3USYA

Crystal structure of flig (residue 116-343) from h. pylori
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
227
structure length
227
Chain Sequence
GPLGSMQKNFAYLGKIKPQQLADFIINEHPQTIALILAHMEAPNAAETLSYFPDEMKAEISIRMANLGEISPQVVKRVSTVLENKLESLTSYKIEVGGLRAVAEIFNRLGQKSAKTTLARIESVDNKLAGAIKEMMFTFEDIVKLDNFAIREILKVADKKDLSLALKTSTKDLTDKFLNNMSSRAAEQFVEEMQYLGAVKIKDVDVAQRKIIEIVQSLQEKGVIQTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar motor switch protein
publication title Multiple conformations of the FliG C-terminal domain provide insight into flagellar motor switching
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Motor protein
total genus 78
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01706 FliG_C FliG C-terminal domain
A PF14841 FliG_M FliG middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3usyA03
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 3usyA01
1LKVX 1QC7A 3USWA 4FHRB 3SOHB 4FQ0C 3HJLA 3USYA 3AJCA
chains in the Genus database with same CATH superfamily
1LKVX 4FHRB 1DM5A 1R8SE 3ABSA 2H0LA 4JMIA 4HREA 1AVHA 1YJ0A 1BC9A 1BC0A 1YCNA 4MDUA 1A8AA 1W45A 3SWVA 1AVRA 2IE7A 2IICA 1SAVA 2HYUA 1BCYA 1KU1A 3ABRA 3LTLA 1XSZA 1HVFA 3SOHB 2Q4CA 2II2A 1N00A 4MDVA 1QC7A 1AOWA 4JK1X 1HVGA 1ANNA 1C1KA 4L5MA 1BCZA 1Q8DA 1R8QE 2R0DA 2XO3A 1G5NA 4A4PA 1AIIA 1AXNA 2IE6A 2VXGA 1HAKA 2ZHIA 1ALAA 4D7RA 2HYVA 3BRXA 1HVEA 3ABQA 1N44A 4C7PA 2H0KA 1I4AA 1BC3A 2OY9A 2HSNA 2ZHJA 4JMOA 3USYA 4C0AA 2H0MA 4EVHA 2R09A 4D7QA 1YIIA 3TW5A 4Q2SA 2XO2A 2ZOCA 4JWLA 3AJCA 3AO0A 3USWA 1XT0B 1A8BA 2K6XA 2QEZA 1HVDA 4JXHA 1R8ME 1M9IA 1N41A 1XJLA 4KMUX 4X9PA 1S9DE 3HJLA 1PBVA 3L8NA 1N42A 4OIYA 1ANWA 1HM6A 1W3WA 1UPTB 1MCXA 1AVCA 3ANYA 1BO9A 1YGMA 4EVFA 3ABOA 1BC1A 4FQ0C 4Z21A 1R4AE 1W7BA 1BCWA 2RANA 4KN4X 1ANXA 1DK5A 1AEIA 1RE0B 2HYWA 4KN7X
chains in the Genus database with same CATH topology
1LKVX 4FHRB 4C7PA 3SOHB 1R8SE 4KMUX 4JXHA 3HJLA 1S9DE 1PBVA 2HSNA 4JMOA 3USYA 4C0AA 3L8NA 4OIYA 1QC7A 4JMIA 4JK1X 1BC9A 2R09A 4D7QA 3TW5A 4L5MA 1Q8DA 4FQ0C 4Z21A 3SWVA 1R8QE 2R0DA 4JWLA 3AJCA 4A4PA 4KN4X 3USWA 1XT0B 1KU1A 1RE0B 2K6XA 4D7RA 3LTLA 4KN7X 1XSZA 1R8ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKV X;  1QC7 A;  3USW A;  4FHR B;  3SOH B;  4FQ0 C;  3HJL A;  3USY A;  3AJC A; 
#chains in the Genus database with same CATH topology
 1LKV X;  4FHR B;  1DM5 A;  1R8S E;  3ABS A;  2H0L A;  4JMI A;  4HRE A;  1AVH A;  1YJ0 A;  1BC9 A;  1BC0 A;  1YCN A;  4MDU A;  1A8A A;  1W45 A;  3SWV A;  1AVR A;  2IE7 A;  2IIC A;  1SAV A;  2HYU A;  1BCY A;  1KU1 A;  3ABR A;  3LTL A;  1XSZ A;  1HVF A;  3SOH B;  2Q4C A;  2II2 A;  1N00 A;  4MDV A;  1QC7 A;  1AOW A;  4JK1 X;  1HVG A;  1ANN A;  1C1K A;  4L5M A;  1BCZ A;  1Q8D A;  1R8Q E;  2R0D A;  2XO3 A;  1G5N A;  4A4P A;  1AII A;  1AXN A;  2IE6 A;  2VXG A;  1HAK A;  2ZHI A;  1ALA A;  4D7R A;  2HYV A;  3BRX A;  1HVE A;  3ABQ A;  1N44 A;  4C7P A;  2H0K A;  1I4A A;  1BC3 A;  2OY9 A;  2HSN A;  2ZHJ A;  4JMO A;  3USY A;  4C0A A;  2H0M A;  4EVH A;  2R09 A;  4D7Q A;  1YII A;  3TW5 A;  4Q2S A;  2XO2 A;  2ZOC A;  4JWL A;  3AJC A;  3AO0 A;  3USW A;  1XT0 B;  1A8B A;  2K6X A;  2QEZ A;  1HVD A;  4JXH A;  1R8M E;  1M9I A;  1N41 A;  1XJL A;  4KMU X;  4X9P A;  1S9D E;  3HJL A;  1PBV A;  3L8N A;  1N42 A;  4OIY A;  1ANW A;  1HM6 A;  1W3W A;  1UPT B;  1MCX A;  1AVC A;  3ANY A;  1BO9 A;  1YGM A;  4EVF A;  3ABO A;  1BC1 A;  4FQ0 C;  4Z21 A;  1R4A E;  1W7B A;  1BCW A;  2RAN A;  4KN4 X;  1ANX A;  1DK5 A;  1AEI A;  1RE0 B;  2HYW A;  4KN7 X; 
#chains in the Genus database with same CATH homology
 1LKV X;  4FHR B;  4C7P A;  3SOH B;  1R8S E;  4KMU X;  4JXH A;  3HJL A;  1S9D E;  1PBV A;  2HSN A;  4JMO A;  3USY A;  4C0A A;  3L8N A;  4OIY A;  1QC7 A;  4JMI A;  4JK1 X;  1BC9 A;  2R09 A;  4D7Q A;  3TW5 A;  4L5M A;  1Q8D A;  4FQ0 C;  4Z21 A;  3SWV A;  1R8Q E;  2R0D A;  4JWL A;  3AJC A;  4A4P A;  4KN4 X;  3USW A;  1XT0 B;  1KU1 A;  1RE0 B;  2K6X A;  4D7R A;  3LTL A;  4KN7 X;  1XSZ A;  1R8M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...