3B69A 4AOCA 2ZEXA 3ZMOA 4DOUA 1YQ5A 3ACLA 3J8F3 1FXZA 4JDNA 2BPA2 1SFCC 5H9RA 3IDAA 4ISQA 4COZA 4IFDK 5JAXA 2EVXA 2P3IA 3B02A 2GP5A 5IVYA 4MXWA 1EZVI 1RE4C 5DUWA 3AXEA 4U3FE 3ZVXA 1NT0A 3JU9A 3J26N 3WSOA 4A3ZA 1WW5A 1RTVA 2C4XA 4PD4H 1QOSA 4IGPA 1FV3A 4Q4W1 3ZFEB 1JEKA 2DTYA 2E75B 1QMJA 1GL2D 1MUUA 4I0WB 1CQ9A 1AR62 1OWAA 4C7RA 2DBNA 1M1KQ 2FDKA 3HE4A 2F17A 3OG2A 3N9MA 5A7WB 1IFNA 3O1RA 1SLBA 1YIFA 3NMBA 2XH6A 2A45G 3WY6A 3UKTA 4ZKTB 2XJPA 1WCQA 3IT8A 1RUJ3 1QKQA 3VBHC 1DQ6A 1JYIA 1SHWB 3GXUA 2VTXA 5FLJA 1GZWB 3VDAA 5D8AA 1GMJA 3KF5A 4YVWB 5HXMA 1J2JB 2JXAA 2VOWA 1FZCB 4IEWA 3L73E 4C7NA 1L4AD 5C70A 1H0TB 4CCCA 4Z1MH 1LTEA 1DYPA 3O6QB 1WLTA 5DQ0A 5H9SA 1JY2O 1PO21 1SQQD 4UFMA 1DEBA 1SFNA 1J3PA 1OSGA 5FZLA 1Q8VA 1QL1A 5C3SA 2F6BA 3WR0A 3A0BH 2NLRA 4CCDA 1RVF3 2Y9ZA 1EC5A 1YFYA 3SEPA 3BI3A 4AGRA 3ZIXA 1GL2B 4XAAA 1QJU1 2ZBJA 1DG6A 4BWOA 3O1TA 1J3RA 3GF7A 4HYTB 4PIYA 3AMHA 1NU1J 4QKFA 4A7ZA 3RGUA 4IDZA 1YFXA 1KQGB 3H1JD 4Q0VA 4XCAA 3LOBA 4FO9A 3G4SP 3WQ1A 5AW9B 1DD3A 1IG3A 5D8AC 1QVFO 4XUPA 4IERA 1IKQA 3PP5A 5AVVB 5CBNA 1CW5A 2MEV1 4TXWA 5FXXA 1HJBA 5T54A 1ZMEC 3WU2H 3AVRA 3H7JA 2NZ9A 3B9IA 3H1KE 4K6BA 4EJRA 5CVRA 1L4AB 2RJKA 3EFFK 1UKRA 3ZXEA 2PAMA 4DXSA 1LU2A 2XL9A 4KL1A 4HN0A 1WA4A 4DUWA 2Q8OA 4XURA 4LA3A 2X09A 2ZTNA 1QEXA 2BWCA 1NTKJ 3W59A 1DCSA 1EP0A 3FLTA 1CWPA 1PK6B 4H44D 1RUE3 2XG3A 3QH7A 3CWBE 1SBFA 1NQJA 3MEPA 3WDUA 3Q8FA 4XFHA 4OLLA 2Y38A 1P84E 1BE3E 1NTZG 1N7SA 1UYYA 4CP2A 2O01N 4P9WA 5GLVA 3MDPA 5FRAA 1B35B 3G71P 3AB0A 1O4YA 2WYFA 4WZFA 3AKPA 1N2DC 3RNSA 2OARA 3PVNA 5AW3B 1VPCA 4KMQA 4JYCA 1IS3A 4HPKB 2RM21 2JB4A 2RR13 3RZMA 3RWKX 2K9JB 5CCHA 5AVYB 3NFQA 1FE6A 4INDA 5JVVA 5FUIA 3ZN6B 4AQTA 1TME3 4QKNA 1S9KE 1W04A 2FQPA 4Q8KA 4ARYA 1N1VA 4HT1T 4CTEA 4LULA 4XYXA 2XXZA 2IZWA 2A3YA 2OTKE 1ND3C 5FLIA 4XBQA 4Q1RA 2QJPB 5A6YA 3OGGA 2XQXA 2X05A 3AVSA 1UIKA 2Z42A 4NRMA 3GHGB 1G9FA 2M5AA 2UWCA 4ZU7A 4EN0A 3M0DA 2NZ2A 3FWNA 1V6IA 3HN3A 4LMFA 1N3QA 1EDIA 1O4ZA 1OXZA 3CO2A 1DZRA 1FPN1 1GD2E 1DZTA 2C24A 4Q4X1 1EUUA 1OPOA 1RHI2 5FY9A 2XZRA 4NRPA 4PLOA 3VDDB 5KHGA 1BEV3 4C8DA 1U12A 2R0FA 1LTSC 3E7KA 1A8MA 2WNOA 2OGUA 2WWSA 2WSEH 3A0KA 1YJKA 2C0ZA 4FTEA 2YMYA 2IBZD 3GDBA 4H14A 4WVMA 3RZJA 5AVAA 2W95A 2KSJA 4H13C 3VHOA 1ZX5A 2QJKC 5K0UB 3D4KA 2ZHNA 4QXCA 3PUAA 5C71A 1BGYE 4I2LC 3IDBB 2QE3A 3FXDA 3D0SA 3B7MA 1S2KA 5LA1A 1FZEA 1K05A 1JB0J 3B93A 1CZQA 2VH9A 2JKVA 3TSIA 1BSHA 3Q8BA 1JHJA 1LU1A 2XDVA 4FTBA 1LOGA 2HFED 2V72A 2XGXA 1PM7A 5A7OA 2QE7H 2UY9A 4LKFA 1Q8PA 2XJSA 3ZYFA 4D7SA 3HWJA 3JCIA 1OW7A 1UOJA 4W65A 1KDKA 2XVKA 3H1IE 4YW3A 1NTKK 4HKZH 1RUC1 2FY8A 1FZAA 2VY0A 3CLPA 3EJKA 3B01A 3H3LA 3T1LA 4AK3A 3OGRA 1UQXA 3ASIA 2V7QH 2OYIB 4CEWA 1KV4A 3L74G 2RMU3 2W68A 4ZHNA 1WMXA 1HN1A 2JDPA 4RSUA 1O59A 1W6NA 2EXJA 4JGZC 4A2UA 1WCDJ 5GLZA 2A6WA 3TF5A 2BERA 3VZMA 2QJVA 1V9U1 2JE7A 5EPAA 2V73A 2J7MA 4TLGA 2NMNA 1KFXL 1QQP1 4KU8A 5H9PA 1ZRDA 1VQ9P 4XDOA 2RDNA 5F8PA 3PURA 5JR7B 2J1UA 1LEMA 3VHRA 3CQOA 3FMGA 4LBQA 3VYIA 1UY2A 4GZ9A 3GF6A 3AKQA 4UFHA 2FYZA 1VMFA 1RC6A 2R072 3ZPOA 2D6KA 3LDKA 1MVEA 4OHZA 4JGYB 1HGZA 4C1WA 1RMU3 2JE8A 2HG5D 2X8KA 2AUYA 1W2AX 4V2WA 1VBD1 2P3KA 1JOPA 3AE4C 2RH0A 1ZA4A 2WT7B 1O4TA 2OKXA 1ZA7A 4CEWC 3NVCA 4MSVA 3BVHA 5AVUB 4U2AA 1H4GA 5F6KA 1M4WA 1VBB2 1UF2C 2VECA 3MPBA 4ES9A 2ZVOB 1RE3C 4NN0A 2R16A 3SWKA 5F3CA 3ZX7A 4EN8B 1S1AA 2ZGLA 4LOSA 2PHRA 5KXDA 5HCFA 4IE5A 3N4MA 3SFEC 3OA7A 3LDBA 2ZHKA 4DZOA 2DV9A 5E6HA 3AEBC 3USSA 5BNPB 4AEDC 3CU7A 1NCQB 4XF1A 3FBMA 3PHLA 2QQJA 3KD4A 2JG8A 2JEMA 5AW2B 4ASMB 3ZXLA 2Q1FA 3MW3A 1F5JA 3AEDC 2ZX1A 4RA0A 2ZX3A 5FP7A 3RYRA 4I1LA 3OEBA 3FJSA 4OMCA 4UT5A 1R091 1U7JA 1Z56A 2OQ7A 2A75A 1JY3P 5AVQB 2EAKA 4FFHA 5T5PA 3HD7A 2Q4SA 2NN8A 5IK8A 1EXIA 4UXAA 2WFF2 5CFCA 2QDNA 1GDTA 2V4AA 1EV11 1WZXA 2OA2A 3C3VA 1JTHA 4KHXA 5JZGA 3VMAA 2PN5A 4GKXA 4LEJA 1HVVA 1Y43B 1NTZD 1QGKB 5BNNC 3KVAA 1UXXX 1XNDA 1L0NK 2LS6A 3LIEA 1NU1G 1OOPC 4LPLA 4IV1B 4OULA 4V2VA 2VMDA 3KS7A 4COUA 3HBKA 5C3PA 4Y22B 5DDJ1 3M7AA 3VD3A 3ZXGA 1A3KA 1KYOH 1VMHA 1XE0A 4A6OA 3HUSA 1SS1A 4IGOA 5CG9A 1NZIA 1GZLA 1HX6A 2JJ6A 4LO8A 1NZCA 1CAUA 4OI2A 1N8RQ 4H0LC 2WQYC 4M3CA 3RL0g 4CCOA 3WUDA 2J1AA 2PAJA 1ZR4A 3OD4A 1BXHA 5FZGA 1EYBA 2A5ZA 2NM1A 3BASA 4D7TA 5FYZA 2WUHA 2G3AA 2A45H 1QJFA 4ASVA 1GUIA 2DWRA 4NJ4A 3IM0A 5BU5A 3GCXA 5ACA2 3EWKA 4RQPB 3TNQA 2IXJA 1A02J 3FX3A 4PCRA 1N1SA 2WAAA 5JMCA 1NQDA 2IC1A 1K73Q 4N3YB 2PGDA 1SBDA 5F5CA 4LKSA 4WY4B 5BYNA 1SDDB 1R1A1 1WT6A 3P8CD 1ZZ7A 2IVIB 2YB7A 1OI6A 3OSDA 2RN0A 1Z7S3 3D82A 2Q8CA 4FI9A 1VRBA 1LR5A 2ZABA 3H1KJ 2FKWB 2O1KA 3RGBA 2W1SA 2WN2A 1G9DA 1HRI3 3UJQA 3I2GA 4RR3C 4GOEA 2W39A 5CFDA 1AQ5A 3D70A 1UZVA 1DIWA 4S2FA 3P3PA 3ILRA 2FCTA 1BQPA 4FPLA 3GBGA 2OIIA 5AVTB 3ATGA 4HKOA 2I1KA 1KJLA 1Q3EA 1KQRA 5D1IA 5GKAC 3CKHA 3SCFA 3IWZA 4KGQA 2RE9A 1IFPA 2VTXJ 1BE3J 3NV4A 1COV3 5A3WA 1RHI3 4QX3A 1S2BA 3CJXA 5K7PA 1BMV2 1RUI1 3LAGA 3H1HE 4BRYB 1LOFA 1PL5A 5JR2A 1CGPA 4IXLA 1NLSA 1MPXA 3K4AA 3NV1A 3ALQA 2ZVNB 4DOJA 1H8AA 4EE2A 5FV3A 1RUF2 3TEZA 4C0BA 2E42A 1QXRA 2M3BA 2RS52 2GALA 4XMIA 3Q5PA 4MOAA 5K8SA 5FY0A 4OMDA 2P67A 3VKOA 5LEKA 4NPDA 1PFIA 4M00A 1Q2NA 3KXDA 1LESA 4Q4V1 2DUQA 1SFPA 2IYPA 3BOPA 1POQA 1ULEA 2FBEA 5FZBA 3BATA 2RS12 2NPSD 4RD7A 3Q2YA 2VUAA 1JW6A 2AEJA 1CX4A 5A3LA 3AKTA 2A6XA 4M0NA 1FS0E 3O14A 5IVCA 4AYUA 1OW8A 3USUA 5AVWB 4DY3A 3KV4A 3ZFFB 1U7MA 3BPSA 5BUVA 4GB31 1BLZA 3O6QA 2E76D 2QQIA 4H55A 5E16A 4FFIA 1HB3A 4I0AA 1HRV2 3ZYIB 3NAPC 1V00A 4JVAA 1D4M3 3ZFEC 2E75C 3E1RA 3M3EA 4PIXA 4BZ4A 3AECC 2JD4A 1HJFA 4UBHA 5FO8B 3UYJA 3SSUA 4XUTA 5SV5A 5JSOA 5DN2A 2HWC1 2VBPA 5DAQA 5FPUA
chains in the Genus database with same CATH topology
2K2SA 3ILFA 2XJRA 1R092 1IQAA 2D3SA 2IXIA 3AKRA 5I0RA 4XQDA 2D6MA 2WA3A 1D4M2 2R063 3JBG3 4Y1XA 4CZSA 4LBJA 1EPWA 4NVPA 4UW5A 3WNXA 4BQ1A 3TB0A 4PJYA 3WCRA 3H1MA 4AFDA 4YVWC 2ZHLA 4MH0E 2ET7A 2F4PA 1AXYA 1BYHA 3IDCB 5BNOA 2FMDA 2XPJA 2BW8A 3EHKA 3VBOB 2TBVA 4RHV3 4B3NA 4Y22A 2LM3A 1EV12 4OHVA 1ZRCA 1PO12 3JD71 3N7MA 1D0GA 4AHWA 3EQEA 5DDJ3 3G6JB 1DU3D 2GH2A 3S6PA 4PF5A 1JUIA 3THTA 3I59B 1LOAA 3RMYA 1BK1A 4HSLA 3WQ7A 3WG2A 3HT2A 3AZXA 2EXHA 4QGMA 3ZYJB 4W6YA 4DNYA 1GSLA 1R1ZA 1EY2A 3V0AA 2R062 3JBG2 1PGW2 4GKYA 2TUNA 2G9FA 4AVCA 2DCJA 1QJZA 2BNOA 2Z79A 3BALA 3UKVA 3UL2A 4OHYA 4DB5A 1REDA 3OGJA 3NSTA 1VBA1 1O3SA 2DFCA 3NKGA 3E5XA 1PGSA 1ZBA1 5GLTA 2E7QA 4RHV2 5H9QA 1UIJA 5HXVA 5F1RA 5J37A 2XB6C 4HKLA 4YW5A 5DDJ2 5KHJA 3WG4A 3V0BB 4CDUC 3AP9A 3WHTA 1BBT3 4IEPA 1MVQA 3W9AA 3ZYRA 1PK6A 4EWDA 1KS4A 2XJVA 4GH4C 1AZDA 3H8UA 3NL1A 3THPA 3VBHA 2JG9A 1SQ4A 4RQPA 2QZ2A 4FQZA 1AL0G 4IEVA 5C4WA 3WZ1A 3VBUA 4AF9A 1X8MA 3ZN4A 4Q1PA 1Y9QA 2QZ3A 4XXPA 3HBZA 1S0CA 2XL7A 3LZZA 5T5OA 2YZ4A 2CGOA 1ONAA 1RUH3 1W6PB 1B35A 4HFSA 2WNUA 3IKWA 4K7JA 4XF9A 4YZ3A 2ZAHA 1OQEA 1GANA 2BUKA 4PDWB 5AC93 5J09A 2C1FA 4XJAA 4AEJA 3C2UA 1Z78A 1BBT2 1HKDA 1R1A3 1VRH1 1LHOA 1SLIA 2HJIA 4I09A 3I7DA 3H9AA 2A3WA 3POWA 2CGNA 2CV6A 2PHLA 2B5HA 2JX9A 3T2TA 4LHKA 2BEOA 2A6VA 2BFUL 1QJY1 3R6SA 1AX1A 1G6NA 2PAKA 4SLIA 3I4IA 1URXA 4QPIC 1MS0A 2XLFA 1H2KA 1JUHA 2EAAA 3ZFGB 4B29A 2SLIA 4GIQA 1RUH2 4Y5Z0 3OD0A 2QUOA 3NAPB 3PVBB 2WSUA 4C90A 5AC92 3QCWA 2YDEA 4ZU5A 4R8HA 2R1BA 2D5HA 4CDQB 3VLBB 1YJLA 1ZZBA 3H0OA 1R1A2 3H50A 3TN91 1PIV1 5CADA 2NYYA 3O0WA 5DZGA 4N7IA 5I0SA 2AR6A 4E2GA 5I0UA 4HSJA 4BHPA 2D5FA 2LUWA 2PHDA 3WW2A 3AM2A 3AMMA 4JDOA <