3UT1A

Crystal structure of the 3-mbt repeat domain of l3mbtl3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
315
structure length
313
Chain Sequence
b'AWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
molecule tags Transcription
source organism Homo sapiens
publication title Crystal structure of the 3-MBT repeat domain of L3MBTL3
rcsb
total genus 83
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A01
2QQRA 2FHDA 3OYEA 4A4GA 5FROA 5FRMA 4QQDA 5D6XA 3CEYA 5IN1A 2DIGA 3OS2A 3S3MA 3OS1A 4UC4A 3QBYA 4Z02A 2LDMA 4C5GA 3OYIA 2HQEA 5J26A 2RJEA 3F70A 3EAEA 3MO8A 3UWNA 4FL6A 2YRVA 3FC3A 4E7IA 3MEUA 3MEAA 1MHNA 2QQSA 2BUDA 3S3OA 3OQ5A 2K3YA 3C4SA 3P8DA 5D6WA 3DB4A 2MWOA 2RJFA 3DLMA 4X34A 4EDUA 3MEVA 1OI1A 4ZTJA 3OS0A 2X4YA 3KUFA 3OY9A 3OYKA 3QJ6A 5C0MA 4A4EA 3PMIA 2B8AA 2EKOA 4BD3A 2RHZA 2CKKA 5CIUA 3OYFA 1WJRA 3OYBA 2G3RA 2GFAA 4A4FA 2EQUA 4HCZA 5KE3A 4OVAA 2JZ2A 3P8HA 3L2WA 1SSFA 1WJQA 4II1A 4BE2A 4PL6A 3MEWA 3NTIA 4N4HA 1OYXA 2BKDN 3PMTA 3QIIA 4N4IA 4B9WA 2RJDA 3O8VA 3OB9A 4PLIA 3LGLA 3OYJA 3OYHA 3PFSA 3Q1JA 2R58A 2R5AA 4ZTFA 2MWPA 3S6WA 1N27A 2HQXA 2LRQA 2LTOA 3ME9A 2M0OA 1KHCA 5KH6A 2X4XA 2O4XB 3LX7A 3M9QA 2JTFA 2EFIA 4NS5A 3SD4A 3OYMA 2NLUA 3BDLA 2L3RA 3FLGA 2DIQA 3PNWC 4IUPA 4BE1A 4GY5A 2VYTA 3H8ZA 3L2VA 3LGFA 2GF7A 3LYIA 2RI5A 2RI2A 2P0KA 4RG2A 2LVMA 3OYGA 2WACA 2EQMA 2M1HA 2RI3A 2RJCA 4IUQA 3MP6A 4C5HA 3L2UA 3MP1A 4C5IA 5J39A 3FEOA 4QQ6A 2L89A 1G5VA 4BACA 4E7HA 1OZ2A 3ZEHA 4A4HA 4C5EA 5M9OA 4L59A 4BDZA 3MP8A 3NTHA 3NTKA 3OYAA 2EQKA 2BIVA 2PQWA 4Q5WA 5KCOA 2IG0A 3H6ZA 5KE2A 2RHUA 2GFUA 3S3NA 2O4XA 2XDPA 3OMGA 4PLLA 2R57A 2F5KA 3QKJA 5FRNA 2DAQA 2R5MA 3GOXA 3OYDA 3L2QA 3E9FA 2RO0A 2RHIA 3DB3A 3UT1A 4E7KA 4IURA 2EQJA 1XNIA 2D9TA 3E9GA 2XK0A 3L2RA 5IAYA 1RI0A 4IUTA 4IUVA 3OA6A 4BDYA 3ASKA 3OYNA 4E7JA 4BE0A 4CRIA 2RHYA 3OYCA 2E6NA 2E5QA 3FDRA 1WJSA 1OZ3A 4LD6A 5C6SA 3META 4B9XA 1H3ZA 4E7LA 4IUUA 4N4GA 4IKFA 2RHXA 5D6YA 4QVZA 2K3XA 3OYLA 2LCCA 3L42A 3LH0A 2X35A 2L8DA 4FU6A 4QW2A 2X4WA 4QQGA 5KCHA 2M16A 3OMCA 3LLRA 1WGSA
chains in the Genus database with same CATH superfamily
2P4RA 3CCJA 2FHDA 2QAZA 1PSFA 2KRMA 2E3IA 3CCRQ 1FX7A 4BUGA 3A8MB 5GANe 4Z02A 2ZPBB 4RTZA 3F70A 1VQ4A 3I9QA 2SRCA 2HMAA 1MHNA 2QQSA 3JB9G 1IO6A 3DLMA 5FU7C 1TUCA 2X4YA 2D8JA 1Q81C 5AT1B 1M2OA 5C0MA 3X28B 4A53A 2B8AA 1ABOA 3REAB 1X2QA 4JLGA 3GLXA 2A28A 4DOVA 3WVEB 2RQVA 2XI9A 4D8KA 1N6AA 1QVFS 2M0OA 4J9BA 4ZNXA 2VVKA 2DBMA 5A0DA 5GANd 3L2VA 2LNHB 1RAIB 1YN8A 2P0KA 1M90U 4JJCA 1NJIU 3JB9I 3LWIA 4PKCC 1Z9ZA 1VQ5A 2A08A 2JT4A 1ZSGA 1MGQA 1N9SA 1E6GA 1WHLA 1VQ8T 2O4XA 1K73R 3M54A 2JS2A 2VXFA 1QCNA 2DEUA 4M78C 1D09B 4NOYA 1RI9A 4BDYA 2K3BA 1VQLQ 3ASKA 4XTYA 5LJ3h 1U06A 1HK9A 1MUZA 4LD6A 1K1ZA 1VQOT 1OU9A 1LNXA 2EPDA 1W4SA 2M51A 4X9DA 4FU6A 2KGTA 2ENMA 2P4TA 3E1SA 1JBMA 2LMJA 4J6WA 5FROA 4QQDA 1W2BA 4JLIA 9ATCB 3S3MA 3M56A 4MZMA 5GAOr 5IHNA 2DJQA 2EJ9A 3M0PA 1WPYA 5CK9A 2E64A 1BI1A 5LJ5g 3GNFB 2B86A 1ZSZB 4Y28E 3V8LA 1KD1R 2KBTA 2DXTA 2NUZA 2HCKA 1Q82R 4C0ZA 4CC3A 1VQ9A 5KE3A 2NUPB 3CMAA 2ED1A 2GTOA 4J9CA 2QDLA 2WSCE 3RKWA 2DTIA 4RTYA 5GANj 3G6ET 4C0DB 1VQOA 1WI7A 2BTTA 1S1NA 2KRSA 4BY6C 5CVIA 2EFIA 3CC4T 1WHHA 1D0ZA 3EG2A 4GY5A 3OBWA 5LJ3j 1ZA2B 2DVEA 3LYIA 2DL4A 4J9DA 3VYGA 1VQMT 1SSHA 3NFCA 5L8RE 5L23A 2C0IA 3ULRB 1NZ9A 4A4HA 3M4YA 1WXBA 1BIAA 5GAOl 2QK0A 2EQKA 4FYVB 4M7DG 2RD1A 4JZ4A 1X6OA 4PFPA 4X9CA 1F1BB 2KDSA 2H3JA 1M90R 4M7DC 1JXOA 4C8QA 3RBBB 2D9TA 2CSQA 1RLPC 4PJNA 2KK4A 1Q7YR 1YJ9Q 3PVQA 4BE0A 3HL8A 4J8OA 2K3XA 2DMOA 2JJ9A 3LH0A 4M78D 2FG0A 2CT3A 1WGSA 3CCQA 3M0SA 2CZ1B 5IN1A 1T3LA 2I0NA 4UC4A 2DD5A 3EGDB 2FPFA 3AT1B 2RJEA 3INZA 3UWNA 4FL6A 4MDWA 2G6FX 3S3OA 1YJWQ 1VQKT 1J3TA 1KHIA 3TVTA 2KYBA 4M7DF 2KSSA 1Y57A 1W2BP 4L6V5 2JTMA 4LDUA 3VS4A 1KFZA 4M75D 1MV0B 3TSWA 1TU0B 3L2WA 4LDVA 1D3BA 4PL6A 5I2SA 1M90C 3LW5E 1JO8A 3EH1A 3JCMg 3AHUA 4ANJA 2JMAA 2YHTA 3CXCP 2DRMA 2FB7A 2LRQA 3VUBA 4C0FA 4GLMA 2LT1A 1GL5A 2NUPA 1AOJA 4LUDA 5LL6S 1WXUA 3URGA 4RG2A 3BDUA 2RI3A 5GAN7 5GANf 2QI2A 3A5ZB 3O5ZA 1TOVA 1G5VA 1VQNQ 1JB0E 3EFOB 2E1HA 1KD1U 1IB8A 5GAMh 3NTKA 3V7RA 4XU3A 4M7AE 4M7DB 1Z9QA 4M78G 4N0AA 1LOJA 2RMOA 2F2VA 1UJ0A 4JUVA 1VQ8Q 4J6XA 3RNJA 2AZSA 1YWPA 4OB1B 3I55A 3L2QA 2PVOB 3QUIA 4M77D 4M7AF 1M9SA 4VUBA 4E7KA 5GAN2 1XNIA 3QDFA 3CC2A 5IAYA 1YITA 2JW4A 4ZN1A 1QVGP 5FRMA 1GXIE 3HHTB 4IUUA 2AKLA 1HYOA 4AT1B 3OYLA 3JCMh 2QTVA 3JB9D 1HSQA 2LX7A 4XTUA 3FJPA 3VJPA 4M7AA 1H92A 3CMEA 2XKOC 3NGPA 1BI0A 1S72A 1C6VX 1PRLC 5GMKi 2JVVA 1KQ1A 4OMPA 3MPUB 3CQTA 4LDWA 4E7IA 3ZBDA 4AFQC 1G3YA 2CREA 2AZVA 2J6KA 2JM9A 3VS6A 1AHJB 4HT9A 1OEBA 2D0QB 1T0HA 2MI6A 4NL2A 4ATOA 3EG0A 4KUDK 2KXCA 2EQUA 1FMWA 4OVAA 2LQ8A 1V1CA 2YDLA 4N4HA 4B9WA 1KG1A 4CC4B 1OU8A 4JRIA 4LN2A 2QGGA 2DBKA 1Q81U 4F7UG 1PCXA 3VRYA 2COWA 1FYNA 4CI0C 2OAUA 3SB2A 2EGCA 5FW9A 1OV3A 2VYTA 3JCMe 4RTTA 2Z0WA 4ELYC 3CC4Q 2RI2A 5CQYA 3OYGA 4M75B 4M7DA 4EMHA 4C8QC 2MK5A 2CZ6B 4C5IA 3MKDA 2CGHA 3CCVT 1MMNA 1Y07A 3G6EQ 7AT1B 4D8DA 1H8KA 3OS5A 2X3WD 2ZAEA 2RQTA 1OQKA 3E2UA 3HRUA 1WFWA 1UUEA 1IGQA 1X2KA 1TSFA 5KCOA 5CO7A 4PJMA 4GLKA 4ESRA 1K9MU 2GCXA 3OYDA 1H641 1BK2A 1AWOA 2RHIA 2ED0A 3FRNA 3E9GA 2K2MA 2JOYA 2YUOA 3D7SB 2FRYA 3OYNA 4C8QE 3EG9B 2E5QA 1WJSA 1VQKA 3META 5GMKm 1KIKA 1VQMQ 4M75G 3M5AA 3MJXA 3BFMA 1Q86C 4C8QF 2L8DA 2H8HA 2X4WA 3OMCA 3OSSC 3LLRA 2QQRA 2K6DA 5A0GA 2RK1A 1YJ9A 1UB4A 2VUBA 2XMFA 1GCQA 2COYA 2DIGA 1N5ZA 1PD1A 1E6HA 1OX8A 1VQ8A 5GAMf 1LPLA 2RNAA 4C5GA 3QJYA 4OF1A 4M77A 5DY9A 2MIOA 1M4ZA 2RH2A 3SWNC 5GAMe 2DX1A 2BZXA 4A4EA 4ME7A 2HKNA 5CIUA 4EMKA 1WJRA 3CCLT 4A4FA 4HCZA 1JRIA 4BE2A 4OMQA 2HAXA 3CCVA 3QDRB 4ZTFA 4XU2A 3H0IA 3G7ZA 4M75E 1BB9A 1M5Q1 1WQ7A 1YI2A 3SEMA 4C8QG 2HZYA 2WSEE 1UFFA 5FWCA 2HQHA 4PJOB 4XAXB 4C92D 5CKHA 1KJWA 2YRDA 1ZX6A 2Y90A 2Y4YA 3HRTA 2MF2A 1TUGB 2JNGA 4PFOA 5KYWB 4J9GA 2L3SA 1BIBA 1YITT 2V1RA 3CMAT 4C92A 5CCAA 1D0XA 1YIJQ 2DRKA 2X9HA 1K9MR 3CC4A 3FJ5A 1WQWA 2DD4A 1KQSS 1AEYA 1C0MA 4CRIA 3FDRA 4B9XA 1YJNA 4E7LA 2A37A 1W1FA 4F7UE 5D6YA 1S72T 2P0PA 2KI7A 2FL7A 4E7ZA 3LH5A 3GP8A 2M16A 3MP6A 4FT4A 1AZGB 3OYEA 2EJFA 4JJBA 5IT9E 4FW2A 4B6MA 2CDTA 3OS2A 1Y96A 2J7IA 1WYXA 2V8IA 2FPDA 5FU6C 3J7AF 5J26A 1IREB 3MO8A 1RAGB 2GTJA 2DTHA 2NUTB 4XTVA 1K8AC 4RTVA 2E6ZA 4WF2A 2QEXQ 3FIFA 3HTRA 3OYKA 3FB9A 2LCSA 2LQWA 3M58A 3ZL7C 2D8HA 1WHJA 2A7YA 1UGVA 3V8KA 2PNIA 3RESA 4EIKA 2VWFA 2YT6A 4JZ3A 3MEWA 3OW2A 5IXFA 1ABQA 4J9HA 1R0CB 2L3PA 3JCMQ 2LTOA 1KHCA 3CCRT 4FSXA 1W2BS 1Q95G 3QSUA 2E65A 3RR6A 2DIQA 4IUPA 2K9GA 4J7IA 2DE0X 3PE0A 4RCBA 2CP6A 2DXUA 4OB3B 5ECAA 1IRXA 4PJOC 1ZLMA 3H0HA 2RM4A 4C5EA 2PU9B 4QVCA 2DZCA 1Y0MA 3OYAA 1GFDA 2DYIA 2L0AA 2V8KA 2IG0A 4N0AC 3OMGA 3QKJA 4KH0B 5FRNA 1PKSA 1YI2Q 3GOXA 3CCEQ 5GMKj 3CBOA 4HVUA 3CD6A 2I2LA 2VKNA 2P0QA 2J6FA 1WIEA 3CCVQ 1OZ3A 1R8OB 3GNGA 1VQ7T 3G1JA 4C92G 3C94A 4ELZC 1KQSA 1VQLA 3JAME 4Z8AA 2EGEA 1WHGA 4JS5A 3I35A 4M77B 1QCFA 2DL3A 1UECA 1VOMA 1AD5A 2DPPB 4XK8E 1AWJA 3EAEA 1SHGA 3PVLA 3MEUA 3MEAA 5HK0A 2VV5A 2DTOA 4ZGJB 1UEBA 3VS3A 3TREA 5GAN3 1WLPB 4XTWA 3RERA 1TH7A 4DOWA 1X69A 2F5TX 2JTEA 4JPBW 1X6BA 2GBQA 2RA2A 4BB7A 1VUBA 4N4IA 1V76A 3EGXA 3CPFA 2ZGWA 5KYNA 1WNLA 8ATCB 2FPEA 2HL5C 2XG8D 4E7SA 4J7FA 4CC2A 5DLOA 2QA4A 8AT1B 2O31A 1ACMB 3H8ZA 2CZ7B 2EQMA 4Y91A 2L2PA 1LVKA 1SF9A 2C0TA 2ESWA 3X25B 3CMEQ 3MP1A 1QLYA 4HCBA 4Y92A 1QW1A 2AKKA 1GFCA 4DBFA 3MP8A 2COZA 1UGPB 2GFUA 2EYYA 1O75A 2F5KA 1WA7A 2GQIA 2DERA 3V7CA 4MDXA 1NEBA 4PFZA 3UT1A 1OX9A 1PM3A 1BI3A 1YJWA 3UA7A 1VQ4T 2V8JA 2QQAA 5AYFA 2VGNA 4HT8A 3CCQT 2NUTA 3QWXX 3JCMb 1RAFB 1I07A 1VYUA 2YUQA 5LJ5d 5GAMj 2RHXA 3HP9A 2CH4W 3P8BB 4MZTA 4RKUE 3V8JA 4DEYA 4LD9K 2MAMA 2FZCB 3MCAB 3CXCA 2CUBA 1KC8C 1YBYA 2OTLT 4V2SA 1HXDA 4OB2B 1QVPA 2ABLA 5I2MA 3CPWP 3CD6T 1LJOA 3THKA 1WXTA 3T9NA 2W10A 1PNJA 4JRPA 1ZA1B 5J3BA 5LJ3g 1NYGA 1VQPA 1JJ2S 4A54A 4M75A 3A8HB 3I5SA 1I1JA 2JZ2A 1B34B 1NM7A 3WVDB 3PIPA 2EQIA 3QIIA 3QG1A 3I5RA 2W0ZA 5GAOm 2KMTA 2MWPA 2Y4XA 1NLOC 5GAN6 2X4XA 1VYVA 1NYFA 1FMVA 2KY9A 4XU1A 1YJNQ 4KGZB 5KYXA 1K0SA 5GAN5 1AT1B 3PTAA 2ECZA 2M0YA 3GIBA 4R0KA 1I0CA 3DLLA 1VQ9T 1JEGA 3BE3A 4OGEA 2CZ0B 3PT9A 1QVFP 3JB9F 6AT1B 3G4ST 1OPKA 5GAOn 4FYYB 2PQWA 3CCMT 2DL5A 2RHUA 1I5OB 4RTUA 2DFUA 4JJDA 2R57A 2DAQA 1R77A 5CKBA 1YNZA 2XK0A 1RAAB 2EVRA 3TQ7P 3CXCS 3J80E 3JRZA 3CBPA 2KNBB 2FEIA 2IVWA 2FRWA 3I56Q 4M7AD 4DEXA 3JCMJ 5KYYB 4OMLA 2ATCB 1M1KC 5KYWA 4F14A 1WHMA 2BE9B 2CP0A 3RDVA 1VIEA 4AG1C 3MHXA 3HRSA 2OX7A 2ROLA 4C8QB 3QYGB 2OAWA 3G6EA 2MCNA 3OQ5A 2RPNA 3EG9A 4YTLA 1OPLA 4XTZA 1QP2A 1Y71A 2DA9A 2QXFA 3J81E 3G71A 3OYFA 2J6OA 2G3RA 3M0TA 1X43A 1K4US 4P5NA 2F2WA 3SDZA 5I11A 1UGSB 4M75F 3CCRA 1YP5A 5FU7B 1QWFA 4FYWB 4F04B 2QQ9A 1VQ6T 2R58A 2C0OA 3GPLA 4LXCA 3EG1A 1QKXA 2ROTA 3RUXA 2OTJA 2RN8A 3SD4A 1K73C 1X75C 5HY6A 2V1QA 3SWNB 1EZZB 3LGFA 5CKEA 1M1KR 1ZUKA 1T0JA 3VUZA 1E7OA 2BIVA 1D1AA 3H6ZA 4PJJA 3OW2P 2MOXA 3EHRA 1K73U 1HD3A 2O01E 3DB3A 2FZKB 3EGXB 4IURA 1G3SA 4IUTA 1UJYA 5CKDA 1WX6A 1RLQC 2E6NA 2KVQG 3M0RA 4BI3A 5CAIA 1D1CA 1C1AA 4QVZA 1JU5C 5GMKh 3L42A 3CCJQ 1Q82C 2VGMA 4QW2A 1N8RR 5D6XA 3CCMQ 4DBHA 2F1LA 3C95A 1WDXA 4KH1B 2IIMA 4RTWA 2P84A 3QZ5B 4MMLA 1NEGA 2L5QA 3FC3A 3M57A 2YRCA 2J05A 1D3BB 3H9NA 2BUDA 2DVJA 2DM1A 2LC4A 4C92E 1AWWA 3P8DA 4JDSA 4X34A 1Q86R 4M7AC 4ZTJA 4Z88A 1MNDA 5GAN8 1N8RU 2CYZB 1R0BG 3QHSA 2D6FA 4PNOA 3L1AA 4M77E 3G71Q 3M55A 1OYXA 2BKDN 3PMTA 1FXXA 2QASA 3TU4K 3X26B 5A2QE 3HFNA 4EPCA 2QEXT 3ME9A 4R55A 4LDYA 3BDLA 2KR3A 1OULA 1VQ4Q 2ZPEB 2RQWA 2RI5A 5A0LA 3U23A 2K4YA 3OSVA 4KGVB 1D1BA 5I21A 1JQQA 1SRMA 1VQNT 3FEOA 2QDYB 2L89A 4O5VA 1BCMA 3JCMf 3VV0A 3EFRA 5CKFA 1AVZC 1ZSZA 1QCOA 4F7UB 2PZ1A 1ZUUA 5KE2A 5GAOp 5HK3A 2DYBA 1TTHB 1M1KU 2OTJQ 1QMCA 2A3LA 2VXEA 2RO0A 2PVGB 4D6WA 1I4K1 5LJ5f 4C0DC 1G83A 2DXCA 1WZOA 2RHYA 1VQLT 2ZPFB 2E12A 2FVUA 1UDLA 3OYYA 4E2FB 4KT0E 5CR2A 2OTLQ 1MMDA 5KCHA 3QJ6A 3HKSA 3RMQA 1UGQB 4MMKA 2ZZDA 1M3BA 1MV3A 1PWTA 1U5SA 1TS9A 3C0CA 4KULA 1RUWA 2LDMA 5HKCA 2YRVA 2A36A 2HD0A 1AWXA 2YXYA 4ZGEB 2K3YA 4F7UF 3DB4A 2MWOA 3MEVA 2EIFA 2EJGA 4FW1A 3VS7A 2E70A 5GAMg 2LZ6B 4BD3A 4M78E 2MYSA 1H3HA 4M7AG 3P8HA 1RADB 1VQMA 4ZGDB 1NPRA 2A0FB 3VS2A 2JM8A 5D7UA 5LJ3d 1YJ9T 3CCST 3EH2A 1YCYA 2OJ2A 2JMCA 1QP3A 2R5AA 1DJ7B 1EIFA 4E47A 1K8AR 3SHWA 2KQWA 2K2VA 2O4XB 3M53A 3JSCA 4NS5A 5GMKe 3I55Q 1NJIC 3JCMV 4IIMA 1ZHIA 2GF7A 4M78A 4IUQA 3KBGA 3TEEA 3CCET 1VYTA 2WSFE 3G4SA 2OTJT 4KGXB 3QZ9B 2XD0A 4QQ6A 4PJOA 1MNEA 1YWOA 4E7HA 5IHIA 1M2VB 5LJ5j 5GAMd 3NPFA 2ZCFB 3REBB 1KC8R 3KFVA 2KT1A 4PJOD 2CP5A 2LX9A 4OMMA 2HKQB 4LE9A 3NMZC 4AFSC 4IUVA 4C92F 3JB9J 4C0GA 3JB9H 1PD0A 1BI2A 2DNUA 4E7JA 2D1XA 2XDBA 2ZPHB 4AMCA 3JCMd 3JCMP 1YJWT 1G3WA 1VQKQ 2BZYA 1PHTA 1VQOQ 4M7DD 2X35A 3E19A 2E4HA 4C92C 3DKMA 2QYZA 2PTKA 2YLCA 1BCOA 1WHKA 2AHJB 2RQUA 3IQLA 1YIJT 2PUKB 3ER0A 3CCSA 3VS1A 4ORZA 2LJ0A 1OOTA 3N5BB 2E41A 4PJOF 2QEXA 1UHFA 1QVGA 5D6WA 4EMKB 3HFOA 1M3CA 1M2VA 3KUFA 4HCKA 4M78F 1U1SA 3VRZA 3TCJA 4E6RA 4JRKA 2RHZA 1JJ2A 4M7DE 3VS5A 4IIOA 4DA4A 2RJDA 2L3QA 5LJ5e 3LGLA 3CCMA 1UGRB 3OYHA 2BZ8A 4TVRA 4OGCA 2CP2A 2E5KA 4M77G 2HQXA 3M9QA 4M77F 1VQ7A 1PSEA 3OYMA 2NLUA 4BE1A 3PNWC 4RUGA 2K57A 1TUDA 3QO3A 4ZN3A 1BKBA 3R6NA 2GGRA 2M1HA 3UA6A 4F7UA 3BW1A 1PRMC 1Q7YU 5GJWB 4BDZA 2HBWA 2KROA 2DK3A 1UTIA 4NL3A 1M1GA 4EMGA 2O9SA 2KYMA 4M78B 1KQ2A 2LQNA 4R56A 2QQBA 3VYHB 5KYUB 4PJLA 1YHQT 1S72Q 3L2RA 3OA6A 4HXJA 2LCLA 3OYCA 1Y96B 2F69A 1M1FA 2O9VA 4IKFA 2D0NA 4J5YA 1ZBXA 2FZGB 1UHCA 4FT2A 2RQRA 1QWEA 2DL8A 1GBQA 2HBPA 4A4GA 2KAFA 1NG2A 1N8RC 3JCMX 1VQPT 3CCLQ 3PIOA 3R6OA 3SFMA 4FIBA 1IHWA 2AK5A 3RIRA 1FWZA 1RABB 1OI1A 2XU8A 3CCQQ 2DL7A 2E3HA 2H3EB 4J6YA 1U3OA 4OB0B 2DJZA 2KEAA 4QVDA 4J9EA 2OI3A 3RKYA 3O8VA 4RMOA 2BE7D 1MMAA 2VB6A 4AFZC 2AIRB 2M9UA 5KYYA 3CD6Q 2DF6A 4DBRA 2K5LA 4Z89A 1QQJA 1YIJA 3GBQA 3I55T 3EFOA 2X4JA 2CP7A 1VQPQ 2EYQA 2OTLA 3HPWA 1V29B 2RJCA 1U8RA 4C5HA 4DQ2A 1NLPC 1KD1C 1NPPA 5J39A 3JCMc 1VQ6Q 1T3SA 3CCSQ 4BACA 3UDCA 4OMOA 1TWBA 2YSQA 2EW3A 2YUNA 3X24B 1MMGA 3EFSA 1BBZA 4Q5WA 1GCPA 2GQVA 1X01A 1P92A 4XQ3A 4JS4A 4PK4A 3TSZA 1G2BA 4CC7A 1B34A 3E9FA 2EQJA 1YHQQ 4C92B 3CC7A 2JUFA 4C8QD 3JV3A 1SG5A 1KK7A 1YJNT 2YUPA 2VASA 5KYUA 2LP5A 3EGUA 1IHVA 3A98A 1RACB 1K9AA 3QWYA 4M75C 1EX4A 4RCCA 3WXMB 1JXMA 5FU6B 3C12A 2DETA 3CEYA 1GCQC 5GJVB 2CP3A 2M02A 3CC7Q 1KSWA 3QBYA 2QA4T 3OYIA 3RKXA 4O6JA 1VIFA 2EBPA 3UF4A 3GF5A 3A8LB 1Q81R 1RAHB 4EDUA 4OMNA 3OY9A 2K5FA 1TG0A 1ZQ1A 2J06A 3CCUT 1K0XA 3OYBA 4BY6B 1XOVA 4L5GA 1SSFA 1WJQA 3M0UA 4RTXA 2LT4A 5CQXA 3VS0A 2C06A 2HNIA 2LNVA 3OYJA 1B7TA 1M8VA 1O9SA 3EGDA 3PFSA 3Q1JA 1NBEB 5KH6A 2JTFA 2K79A 1RAEB 3M59A 2EYZA 1XJWB 1YITQ 3OBYA 2O88A 3OW2S 5GAOq 1SEMA 3CC7T 2CSIA 2DEQA 3L2UA 4LNPA 1I8FA 3EG3A 2HEQA 4F17A 5GAN4 2QTXA 1YFNA 2MMPA 4HA8A 5M9OA 1N9RA 1IZ6A 2EGAA 1YHQA 3I56A 4BI4A 2IPOB 3S3NA 3CCUQ 4PLLA 3V7SA 1VQ5T 1SPKA 1RL2A 2FO0A 4WTOB 2VC8A 2K5IA 2NWMA 3QYHB 4JJNK 1KC8U 1RI0A 4FSSA 3LWHA 1Q86U 2NYSA 1H3ZA 2V26A 4M77C 1VQ6A 4OMFB 3A8GB 2LCCA 2DILA 5EG2A 3SWNA 1G3TA 3L2ZA 1D0YA 5FLXE 5GANh 4FYXB 3A1PA 2RF0A 1K9MC 2ZPIB 1XQHA 4MZPA 2HQEA 2KXDA 2LQKA 1GRIA 1ZUYA 4HVVA 5DM7R 3C4SA 1LCKA 1XTDA 2RJFA 5FWBA 4KBMB 2HSPA 4PJOE 4HCCA 1M27C 2XICA 5I22A 2KRNA 2JS0A 1SKUB 4BI8B 2GFAA 1BYMA 3CCEA 2QG9B 2EWNA 4J9FA 1X6GA 3OB9A 1Y7XA 1QKWA 5GMKl 3CMET 5KYXB 3S6WA 4GBQA 2PVDB 1CSKA 1SRLA 1I81A 3H0FA 1NJIR 1QVFA 3KXTA 3PGGA 1M8MA 4KUIA 1VQ5Q 2LVMA 2MPXC 1W70A 4AG2C 1PC0A 1AZEA 4J83A 1YI2T 1OZ2A 4K11A 5IXBA 1JJ2P 1A0NB 2CH4A 4M7AB 1K76A 4KRTA 2YLBA 2CS7A 2XDPA 3CMAQ 2EYWA 1UG1A 1PKTA 2QA4Q 5LJ3e 2LJ3A 3BY7A 4PJOG 3RMSA 2EAYA 1Q7YC 1HJDA 2RK2A 4F16A 4DBQA 4N4GA 2ZPGB 5LJ5h 5GANg 4HVWA 3CC2T 4AFUC 2DKGA 1G8XA 5HCKA 2XIDA 4HKEA 4FM4B 4OP0A 1W6XA 3CPWA 1VQ7Q 3OS1A 2GNCA 2JXBA 1UE9A 1K8AU 2XDDA 1IGUA 1VQ9Q 5IH2A 4M4ZA 1YCSB 4FCYA 3I56T 1U1TA 1SHFA 3OS0A 2K7AA 3CCUA 2DLPA 2HSEB 3NHNA 3PMIA 2KT8A 2EKHA 3VKIA 4EMKC 2EKOA 2KE9A 2CKKA 2FYKA 3CCJT 3JCMW 3G4SQ 3G71T 1NE8A 4II1A 4A4KA 1IXDA 3NTIA 2LJ1A 4PLIA 4LUEA 1B3QA 5IHKA 3M0QA 3CC2Q 4XU0A 1N27A 1ZSZC 1M30A 3LX7A 2AT1B 4X1VA 3VU3C 2X51A 2O2OA 3FLGA 1ZBJA 2L3RA 1X27A 4QT7A 2PUOB 1I5LA 1PG5B 2CUDA 2JN0A 3ZFJA 4J9IA 3H41A 1Q82U 2WACA 3A8OB 2XHCA 5EC7A 2HL3A 3ZEHA 2EYXA 1FMKA 4L59A 1TXQA 1CKBA 1EFNA 4WCIA 3NTHA 1B07A 3X20B 1QVGS 3CCLA 5DLQE 4JRQA 3M4GA 2DO3A 1ARKA 4RG8A 2R5MA 2HDAA 2RB6A 3CPWS 1BU1A 2CT4A 1CKAA 3QXEB 3CBMA 1KQSP 1VQNA 3HSBA 2QGFB 5C6SA 3EHQA 5LJ3f 3QPHA 1GBRA 2DXBA 2X3XD 2SEMA 4QKUA 3UATA 2DZ9A 1VA7A 2F2XA 4A63B 4LDXA 2E10A 4QQGA 2YWWA 3UPUA 4XTXA 1M3AA
chains in the Genus database with same CATH topology
2QQRA 3CCJA 5A0GA 2FHDA 2HBPA 2RK1A 4A4GA 1PSFA 1UB4A 1YJ9A 2VUBA 1VIEA 2KAFA 2DIGA 1FX7A 3MHXA 4BUGA 3HRSA 3A8MB 1N8RC 5GANe 3JCMX 1VQ8A 5GAMf 1VQPT 3OSSC 3PIOA 4C8QB 4Z02A 3QYGB 4C5GA 2ZPBB 3G6EA 3F70A 1VQ4A 3QJYA 4OF1A 3R6OA 3SFMA 4FIBA 4M77A 5DY9A 3RIRA 1MHNA 2QQSA 4MDXA 1FWZA 3OQ5A 4YTLA 1M4ZA 2RH2A 3JB9G 3DLMA 4XTZA 1QP2A 1OI1A 5FU7C 3SWNC 1Y71A 5GAMe 2X4YA 1Q81C 2XU8A 2QXFA 5C0MA 4A4EA 3X28B 4A53A 3J81E 4J6YA 2B8AA 4ME7A 3G71A 5CIUA 3OYFA 4EMKA 1WJRA 3CCLT 2G3RA 4OB0B 2DJZA 4A4FA 4HCZA 1JRIA 4P5NA 4JLGA 3GLXA 4QVDA 4BE2A 3SDZA 1UGSB 4DOVA 4M75F 3WVEB 2XI9A 3RKYA 3CCRA 2HAXA 3O8VA 4RMOA 5FU7B 3CCVA 3QDRB 2QQ9A 1VQ6T 1N6AA 2R58A 2M9UA 4ZTFA 4XU2A 3GPLA 1QVFS 3G7ZA 4M75E 2M0OA 1M5Q1 1WQ7A 2K5LA 3RUXA 1YI2A 2OTJA 3SD4A 4C8QG 1K73C 1YIJA 1X75C 3I55T 5HY6A 2WSEE 2X4JA 3SWNB 5A0DA 5GANd 3L2VA 3LGFA 5CKEA 2EYQA 2P0KA 1M90U 4PJOB 2OTLA 3HPWA 4XAXB 1V29B 2RJCA 1U8RA 1NJIU 4C92D 4C5HA 5CKHA 4DQ2A 3JB9I 3LWIA 1KD1C 1NPPA 5J39A 3JCMc 2Y90A 2Y4YA 4PKCC 1VQ5A 3HRTA 4BACA 3UDCA 3X24B 3VUZA 1MGQA 1N9SA 2MF2A 2JNGA 3EFSA 2BIVA 4Q5WA 2GQVA 1X01A 1P92A 3H6ZA 4XQ3A 1BIBA 4JS4A 1VQ8T 2O4XA 1YITT 3CMAT 4C92A 5CCAA 3M54A 2VXFA 1B34A 1K73U 4PJOD 4M78C 3E9FA 2O01E 3DB3A 4IURA 2EQJA 1G3SA 3CC4A 4C92B 3CC7A 1WQWA 4NOYA 4IUTA 2JUFA 4C8QD 4BDYA 3ASKA 4XTYA 5LJ3h 5CKDA 2DD4A 1KQSS 1YJNT 1HK9A 4CRIA 2E6NA 2KVQG 3FDRA 4LD6A 1VQOT 4B9XA 1YJNA 4E7LA 4BI3A 5CAIA 4F7UE 5D6YA 1S72T 4QVZA 1LNXA 1W4SA 2P0PA 5GMKh 2FL7A 3L42A 4X9DA 1Q82C 3CCLA 4FU6A 3GP8A 2VGMA 4QW2A 2P4TA 2M16A 3MP6A 4FT4A 3E1SA 1JBMA 4J6WA 3OYEA 4M75C 2EJFA 4RCCA 5FROA 3WXMB 5IT9E 4QQDA 5D6XA 5FU6B 3C12A 1W2BA 3CEYA 3OS2A 4JLIA 3C95A 3M56A 4MZMA 3S3MA 5GAOr 1Y96A 3QBYA 2QA4T 2EJ9A 2V8IA 1WPYA 5CK9A 2E64A 1BI1A 3QZ5B 4MMLA 5FU6C 1IREB 3GNFB 2L5QA 3MO8A 4O6JA 5J26A 3RKXA 3FC3A 4Y28E 1VIFA 3M57A 3V8LA 1D3BB 2BUDA 2DTHA 2LC4A 4C92E 3GF5A 3A8LB 3P8DA 4XTVA 1K8AC 4JDSA 2DXTA 2E6ZA 4WF2A 4X34A 4EDUA 4M7AC 4ZTJA 3OY9A 3FIFA 3OYKA 3FB9A 4C0ZA 2K5FA 5GAN8 1ZQ1A 1N8RU 3M58A 3CCUT 2CYZB 1VQ9A 2A7YA 3OYBA 3V8KA 3QHSA 2D6FA 4PNOA 5KE3A 3RESA 4BY6B 1XOVA 4L5GA 3L1AA 1SSFA 1WJQA 4M77E 3M55A 3CMAA 2LT4A 3MEWA 5CQXA 1OYXA 2BKDN 3PMTA 3OW2A 2WSCE 2C06A 2HNIA 2LNVA 2DTIA 3RKWA 1FXXA 3OYJA 5GANj 3G6ET 1M8VA 1O9SA 4C0DB 3TU4K 3PFSA 3X26B 1VQOA 3Q1JA 5A2QE 3JCMQ 3HFNA 4EPCA 2QEXT 3ME9A 2LTOA 1KHCA 4XTXA 5KH6A 3CCRT 4FSXA 4BY6C 1W2BS 2JTFA 5CVIA 2EFIA 4R55A 3CC4T 3QSUA 3M59A 2E65A 3BDLA 4LDYA 2DIQA 4IUPA 4GY5A 3OBWA 4J7IA 5LJ3j 2ZPEB 3OBYA 2DVEA 3OW2S 4RCBA 3LYIA 2RI5A 5GAOq 3CC7T 3VYGA 5A0LA 2DXUA 5LJ5g 1VQMT 2DEQA 2K4YA 3OSVA 4OB3B 3L2UA 3NFCA 1I8FA 5I21A 5L8RE 1VQNT 3FEOA 2QDYB 4PJOC 5GAN4 2L89A 4O5VA 1NZ9A 4A4HA 3JCMf 2QTXA 2RM4A 3M4YA 2MMPA 3EFRA 3VV0A 4HA8A 2PU9B 1N9RA 1IZ6A 5CKFA 4C5EA 4QVCA 1BIAA 2DZCA 5M9OA 5GAOl 4F7UB 1YHQA 3OYAA 3I56A 2EQKA 2V8KA 4N0AC 2IG0A 4BI4A 5KE2A 5GAOp 3S3NA 4M7DG 2RD1A 3OMGA 4PLLA 5HK3A 3V7SA 3QKJA 1VQ5T 1X6OA 1RL2A 5FRNA 4X9CA 1M1KU 3GOXA 2A3LA 2VXEA 2KDSA 2H3JA 4M7DC 2VC8A 5GMKj 2K5IA 3CBOA 2RO0A 2PVGB 3QYHB 4C8QA 4D6WA 4JJNK 3CD6A 2I2LA 1KC8U 2D9TA 1RI0A 1I4K1 2P0QA 4C0DC 5LJ5f 2KK4A 3LWHA 2DXCA 4BE0A 1Q86U 2RHYA 1VQLT 1H3ZA 2ZPFB 1OZ3A 4M77C 1VQ6A 3HL8A 4J8OA 1R8OB 2E12A 4OMFB 2FVUA 3A8GB 3OYIA 3GNGA 1VQ7T 2K3XA 3OYYA 4KT0E 2LCCA 3LH0A 4C92G 4M78D 5CR2A 5EG2A 3C94A 3SWNA 1G3TA 5KCHA 3L2ZA 3QJ6A 3HKSA 4ELZC 1KQSA 3RMQA 1WGSA 1UGQB 4MMKA 5FLXE 5GANh 3JAME 3CCQA 2ZZDA 2CZ1B 5IN1A 4JS5A 1K9MC 4M77B 4UC4A 4KULA 2DD5A 2DPPB 2ZPIB 1XQHA 2LDMA 4MZPA 4XK8E 5HKCA 2HQEA 2LQKA 2RJEA 3EAEA 3INZA 3UWNA 4FL6A 2YRVA 3MEUA 4MDWA 3MEAA 2HD0A 5HK0A 2VV5A 4ZGEB 3S3OA 5DM7R 1VQKT 2DTOA 2K3YA 3C4SA 4F7UF 3DB4A 2MWOA 1XTDA 2RJFA 4KBMB 3MEVA 4PJOE 1KHIA 4HCCA 2EIFA 4ZGJB 4M7DF 2EJGA 1UEBA 2E70A 2XICA 2KSSA 5GAMg 3TREA 4L6V5 5GAN3 4BD3A 4BI8B 2GFAA 2JTMA 4LDUA 4M78E 4XTWA 1BYMA 4M75D 3CCEA 4M7AG 3L2WA 3RERA 3P8HA 4LDVA 1TH7A 4DOWA 1D3BA 2F5TX 4ZGDB 1NPRA 4PL6A 1VQMA 2EWNA 5I2SA 1M90C 2RA2A 3LW5E 1VUBA 4N4IA 4BB7A 3OB9A 5LJ3d 1Y7XA 2ZGWA 3CPFA 5GMKl 3CCST 1YJ9T 1WNLA 3JCMg 1YCYA 3AHUA 2XG8D 2YHTA 1QP3A 3CMET 2R5AA 1DJ7B 1EIFA 4E47A 3S6WA 4J7FA 2FB7A 2PVDB 2LRQA 1I81A 2KQWA 2K2VA 2O4XB 3M53A 3VUBA 4C0FA 3JSCA 1QVFA 2LT1A 4NS5A 5GMKe 3KXTA 3PGGA 4KUIA 5DLOA 2QA4A 1NJIC 5LL6S 3JCMV 3URGA 3H8ZA 1ZHIA 2GF7A 4RG2A 2LVMA 3BDUA 2CZ7B 4M78A 2EQMA 2RI3A 4Y91A 4IUQA 5GAN7 3KBGA 5GANf 3TEEA 3X25B 3CCET 2QI2A 2WSFE 3G4SA 4J83A 3A5ZB 1YI2T 3MP1A 2OTJT 3QZ9B 2XD0A 4QQ6A 4HCBA 4PJOA 1G5VA 4E7HA 1OZ2A 1QW1A 1VQLA 1JB0E 3MP8A 2E1HA 4M7AB 1KD1U 5LJ5j 5GAMd 5GAMh 3NTKA 3V7RA 2YLBA 4XU3A 1UGPB 4M7AE 4M7DB 2CS7A 4M78G 2GFUA 2ZCFB 4N0AA 1LOJA 2XDPA 1O75A 2F5KA 4JUVA 4J6XA 3V7CA 4OB1B 5LJ3e 3I55A 3BY7A 2PVOB 3QUIA 2LX9A 4M77D 4PJOG 1M9SA 4VUBA 3RMSA 3UT1A 4E7KA 5GAN2 4M7AF 2EAYA 1XNIA 1BI3A 3CC2A 1Q7YC 2RK2A 4IUVA 4C92F 5IAYA 4C0GA 3JB9J 1YITA 1YJWA 3JB9H 1BI2A 1VQ4T 2V8JA 2QQAA 5AYFA 4ZN1A 2VGNA 4E7JA 4HT8A 3CCQT 2XDBA 2ZPHB 3JCMb 5FRMA 1GXIE 3HHTB 4IUUA 4N4GA 2ZPGB 5LJ5d 5GAMj 2RHXA 5LJ5h 3HP9A 3OYLA 5GANg 3JCMh 3JB9D 3JCMd 3JCMP 3P8BB 1G3WA 1YJWT 4XTUA 3CC2T 4MZTA 2DKGA 3FJPA 4RKUE 2X35A 3VJPA 3E19A 4M7AA 4M7DD 3V8JA 4C92C 3CMEA 4LD9K 2MAMA 2XKOC 3DKMA 2XIDA 3MCAB 4HKEA 3CXCA 2YLCA 1YBYA 4FM4B 4OP0A 1KC8C 2OTLT 1BI0A 2AHJB 1S72A 4V2SA 1HXDA 4OB2B 1QVPA 3L2QA 3CPWA 3OS1A 5I2MA 3CD6T 1LJOA 1YIJT 5GMKi 2JVVA 1KQ1A 2PUKB 3ER0A 4LDWA 1K8AU 3CCSA 2XDDA 3T9NA 4E7IA 3ZBDA 3N5BB 2E41A 4PJOF 2QEXA 4JRPA 1G3YA 5J3BA 1QVGA 5LJ3g 5D6WA 4EMKB 3I56T 1AHJB 1U1TA 3HFOA 3J7AF 4HT9A 1VQPA 2D0QB 3OS0A 3KUFA 1JJ2S 4M78F 3CCUA 4A54A 2MI6A 4NL2A 1U1SA 4ATOA 3PMIA 3TCJA 4M75A 3VKIA 3A8HB 4EMKC 2EKOA 4JRKA 2RHZA 2CKKA 1JJ2A 4KUDK 2FYKA 3CCJT 4M7DE 2EQUA 3JCMW 4OVAA 2JZ2A 3G71T 1B34B 1NE8A 2LQ8A 4II1A 3WVDB 4A4KA 3NTIA 4N4HA 3PIPA 4B9WA 3QIIA 4DA4A 1KG1A 2RJDA 4PLIA 3QG1A 3LGLA 4JRIA 5LJ5e 3CCMA 1UGRB 3OYHA 1Q81U 5GAOm 2KMTA 2MWPA 2Y4XA 1N27A 4OGCA 4M77G 4TVRA 2HQXA 4XU0A 4F7UG 5GAN6 2X4XA 3LX7A 3M9QA 4M77F 3VU3C 1VQ7A 1PSEA 4CI0C 2KY9A 3OYMA 4XU1A 2NLUA 2OAUA 2L3RA 3FLGA 3PNWC 3SB2A 4BE1A 2VYTA 3JCMe 2PUOB 2K57A 2JN0A 1I5LA 4ELYC 2RI2A 3ZFJA 5CQYA 5GAN5 3OYGA 3QO3A 4M75B 2WACA 1BKBA 4EMHA 4ZN3A 2M1HA 3PTAA 1Q82U 4M7DA 4C8QC 3GIBA 3A8OB 2XHCA 2CZ6B 3DLLA 4F7UA 4C5IA 2CGHA 3CCVT 1VQ9T 1Y07A 3BW1A 4OGEA 3ZEHA 1Q7YU 2CZ0B 3PT9A 4L59A 4BDZA 2DK3A 3OS5A 3JB9F 3NTHA 3X20B 3G4ST 4NL3A 3HRUA 5GAOn 1M1GA 4EMGA 1QVGS 2PQWA 5DLQE 3CCMT 4JRQA 4M78B 5KCOA 1KQ2A 5CO7A 2RHUA 3M4GA 4R56A 2QQBA 4GLKA 2DO3A 2R57A 3VYHB 2DAQA 1K9MU 4RG8A 2GCXA 2R5MA 2RB6A 3OYDA 1H641 1YHQT 5CKBA 2RHIA 3CPWS 3FRNA 3E9GA 2JOYA 2XK0A 3L2RA 3OA6A 3CXCS 3QXEB 3J80E 3JRZA 3OYNA 3CBPA 3CBMA 1VQNA 2LCLA 4C8QE 3HSBA 3OYCA 2E5QA 1WJSA 1Y96B 5C6SA 1VQKA 2F69A 2IVWA 3META 5LJ3f 5GMKm 1M1FA 3QPHA 4IKFA 4M75G 3M5AA 2DXBA 4M7AD 4J5YA 2DZ9A 3JCMJ 1ZBXA 4LDXA 2E10A 3BFMA 1Q86C 4C8QF 2L8DA 1M1KC 2X4WA 4QQGA 3UPUA 3OMCA 4FT2A 3LLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQR A;  2FHD A;  3OYE A;  4A4G A;  5FRO A;  5FRM A;  4QQD A;  5D6X A;  3CEY A;  5IN1 A;  2DIG A;  3OS2 A;  3S3M A;  3OS1 A;  4UC4 A;  3QBY A;  4Z02 A;  2LDM A;  4C5G A;  3OYI A;  2HQE A;  5J26 A;  2RJE A;  3F70 A;  3EAE A;  3MO8 A;  3UWN A;  4FL6 A;  2YRV A;  3FC3 A;  4E7I A;  3MEU A;  3MEA A;  1MHN A;  2QQS A;  2BUD A;  3S3O A;  3OQ5 A;  2K3Y A;  3C4S A;  3P8D A;  5D6W A;  3DB4 A;  2MWO A;  2RJF A;  3DLM A;  4X34 A;  4EDU A;  3MEV A;  1OI1 A;  4ZTJ A;  3OS0 A;  2X4Y A;  3KUF A;  3OY9 A;  3OYK A;  3QJ6 A;  5C0M A;  4A4E A;  3PMI A;  2B8A A;  2EKO A;  4BD3 A;  2RHZ A;  2CKK A;  5CIU A;  3OYF A;  1WJR A;  3OYB A;  2G3R A;  2GFA A;  4A4F A;  2EQU A;  4HCZ A;  5KE3 A;  4OVA A;  2JZ2 A;  3P8H A;  3L2W A;  1SSF A;  1WJQ A;  4II1 A;  4BE2 A;  4PL6 A;  3MEW A;  3NTI A;  4N4H A;  1OYX A;  2BKD N;  3PMT A;  3QII A;  4N4I A;  4B9W A;  2RJD A;  3O8V A;  3OB9 A;  4PLI A;  3LGL A;  3OYJ A;  3OYH A;  3PFS A;  3Q1J A;  2R58 A;  2R5A A;  4ZTF A;  2MWP A;  3S6W A;  1N27 A;  2HQX A;  2LRQ A;  2LTO A;  3ME9 A;  2M0O A;  1KHC A;  5KH6 A;  2X4X A;  2O4X B;  3LX7 A;  3M9Q A;  2JTF A;  2EFI A;  4NS5 A;  3SD4 A;  3OYM A;  2NLU A;  3BDL A;  2L3R A;  3FLG A;  2DIQ A;  3PNW C;  4IUP A;  4BE1 A;  4GY5 A;  2VYT A;  3H8Z A;  3L2V A;  3LGF A;  2GF7 A;  3LYI A;  2RI5 A;  2RI2 A;  2P0K A;  4RG2 A;  2LVM A;  3OYG A;  2WAC A;  2EQM A;  2M1H A;  2RI3 A;  2RJC A;  4IUQ A;  3MP6 A;  4C5H A;  3L2U A;  3MP1 A;  4C5I A;  5J39 A;  3FEO A;  4QQ6 A;  2L89 A;  1G5V A;  4BAC A;  4E7H A;  1OZ2 A;  3ZEH A;  4A4H A;  4C5E A;  5M9O A;  4L59 A;  4BDZ A;  3MP8 A;  3NTH A;  3NTK A;  3OYA A;  2EQK A;  2BIV A;  2PQW A;  4Q5W A;  5KCO A;  2IG0 A;  3H6Z A;  5KE2 A;  2RHU A;  2GFU A;  3S3N A;  2O4X A;  2XDP A;  3OMG A;  4PLL A;  2R57 A;  2F5K A;  3QKJ A;  5FRN A;  2DAQ A;  2R5M A;  3GOX A;  3OYD A;  3L2Q A;  3E9F A;  2RO0 A;  2RHI A;  3DB3 A;  3UT1 A;  4E7K A;  4IUR A;  2EQJ A;  1XNI A;  2D9T A;  3E9G A;  2XK0 A;  3L2R A;  5IAY A;  1RI0 A;  4IUT A;  4IUV A;  3OA6 A;  4BDY A;  3ASK A;  3OYN A;  4E7J A;  4BE0 A;  4CRI A;  2RHY A;  3OYC A;  2E6N A;  2E5Q A;  3FDR A;  1WJS A;  1OZ3 A;  4LD6 A;  5C6S A;  3MET A;  4B9X A;  1H3Z A;  4E7L A;  4IUU A;  4N4G A;  4IKF A;  2RHX A;  5D6Y A;  4QVZ A;  2K3X A;  3OYL A;  2LCC A;  3L42 A;  3LH0 A;  2X35 A;  2L8D A;  4FU6 A;  4QW2 A;  2X4W A;  4QQG A;  5KCH A;  2M16 A;  3OMC A;  3LLR A;  1WGS A; 
#chains in the Genus database with same CATH topology
 2P4R A;  3CCJ A;  2FHD A;  2QAZ A;  1PSF A;  2KRM A;  2E3I A;  3CCR Q;  1FX7 A;  4BUG A;  3A8M B;  5GAN e;  4Z02 A;  2ZPB B;  4RTZ A;  3F70 A;  1VQ4 A;  3I9Q A;  2SRC A;  2HMA A;  1MHN A;  2QQS A;  3JB9 G;  1IO6 A;  3DLM A;  5FU7 C;  1TUC A;  2X4Y A;  2D8J A;  1Q81 C;  5AT1 B;  1M2O A;  5C0M A;  3X28 B;  4A53 A;  2B8A A;  1ABO A;  3REA B;  1X2Q A;  4JLG A;  3GLX A;  2A28 A;  4DOV A;  3WVE B;  2RQV A;  2XI9 A;  4D8K A;  1N6A A;  1QVF S;  2M0O A;  4J9B A;  4ZNX A;  2VVK A;  2DBM A;  5A0D A;  5GAN d;  3L2V A;  2LNH B;  1RAI B;  1YN8 A;  2P0K A;  1M90 U;  4JJC A;  1NJI U;  3JB9 I;  3LWI A;  4PKC C;  1Z9Z A;  1VQ5 A;  2A08 A;  2JT4 A;  1ZSG A;  1MGQ A;  1N9S A;  1E6G A;  1WHL A;  1VQ8 T;  2O4X A;  1K73 R;  3M54 A;  2JS2 A;  2VXF A;  1QCN A;  2DEU A;  4M78 C;  1D09 B;  4NOY A;  1RI9 A;  4BDY A;  2K3B A;  1VQL Q;  3ASK A;  4XTY A;  5LJ3 h;  1U06 A;  1HK9 A;  1MUZ A;  4LD6 A;  1K1Z A;  1VQO T;  1OU9 A;  1LNX A;  2EPD A;  1W4S A;  2M51 A;  4X9D A;  4FU6 A;  2KGT A;  2ENM A;  2P4T A;  3E1S A;  1JBM A;  2LMJ A;  4J6W A;  5FRO A;  4QQD A;  1W2B A;  4JLI A;  9ATC B;  3S3M A;  3M56 A;  4MZM A;  5GAO r;  5IHN A;  2DJQ A;  2EJ9 A;  3M0P A;  1WPY A;  5CK9 A;  2E64 A;  1BI1 A;  5LJ5 g;  3GNF B;  2B86 A;  1ZSZ B;  4Y28 E;  3V8L A;  1KD1 R;  2KBT A;  2DXT A;  2NUZ A;  2HCK A;  1Q82 R;  4C0Z A;  4CC3 A;  1VQ9 A;  5KE3 A;  2NUP B;  3CMA A;  2ED1 A;  2GTO A;  4J9C A;  2QDL A;  2WSC E;  3RKW A;  2DTI A;  4RTY A;  5GAN j;  3G6E T;  4C0D B;  1VQO A;  1WI7 A;  2BTT A;  1S1N A;  2KRS A;  4BY6 C;  5CVI A;  2EFI A;  3CC4 T;  1WHH A;  1D0Z A;  3EG2 A;  4GY5 A;  3OBW A;  5LJ3 j;  1ZA2 B;  2DVE A;  3LYI A;  2DL4 A;  4J9D A;  3VYG A;  1VQM T;  1SSH A;  3NFC A;  5L8R E;  5L23 A;  2C0I A;  3ULR B;  1NZ9 A;  4A4H A;  3M4Y A;  1WXB A;  1BIA A;  5GAO l;  2QK0 A;  2EQK A;  4FYV B;  4M7D G;  2RD1 A;  4JZ4 A;  1X6O A;  4PFP A;  4X9C A;  1F1B B;  2KDS A;  2H3J A;  1M90 R;  4M7D C;  1JXO A;  4C8Q A;  3RBB B;  2D9T A;  2CSQ A;  1RLP C;  4PJN A;  2KK4 A;  1Q7Y R;  1YJ9 Q;  3PVQ A;  4BE0 A;  3HL8 A;  4J8O A;  2K3X A;  2DMO A;  2JJ9 A;  3LH0 A;  4M78 D;  2FG0 A;  2CT3 A;  1WGS A;  3CCQ A;  3M0S A;  2CZ1 B;  5IN1 A;  1T3L A;  2I0N A;  4UC4 A;  2DD5 A;  3EGD B;  2FPF A;  3AT1 B;  2RJE A;  3INZ A;  3UWN A;  4FL6 A;  4MDW A;  2G6F X;  3S3O A;  1YJW Q;  1VQK T;  1J3T A;  1KHI A;  3TVT A;  2KYB A;  4M7D F;  2KSS A;  1Y57 A;  1W2B P;  4L6V 5;  2JTM A;  4LDU A;  3VS4 A;  1KFZ A;  4M75 D;  1MV0 B;  3TSW A;  1TU0 B;  3L2W A;  4LDV A;  1D3B A;  4PL6 A;  5I2S A;  1M90 C;  3LW5 E;  1JO8 A;  3EH1 A;  3JCM g;  3AHU A;  4ANJ A;  2JMA A;  2YHT A;  3CXC P;  2DRM A;  2FB7 A;  2LRQ A;  3VUB A;  4C0F A;  4GLM A;  2LT1 A;  1GL5 A;  2NUP A;  1AOJ A;  4LUD A;  5LL6 S;  1WXU A;  3URG A;  4RG2 A;  3BDU A;  2RI3 A;  5GAN 7;  5GAN f;  2QI2 A;  3A5Z B;  3O5Z A;  1TOV A;  1G5V A;  1VQN Q;  1JB0 E;  3EFO B;  2E1H A;  1KD1 U;  1IB8 A;  5GAM h;  3NTK A;  3V7R A;  4XU3 A;  4M7A E;  4M7D B;  1Z9Q A;  4M78 G;  4N0A A;  1LOJ A;  2RMO A;  2F2V A;  1UJ0 A;  4JUV A;  1VQ8 Q;  4J6X A;  3RNJ A;  2AZS A;  1YWP A;  4OB1 B;  3I55 A;  3L2Q A;  2PVO B;  3QUI A;  4M77 D;  4M7A F;  1M9S A;  4VUB A;  4E7K A;  5GAN 2;  1XNI A;  3QDF A;  3CC2 A;  5IAY A;  1YIT A;  2JW4 A;  4ZN1 A;  1QVG P;  5FRM A;  1GXI E;  3HHT B;  4IUU A;  2AKL A;  1HYO A;  4AT1 B;  3OYL A;  3JCM h;  2QTV A;  3JB9 D;  1HSQ A;  2LX7 A;  4XTU A;  3FJP A;  3VJP A;  4M7A A;  1H92 A;  3CME A;  2XKO C;  3NGP A;  1BI0 A;  1S72 A;  1C6V X;  1PRL C;  5GMK i;  2JVV A;  1KQ1 A;  4OMP A;  3MPU B;  3CQT A;  4LDW A;  4E7I A;  3ZBD A;  4AFQ C;  1G3Y A;  2CRE A;  2AZV A;  2J6K A;  2JM9 A;  3VS6 A;  1AHJ B;  4HT9 A;  1OEB A;  2D0Q B;  1T0H A;  2MI6 A;  4NL2 A;  4ATO A;  3EG0 A;  4KUD K;  2KXC A;  2EQU A;  1FMW A;  4OVA A;  2LQ8 A;  1V1C A;  2YDL A;  4N4H A;  4B9W A;  1KG1 A;  4CC4 B;  1OU8 A;  4JRI A;  4LN2 A;  2QGG A;  2DBK A;  1Q81 U;  4F7U G;  1PCX A;  3VRY A;  2COW A;  1FYN A;  4CI0 C;  2OAU A;  3SB2 A;  2EGC A;  5FW9 A;  1OV3 A;  2VYT A;  3JCM e;  4RTT A;  2Z0W A;  4ELY C;  3CC4 Q;  2RI2 A;  5CQY A;  3OYG A;  4M75 B;  4M7D A;  4EMH A;  4C8Q C;  2MK5 A;  2CZ6 B;  4C5I A;  3MKD A;  2CGH A;  3CCV T;  1MMN A;  1Y07 A;  3G6E Q;  7AT1 B;  4D8D A;  1H8K A;  3OS5 A;  2X3W D;  2ZAE A;  2RQT A;  1OQK A;  3E2U A;  3HRU A;  1WFW A;  1UUE A;  1IGQ A;  1X2K A;  1TSF A;  5KCO A;  5CO7 A;  4PJM A;  4GLK A;  4ESR A;  1K9M U;  2GCX A;  3OYD A;  1H64 1;  1BK2 A;  1AWO A;  2RHI A;  2ED0 A;  3FRN A;  3E9G A;  2K2M A;  2JOY A;  2YUO A;  3D7S B;  2FRY A;  3OYN A;  4C8Q E;  3EG9 B;  2E5Q A;  1WJS A;  1VQK A;  3MET A;  5GMK m;  1KIK A;  1VQM Q;  4M75 G;  3M5A A;  3MJX A;  3BFM A;  1Q86 C;  4C8Q F;  2L8D A;  2H8H A;  2X4W A;  3OMC A;  3OSS C;  3LLR A;  2QQR A;  2K6D A;  5A0G A;  2RK1 A;  1YJ9 A;  1UB4 A;  2VUB A;  2XMF A;  1GCQ A;  2COY A;  2DIG A;  1N5Z A;  1PD1 A;  1E6H A;  1OX8 A;  1VQ8 A;  5GAM f;  1LPL A;  2RNA A;  4C5G A;  3QJY A;  4OF1 A;  4M77 A;  5DY9 A;  2MIO A;  1M4Z A;  2RH2 A;  3SWN C;  5GAM e;  2DX1 A;  2BZX A;  4A4E A;  4ME7 A;  2HKN A;  5CIU A;  4EMK A;  1WJR A;  3CCL T;  4A4F A;  4HCZ A;  1JRI A;  4BE2 A;  4OMQ A;  2HAX A;  3CCV A;  3QDR B;  4ZTF A;  4XU2 A;  3H0I A;  3G7Z A;  4M75 E;  1BB9 A;  1M5Q 1;  1WQ7 A;  1YI2 A;  3SEM A;  4C8Q G;  2HZY A;  2WSE E;  1UFF A;  5FWC A;  2HQH A;  4PJO B;  4XAX B;  4C92 D;  5CKH A;  1KJW A;  2YRD A;  1ZX6 A;  2Y90 A;  2Y4Y A;  3HRT A;  2MF2 A;  1TUG B;  2JNG A;  4PFO A;  5KYW B;  4J9G A;  2L3S A;  1BIB A;  1YIT T;  2V1R A;  3CMA T;  4C92 A;  5CCA A;  1D0X A;  1YIJ Q;  2DRK A;  2X9H A;  1K9M R;  3CC4 A;  3FJ5 A;  1WQW A;  2DD4 A;  1KQS S;  1AEY A;  1C0M A;  4CRI A;  3FDR A;  4B9X A;  1YJN A;  4E7L A;  2A37 A;  1W1F A;  4F7U E;  5D6Y A;  1S72 T;  2P0P A;  2KI7 A;  2FL7 A;  4E7Z A;  3LH5 A;  3GP8 A;  2M16 A;  3MP6 A;  4FT4 A;  1AZG B;  3OYE A;  2EJF A;  4JJB A;  5IT9 E;  4FW2 A;  4B6M A;  2CDT A;  3OS2 A;  1Y96 A;  2J7I A;  1WYX A;  2V8I A;  2FPD A;  5FU6 C;  3J7A F;  5J26 A;  1IRE B;  3MO8 A;  1RAG B;  2GTJ A;  2DTH A;  2NUT B;  4XTV A;  1K8A C;  4RTV A;  2E6Z A;  4WF2 A;  2QEX Q;  3FIF A;  3HTR A;  3OYK A;  3FB9 A;  2LCS A;  2LQW A;  3M58 A;  3ZL7 C;  2D8H A;  1WHJ A;  2A7Y A;  1UGV A;  3V8K A;  2PNI A;  3RES A;  4EIK A;  2VWF A;  2YT6 A;  4JZ3 A;  3MEW A;  3OW2 A;  5IXF A;  1ABQ A;  4J9H A;  1R0C B;  2L3P A;  3JCM Q;  2LTO A;  1KHC A;  3CCR T;  4FSX A;  1W2B S;  1Q95 G;  3QSU A;  2E65 A;  3RR6 A;  2DIQ A;  4IUP A;  2K9G A;  4J7I A;  2DE0 X;  3PE0 A;  4RCB A;  2CP6 A;  2DXU A;  4OB3 B;  5ECA A;  1IRX A;  4PJO C;  1ZLM A;  3H0H A;  2RM4 A;  4C5E A;  2PU9 B;  4QVC A;  2DZC A;  1Y0M A;  3OYA A;  1GFD A;  2DYI A;  2L0A A;  2V8K A;  2IG0 A;  4N0A C;  3OMG A;  3QKJ A;  4KH0 B;  5FRN A;  1PKS A;  1YI2 Q;  3GOX A;  3CCE Q;  5GMK j;  3CBO A;  4HVU A;  3CD6 A;  2I2L A;  2VKN A;  2P0Q A;  2J6F A;  1WIE A;  3CCV Q;  1OZ3 A;  1R8O B;  3GNG A;  1VQ7 T;  3G1J A;  4C92 G;  3C94 A;  4ELZ C;  1KQS A;  1VQL A;  3JAM E;  4Z8A A;  2EGE A;  1WHG A;  4JS5 A;  3I35 A;  4M77 B;  1QCF A;  2DL3 A;  1UEC A;  1VOM A;  1AD5 A;  2DPP B;  4XK8 E;  1AWJ A;  3EAE A;  1SHG A;  3PVL A;  3MEU A;  3MEA A;  5HK0 A;  2VV5 A;  2DTO A;  4ZGJ B;  1UEB A;  3VS3 A;  3TRE A;  5GAN 3;  1WLP B;  4XTW A;  3RER A;  1TH7 A;  4DOW A;  1X69 A;  2F5T X;  2JTE A;  4JPB W;  1X6B A;  2GBQ A;  2RA2 A;  4BB7 A;  1VUB A;  4N4I A;  1V76 A;  3EGX A;  3CPF A;  2ZGW A;  5KYN A;  1WNL A;  8ATC B;  2FPE A;  2HL5 C;  2XG8 D;  4E7S A;  4J7F A;  4CC2 A;  5DLO A;  2QA4 A;  8AT1 B;  2O31 A;  1ACM B;  3H8Z A;  2CZ7 B;  2EQM A;  4Y91 A;  2L2P A;  1LVK A;  1SF9 A;  2C0T A;  2ESW A;  3X25 B;  3CME Q;  3MP1 A;  1QLY A;  4HCB A;  4Y92 A;  1QW1 A;  2AKK A;  1GFC A;  4DBF A;  3MP8 A;  2COZ A;  1UGP B;  2GFU A;  2EYY A;  1O75 A;  2F5K A;  1WA7 A;  2GQI A;  2DER A;  3V7C A;  4MDX A;  1NEB A;  4PFZ A;  3UT1 A;  1OX9 A;  1PM3 A;  1BI3 A;  1YJW A;  3UA7 A;  1VQ4 T;  2V8J A;  2QQA A;  5AYF A;  2VGN A;  4HT8 A;  3CCQ T;  2NUT A;  3QWX X;  3JCM b;  1RAF B;  1I07 A;  1VYU A;  2YUQ A;  5LJ5 d;  5GAM j;  2RHX A;  3HP9 A;  2CH4 W;  3P8B B;  4MZT A;  4RKU E;  3V8J A;  4DEY A;  4LD9 K;  2MAM A;  2FZC B;  3MCA B;  3CXC A;  2CUB A;  1KC8 C;  1YBY A;  2OTL T;  4V2S A;  1HXD A;  4OB2 B;  1QVP A;  2ABL A;  5I2M A;  3CPW P;  3CD6 T;  1LJO A;  3THK A;  1WXT A;  3T9N A;  2W10 A;  1PNJ A;  4JRP A;  1ZA1 B;  5J3B A;  5LJ3 g;  1NYG A;  1VQP A;  1JJ2 S;  4A54 A;  4M75 A;  3A8H B;  3I5S A;  1I1J A;  2JZ2 A;  1B34 B;  1NM7 A;  3WVD B;  3PIP A;  2EQI A;  3QII A;  3QG1 A;  3I5R A;  2W0Z A;  5GAO m;  2KMT A;  2MWP A;  2Y4X A;  1NLO C;  5GAN 6;  2X4X A;  1VYV A;  1NYF A;  1FMV A;  2KY9 A;  4XU1 A;  1YJN Q;  4KGZ B;  5KYX A;  1K0S A;  5GAN 5;  1AT1 B;  3PTA A;  2ECZ A;  2M0Y A;  3GIB A;  4R0K A;  1I0C A;  3DLL A;  1VQ9 T;  1JEG A;  3BE3 A;  4OGE A;  2CZ0 B;  3PT9 A;  1QVF P;  3JB9 F;  6AT1 B;  3G4S T;  1OPK A;  5GAO n;  4FYY B;  2PQW A;  3CCM T;  2DL5 A;  2RHU A;  1I5O B;  4RTU A;  2DFU A;  4JJD A;  2R57 A;  2DAQ A;  1R77 A;  5CKB A;  1YNZ A;  2XK0 A;  1RAA B;  2EVR A;  3TQ7 P;  3CXC S;  3J80 E;  3JRZ A;  3CBP A;  2KNB B;  2FEI A;  2IVW A;  2FRW A;  3I56 Q;  4M7A D;  4DEX A;  3JCM J;  5KYY B;  4OML A;  2ATC B;  1M1K C;  5KYW A;  4F14 A;  1WHM A;  2BE9 B;  2CP0 A;  3RDV A;  1VIE A;  4AG1 C;  3MHX A;  3HRS A;  2OX7 A;  2ROL A;  4C8Q B;  3QYG B;  2OAW A;  3G6E A;  2MCN A;  3OQ5 A;  2RPN A;  3EG9 A;  4YTL A;  1OPL A;  4XTZ A;  1QP2 A;  1Y71 A;  2DA9 A;  2QXF A;  3J81 E;  3G71 A;  3OYF A;  2J6O A;  2G3R A;  3M0T A;  1X43 A;  1K4U S;  4P5N A;  2F2W A;  3SDZ A;  5I11 A;  1UGS B;  4M75 F;  3CCR A;  1YP5 A;  5FU7 B;  1QWF A;  4FYW B;  4F04 B;  2QQ9 A;  1VQ6 T;  2R58 A;  2C0O A;  3GPL A;  4LXC A;  3EG1 A;  1QKX A;  2ROT A;  3RUX A;  2OTJ A;  2RN8 A;  3SD4 A;  1K73 C;  1X75 C;  5HY6 A;  2V1Q A;  3SWN B;  1EZZ B;  3LGF A;  5CKE A;  1M1K R;  1ZUK A;  1T0J A;  3VUZ A;  1E7O A;  2BIV A;  1D1A A;  3H6Z A;  4PJJ A;  3OW2 P;  2MOX A;  3EHR A;  1K73 U;  1HD3 A;  2O01 E;  3DB3 A;  2FZK B;  3EGX B;  4IUR A;  1G3S A;  4IUT A;  1UJY A;  5CKD A;  1WX6 A;  1RLQ C;  2E6N A;  2KVQ G;  3M0R A;  4BI3 A;  5CAI A;  1D1C A;  1C1A A;  4QVZ A;  1JU5 C;  5GMK h;  3L42 A;  3CCJ Q;  1Q82 C;  2VGM A;  4QW2 A;  1N8R R;  5D6X A;  3CCM Q;  4DBH A;  2F1L A;  3C95 A;  1WDX A;  4KH1 B;  2IIM A;  4RTW A;  2P84 A;  3QZ5 B;  4MML A;  1NEG A;  2L5Q A;  3FC3 A;  3M57 A;  2YRC A;  2J05 A;  1D3B B;  3H9N A;  2BUD A;  2DVJ A;  2DM1 A;  2LC4 A;  4C92 E;  1AWW A;  3P8D A;  4JDS A;  4X34 A;  1Q86 R;  4M7A C;  4ZTJ A;  4Z88 A;  1MND A;  5GAN 8;  1N8R U;  2CYZ B;  1R0B G;  3QHS A;  2D6F A;  4PNO A;  3L1A A;  4M77 E;  3G71 Q;  3M55 A;  1OYX A;  2BKD N;  3PMT A;  1FXX A;  2QAS A;  3TU4 K;  3X26 B;  5A2Q E;  3HFN A;  4EPC A;  2QEX T;  3ME9 A;  4R55 A;  4LDY A;  3BDL A;  2KR3 A;  1OUL A;  1VQ4 Q;  2ZPE B;  2RQW A;  2RI5 A;  5A0L A;  3U23 A;  2K4Y A;  3OSV A;  4KGV B;  1D1B A;  5I21 A;  1JQQ A;  1SRM A;  1VQN T;  3FEO A;  2QDY B;  2L89 A;  4O5V A;  1BCM A;  3JCM f;  3VV0 A;  3EFR A;  5CKF A;  1AVZ C;  1ZSZ A;  1QCO A;  4F7U B;  2PZ1 A;  1ZUU A;  5KE2 A;  5GAO p;  5HK3 A;  2DYB A;  1TTH B;  1M1K U;  2OTJ Q;  1QMC A;  2A3L A;  2VXE A;  2RO0 A;  2PVG B;  4D6W A;  1I4K 1;  5LJ5 f;  4C0D C;  1G83 A;  2DXC A;  1WZO A;  2RHY A;  1VQL T;  2ZPF B;  2E12 A;  2FVU A;  1UDL A;  3OYY A;  4E2F B;  4KT0 E;  5CR2 A;  2OTL Q;  1MMD A;  5KCH A;  3QJ6 A;  3HKS A;  3RMQ A;  1UGQ B;  4MMK A;  2ZZD A;  1M3B A;  1MV3 A;  1PWT A;  1U5S A;  1TS9 A;  3C0C A;  4KUL A;  1RUW A;  2LDM A;  5HKC A;  2YRV A;  2A36 A;  2HD0 A;  1AWX A;  2YXY A;  4ZGE B;  2K3Y A;  4F7U F;  3DB4 A;  2MWO A;  3MEV A;  2EIF A;  2EJG A;  4FW1 A;  3VS7 A;  2E70 A;  5GAM g;  2LZ6 B;  4BD3 A;  4M78 E;  2MYS A;  1H3H A;  4M7A G;  3P8H A;  1RAD B;  1VQM A;  4ZGD B;  1NPR A;  2A0F B;  3VS2 A;  2JM8 A;  5D7U A;  5LJ3 d;  1YJ9 T;  3CCS T;  3EH2 A;  1YCY A;  2OJ2 A;  2JMC A;  1QP3 A;  2R5A A;  1DJ7 B;  1EIF A;  4E47 A;  1K8A R;  3SHW A;  2KQW A;  2K2V A;  2O4X B;  3M53 A;  3JSC A;  4NS5 A;  5GMK e;  3I55 Q;  1NJI C;  3JCM V;  4IIM A;  1ZHI A;  2GF7 A;  4M78 A;  4IUQ A;  3KBG A;  3TEE A;  3CCE T;  1VYT A;  2WSF E;  3G4S A;  2OTJ T;  4KGX B;  3QZ9 B;  2XD0 A;  4QQ6 A;  4PJO A;  1MNE A;  1YWO A;  4E7H A;  5IHI A;  1M2V B;  5LJ5 j;  5GAM d;  3NPF A;  2ZCF B;  3REB B;  1KC8 R;  3KFV A;  2KT1 A;  4PJO D;  2CP5 A;  2LX9 A;  4OMM A;  2HKQ B;  4LE9 A;  3NMZ C;  4AFS C;  4IUV A;  4C92 F;  3JB9 J;  4C0G A;  3JB9 H;  1PD0 A;  1BI2 A;  2DNU A;  4E7J A;  2D1X A;  2XDB A;  2ZPH B;  4AMC A;  3JCM d;  3JCM P;  1YJW T;  1G3W A;  1VQK Q;  2BZY A;  1PHT A;  1VQO Q;  4M7D D;  2X35 A;  3E19 A;  2E4H A;  4C92 C;  3DKM A;  2QYZ A;  2PTK A;  2YLC A;  1BCO A;  1WHK A;  2AHJ B;  2RQU A;  3IQL A;  1YIJ T;  2PUK B;  3ER0 A;  3CCS A;  3VS1 A;  4ORZ A;  2LJ0 A;  1OOT A;  3N5B B;  2E41 A;  4PJO F;  2QEX A;  1UHF A;  1QVG A;  5D6W A;  4EMK B;  3HFO A;  1M3C A;  1M2V A;  3KUF A;  4HCK A;  4M78 F;  1U1S A;  3VRZ A;  3TCJ A;  4E6R A;  4JRK A;  2RHZ A;  1JJ2 A;  4M7D E;  3VS5 A;  4IIO A;  4DA4 A;  2RJD A;  2L3Q A;  5LJ5 e;  3LGL A;  3CCM A;  1UGR B;  3OYH A;  2BZ8 A;  4TVR A;  4OGC A;  2CP2 A;  2E5K A;  4M77 G;  2HQX A;  3M9Q A;  4M77 F;  1VQ7 A;  1PSE A;  3OYM A;  2NLU A;  4BE1 A;  3PNW C;  4RUG A;  2K57 A;  1TUD A;  3QO3 A;  4ZN3 A;  1BKB A;  3R6N A;  2GGR A;  2M1H A;  3UA6 A;  4F7U A;  3BW1 A;  1PRM C;  1Q7Y U;  5GJW B;  4BDZ A;  2HBW A;  2KRO A;  2DK3 A;  1UTI A;  4NL3 A;  1M1G A;  4EMG A;  2O9S A;  2KYM A;  4M78 B;  1KQ2 A;  2LQN A;  4R56 A;  2QQB A;  3VYH B;  5KYU B;  4PJL A;  1YHQ T;  1S72 Q;  3L2R A;  3OA6 A;  4HXJ A;  2LCL A;  3OYC A;  1Y96 B;  2F69 A;  1M1F A;  2O9V A;  4IKF A;  2D0N A;  4J5Y A;  1ZBX A;  2FZG B;  1UHC A;  4FT2 A;  2RQR A;  1QWE A;  2DL8 A;  1GBQ A;  2HBP A;  4A4G A;  2KAF A;  1NG2 A;  1N8R C;  3JCM X;  1VQP T;  3CCL Q;  3PIO A;  3R6O A;  3SFM A;  4FIB A;  1IHW A;  2AK5 A;  3RIR A;  1FWZ A;  1RAB B;  1OI1 A;  2XU8 A;  3CCQ Q;  2DL7 A;  2E3H A;  2H3E B;  4J6Y A;  1U3O A;  4OB0 B;  2DJZ A;  2KEA A;  4QVD A;  4J9E A;  2OI3 A;  3RKY A;  3O8V A;  4RMO A;  2BE7 D;  1MMA A;  2VB6 A;  4AFZ C;  2AIR B;  2M9U A;  5KYY A;  3CD6 Q;  2DF6 A;  4DBR A;  2K5L A;  4Z89 A;  1QQJ A;  1YIJ A;  3GBQ A;  3I55 T;  3EFO A;  2X4J A;  2CP7 A;  1VQP Q;  2EYQ A;  2OTL A;  3HPW A;  1V29 B;  2RJC A;  1U8R A;  4C5H A;  4DQ2 A;  1NLP C;  1KD1 C;  1NPP A;  5J39 A;  3JCM c;  1VQ6 Q;  1T3S A;  3CCS Q;  4BAC A;  3UDC A;  4OMO A;  1TWB A;  2YSQ A;  2EW3 A;  2YUN A;  3X24 B;  1MMG A;  3EFS A;  1BBZ A;  4Q5W A;  1GCP A;  2GQV A;  1X01 A;  1P92 A;  4XQ3 A;  4JS4 A;  4PK4 A;  3TSZ A;  1G2B A;  4CC7 A;  1B34 A;  3E9F A;  2EQJ A;  1YHQ Q;  4C92 B;  3CC7 A;  2JUF A;  4C8Q D;  3JV3 A;  1SG5 A;  1KK7 A;  1YJN T;  2YUP A;  2VAS A;  5KYU A;  2LP5 A;  3EGU A;  1IHV A;  3A98 A;  1RAC B;  1K9A A;  3QWY A;  4M75 C;  1EX4 A;  4RCC A;  3WXM B;  1JXM A;  5FU6 B;  3C12 A;  2DET A;  3CEY A;  1GCQ C;  5GJV B;  2CP3 A;  2M02 A;  3CC7 Q;  1KSW A;  3QBY A;  2QA4 T;  3OYI A;  3RKX A;  4O6J A;  1VIF A;  2EBP A;  3UF4 A;  3GF5 A;  3A8L B;  1Q81 R;  1RAH B;  4EDU A;  4OMN A;  3OY9 A;  2K5F A;  1TG0 A;  1ZQ1 A;  2J06 A;  3CCU T;  1K0X A;  3OYB A;  4BY6 B;  1XOV A;  4L5G A;  1SSF A;  1WJQ A;  3M0U A;  4RTX A;  2LT4 A;  5CQX A;  3VS0 A;  2C06 A;  2HNI A;  2LNV A;  3OYJ A;  1B7T A;  1M8V A;  1O9S A;  3EGD A;  3PFS A;  3Q1J A;  1NBE B;  5KH6 A;  2JTF A;  2K79 A;  1RAE B;  3M59 A;  2EYZ A;  1XJW B;  1YIT Q;  3OBY A;  2O88 A;  3OW2 S;  5GAO q;  1SEM A;  3CC7 T;  2CSI A;  2DEQ A;  3L2U A;  4LNP A;  1I8F A;  3EG3 A;  2HEQ A;  4F17 A;  5GAN 4;  2QTX A;  1YFN A;  2MMP A;  4HA8 A;  5M9O A;  1N9R A;  1IZ6 A;  2EGA A;  1YHQ A;  3I56 A;  4BI4 A;  2IPO B;  3S3N A;  3CCU Q;  4PLL A;  3V7S A;  1VQ5 T;  1SPK A;  1RL2 A;  2FO0 A;  4WTO B;  2VC8 A;  2K5I A;  2NWM A;  3QYH B;  4JJN K;  1KC8 U;  1RI0 A;  4FSS A;  3LWH A;  1Q86 U;  2NYS A;  1H3Z A;  2V26 A;  4M77 C;  1VQ6 A;  4OMF B;  3A8G B;  2LCC A;  2DIL A;  5EG2 A;  3SWN A;  1G3T A;  3L2Z A;  1D0Y A;  5FLX E;  5GAN h;  4FYX B;  3A1P A;  2RF0 A;  1K9M C;  2ZPI B;  1XQH A;  4MZP A;  2HQE A;  2KXD A;  2LQK A;  1GRI A;  1ZUY A;  4HVV A;  5DM7 R;  3C4S A;  1LCK A;  1XTD A;  2RJF A;  5FWB A;  4KBM B;  2HSP A;  4PJO E;  4HCC A;  1M27 C;  2XIC A;  5I22 A;  2KRN A;  2JS0 A;  1SKU B;  4BI8 B;  2GFA A;  1BYM A;  3CCE A;  2QG9 B;  2EWN A;  4J9F A;  1X6G A;  3OB9 A;  1Y7X A;  1QKW A;  5GMK l;  3CME T;  5KYX B;  3S6W A;  4GBQ A;  2PVD B;  1CSK A;  1SRL A;  1I81 A;  3H0F A;  1NJI R;  1QVF A;  3KXT A;  3PGG A;  1M8M A;  4KUI A;  1VQ5 Q;  2LVM A;  2MPX C;  1W70 A;  4AG2 C;  1PC0 A;  1AZE A;  4J83 A;  1YI2 T;  1OZ2 A;  4K11 A;  5IXB A;  1JJ2 P;  1A0N B;  2CH4 A;  4M7A B;  1K76 A;  4KRT A;  2YLB A;  2CS7 A;  2XDP A;  3CMA Q;  2EYW A;  1UG1 A;  1PKT A;  2QA4 Q;  5LJ3 e;  2LJ3 A;  3BY7 A;  4PJO G;  3RMS A;  2EAY A;  1Q7Y C;  1HJD A;  2RK2 A;  4F16 A;  4DBQ A;  4N4G A;  2ZPG B;  5LJ5 h;  5GAN g;  4HVW A;  3CC2 T;  4AFU C;  2DKG A;  1G8X A;  5HCK A;  2XID A;  4HKE A;  4FM4 B;  4OP0 A;  1W6X A;  3CPW A;  1VQ7 Q;  3OS1 A;  2GNC A;  2JXB A;  1UE9 A;  1K8A U;  2XDD A;  1IGU A;  1VQ9 Q;  5IH2 A;  4M4Z A;  1YCS B;  4FCY A;  3I56 T;  1U1T A;  1SHF A;  3OS0 A;  2K7A A;  3CCU A;  2DLP A;  2HSE B;  3NHN A;  3PMI A;  2KT8 A;  2EKH A;  3VKI A;  4EMK C;  2EKO A;  2KE9 A;  2CKK A;  2FYK A;  3CCJ T;  3JCM W;  3G4S Q;  3G71 T;  1NE8 A;  4II1 A;  4A4K A;  1IXD A;  3NTI A;  2LJ1 A;  4PLI A;  4LUE A;  1B3Q A;  5IHK A;  3M0Q A;  3CC2 Q;  4XU0 A;  1N27 A;  1ZSZ C;  1M30 A;  3LX7 A;  2AT1 B;  4X1V A;  3VU3 C;  2X51 A;  2O2O A;  3FLG A;  1ZBJ A;  2L3R A;  1X27 A;  4QT7 A;  2PUO B;  1I5L A;  1PG5 B;  2CUD A;  2JN0 A;  3ZFJ A;  4J9I A;  3H41 A;  1Q82 U;  2WAC A;  3A8O B;  2XHC A;  5EC7 A;  2HL3 A;  3ZEH A;  2EYX A;  1FMK A;  4L59 A;  1TXQ A;  1CKB A;  1EFN A;  4WCI A;  3NTH A;  1B07 A;  3X20 B;  1QVG S;  3CCL A;  5DLQ E;  4JRQ A;  3M4G A;  2DO3 A;  1ARK A;  4RG8 A;  2R5M A;  2HDA A;  2RB6 A;  3CPW S;  1BU1 A;  2CT4 A;  1CKA A;  3QXE B;  3CBM A;  1KQS P;  1VQN A;  3HSB A;  2QGF B;  5C6S A;  3EHQ A;  5LJ3 f;  3QPH A;  1GBR A;  2DXB A;  2X3X D;  2SEM A;  4QKU A;  3UAT A;  2DZ9 A;  1VA7 A;  2F2X A;  4A63 B;  4LDX A;  2E10 A;  4QQG A;  2YWW A;  3UPU A;  4XTX A;  1M3A A; 
#chains in the Genus database with same CATH homology
 2QQR A;  3CCJ A;  5A0G A;  2FHD A;  2HBP A;  2RK1 A;  4A4G A;  1PSF A;  1UB4 A;  1YJ9 A;  2VUB A;  1VIE A;  2KAF A;  2DIG A;  1FX7 A;  3MHX A;  4BUG A;  3HRS A;  3A8M B;  1N8R C;  5GAN e;  3JCM X;  1VQ8 A;  5GAM f;  1VQP T;  3OSS C;  3PIO A;  4C8Q B;  4Z02 A;  3QYG B;  4C5G A;  2ZPB B;  3G6E A;  3F70 A;  1VQ4 A;  3QJY A;  4OF1 A;  3R6O A;  3SFM A;  4FIB A;  4M77 A;  5DY9 A;  3RIR A;  1MHN A;  2QQS A;  4MDX A;  1FWZ A;  3OQ5 A;  4YTL A;  1M4Z A;  2RH2 A;  3JB9 G;  3DLM A;  4XTZ A;  1QP2 A;  1OI1 A;  5FU7 C;  3SWN C;  1Y71 A;  5GAM e;  2X4Y A;  1Q81 C;  2XU8 A;  2QXF A;  5C0M A;  4A4E A;  3X28 B;  4A53 A;  3J81 E;  4J6Y A;  2B8A A;  4ME7 A;  3G71 A;  5CIU A;  3OYF A;  4EMK A;  1WJR A;  3CCL T;  2G3R A;  4OB0 B;  2DJZ A;  4A4F A;  4HCZ A;  1JRI A;  4P5N A;  4JLG A;  3GLX A;  4QVD A;  4BE2 A;  3SDZ A;  1UGS B;  4DOV A;  4M75 F;  3WVE B;  2XI9 A;  3RKY A;  3CCR A;  2HAX A;  3O8V A;  4RMO A;  5FU7 B;  3CCV A;  3QDR B;  2QQ9 A;  1VQ6 T;  1N6A A;  2R58 A;  2M9U A;  4ZTF A;  4XU2 A;  3GPL A;  1QVF S;  3G7Z A;  4M75 E;  2M0O A;  1M5Q 1;  1WQ7 A;  2K5L A;  3RUX A;  1YI2 A;  2OTJ A;  3SD4 A;  4C8Q G;  1K73 C;  1YIJ A;  1X75 C;  3I55 T;  5HY6 A;  2WSE E;  2X4J A;  3SWN B;  5A0D A;  5GAN d;  3L2V A;  3LGF A;  5CKE A;  2EYQ A;  2P0K A;  1M90 U;  4PJO B;  2OTL A;  3HPW A;  4XAX B;  1V29 B;  2RJC A;  1U8R A;  1NJI U;  4C92 D;  4C5H A;  5CKH A;  4DQ2 A;  3JB9 I;  3LWI A;  1KD1 C;  1NPP A;  5J39 A;  3JCM c;  2Y90 A;  2Y4Y A;  4PKC C;  1VQ5 A;  3HRT A;  4BAC A;  3UDC A;  3X24 B;  3VUZ A;  1MGQ A;  1N9S A;  2MF2 A;  2JNG A;  3EFS A;  2BIV A;  4Q5W A;  2GQV A;  1X01 A;  1P92 A;  3H6Z A;  4XQ3 A;  1BIB A;  4JS4 A;  1VQ8 T;  2O4X A;  1YIT T;  3CMA T;  4C92 A;  5CCA A;  3M54 A;  2VXF A;  1B34 A;  1K73 U;  4PJO D;  4M78 C;  3E9F A;  2O01 E;  3DB3 A;  4IUR A;  2EQJ A;  1G3S A;  3CC4 A;  4C92 B;  3CC7 A;  1WQW A;  4NOY A;  4IUT A;  2JUF A;  4C8Q D;  4BDY A;  3ASK A;  4XTY A;  5LJ3 h;  5CKD A;  2DD4 A;  1KQS S;  1YJN T;  1HK9 A;  4CRI A;  2E6N A;  2KVQ G;  3FDR A;  4LD6 A;  1VQO T;  4B9X A;  1YJN A;  4E7L A;  4BI3 A;  5CAI A;  4F7U E;  5D6Y A;  1S72 T;  4QVZ A;  1LNX A;  1W4S A;  2P0P A;  5GMK h;  2FL7 A;  3L42 A;  4X9D A;  1Q82 C;  3CCL A;  4FU6 A;  3GP8 A;  2VGM A;  4QW2 A;  2P4T A;  2M16 A;  3MP6 A;  4FT4 A;  3E1S A;  1JBM A;  4J6W A;  3OYE A;  4M75 C;  2EJF A;  4RCC A;  5FRO A;  3WXM B;  5IT9 E;  4QQD A;  5D6X A;  5FU6 B;  3C12 A;  1W2B A;  3CEY A;  3OS2 A;  4JLI A;  3C95 A;  3M56 A;  4MZM A;  3S3M A;  5GAO r;  1Y96 A;  3QBY A;  2QA4 T;  2EJ9 A;  2V8I A;  1WPY A;  5CK9 A;  2E64 A;  1BI1 A;  3QZ5 B;  4MML A;  5FU6 C;  1IRE B;  3GNF B;  2L5Q A;  3MO8 A;  4O6J A;  5J26 A;  3RKX A;  3FC3 A;  4Y28 E;  1VIF A;  3M57 A;  3V8L A;  1D3B B;  2BUD A;  2DTH A;  2LC4 A;  4C92 E;  3GF5 A;  3A8L B;  3P8D A;  4XTV A;  1K8A C;  4JDS A;  2DXT A;  2E6Z A;  4WF2 A;  4X34 A;  4EDU A;  4M7A C;  4ZTJ A;  3OY9 A;  3FIF A;  3OYK A;  3FB9 A;  4C0Z A;  2K5F A;  5GAN 8;  1ZQ1 A;  1N8R U;  3M58 A;  3CCU T;  2CYZ B;  1VQ9 A;  2A7Y A;  3OYB A;  3V8K A;  3QHS A;  2D6F A;  4PNO A;  5KE3 A;  3RES A;  4BY6 B;  1XOV A;  4L5G A;  3L1A A;  1SSF A;  1WJQ A;  4M77 E;  3M55 A;  3CMA A;  2LT4 A;  3MEW A;  5CQX A;  1OYX A;  2BKD N;  3PMT A;  3OW2 A;  2WSC E;  2C06 A;  2HNI A;  2LNV A;  2DTI A;  3RKW A;  1FXX A;  3OYJ A;  5GAN j;  3G6E T;  1M8V A;  1O9S A;  4C0D B;  3TU4 K;  3PFS A;  3X26 B;  1VQO A;  3Q1J A;  5A2Q E;  3JCM Q;  3HFN A;  4EPC A;  2QEX T;  3ME9 A;  2LTO A;  1KHC A;  4XTX A;  5KH6 A;  3CCR T;  4FSX A;  4BY6 C;  1W2B S;  2JTF A;  5CVI A;  2EFI A;  4R55 A;  3CC4 T;  3QSU A;  3M59 A;  2E65 A;  3BDL A;  4LDY A;  2DIQ A;  4IUP A;  4GY5 A;  3OBW A;  4J7I A;  5LJ3 j;  2ZPE B;  3OBY A;  2DVE A;  3OW2 S;  4RCB A;  3LYI A;  2RI5 A;  5GAO q;  3CC7 T;  3VYG A;  5A0L A;  2DXU A;  5LJ5 g;  1VQM T;  2DEQ A;  2K4Y A;  3OSV A;  4OB3 B;  3L2U A;  3NFC A;  1I8F A;  5I21 A;  5L8R E;  1VQN T;  3FEO A;  2QDY B;  4PJO C;  5GAN 4;  2L89 A;  4O5V A;  1NZ9 A;  4A4H A;  3JCM f;  2QTX A;  2RM4 A;  3M4Y A;  2MMP A;  3EFR A;  3VV0 A;  4HA8 A;  2PU9 B;  1N9R A;  1IZ6 A;  5CKF A;  4C5E A;  4QVC A;  1BIA A;  2DZC A;  5M9O A;  5GAO l;  4F7U B;  1YHQ A;  3OYA A;  3I56 A;  2EQK A;  2V8K A;  4N0A C;  2IG0 A;  4BI4 A;  5KE2 A;  5GAO p;  3S3N A;  4M7D G;  2RD1 A;  3OMG A;  4PLL A;  5HK3 A;  3V7S A;  3QKJ A;  1VQ5 T;  1X6O A;  1RL2 A;  5FRN A;  4X9C A;  1M1K U;  3GOX A;  2A3L A;  2VXE A;  2KDS A;  2H3J A;  4M7D C;  2VC8 A;  5GMK j;  2K5I A;  3CBO A;  2RO0 A;  2PVG B;  3QYH B;  4C8Q A;  4D6W A;  4JJN K;  3CD6 A;  2I2L A;  1KC8 U;  2D9T A;  1RI0 A;  1I4K 1;  2P0Q A;  4C0D C;  5LJ5 f;  2KK4 A;  3LWH A;  2DXC A;  4BE0 A;  1Q86 U;  2RHY A;  1VQL T;  1H3Z A;  2ZPF B;  1OZ3 A;  4M77 C;  1VQ6 A;  3HL8 A;  4J8O A;  1R8O B;  2E12 A;  4OMF B;  2FVU A;  3A8G B;  3OYI A;  3GNG A;  1VQ7 T;  2K3X A;  3OYY A;  4KT0 E;  2LCC A;  3LH0 A;  4C92 G;  4M78 D;  5CR2 A;  5EG2 A;  3C94 A;  3SWN A;  1G3T A;  5KCH A;  3L2Z A;  3QJ6 A;  3HKS A;  4ELZ C;  1KQS A;  3RMQ A;  1WGS A;  1UGQ B;  4MMK A;  5FLX E;  5GAN h;  3JAM E;  3CCQ A;  2ZZD A;  2CZ1 B;  5IN1 A;  4JS5 A;  1K9M C;  4M77 B;  4UC4 A;  4KUL A;  2DD5 A;  2DPP B;  2ZPI B;  1XQH A;  2LDM A;  4MZP A;  4XK8 E;  5HKC A;  2HQE A;  2LQK A;  2RJE A;  3EAE A;  3INZ A;  3UWN A;  4FL6 A;  2YRV A;  3MEU A;  4MDW A;  3MEA A;  2HD0 A;  5HK0 A;  2VV5 A;  4ZGE B;  3S3O A;  5DM7 R;  1VQK T;  2DTO A;  2K3Y A;  3C4S A;  4F7U F;  3DB4 A;  2MWO A;  1XTD A;  2RJF A;  4KBM B;  3MEV A;  4PJO E;  1KHI A;  4HCC A;  2EIF A;  4ZGJ B;  4M7D F;  2EJG A;  1UEB A;  2E70 A;  2XIC A;  2KSS A;  5GAM g;  3TRE A;  4L6V 5;  5GAN 3;  4BD3 A;  4BI8 B;  2GFA A;  2JTM A;  4LDU A;  4M78 E;  4XTW A;  1BYM A;  4M75 D;  3CCE A;  4M7A G;  3L2W A;  3RER A;  3P8H A;  4LDV A;  1TH7 A;  4DOW A;  1D3B A;  2F5T X;  4ZGD B;  1NPR A;  4PL6 A;  1VQM A;  2EWN A;  5I2S A;  1M90 C;  2RA2 A;  3LW5 E;  1VUB A;  4N4I A;  4BB7 A;  3OB9 A;  5LJ3 d;  1Y7X A;  2ZGW A;  3CPF A;  5GMK l;  3CCS T;  1YJ9 T;  1WNL A;  3JCM g;  1YCY A;  3AHU A;  2XG8 D;  2YHT A;  1QP3 A;  3CME T;  2R5A A;  1DJ7 B;  1EIF A;  4E47 A;  3S6W A;  4J7F A;  2FB7 A;  2PVD B;  2LRQ A;  1I81 A;  2KQW A;  2K2V A;  2O4X B;  3M53 A;  3VUB A;  4C0F A;  3JSC A;  1QVF A;  2LT1 A;  4NS5 A;  5GMK e;  3KXT A;  3PGG A;  4KUI A;  5DLO A;  2QA4 A;  1NJI C;  5LL6 S;  3JCM V;  3URG A;  3H8Z A;  1ZHI A;  2GF7 A;  4RG2 A;  2LVM A;  3BDU A;  2CZ7 B;  4M78 A;  2EQM A;  2RI3 A;  4Y91 A;  4IUQ A;  5GAN 7;  3KBG A;  5GAN f;  3TEE A;  3X25 B;  3CCE T;  2QI2 A;  2WSF E;  3G4S A;  4J83 A;  3A5Z B;  1YI2 T;  3MP1 A;  2OTJ T;  3QZ9 B;  2XD0 A;  4QQ6 A;  4HCB A;  4PJO A;  1G5V A;  4E7H A;  1OZ2 A;  1QW1 A;  1VQL A;  1JB0 E;  3MP8 A;  2E1H A;  4M7A B;  1KD1 U;  5LJ5 j;  5GAM d;  5GAM h;  3NTK A;  3V7R A;  2YLB A;  4XU3 A;  1UGP B;  4M7A E;  4M7D B;  2CS7 A;  4M78 G;  2GFU A;  2ZCF B;  4N0A A;  1LOJ A;  2XDP A;  1O75 A;  2F5K A;  4JUV A;  4J6X A;  3V7C A;  4OB1 B;  5LJ3 e;  3I55 A;  3BY7 A;  2PVO B;  3QUI A;  2LX9 A;  4M77 D;  4PJO G;  1M9S A;  4VUB A;  3RMS A;  3UT1 A;  4E7K A;  5GAN 2;  4M7A F;  2EAY A;  1XNI A;  1BI3 A;  3CC2 A;  1Q7Y C;  2RK2 A;  4IUV A;  4C92 F;  5IAY A;  4C0G A;  3JB9 J;  1YIT A;  1YJW A;  3JB9 H;  1BI2 A;  1VQ4 T;  2V8J A;  2QQA A;  5AYF A;  4ZN1 A;  2VGN A;  4E7J A;  4HT8 A;  3CCQ T;  2XDB A;  2ZPH B;  3JCM b;  5FRM A;  1GXI E;  3HHT B;  4IUU A;  4N4G A;  2ZPG B;  5LJ5 d;  5GAM j;  2RHX A;  5LJ5 h;  3HP9 A;  3OYL A;  5GAN g;  3JCM h;  3JB9 D;  3JCM d;  3JCM P;  3P8B B;  1G3W A;  1YJW T;  4XTU A;  3CC2 T;  4MZT A;  2DKG A;  3FJP A;  4RKU E;  2X35 A;  3VJP A;  3E19 A;  4M7A A;  4M7D D;  3V8J A;  4C92 C;  3CME A;  4LD9 K;  2MAM A;  2XKO C;  3DKM A;  2XID A;  3MCA B;  4HKE A;  3CXC A;  2YLC A;  1YBY A;  4FM4 B;  4OP0 A;  1KC8 C;  2OTL T;  1BI0 A;  2AHJ B;  1S72 A;  4V2S A;  1HXD A;  4OB2 B;  1QVP A;  3L2Q A;  3CPW A;  3OS1 A;  5I2M A;  3CD6 T;  1LJO A;  1YIJ T;  5GMK i;  2JVV A;  1KQ1 A;  2PUK B;  3ER0 A;  4LDW A;  1K8A U;  3CCS A;  2XDD A;  3T9N A;  4E7I A;  3ZBD A;  3N5B B;  2E41 A;  4PJO F;  2QEX A;  4JRP A;  1G3Y A;  5J3B A;  1QVG A;  5LJ3 g;  5D6W A;  4EMK B;  3I56 T;  1AHJ B;  1U1T A;  3HFO A;  3J7A F;  4HT9 A;  1VQP A;  2D0Q B;  3OS0 A;  3KUF A;  1JJ2 S;  4M78 F;  3CCU A;  4A54 A;  2MI6 A;  4NL2 A;  1U1S A;  4ATO A;  3PMI A;  3TCJ A;  4M75 A;  3VKI A;  3A8H B;  4EMK C;  2EKO A;  4JRK A;  2RHZ A;  2CKK A;  1JJ2 A;  4KUD K;  2FYK A;  3CCJ T;  4M7D E;  2EQU A;  3JCM W;  4OVA A;  2JZ2 A;  3G71 T;  1B34 B;  1NE8 A;  2LQ8 A;  4II1 A;  3WVD B;  4A4K A;  3NTI A;  4N4H A;  3PIP A;  4B9W A;  3QII A;  4DA4 A;  1KG1 A;  2RJD A;  4PLI A;  3QG1 A;  3LGL A;  4JRI A;  5LJ5 e;  3CCM A;  1UGR B;  3OYH A;  1Q81 U;  5GAO m;  2KMT A;  2MWP A;  2Y4X A;  1N27 A;  4OGC A;  4M77 G;  4TVR A;  2HQX A;  4XU0 A;  4F7U G;  5GAN 6;  2X4X A;  3LX7 A;  3M9Q A;  4M77 F;  3VU3 C;  1VQ7 A;  1PSE A;  4CI0 C;  2KY9 A;  3OYM A;  4XU1 A;  2NLU A;  2OAU A;  2L3R A;  3FLG A;  3PNW C;  3SB2 A;  4BE1 A;  2VYT A;  3JCM e;  2PUO B;  2K57 A;  2JN0 A;  1I5L A;  4ELY C;  2RI2 A;  3ZFJ A;  5CQY A;  5GAN 5;  3OYG A;  3QO3 A;  4M75 B;  2WAC A;  1BKB A;  4EMH A;  4ZN3 A;  2M1H A;  3PTA A;  1Q82 U;  4M7D A;  4C8Q C;  3GIB A;  3A8O B;  2XHC A;  2CZ6 B;  3DLL A;  4F7U A;  4C5I A;  2CGH A;  3CCV T;  1VQ9 T;  1Y07 A;  3BW1 A;  4OGE A;  3ZEH A;  1Q7Y U;  2CZ0 B;  3PT9 A;  4L59 A;  4BDZ A;  2DK3 A;  3OS5 A;  3JB9 F;  3NTH A;  3X20 B;  3G4S T;  4NL3 A;  3HRU A;  5GAO n;  1M1G A;  4EMG A;  1QVG S;  2PQW A;  5DLQ E;  3CCM T;  4JRQ A;  4M78 B;  5KCO A;  1KQ2 A;  5CO7 A;  2RHU A;  3M4G A;  4R56 A;  2QQB A;  4GLK A;  2DO3 A;  2R57 A;  3VYH B;  2DAQ A;  1K9M U;  4RG8 A;  2GCX A;  2R5M A;  2RB6 A;  3OYD A;  1H64 1;  1YHQ T;  5CKB A;  2RHI A;  3CPW S;  3FRN A;  3E9G A;  2JOY A;  2XK0 A;  3L2R A;  3OA6 A;  3CXC S;  3QXE B;  3J80 E;  3JRZ A;  3OYN A;  3CBP A;  3CBM A;  1VQN A;  2LCL A;  4C8Q E;  3HSB A;  3OYC A;  2E5Q A;  1WJS A;  1Y96 B;  5C6S A;  1VQK A;  2F69 A;  2IVW A;  3MET A;  5LJ3 f;  5GMK m;  1M1F A;  3QPH A;  4IKF A;  4M75 G;  3M5A A;  2DXB A;  4M7A D;  4J5Y A;  2DZ9 A;  3JCM J;  1ZBX A;  4LDX A;  2E10 A;  3BFM A;  1Q86 C;  4C8Q F;  2L8D A;  1M1K C;  2X4W A;  4QQG A;  3UPU A;  3OMC A;  4FT2 A;  3LLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...