3UT1A

Crystal structure of the 3-mbt repeat domain of l3mbtl3
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
315
structure length
313
Chain Sequence
AWCWASYLEEEKAVAVPAKLFKEHQSFPYNKNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKSLFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKKMKLEVVDKRNPMFIRVATVADTDDHRVKVHFDGWNNCYDYWIDADSPDIHPVGWCSKTGHPLQPPLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein 3
publication title Crystal structure of the 3-MBT repeat domain of L3MBTL3
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 83
structure length 313
sequence length 315
ec nomenclature
pdb deposition date 2011-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A03
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3ut1A01
4RG2A 2M16A 3ZEHA 3Q1JA 3OYBA 4L59A 3ASKA 2L8DA 3MEWA 4LD6A 3OYIA 3L2UA 5J39A 4Q5WA 4FU6A 1KHCA 1SSFA 2FHDA 2P0KA 5FRMA 1WJQA 2R57A 2R58A 5D6WA 3M9QA 4CRIA 3OYDA 2E5QA 3OQ5A 4C5GA 3OYLA 4E7IA 2LRQA 2YRVA 4IUUA 3O8VA 4EDUA 4Z02A 4A4HA 2RI2A 4BE2A 3GOXA 2RJEA 5C6SA 3OYFA 4BE0A 1WGSA 2JZ2A 3E9FA 5KE2A 3OYHA 2BKDN 3DB3A 3OYMA 5IAYA 3S3MA 3MEUA 3OYJA 3LLRA 3QIIA 3OYCA 3MEVA 4IUQA 2RHUA 4QW2A 4A4EA 4IUTA 4A4GA 4IKFA 3C4SA 3QBYA 5KCHA 5KE3A 3P8DA 1OZ3A 4E7KA 1XNIA 5J26A 2QQRA 3OYNA 4QQ6A 1OZ2A 1WJSA 4BACA 3DLMA 1H3ZA 4PLLA 4NS5A 4E7JA 3QKJA 4BDZA 3S3OA 2G3RA 2JTFA 4IUPA 2MWOA 2RI3A 3UT1A 4QQDA 2EQJA 2RHZA 2K3XA 3NTIA 2LTOA 3DB4A 4QVZA 4QQGA 3OS1A 3FLGA 4E7LA 3OYEA 2HQXA 4A4FA 3OYAA 2QQSA 4PL6A 1RI0A 2LVMA 3LYIA 2LDMA 2EFIA 2LCCA 3H6ZA 3F70A 2RHIA 2L3RA 2RI5A 3QJ6A 2O4XA 3S3NA 4C5EA 5D6XA 3L42A 4N4IA 2RJDA 5M9OA 3BDLA 3E9GA 3MEAA 2X4WA 2RJCA 3L2RA 3MP8A 2IG0A 2K3YA 5IN1A 3S6WA 3OY9A 2GFUA 1OYXA 2WACA 3OMGA 3MP1A 1WJRA 2F5KA 2RHYA 3LGFA 1OI1A 4IURA 4N4GA 3KUFA 3NTHA 4C5IA 3NTKA 4II1A 2EKOA 3PMIA 4HCZA 3FC3A 4BE1A 2DIGA 3L2WA 4B9WA 2X4XA 3OS2A 2E6NA 2RO0A 4PLIA 5D6YA 4C5HA 2R5AA 3PMTA 3FDRA 3LGLA 4GY5A 2VYTA 5KH6A 2CKKA 3MO8A 2MWPA 3P8HA 2D9TA 2L89A 2BUDA 2M0OA 1MHNA 2X4YA 3LX7A 4OVAA 3OMCA 3SD4A 4N4HA 4E7HA 5FROA 4B9XA 2EQUA 3ME9A 1N27A 3PNWC 3OYKA 5CIUA 3EAEA 4FL6A 4UC4A 4X34A 2GFAA 3OS0A 2B8AA 5KCOA 3UWNA 2X35A 3CEYA 4ZTFA 2XDPA 5FRNA 2HQEA 2O4XB 3OA6A 2DAQA 4IUVA 3OYGA 3L2QA 2GF7A 3FEOA 3LH0A 3META 4BD3A 2M1HA 3H8ZA 3PFSA 2BIVA 5C0MA 2R5MA 2NLUA 2RJFA 3L2VA 4ZTJA 1G5VA 4BDYA 3OB9A 2RHXA 2EQMA 2XK0A 2DIQA 2PQWA 3MP6A 2EQKA
chains in the Genus database with same CATH superfamily
1D0ZA 3GNGA 5GAOm 2FZCB 3CPWA 4M7AE 2FHDA 1I81A 4J9FA 2LT4A 3HHTB 1W2BS 3EH2A 3URGA 2R58A 4KBMB 3KXTA 1Q81U 2GNCA 4L6V5 1VQ5A 1FYNA 2LRQA 3I56T 3EH1A 4IUUA 4PJNA 1OPKA 2HAXA 2DLPA 5KE2A 2MIOA 4KGZB 3G6EQ 2F5TX 4A4GA 4M7DA 3THKA 2VGNA 3OBWA 4E7KA 1XNIA 1MMGA 1GL5A 1HJDA 4LUEA 4PLLA 1IZ6A 4RTTA 2QG9B 3UA7A 1YI2Q 1M8VA 2P4RA 2K3XA 4J6WA 3SHWA 4KH0B 3EFRA 1RAHB 2DXBA 2LQKA 4CI0C 3LYIA 2K7AA 1XJWB 1ZLMA 1BB9A 5IHIA 1K8AR 1K0SA 1PSEA 3S3NA 4KT0E 1M1FA 1KQSS 4F7UF 2NYSA 4FSSA 1VQ7Q 1ZSZB 3UDCA 2W10A 3OYYA 1S72Q 4IURA 3INZA 3GF5A 2XDBA 1B7TA 1E6GA 4VUBA 4MZMA 3OS2A 4JUVA 1VIFA 3D7SB 5FU6B 2PU9B 4OMPA 1SSHA 2EQIA 1NZ9A 1Z9QA 1AZGB 2WSFE 1KK7A 4PJOC 3OS0A 1LVKA 1YJ9T 1KSWA 3CC2T 1KC8R 2K6DA 1QCFA 5LJ3g 3RR6A 4F7UA 4XU2A 4LN2A 2BIVA 3RESA 1GRIA 1K8AC 1KD1U 4HT9A 5FW9A 2X4JA 3SWNA 4BI8B 2O88A 2QA4A 1RAAB 1I0CA 2EYXA 2YDLA 1VQ8Q 5KYUB 3CCQQ 4OMNA 1M1KR 3CC4Q 1D0XA 4D8KA 2ZPGB 1O9SA 4EMKA 3OYMA 1SG5A 3JCMP 1Y0MA 3OYJA 4FW1A 3I9QA 1VQLQ 1BI1A 4J7IA 1VQ5T 1WHGA 2RA2A 2LCSA 3U23A 1TUGB 4IUPA 2C0IA 1W2BA 5KYWA 1Q82U 1KC8C 1ARKA 4A4FA 1GCPA 2LDMA 2WSEE 4E47A 3JCMh 3M4YA 2RI5A 3QJ6A 1KQ1A 3HFNA 3JCMb 2OI3A 3I5SA 4CC4B 1K76A 4OMQA 2H3EB 2KBTA 2RJCA 3OW2A 5HK0A 1OYXA 2CP3A 1K9AA 4M77F 4ATOA 3KFVA 3CD6Q 5GAN7 1HYOA 2EKOA 4QT7A 3FC3A 1M1KC 1XOVA 4PLIA 5KH6A 4M7AB 1WYXA 2FRYA 2X4YA 3EG9B 1Y7XA 3BFMA 4M78D 5CVIA 5DY9A 4BI4A 5CIUA 4E2FB 3CBMA 4BB7A 4DBFA 1TUCA 2O4XB 1V76A 3R6NA 2LJ3A 4OF1A 3DKMA 4KUIA 5C0MA 1WHLA 1V29B 2DRMA 2DIQA 2E64A 2QXFA 1GXIE 2AZVA 9ATCB 5GAN5 2DXTA 1AHJB 3HP9A 1AD5A 3VU3C 3PE0A 2DYIA 4K11A 2JNGA 4M7DC 2DPPB 3X28B 1OX8A 5GAN2 4BE0A 1WLPB 1VQOT 4MZTA 1ABQA 3OYHA 2YLBA 1IRXA 2DX1A 2J6OA 1UHCA 3VS2A 2O2OA 2OJ2A 3C4SA 1R8OB 1WI7A 1VIEA 2EIFA 1K4US 2LMJA 3VUBA 3PIOA 4C92D 4Y92A 2RK1A 1NPRA 1YBYA 2DJQA 2RQUA 2P84A 3VJPA 2L3RA 1IXDA 2GQIA 3GP8A 4M75D 1EZZB 1W1FA 3JB9I 2A08A 4RTZA 3UF4A 3QXEB 4C8QD 3L2RA 2QQBA 2XI9A 3OY9A 1K8AU 2VXFA 3HL8A 2A37A 3KUFA 1X43A 2QGGA 4M78E 5KYXB 3PMIA 3RMQA 3A5ZB 1LPLA 5DLQE 2RO0A 2PUKB 3EFSA 4RMOA 3V7RA 2L3QA 4DBRA 2NUTA 1X2QA 2KRMA 1YIJA 2CT4A 4OB3B 1NM7A 1YJ9Q 2B8AA 1PD0A 2CGHA 3CC2Q 3CPFA 2XICA 5FRNA 2EJ9A 1PKTA 2HQEA 5I22A 1I1JA 4PFOA 3LW5E 2DL3A 1VQ7A 2K2MA 1UB4A 2MPXC 1IREB 1KQ2A 1GCQA 1KC8U 2CP2A 4FYVB 3MPUB 2EBPA 1QMCA 2JUFA 2QQ9A 3JB9D 4EMKC 5LJ5g 2MF2A 1G3WA 1LOJA 3OQ5A 2RQVA 4PJJA 3OYLA 3G1JA 5GANe 3HRTA 2DJZA 4M7AG 2DTIA 1KQSP 5HY6A 4C92E 3LWHA 5IHKA 3TSWA 3HRSA 4HCKA 1N5ZA 1EIFA 3LLRA 3PVLA 1M1KU 2FVUA 2Y4XA 4N0AA 5IXBA 5KE3A 2AIRB 1OZ2A 4XU0A 1PM3A 1H3ZA 4HVUA 1PC0A 5GMKl 4M75E 2F69A 3MCAB 1TU0B 2CH4W 1TWBA 2RHZA 3NTIA 4M75A 1I5OB 4C8QE 4PL6A 1WHJA 2DM1A 2KY9A 2M9UA 2I2LA 4C0ZA 5IN1A 1BI0A 2QI2A 2EGCA 1RL2A 2KR3A 2E65A 3JCMd 2A3LA 1YHQA 4HCZA 1BU1A 5LJ3h 4FYYB 3RKYA 1VUBA 1QP3A 2LNVA 2H8HA 4ZN1A 3X25B 3NPFA 2EQUA 4M77C 2FB7A 2KMTA 3ME9A 3CCRA 2YRDA 2XDPA 2ZAEA 2JN0A 1SHFA 2C06A 4AT1B 3HFOA 1RLQC 3JCMW 3H8ZA 5LJ3f 3BE3A 1ZQ1A 2YUQA 3CCJA 1E7OA 3FIFA 3V8KA 4F7UG 3CCEQ 2DRKA 3CBOA 1I4K1 2CP6A 1Q7YR 2DKGA 3ASKA 2KYMA 3ER0A 2JW4A 4XAXB 1KHCA 4XK8E 1VA7A 1NG2A 2HQHA 2O31A 4JJNK 4JPBW 1X6OA 1M3CA 1MV0B 3O8VA 2OTJA 1VQOQ 1KD1R 3GBQA 1AWXA 2D8JA 4EMGA 1ZSZA 5GAOn 4XTYA 1AOJA 4D6WA 4A4EA 5HKCA 3CCLT 3C12A 1N9SA 1YWOA 2K3BA 2DO3A 4QQ6A 1BK2A 1IB8A 4M78B 2ROLA 1HD3A 2XU8A 2L3SA 2MYSA 4ME7A 4LXCA 4PJOE 3DB4A 5AT1B 4HVVA 3A8GB 1FMVA 3M55A 4V2SA 2D0QB 4KULA 4BI3A 2F2VA 3G4SA 4PK4A 1Q7YC 1IHWA 3RNJA 2QEXQ 1DJ7B 2IG0A 2DK3A 1T3LA 5CO7A 1Y57A 3V8JA 3NTHA 2CH4A 5KYNA 2BZ8A 2LJ0A 4LUDA 1UGPB 3PMTA 4RCBA 2MI6A 5KYUA 1VQ4T 2MCNA 5GMKi 1JEGA 2CYZB 4B6MA 1YJWA 2KXCA 1GCQC 2AT1B 1TSFA 1KHIA 2LCLA 4OMLA 4C92B 1PD1A 2K57A 2I0NA 5GAMj 2RD1A 5I21A 1WXBA 4RUGA 2COYA 1SF9A 1G2BA 3CCRT 1PKSA 4M7AF 3OYIA 3ZL7C 2CUDA 3RDVA 1OQKA 1SSFA 2CDTA 3M0TA 1ABOA 2DERA 3FJ5A 4C8QB 4N0AC 1CKAA 1RADB 1YNZA 4EDUA 5HCKA 3MHXA 3I55Q 1UG1A 2PVOB 3VRYA 2FPEA 4OMFB 2IIMA 1UGVA 1YITA 2DL4A 1TUDA 3SDZA 1X75C 3RMSA 1MUZA 1D1CA 5FU7B 1KJWA 1ZX6A 3OYNA 1EX4A 2OTJT 3DLMA 4ZNXA 3EHRA 1G8XA 4NS5A 2OTLA 2HBPA 4M7AA 3NHNA 1RAFB 2FZKB 1X69A 1G3TA 1NYGA 2XMFA 3EG9A 2EKHA 1UHFA 3GLXA 3M54A 4QKUA 4O6JA 1IGUA 2RMOA 2HSEB 2VWFA 2O4XA 3O5ZA 1AT1B 5M9OA 1UDLA 1VQPA 5LJ5j 2FZGB 1OULA 4OMOA 3MP1A 4AFQC 4PJLA 1E6HA 3PIPA 1OI1A 2JVVA 2DMOA 3A8LB 3JV3A 4J5YA 3G4ST 3CC7A 3QG1A 2YUNA 3C0CA 4XTZA 4LD9K 1ZUUA 2VVKA 4DBHA 2CKKA 3A8OB 3OBYA 4M78G 2HL5C 2HNIA 2VASA 1B34B 3LH5A 2HEQA 1QCNA 1Z9ZA 3UWNA 5LJ5h 3CCMT 5GMKj 1O75A 5LJ3d 3AT1B 2H3JA 1B07A 1VQ9Q 2ENMA 2RH2A 1QWEA 1VQ6A 2AK5A 2KAFA 4HA8A 1OOTA 2GCXA 1I8FA 1UJYA 1V1CA 4FYXB 2NWMA 5GJWB 2L8DA 1VQKA 1UGSB 4IIMA 1WHHA 2V8KA 5CQXA 1BKBA 1ZSZC 1JRIA 2VV5A 2J06A 2P0KA 2KE9A 4PJOB 2DEQA 1ZA2B 1Q7YU 4WF2A 1RAGB 4JDSA 3CMAT 4Z02A 2RI2A 5GAN4 2RJEA 1GFDA 4R0KA 2RN8A 4AFZC 3CCST 3QJYA 3CCLQ 3CCVA 1MMDA 3KBGA 1CKBA 5KYXA 3ZFJA 2YRCA 4CC7A 5CQYA 3VRZA 2KRSA 4IIOA 1JQQA 2RI3A 3GIBA 1M30A 4FW2A 2A36A 3TVTA 1MNEA 4DQ2A 1X01A 4QQGA 2QAZA 5A0GA 1QVFP 1WQWA 2EAYA 3R6OA 1CSKA 2OTLT 2RHIA 4M75G 3M4GA 3BY7A 4M77D 3MEAA 2NUZA 4JLIA 4DOWA 1AWOA 4NL2A 1QWFA 1VQNQ 2O01E 3CCUQ 1AZEA 2RF0A 1WJRA 2FRWA 3G71Q 2YUPA 1VQMA 5GANg 3NTKA 4II1A 1VQPT 3BDUA 4LE9A 2D6FA 3FDRA 3LWIA 1VQ4Q 1ACMB 1PSFA 2L89A 4C0FA 2HMAA 1H92A 3TU4K 1D3BB 2DILA 3PNWC 3CC7T 1QVGS 3QWXX 3RKWA 3J80E 4KUDK 4E7SA 3OYGA 4Y91A 3FEOA 3PFSA 2YHTA 3JCMf 3VYHB 3QZ5B 2JM8A 3JSCA 2EYYA 3TQ7P 3MEWA 1K73R 1OX9A 1UGQB 4CRIA 2DF6A 4CC3A 1KQSA 2GQVA 1VQKT 2V8JA 4MMKA 3EGXB 4M7AC 2BKDN 1FX7A 1PRMC 3QIIA 4JJBA 3CMEA 2COZA 4PNOA 4X9DA 1M1GA 1PNJA 4XU3A 2G3RA 2QTXA 1WXUA 2DL8A 4AG1C 4M77E 3I56Q 2DA9A 4DA4A 3CCVT 3EHQA 1M5Q1 2LC4A 1ZBJA 3QSUA 2LQWA 4JRKA 1YJNA 4MDWA 2LCCA 2RQWA 2QA4T 2YXYA 2DTHA 2C0OA 1M3BA 2DBKA 3G7ZA 1PG5B 4ELZC 2DXCA 1K73C 1IO6A 2K9GA 1UTIA 2LP5A 2CZ7B 3QDRB 3LGFA 4PFZA 2PNIA 4M78F 3EG0A 1SPKA 3IQLA 4B9WA 5GAMg 4J9GA 5D6YA 7AT1B 1MGQA 4HXJA 2D8HA 4GY5A 1U1TA 5FWCA 4AMCA 2EVRA 1G3YA 3VV0A 2ZPFB 2MMPA 4C0GA 3PVQA 3CCMQ 2MOXA 3G6EA 2DETA 3M0UA 1R0CB 2GF7A 5CKBA 2R5MA 4EMHA 4M78A 2EQMA 4WCIA 1YI2A 2EQKA 3DLLA 4O5VA 2M16A 4J7FA 5CAIA 2HD0A 5LJ5d 2K5IA 5CK9A 3GPLA 2L5QA 2IPOB 8ATCB 5FRMA 2B86A 5LJ3e 1YN8A 4FYWB 4ORZA 2DZCA 3EGDB 2YRVA 1FMKA 2L3PA 3SWNC 1UEBA 1WHMA 1QVGA 1C6VX 3GOXA 1MV3A 1WHKA 2BE7D 2JM9A 3CCSQ 1S72A 4LDUA 2EYQA 3MEVA 2RHUA 2FEIA 1ZSGA 3P8DA 1BCOA 1OZ3A 2DL5A 2DVJA 4M75F 3NMZC 4E7JA 2E3IA 3EFOB 1PRLC 2F2WA 4QQDA 4C8QF 3FLGA 2HQXA 2CP0A 1WXTA 3F70A 3L2ZA 4C92A 1VQ5Q 5D6XA 2RJDA 2Z0WA 1FXXA 1Q86R 1GBRA 2M51A 4ZN3A 5GAN8 2QGFB 1QKWA 2YLCA 4A63B 2AKKA 2NUPB 2R5AA 3M0QA 3VS7A 1VQ8A 5LL6S 3LGLA 3CCQA 2CT3A 4C8QA 2A28A 1ZBXA 1D1AA 3CC4A 3GNFB 2M0OA 1X27A 2KVQG 5FROA 4PJOD 3JAME 1KFZA 1VQLA 2OAWA 4ZTFA 3M59A 3JB9F 4AFUC 8AT1B 2JTMA 3REAB 3OB9A 4LDVA 3RBBB 2E5KA 1Y07A 4RG2A 2E4HA 3EG1A 4J9BA 1QLYA 4FIBA 1QVFS 3M53A 4Y28E 4M77B 2DD4A 2MAMA 2V26A 2PZ1A 1X6BA 5D6WA 1Q86C 1S1NA 3C94A 3OYDA 1K73U 4ELYC 2BZYA 1YCSB 5GANj 2JS0A 2D1XA 5C6SA 2HCKA 1OV3A 4D8DA 1YIJT 1WZOA 1PWTA 3QO3A 3CD6A 1VYTA 4IUTA 4IKFA 3C95A 3QBYA 1MMAA 2FO0A 3OSVA 4KGXB 1U3OA 1VQ7T 2W0ZA 1BI3A 1EFNA 4RTUA 4BY6B 4PKCC 2E3HA 1WPYA 2E1HA 1M9SA 2LVMA 4J9CA 1B34A 2DBMA 4C0DC 5GANh 3CPWS 2QA4Q 1QVGP 3V7SA 3WXMB 1F1BB 1YWPA 4A54A 1SRLA 2K5LA 1JJ2S 2ZZDA 2V8IA 1MMNA 3ULRB 4QVCA 1SEMA 2J6FA 4BE1A 3E19A 3L2WA 4QVDA 1Y96B 4PJOA 3A1PA 3QDFA 1JU5C 1U5SA 2K79A 3H41A 1HK9A 4MDXA 1BIAA 4OB0B 4PFPA 3JRZA 4M78C 2PTKA 1G5VA 1MNDA 4RKUE 4FT4A 2DL7A 1VQ8T 3HPWA 4JS4A 2ESWA 4XTXA 3CCQT 4RG8A 2CP7A 3L2QA 3V7CA 5GAOq 4BDYA 1VQLT 2JS2A 3ZEHA 3OYBA 1VOMA 4FU6A 4J83A 1M2OA 2P4TA 2KT1A 1P92A 3OS5A 1YHQT 4FM4B 4M7DD 2X3WD 2SRCA 1G3SA 5IT9E 4ZGDB 4XTVA 2CREA 1G83A 4OB1B 3QUIA 4XTWA 3QHSA 3S3MA 1NLPC 4IUQA 2VKNA 5KYYB 2JOYA 2GBQA 2OX7A 1LJOA 1QCOA 1VYVA 1RLPC 3S3OA 4JLGA 1YFNA 1AVZC 3CCJT 2O9SA 2QASA 2EW3A 1QVFA 2HL3A 3CD6T 4E7LA 2KNBB 3OYEA 3VS4A 1D3BA 3OYAA 5GMKm 1NEBA 2CZ6B 1YJ9A 3VS6A 4CC2A 3CC2A 1FMWA 1JBMA 2ED1A 4F16A 1IGQA 5GAMh 2LJ1A 4M75C 1B3QA 2KK4A 2ED0A 1M2VB 2V1RA 4C8QC 2WSCE 4FSXA 4OP0A 2X3XD 1UGRB 2GTOA 1NBEB 2ZPBB 4MMLA 1Q86U 4P5NA 2E6NA 3M0SA 3A8HB 1OEBA 5FU7C 5GAMf 3SEMA 3P8HA 1HSQA 1W4SA 4XTUA 3ZBDA 1NJIR 2XG8D 4AFSC 4E7HA 3EGXA 3QYGB 4EIKA 2LQNA 4J8OA 3V8LA 1M8MA 3H0IA 1SKUB 1K0XA 1JJ2A 2COWA 3H0HA 5EC7A 3M56A 4ZTJA 1BIBA 3JCMV 4M7DE 1UFFA 2E12A 2XK0A 5J3BA 3OW2S 4NL3A 2JMCA 3SB2A 2LQ8A 4L59A 3QPHA 4LD6A 4J9DA 4ZGJB 4J6YA 2J7IA 2XD0A 2VC8A 2QQAA 3M0RA 3VS3A 3J81E 1N9RA 1WJQA 2SEMA 2CZ0B 2BTTA 2VB6A 3H0FA 3JCMe 4DEXA 4ESRA 4A4HA 5CKFA 3VUZA 2HKNA 2K2VA 3OYFA 2MK5A 3M58A 1YIJQ 1YJWT 4F17A 3PGGA 4X1VA 5CR2A 3H9NA 3VS5A 5DLOA 2O9VA 1WJSA 4BACA 1NJIC 3VYGA 2LT1A 1YP5A 1D0YA 3SFMA 5LJ5f 2KXDA 4RTWA 1RAIB 4R55A 4FCYA 1WDXA 2QQSA 5GMKh 1RI0A 5FU6C 3MKDA 4C5EA 2HSPA 2EPDA 1T3SA 4N4IA 4F14A 2KT8A 2LZ6B 2X4WA 1R0BG 2AHJB 4C92G 2EGEA 4JJCA 2JT4A 4M4ZA 2GFUA 3OMGA 4F7UE 3CCEA 4JRIA 1YITT 2DD5A 4J9EA 1KG1A 2AZSA 5GANd 4C5IA 1QVPA 1Q95G 4Z8AA 5DM7R 1UUEA 2EGAA 2CSIA 4KH1B 4DEYA 1WIEA 2RQTA 3EGDA 3MO8A 3LX7A 1VQOA 3OMCA 1VYUA 4N4HA 1HXDA 4C8QG 2ATCB 1H8KA 4X34A 1W6XA 3FJPA 3JCMJ 2BZXA 5A0LA 4BD3A 2FPDA 3FRNA 2GTJA 4LDXA 3EFOA 2VGMA 1A0NB 2P0PA 1WFWA 2PVDB 4OMMA 1N8RR 2CSQA 4HCCA 1R77A 4F04B 1PCXA 4KGVB 5GAN3 1T0HA 1YHQQ 2RNAA 2KQWA 1K1ZA 3CPWP 2R57A 3OSSC 2RM4A 5GAOp 4GLKA 1UE9A 2QEXA 1D09B 2HBWA 3X26B 5CCAA 4BE2A 5I11A 4JRQA 1JJ2P 2A7YA 4HT8A 2K4YA 1RAEB 3M0PA 3DB3A 3CCRQ 3OYCA 3E2UA 3JB9G 3L1AA 1J3TA 1TOVA 1VQ6T 1RI9A 1N6AA 2NUPA 2Y90A 2JTEA 3CCJQ 1BCMA 1XTDA 3CQTA 1FWZA 1I07A 4QVZA 4A53A 2LX9A 5L23A 3FB9A 1GBQA 1QKXA 3TREA 1N8RC 1T0JA 2VXEA 2OTJQ 4J9IA 5CKHA 3MP8A 3BW1A 3S6WA 2DZ9A 1TG0A 3HKSA 6AT1B 4N4GA 2CS7A 4M7DB 1LNXA 2DIGA 5GAMd 2X4XA 4M77A 4C5HA 4E6RA 3JCMc 2VYTA 1Y71A 1U8RA 3EG3A 3CCET 2E10A 2Y4YA 4LNPA 3I55A 4PJOG 3TSZA 5ECAA 2RK2A 1K9MR 4FL6A 4UC4A 5I2MA 2KYBA 5KCOA 4MZPA 4BUGA 1AWWA 5IHNA 1NJIU 3OA6A 4EPCA 1ZUYA 3G4SQ 2M1HA 3I5RA 2NLUA 1X6GA 2DVEA 1BI2A 1NPPA 1C0MA 2E6ZA 3NFCA 5IH2A 3L2UA 1VQMT 3E1SA 3RKXA 1OU9A 2EWNA 3CXCS 4NOYA 3M9QA 1KIKA 1OU8A 4C5GA 4WTOB 1M90R 4ANJA 3X24B 1M4ZA 2E70A 1YJWQ 5IAYA 3MEUA 1D1BA 4QW2A 1ZHIA 4F7UB 5J26A 1WQ7A 2QQRA 4R56A 2QEXT 4E7ZA 2XIDA 2FPFA 1Y96A 4BDZA 4JZ3A 1M27C 1NLOC 2MWOA 2V1QA 4X9CA 1K9MC 1H641 3X20B 3CMAQ 2DXUA 2OAUA 4XQ3A 3SWNB 4C92F 2M02A 1W2BP 2HDAA 4RTYA 2C0TA 2EJGA 2X9HA 2DTOA 2IVWA 3AHUA 2XHCA 3A8MB 1VQ9A 3BDLA 1NEGA 2ZPEB 2J05A 5D7UA 3A98A 4EMKB 3JCMQ 1BYMA 1AEYA 3NGPA 4JRPA 3OW2P 1YITQ 3QZ9B 4J9HA 3WVDB 2YSQA 1M90C 3CMET 2M0YA 1JXOA 2OTLQ 4OGCA 4YTLA 1I5LA 2ROTA 4RCCA 2MWPA 4OVAA 3CBPA 5KYWB 2ABLA 1TH7A 1SHGA 2GFAA 3CCLA 3CEYA 2CZ1B 1YJNT 5KYYA 2DE0X 4Z88A 1C1AA 4IUVA 5L8RE 3I55T 2CUBA 2JXBA 1VQPQ 2RB6A 3L2VA 4GBQA 2RJFA 4OB2B 2QYZA 2F1LA 2QTVA 5CKDA 1Q81R 3HSBA 2PUOB 3TCJA 2XDDA 5J39A 5EG2A 3QWYA 2EYWA 2KSSA 2JMAA 3CC7Q 4M7DG 3PTAA 2A0FB 1N8RU 2KGTA 3QYHB 4E7IA 5LJ3j 1LCKA 4HKEA 3EG2A 3WVEB 1M2VA 3I35A 1WGSA 5GAOl 2JZ2A 1VQNA 3E9FA 3CCUA 1QW1A 1W70A 2KDSA 4TVRA 2ZCFB 3G71A 4HCBA 2YT6A 4RTVA 3G6ET 4DBQA 1VQ6Q 4OGEA 1IHVA 1VQ4A 2JTFA 1OPLA 4J6XA 2D0NA 4Z89A 3CXCA 1YI2T 3N5BB 3OS1A 3MJXA 1VQKQ 1QP2A 2EFIA 2DFUA 1WX6A 3H6ZA 1UJ0A 2HZYA 2GGRA 2HKQB 2ZGWA 3RUXA 3T9NA 3L42A 2L0AA 1Q81C 2LX7A 2E41A 4XU1A 4JZ4A 1PHTA 2WACA 2X51A 1JO8A 2F5KA 2RHYA 4PJOF 1S72T 1QQJA 3JB9H 1VQ9T 3CCVQ 1SRMA 2P0QA 3JCMg 3HRUA 4C0DB 2EJFA 1U06A 2RPNA 2BUDA 2KROA 1H3HA 2DYBA 2L2PA 3UPUA 4B9XA 4A4KA 1N27A 4BY6C 2K5FA 2KI7A 3UA6A 4JS5A 1ZUKA 2DAQA 5GAMe 3LH0A 3META 1K9MU 5GANf 1NYFA 2PQWA 5A2QE 3VKIA 3I56A 2ZPHB 1YCYA 3Q1JA 1JB0E 2KRNA 4Q5WA 1VQMQ 3REBB 5FWBA 5HK3A 2J6KA 2G6FX 2AKLA 4DOVA 2E5QA 2NUTB 2QDLA 2XKOC 3CC4T 2CP5A 4M7AD 3RIRA 2LNHB 5AYFA 1M3AA 3M57A 2F2XA 5GAN6 1M90U 2ZPIB 2FYKA 3VS1A 5KCHA 2QK0A 3P8BB 3VS0A 2QDYB 1RABB 2FL7A 5FLXE 1Q82R 1TXQA 2DEUA 2RQRA 3QKJA 5CKEA 2EYZA 1VQNT 1WNLA 3CCUT 1RACB 4JJDA 3PT9A 3UT1A 4KRTA 4L5GA 2EQJA 3G71T 5A0DA 2LTOA 2KEAA 4ZGEB 1X2KA 4GLMA 1TS9A 4FT2A 2PVGB 1KD1C 5IXFA 3HTRA 3CCMA 1U1SA 2BE9B 3UATA 1NE8A 4LDWA 5LJ5e 1BBZA 3E9GA 2K3YA 3JCMX 1RUWA 5GJVB 4RTXA 4C92C 3EGUA 1TTHB 4LDYA 1XQHA 1GFCA 1ZA1B 5I2SA 3CMEQ 3M5AA 2FG0A 3CXCP 3RERA 3CMAA 2D9TA 1MHNA 4M77G 3SD4A 4M75B 1JXMA 1WA7A 3CCSA 3OYKA 3EAEA 1Q82C 2X35A 5GMKe 4AG2C 1YJNQ 1AWJA 1UECA 2YUOA 3J7AF 3JB9J 4PJMA 3TEEA 4M7DF 2DNUA 4HVWA 2VUBA 2YWWA 2ECZA 2RHXA 5GAOr 2JJ9A 3MP6A
chains in the Genus database with same CATH topology
3CBOA 2PVDB 1I4K1 3DLLA 4O5VA 2M16A 2DKGA 3ASKA 4J7FA 3GNGA 5CAIA 5GAOm 4HCCA 3ER0A 4XAXB 2HD0A 5LJ5d 2K5IA 4M7AE 1KHCA 3CPWA 5GAN3 4XK8E 5CK9A 2FHDA 2L5QA 1I81A 3GPLA 2KQWA 2LT4A 3HHTB 1W2BS 5FRMA 3URGA 4JJNK 2R57A 2R58A 4KBMB 3KXTA 1Q81U 3OSSC 5LJ3e 2RM4A 4L6V5 1VQ5A 1X6OA 2DZCA 2LRQA 3I56T 5GAOp 2YRVA 4GLKA 4IUUA 3O8VA 3SWNC 2QEXA 1UEBA 2HAXA 2OTJA 1QVGA 3X26B 5CCAA 4BE2A 3GOXA 4JRQA 4HT8A 2A7YA 2K4YA 5KE2A 4EMGA 3DB3A 5GAOn 1S72A 4LDUA 4XTYA 2EYQA 4D6WA 3OYCA 3MEVA 2RHUA 2F5TX 4A4EA 4A4GA 5HKCA 3CCLT 4M7DA 2VGNA 3P8DA 3C12A 1N9SA 1OZ3A 3OBWA 4E7KA 3JB9G 1XNIA 3L1AA 2DO3A 4QQ6A 4PLLA 1VQ6T 1N6AA 1IZ6A 4M75F 2Y90A 4E7JA 4M78B 1XTDA 2XU8A 4QQDA 1FWZA 1M8VA 4ME7A 4C8QF 2K3XA 4J6WA 4QVZA 3DB4A 4PJOE 4A53A 3FLGA 2HQXA 3EFRA 2LX9A 2DXBA 2LQKA 4CI0C 3FB9A 3LYIA 3F70A 3A8GB 3M55A 4V2SA 2D0QB 1PSEA 4KULA 4BI3A 3L2ZA 4C92A 3S3NA 5D6XA 4KT0E 3G4SA 2RJDA 3TREA 1N8RC 1M1FA 1Q7YC 2VXEA 1KQSS 1DJ7B 1FXXA 5CKHA 4F7UF 3MP8A 2IG0A 3BW1A 2DK3A 3S6WA 2DZ9A 3UDCA 4ZN3A 3OYYA 5GAN8 5CO7A 3HKSA 4IURA 4N4GA 3INZA 3V8JA 2CS7A 3GF5A 2XDBA 3NTHA 4M7DB 2YLCA 4VUBA 1LNXA 2DIGA 5GAMd 2X4XA 4MZMA 3OS2A 4JUVA 4M77A 4C5HA 1VIFA 3JCMc 1VQ8A 1UGPB 2R5AA 3PMTA 4RCBA 2MI6A 5FU6B 3LGLA 5LL6S 2VYTA 3CCQA 1Y71A 2PU9B 4C8QA 1VQ4T 1U8RA 3CCET 1ZBXA 2E10A 5GMKi 2Y4YA 3CC4A 3GNFB 3I55A 2M0OA 1NZ9A 4PJOG 2CYZB 1YJWA 2KVQG 5FROA 4PJOD 2RK2A 2WSFE 3JAME 4PJOC 4FL6A 4UC4A 3OS0A 5I2MA 1VQLA 5KCOA 4MZPA 4ZTFA 1YJ9T 3M59A 4BUGA 3CC2T 3JB9F 1KHIA 2LCLA 4C92B 5LJ3g 3OA6A 1NJIU 4EPCA 4F7UA 4XU2A 2JTMA 2K57A 2M1HA 5GAMj 2BIVA 2RD1A 2NLUA 5I21A 3RESA 3OB9A 4LDVA 2DVEA 1BI2A 3CCRT 1Y07A 1NPPA 4RG2A 2E6ZA 4M7AF 3NFCA 3OYIA 1K8AC 1KD1U 3L2UA 4HT9A 4FIBA 2X4JA 3SWNA 1SSFA 3E1SA 3RKXA 4BI8B 1VQMT 1QVFS 2EWNA 3CXCS 2QA4A 3M53A 4Y28E 4M77B 4NOYA 2DD4A 2MAMA 5D6WA 3M9QA 1Q86C 3C94A 3OYDA 4C8QB 4C5GA 4N0AC 1K73U 4ELYC 4EDUA 5GANj 3MHXA 3X24B 2PVOB 1M4ZA 2ZPGB 4OMFB 5C6SA 2E70A 1O9SA 4EMKA 1YITA 3OYMA 3JCMP 3SDZA 5IAYA 1YIJT 3MEUA 3OYJA 1X75C 1BI1A 3RMSA 4QW2A 3QO3A 3CD6A 4J7IA 4IUTA 5FU7B 1VQ5T 3C95A 3QBYA 4IKFA 1ZHIA 2RA2A 4F7UB 5J26A 1WQ7A 2QQRA 4R56A 3OYNA 3OSVA 3DLMA 2QEXT 2OTJT 2XIDA 1Y96A 4NS5A 1VQ7T 2OTLA 4BDZA 2HBPA 4IUPA 4M7AA 1BI3A 2MWOA 4X9CA 4BY6B 1K9MC 4PKCC 1H641 1G3TA 3X20B 1WPYA 2E1HA 1W2BA 1Q82U 2DXUA 1KC8C 2OAUA 4A4FA 3GLXA 4XQ3A 3SWNB 3M54A 4C92F 1M9SA 2LVMA 1B34A 5GANh 4C0DC 4O6JA 3CPWS 2LDMA 2WSEE 2EJGA 3JCMh 2DTOA 2IVWA 4E47A 3AHUA 2XHCA 3M4YA 2RI5A 3QJ6A 1KQ1A 3A8MB 3HFNA 3V7SA 3WXMB 2O4XA 3JCMb 1VQ9A 5M9OA 3BDLA 4A54A 1VQPA 5LJ5j 2ZPEB 2K5LA 2RJCA 3OW2A 1JJ2S 4EMKB 3JCMQ 5HK0A 1BYMA 2ZZDA 1OYXA 2V8IA 4JRPA 3MP1A 3QZ9B 4M77F 4QVCA 3PIPA 1OI1A 2JVVA 3WVDB 4ATOA 3A8LB 5GAN7 4J5YA 2EKOA 3G4ST 1M90C 3FC3A 3CMET 4BE1A 3E19A 1M1KC 1XOVA 3L2WA 3CC7A 3QG1A 4PLIA 4QVDA 1Y96B 4PJOA 4XTZA 4LD9K 4OGCA 4YTLA 4M7AB 5KH6A 2CKKA 3A8OB 1I5LA 3OBYA 4RCCA 2MWPA 2X4YA 4M78G 4OVAA 3CBPA 1HK9A 1Y7XA 3BFMA 4M78D 4MDXA 1TH7A 1BIAA 2HNIA 4OB0B 3JRZA 5CVIA 4M78C 5DY9A 1G5VA 1B34B 4RKUE 5CIUA 4BI4A 3CBMA 4BB7A 2GFAA 4FT4A 3UWNA 5LJ5h 3CCLA 3CEYA 3HPWA 1VQ8T 2CZ1B 4JS4A 3CCMT 5GMKj 1YJNT 4XTXA 1O75A 3CCQT 5LJ3d 2H3JA 2O4XB 4RG8A 2RH2A 4IUVA 5L8RE 3I55T 3L2QA 3V7CA 1VQ6A 4OF1A 3DKMA 2KAFA 4HA8A 2RB6A 4KUIA 5C0MA 2RJFA 5GAOq 4OB2B 3L2VA 2GCXA 4BDYA 1I8FA 1V29B 2DIQA 1VQLT 2E64A 2QXFA 5CKDA 1GXIE 5GAN5 3ZEHA 2DXTA 3OYBA 3HSBA 2PUOB 2L8DA 3TCJA 1AHJB 1UGSB 2XDDA 1VQKA 5J39A 3HP9A 2V8KA 4FU6A 5CQXA 4J83A 5EG2A 2P4TA 1BKBA 1P92A 2KSSA 1JRIA 2VV5A 3OS5A 2P0KA 4FM4B 3VU3C 3PTAA 1YHQT 4M7DG 4PJOB 2DEQA 4M7DD 2JNGA 1N8RU 1Q7YU 4M7DC 3QYHB 4WF2A 5LJ3j 4HKEA 4E7IA 1G3SA 2DPPB 3X28B 4JDSA 5IT9E 4ZGDB 4XTVA 3CMAT 5GAN2 4Z02A 2RI2A 4OB1B 3WVEB 5GAN4 4BE0A 2RJEA 3QUIA 1VQOT 4MZTA 1WGSA 4XTWA 5GAOl 2JZ2A 1VQNA 3E9FA 3QHSA 1QW1A 2YLBA 3OYHA 2KDSA 3CCUA 4TVRA 2ZCFB 3CCST 3S3MA 3QJYA 3G71A 4HCBA 4IUQA 3G6ET 3C4SA 3CCVA 1R8OB 2JOYA 1VIEA 3KBGA 3ZFJA 2EIFA 1LJOA 4OGEA 5CQYA 3VUBA 1VQ4A 3PIOA 4C92D 3S3OA 2JTFA 4JLGA 2RI3A 3GIBA 3CCJT 4J6XA 1QVFA 3CXCA 2RK1A 4DQ2A 3N5BB 3OS1A 1NPRA 1X01A 1YBYA 4QQGA 4E7LA 3CD6T 5A0GA 3OYEA 1QP2A 3OYAA 1D3BA 1WQWA 5GMKm 2EAYA 2CZ6B 1YJ9A 3R6OA 3CC2A 2EFIA 3H6ZA 2OTLT 3VJPA 1JBMA 2L3RA 2RHIA 4M75G 5GAMh 3M4GA 3GP8A 4M75D 2ZGWA 3RUXA 3BY7A 4M75C 3T9NA 3L42A 4M77D 1Q81C 2KK4A 3MEAA 3JB9I 4JLIA 2E41A 3QXEB 4C8QD 4DOWA 3L2RA 4XU1A 2QQBA 4NL2A 4C8QC 2XI9A 3OY9A 1K8AU 2VXFA 2WACA 2O01E 3HL8A 1WJRA 2F5KA 2RHYA 2WSCE 4FSXA 4OP0A 1UGRB 4PJOF 3KUFA 1S72T 1VQMA 3JB9H 1VQ9T 5GANg 4M78E 3NTKA 4II1A 2P0QA 2ZPBB 3PMIA 4MMLA 3JCMg 3HRUA 3RMQA 3A5ZB 1VQPT 1Q86U 4P5NA 3BDUA 5DLQE 2E6NA 2PUKB 2RO0A 3EFSA 2D6FA 3A8HB 4C0DB 3FDRA 4RMOA 2EJFA 3LWIA 3V7RA 5FU7C 5GAMf 1VQNT 3P8HA 1W4SA 4XTUA 1PSFA 2L89A 2BUDA 3ZBDA 4C0FA 2XG8D 3TU4K 4E7HA 3UPUA 1D3BB 4B9XA 3QYGB 1YIJA 4A4KA 1N27A 3PNWC 3CC7T 4J8OA 4OB3B 4BY6C 3V8LA 2B8AA 2K5FA 1QVGS 2CGHA 3RKWA 3J80E 3CPFA 2XICA 5FRNA 2EJ9A 4JS5A 2HQEA 4KUDK 1JJ2A 2DAQA 3OYGA 3LW5E 4Y91A 3FEOA 3LH0A 5GAMe 3META 3PFSA 1VQ7A 1YI2T 3M56A 1K9MU 1UB4A 4ZTJA 2YHTA 1BIBA 1IREB 3JCMV 4M7DE 5GANf 2E12A 1KQ2A 2XK0A 5J3BA 3JCMf 3VYHB 2PQWA 5A2QE 3QZ5B 4NL3A 3OW2S 3JSCA 3VKIA 3I56A 2ZPHB 2LQ8A 3SB2A 1KC8U 1YCYA 3Q1JA 4L59A 2JUFA 2QQ9A 1JB0E 3MEWA 3QPHA 4LD6A 4Q5WA 4ZGJB 4F7UG 3JB9D 4EMKC 4J6YA 5LJ5g 2MF2A 5HK3A 2XD0A 2VC8A 2QQAA 1UGQB 3J81E 1N9RA 1WJQA 2CZ0B 4CRIA 4DOVA 1G3WA 2E5QA 1LOJA 3OQ5A 3OYLA 5GANe 1KQSA 3HRTA 3JCMe 2GQVA 1VQKT 2XKOC 2V8JA 2DJZA 4A4HA 3CC4T 4M7AG 2DTIA 4MMKA 5CKFA 3VUZA 2K2VA 3OYFA 3RIRA 4M7AD 5HY6A 4C92E 3LWHA 3M58A 1YI2A 4M7AC 1YJWT 3PGGA 2BKDN 3HRSA 5AYFA 5CR2A 3M57A 1EIFA 1FX7A 3LLRA 3QIIA 5GAN6 1M90U 1M1KU 2ZPIB 2FYKA 5DLOA 2FVUA 5KCHA 3CMEA 2Y4XA 4N0AA 3P8BB 5KE3A 4PNOA 4X9DA 2QDYB 1M1GA 1OZ2A 2FL7A 4XU0A 1WJSA 4XU3A 5FLXE 4BACA 1H3ZA 1NJIC 3VYGA 3QKJA 5CKEA 5GMKl 2LT1A 1WNLA 2G3RA 3CCUT 3SFMA 5LJ5f 4M75E 3PT9A 2QTXA 3UT1A 2F69A 3MCAB 4L5GA 2EQJA 3G71T 4M77E 4R55A 2RHZA 3NTIA 5A0DA 2LTOA 4DA4A 4M75A 4ZGEB 3CCVT 1M5Q1 4C8QE 2LC4A 2QQSA 4PL6A 5GMKh 1RI0A 4FT2A 2PVGB 1KD1C 5FU6C 3QSUA 3CCMA 4JRKA 1U1SA 4MDWA 1YJNA 2LCCA 2QA4T 2KY9A 1NE8A 2DTHA 2M9UA 4C5EA 3G7ZA 4LDWA 2I2LA 4N4IA 5LJ5e 3E9GA 4ELZC 2DXCA 1K73C 4C0ZA 2X4WA 2AHJB 4C92G 2K3YA 5IN1A 4F7UE 2GFUA 3OMGA 3JCMX 1BI0A 2CZ7B 2QI2A 4JRIA 3QDRB 3CCEA 3LGFA 1YITT 4C92C 2DD5A 4M78F 1KG1A 4LDYA 5GANd 1RL2A 1XQHA 4C5IA 2E65A 5I2SA 3JCMd 1QVPA 2A3LA 1YHQA 4HCZA 5DM7R 5LJ3h 4B9WA 3M5AA 5GAMg 5D6YA 1MGQA 3RKYA 1VUBA 4GY5A 1QP3A 1U1TA 2LNVA 3RERA 3CMAA 4ZN1A 3MO8A 3X25B 2D9TA 1MHNA 3LX7A 1G3YA 4M77G 1VQOA 3OMCA 4M75B 3SD4A 3VV0A 4N4HA 2ZPFB 1HXDA 2EQUA 4M77C 2MMPA 4C0GA 2FB7A 2KMTA 3ME9A 4C8QG 3OYKA 3CCSA 3EAEA 4X34A 1Q82C 2X35A 5GMKe 3G6EA 2XDPA 3FJPA 3CCRA 3JCMJ 2JN0A 3J7AF 2C06A 5A0LA 3JB9J 3TEEA 3HFOA 2GF7A 4BD3A 3JCMW 4M7DF 3FRNA 3H8ZA 5CKBA 5LJ3f 2VUBA 2R5MA 1ZQ1A 4EMHA 4LDXA 3CCJA 2RHXA 4M78A 2EQMA 3FIFA 2VGMA 5GAOr 3V8KA 2P0PA 3MP6A 2EQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG2 A;  2M16 A;  3ZEH A;  3Q1J A;  3OYB A;  4L59 A;  3ASK A;  2L8D A;  3MEW A;  4LD6 A;  3OYI A;  3L2U A;  5J39 A;  4Q5W A;  4FU6 A;  1KHC A;  1SSF A;  2FHD A;  2P0K A;  5FRM A;  1WJQ A;  2R57 A;  2R58 A;  5D6W A;  3M9Q A;  4CRI A;  3OYD A;  2E5Q A;  3OQ5 A;  4C5G A;  3OYL A;  4E7I A;  2LRQ A;  2YRV A;  4IUU A;  3O8V A;  4EDU A;  4Z02 A;  4A4H A;  2RI2 A;  4BE2 A;  3GOX A;  2RJE A;  5C6S A;  3OYF A;  4BE0 A;  1WGS A;  2JZ2 A;  3E9F A;  5KE2 A;  3OYH A;  2BKD N;  3DB3 A;  3OYM A;  5IAY A;  3S3M A;  3MEU A;  3OYJ A;  3LLR A;  3QII A;  3OYC A;  3MEV A;  4IUQ A;  2RHU A;  4QW2 A;  4A4E A;  4IUT A;  4A4G A;  4IKF A;  3C4S A;  3QBY A;  5KCH A;  5KE3 A;  3P8D A;  1OZ3 A;  4E7K A;  1XNI A;  5J26 A;  2QQR A;  3OYN A;  4QQ6 A;  1OZ2 A;  1WJS A;  4BAC A;  3DLM A;  1H3Z A;  4PLL A;  4NS5 A;  4E7J A;  3QKJ A;  4BDZ A;  3S3O A;  2G3R A;  2JTF A;  4IUP A;  2MWO A;  2RI3 A;  3UT1 A;  4QQD A;  2EQJ A;  2RHZ A;  2K3X A;  3NTI A;  2LTO A;  3DB4 A;  4QVZ A;  4QQG A;  3OS1 A;  3FLG A;  4E7L A;  3OYE A;  2HQX A;  4A4F A;  3OYA A;  2QQS A;  4PL6 A;  1RI0 A;  2LVM A;  3LYI A;  2LDM A;  2EFI A;  2LCC A;  3H6Z A;  3F70 A;  2RHI A;  2L3R A;  2RI5 A;  3QJ6 A;  2O4X A;  3S3N A;  4C5E A;  5D6X A;  3L42 A;  4N4I A;  2RJD A;  5M9O A;  3BDL A;  3E9G A;  3MEA A;  2X4W A;  2RJC A;  3L2R A;  3MP8 A;  2IG0 A;  2K3Y A;  5IN1 A;  3S6W A;  3OY9 A;  2GFU A;  1OYX A;  2WAC A;  3OMG A;  3MP1 A;  1WJR A;  2F5K A;  2RHY A;  3LGF A;  1OI1 A;  4IUR A;  4N4G A;  3KUF A;  3NTH A;  4C5I A;  3NTK A;  4II1 A;  2EKO A;  3PMI A;  4HCZ A;  3FC3 A;  4BE1 A;  2DIG A;  3L2W A;  4B9W A;  2X4X A;  3OS2 A;  2E6N A;  2RO0 A;  4PLI A;  5D6Y A;  4C5H A;  2R5A A;  3PMT A;  3FDR A;  3LGL A;  4GY5 A;  2VYT A;  5KH6 A;  2CKK A;  3MO8 A;  2MWP A;  3P8H A;  2D9T A;  2L89 A;  2BUD A;  2M0O A;  1MHN A;  2X4Y A;  3LX7 A;  4OVA A;  3OMC A;  3SD4 A;  4N4H A;  4E7H A;  5FRO A;  4B9X A;  2EQU A;  3ME9 A;  1N27 A;  3PNW C;  3OYK A;  5CIU A;  3EAE A;  4FL6 A;  4UC4 A;  4X34 A;  2GFA A;  3OS0 A;  2B8A A;  5KCO A;  3UWN A;  2X35 A;  3CEY A;  4ZTF A;  2XDP A;  5FRN A;  2HQE A;  2O4X B;  3OA6 A;  2DAQ A;  4IUV A;  3OYG A;  3L2Q A;  2GF7 A;  3FEO A;  3LH0 A;  3MET A;  4BD3 A;  2M1H A;  3H8Z A;  3PFS A;  2BIV A;  5C0M A;  2R5M A;  2NLU A;  2RJF A;  3L2V A;  4ZTJ A;  1G5V A;  4BDY A;  3OB9 A;  2RHX A;  2EQM A;  2XK0 A;  2DIQ A;  2PQW A;  3MP6 A;  2EQK A; 
#chains in the Genus database with same CATH topology
 1D0Z A;  3GNG A;  5GAO m;  2FZC B;  3CPW A;  4M7A E;  2FHD A;  1I81 A;  4J9F A;  2LT4 A;  3HHT B;  1W2B S;  3EH2 A;  3URG A;  2R58 A;  4KBM B;  3KXT A;  1Q81 U;  2GNC A;  4L6V 5;  1VQ5 A;  1FYN A;  2LRQ A;  3I56 T;  3EH1 A;  4IUU A;  4PJN A;  1OPK A;  2HAX A;  2DLP A;  5KE2 A;  2MIO A;  4KGZ B;  3G6E Q;  2F5T X;  4A4G A;  4M7D A;  3THK A;  2VGN A;  3OBW A;  4E7K A;  1XNI A;  1MMG A;  1GL5 A;  1HJD A;  4LUE A;  4PLL A;  1IZ6 A;  4RTT A;  2QG9 B;  3UA7 A;  1YI2 Q;  1M8V A;  2P4R A;  2K3X A;  4J6W A;  3SHW A;  4KH0 B;  3EFR A;  1RAH B;  2DXB A;  2LQK A;  4CI0 C;  3LYI A;  2K7A A;  1XJW B;  1ZLM A;  1BB9 A;  5IHI A;  1K8A R;  1K0S A;  1PSE A;  3S3N A;  4KT0 E;  1M1F A;  1KQS S;  4F7U F;  2NYS A;  4FSS A;  1VQ7 Q;  1ZSZ B;  3UDC A;  2W10 A;  3OYY A;  1S72 Q;  4IUR A;  3INZ A;  3GF5 A;  2XDB A;  1B7T A;  1E6G A;  4VUB A;  4MZM A;  3OS2 A;  4JUV A;  1VIF A;  3D7S B;  5FU6 B;  2PU9 B;  4OMP A;  1SSH A;  2EQI A;  1NZ9 A;  1Z9Q A;  1AZG B;  2WSF E;  1KK7 A;  4PJO C;  3OS0 A;  1LVK A;  1YJ9 T;  1KSW A;  3CC2 T;  1KC8 R;  2K6D A;  1QCF A;  5LJ3 g;  3RR6 A;  4F7U A;  4XU2 A;  4LN2 A;  2BIV A;  3RES A;  1GRI A;  1K8A C;  1KD1 U;  4HT9 A;  5FW9 A;  2X4J A;  3SWN A;  4BI8 B;  2O88 A;  2QA4 A;  1RAA B;  1I0C A;  2EYX A;  2YDL A;  1VQ8 Q;  5KYU B;  3CCQ Q;  4OMN A;  1M1K R;  3CC4 Q;  1D0X A;  4D8K A;  2ZPG B;  1O9S A;  4EMK A;  3OYM A;  1SG5 A;  3JCM P;  1Y0M A;  3OYJ A;  4FW1 A;  3I9Q A;  1VQL Q;  1BI1 A;  4J7I A;  1VQ5 T;  1WHG A;  2RA2 A;  2LCS A;  3U23 A;  1TUG B;  4IUP A;  2C0I A;  1W2B A;  5KYW A;  1Q82 U;  1KC8 C;  1ARK A;  4A4F A;  1GCP A;  2LDM A;  2WSE E;  4E47 A;  3JCM h;  3M4Y A;  2RI5 A;  3QJ6 A;  1KQ1 A;  3HFN A;  3JCM b;  2OI3 A;  3I5S A;  4CC4 B;  1K76 A;  4OMQ A;  2H3E B;  2KBT A;  2RJC A;  3OW2 A;  5HK0 A;  1OYX A;  2CP3 A;  1K9A A;  4M77 F;  4ATO A;  3KFV A;  3CD6 Q;  5GAN 7;  1HYO A;  2EKO A;  4QT7 A;  3FC3 A;  1M1K C;  1XOV A;  4PLI A;  5KH6 A;  4M7A B;  1WYX A;  2FRY A;  2X4Y A;  3EG9 B;  1Y7X A;  3BFM A;  4M78 D;  5CVI A;  5DY9 A;  4BI4 A;  5CIU A;  4E2F B;  3CBM A;  4BB7 A;  4DBF A;  1TUC A;  2O4X B;  1V76 A;  3R6N A;  2LJ3 A;  4OF1 A;  3DKM A;  4KUI A;  5C0M A;  1WHL A;  1V29 B;  2DRM A;  2DIQ A;  2E64 A;  2QXF A;  1GXI E;  2AZV A;  9ATC B;  5GAN 5;  2DXT A;  1AHJ B;  3HP9 A;  1AD5 A;  3VU3 C;  3PE0 A;  2DYI A;  4K11 A;  2JNG A;  4M7D C;  2DPP B;  3X28 B;  1OX8 A;  5GAN 2;  4BE0 A;  1WLP B;  1VQO T;  4MZT A;  1ABQ A;  3OYH A;  2YLB A;  1IRX A;  2DX1 A;  2J6O A;  1UHC A;  3VS2 A;  2O2O A;  2OJ2 A;  3C4S A;  1R8O B;  1WI7 A;  1VIE A;  2EIF A;  1K4U S;  2LMJ A;  3VUB A;  3PIO A;  4C92 D;  4Y92 A;  2RK1 A;  1NPR A;  1YBY A;  2DJQ A;  2RQU A;  2P84 A;  3VJP A;  2L3R A;  1IXD A;  2GQI A;  3GP8 A;  4M75 D;  1EZZ B;  1W1F A;  3JB9 I;  2A08 A;  4RTZ A;  3UF4 A;  3QXE B;  4C8Q D;  3L2R A;  2QQB A;  2XI9 A;  3OY9 A;  1K8A U;  2VXF A;  3HL8 A;  2A37 A;  3KUF A;  1X43 A;  2QGG A;  4M78 E;  5KYX B;  3PMI A;  3RMQ A;  3A5Z B;  1LPL A;  5DLQ E;  2RO0 A;  2PUK B;  3EFS A;  4RMO A;  3V7R A;  2L3Q A;  4DBR A;  2NUT A;  1X2Q A;  2KRM A;  1YIJ A;  2CT4 A;  4OB3 B;  1NM7 A;  1YJ9 Q;  2B8A A;  1PD0 A;  2CGH A;  3CC2 Q;  3CPF A;  2XIC A;  5FRN A;  2EJ9 A;  1PKT A;  2HQE A;  5I22 A;  1I1J A;  4PFO A;  3LW5 E;  2DL3 A;  1VQ7 A;  2K2M A;  1UB4 A;  2MPX C;  1IRE B;  1KQ2 A;  1GCQ A;  1KC8 U;  2CP2 A;  4FYV B;  3MPU B;  2EBP A;  1QMC A;  2JUF A;  2QQ9 A;  3JB9 D;  4EMK C;  5LJ5 g;  2MF2 A;  1G3W A;  1LOJ A;  3OQ5 A;  2RQV A;  4PJJ A;  3OYL A;  3G1J A;  5GAN e;  3HRT A;  2DJZ A;  4M7A G;  2DTI A;  1KQS P;  5HY6 A;  4C92 E;  3LWH A;  5IHK A;  3TSW A;  3HRS A;  4HCK A;  1N5Z A;  1EIF A;  3LLR A;  3PVL A;  1M1K U;  2FVU A;  2Y4X A;  4N0A A;  5IXB A;  5KE3 A;  2AIR B;  1OZ2 A;  4XU0 A;  1PM3 A;  1H3Z A;  4HVU A;  1PC0 A;  5GMK l;  4M75 E;  2F69 A;  3MCA B;  1TU0 B;  2CH4 W;  1TWB A;  2RHZ A;  3NTI A;  4M75 A;  1I5O B;  4C8Q E;  4PL6 A;  1WHJ A;  2DM1 A;  2KY9 A;  2M9U A;  2I2L A;  4C0Z A;  5IN1 A;  1BI0 A;  2QI2 A;  2EGC A;  1RL2 A;  2KR3 A;  2E65 A;  3JCM d;  2A3L A;  1YHQ A;  4HCZ A;  1BU1 A;  5LJ3 h;  4FYY B;  3RKY A;  1VUB A;  1QP3 A;  2LNV A;  2H8H A;  4ZN1 A;  3X25 B;  3NPF A;  2EQU A;  4M77 C;  2FB7 A;  2KMT A;  3ME9 A;  3CCR A;  2YRD A;  2XDP A;  2ZAE A;  2JN0 A;  1SHF A;  2C06 A;  4AT1 B;  3HFO A;  1RLQ C;  3JCM W;  3H8Z A;  5LJ3 f;  3BE3 A;  1ZQ1 A;  2YUQ A;  3CCJ A;  1E7O A;  3FIF A;  3V8K A;  4F7U G;  3CCE Q;  2DRK A;  3CBO A;  1I4K 1;  2CP6 A;  1Q7Y R;  2DKG A;  3ASK A;  2KYM A;  3ER0 A;  2JW4 A;  4XAX B;  1KHC A;  4XK8 E;  1VA7 A;  1NG2 A;  2HQH A;  2O31 A;  4JJN K;  4JPB W;  1X6O A;  1M3C A;  1MV0 B;  3O8V A;  2OTJ A;  1VQO Q;  1KD1 R;  3GBQ A;  1AWX A;  2D8J A;  4EMG A;  1ZSZ A;  5GAO n;  4XTY A;  1AOJ A;  4D6W A;  4A4E A;  5HKC A;  3CCL T;  3C12 A;  1N9S A;  1YWO A;  2K3B A;  2DO3 A;  4QQ6 A;  1BK2 A;  1IB8 A;  4M78 B;  2ROL A;  1HD3 A;  2XU8 A;  2L3S A;  2MYS A;  4ME7 A;  4LXC A;  4PJO E;  3DB4 A;  5AT1 B;  4HVV A;  3A8G B;  1FMV A;  3M55 A;  4V2S A;  2D0Q B;  4KUL A;  4BI3 A;  2F2V A;  3G4S A;  4PK4 A;  1Q7Y C;  1IHW A;  3RNJ A;  2QEX Q;  1DJ7 B;  2IG0 A;  2DK3 A;  1T3L A;  5CO7 A;  1Y57 A;  3V8J A;  3NTH A;  2CH4 A;  5KYN A;  2BZ8 A;  2LJ0 A;  4LUD A;  1UGP B;  3PMT A;  4RCB A;  2MI6 A;  5KYU A;  1VQ4 T;  2MCN A;  5GMK i;  1JEG A;  2CYZ B;  4B6M A;  1YJW A;  2KXC A;  1GCQ C;  2AT1 B;  1TSF A;  1KHI A;  2LCL A;  4OML A;  4C92 B;  1PD1 A;  2K57 A;  2I0N A;  5GAM j;  2RD1 A;  5I21 A;  1WXB A;  4RUG A;  2COY A;  1SF9 A;  1G2B A;  3CCR T;  1PKS A;  4M7A F;  3OYI A;  3ZL7 C;  2CUD A;  3RDV A;  1OQK A;  1SSF A;  2CDT A;  3M0T A;  1ABO A;  2DER A;  3FJ5 A;  4C8Q B;  4N0A C;  1CKA A;  1RAD B;  1YNZ A;  4EDU A;  5HCK A;  3MHX A;  3I55 Q;  1UG1 A;  2PVO B;  3VRY A;  2FPE A;  4OMF B;  2IIM A;  1UGV A;  1YIT A;  2DL4 A;  1TUD A;  3SDZ A;  1X75 C;  3RMS A;  1MUZ A;  1D1C A;  5FU7 B;  1KJW A;  1ZX6 A;  3OYN A;  1EX4 A;  2OTJ T;  3DLM A;  4ZNX A;  3EHR A;  1G8X A;  4NS5 A;  2OTL A;  2HBP A;  4M7A A;  3NHN A;  1RAF B;  2FZK B;  1X69 A;  1G3T A;  1NYG A;  2XMF A;  3EG9 A;  2EKH A;  1UHF A;  3GLX A;  3M54 A;  4QKU A;  4O6J A;  1IGU A;  2RMO A;  2HSE B;  2VWF A;  2O4X A;  3O5Z A;  1AT1 B;  5M9O A;  1UDL A;  1VQP A;  5LJ5 j;  2FZG B;  1OUL A;  4OMO A;  3MP1 A;  4AFQ C;  4PJL A;  1E6H A;  3PIP A;  1OI1 A;  2JVV A;  2DMO A;  3A8L B;  3JV3 A;  4J5Y A;  3G4S T;  3CC7 A;  3QG1 A;  2YUN A;  3C0C A;  4XTZ A;  4LD9 K;  1ZUU A;  2VVK A;  4DBH A;  2CKK A;  3A8O B;  3OBY A;  4M78 G;  2HL5 C;  2HNI A;  2VAS A;  1B34 B;  3LH5 A;  2HEQ A;  1QCN A;  1Z9Z A;  3UWN A;  5LJ5 h;  3CCM T;  5GMK j;  1O75 A;  5LJ3 d;  3AT1 B;  2H3J A;  1B07 A;  1VQ9 Q;  2ENM A;  2RH2 A;  1QWE A;  1VQ6 A;  2AK5 A;  2KAF A;  4HA8 A;  1OOT A;  2GCX A;  1I8F A;  1UJY A;  1V1C A;  4FYX B;  2NWM A;  5GJW B;  2L8D A;  1VQK A;  1UGS B;  4IIM A;  1WHH A;  2V8K A;  5CQX A;  1BKB A;  1ZSZ C;  1JRI A;  2VV5 A;  2J06 A;  2P0K A;  2KE9 A;  4PJO B;  2DEQ A;  1ZA2 B;  1Q7Y U;  4WF2 A;  1RAG B;  4JDS A;  3CMA T;  4Z02 A;  2RI2 A;  5GAN 4;  2RJE A;  1GFD A;  4R0K A;  2RN8 A;  4AFZ C;  3CCS T;  3QJY A;  3CCL Q;  3CCV A;  1MMD A;  3KBG A;  1CKB A;  5KYX A;  3ZFJ A;  2YRC A;  4CC7 A;  5CQY A;  3VRZ A;  2KRS A;  4IIO A;  1JQQ A;  2RI3 A;  3GIB A;  1M30 A;  4FW2 A;  2A36 A;  3TVT A;  1MNE A;  4DQ2 A;  1X01 A;  4QQG A;  2QAZ A;  5A0G A;  1QVF P;  1WQW A;  2EAY A;  3R6O A;  1CSK A;  2OTL T;  2RHI A;  4M75 G;  3M4G A;  3BY7 A;  4M77 D;  3MEA A;  2NUZ A;  4JLI A;  4DOW A;  1AWO A;  4NL2 A;  1QWF A;  1VQN Q;  2O01 E;  3CCU Q;  1AZE A;  2RF0 A;  1WJR A;  2FRW A;  3G71 Q;  2YUP A;  1VQM A;  5GAN g;  3NTK A;  4II1 A;  1VQP T;  3BDU A;  4LE9 A;  2D6F A;  3FDR A;  3LWI A;  1VQ4 Q;  1ACM B;  1PSF A;  2L89 A;  4C0F A;  2HMA A;  1H92 A;  3TU4 K;  1D3B B;  2DIL A;  3PNW C;  3CC7 T;  1QVG S;  3QWX X;  3RKW A;  3J80 E;  4KUD K;  4E7S A;  3OYG A;  4Y91 A;  3FEO A;  3PFS A;  2YHT A;  3JCM f;  3VYH B;  3QZ5 B;  2JM8 A;  3JSC A;  2EYY A;  3TQ7 P;  3MEW A;  1K73 R;  1OX9 A;  1UGQ B;  4CRI A;  2DF6 A;  4CC3 A;  1KQS A;  2GQV A;  1VQK T;  2V8J A;  4MMK A;  3EGX B;  4M7A C;  2BKD N;  1FX7 A;  1PRM C;  3QII A;  4JJB A;  3CME A;  2COZ A;  4PNO A;  4X9D A;  1M1G A;  1PNJ A;  4XU3 A;  2G3R A;  2QTX A;  1WXU A;  2DL8 A;  4AG1 C;  4M77 E;  3I56 Q;  2DA9 A;  4DA4 A;  3CCV T;  3EHQ A;  1M5Q 1;  2LC4 A;  1ZBJ A;  3QSU A;  2LQW A;  4JRK A;  1YJN A;  4MDW A;  2LCC A;  2RQW A;  2QA4 T;  2YXY A;  2DTH A;  2C0O A;  1M3B A;  2DBK A;  3G7Z A;  1PG5 B;  4ELZ C;  2DXC A;  1K73 C;  1IO6 A;  2K9G A;  1UTI A;  2LP5 A;  2CZ7 B;  3QDR B;  3LGF A;  4PFZ A;  2PNI A;  4M78 F;  3EG0 A;  1SPK A;  3IQL A;  4B9W A;  5GAM g;  4J9G A;  5D6Y A;  7AT1 B;  1MGQ A;  4HXJ A;  2D8H A;  4GY5 A;  1U1T A;  5FWC A;  4AMC A;  2EVR A;  1G3Y A;  3VV0 A;  2ZPF B;  2MMP A;  4C0G A;  3PVQ A;  3CCM Q;  2MOX A;  3G6E A;  2DET A;  3M0U A;  1R0C B;  2GF7 A;  5CKB A;  2R5M A;  4EMH A;  4M78 A;  2EQM A;  4WCI A;  1YI2 A;  2EQK A;  3DLL A;  4O5V A;  2M16 A;  4J7F A;  5CAI A;  2HD0 A;  5LJ5 d;  2K5I A;  5CK9 A;  3GPL A;  2L5Q A;  2IPO B;  8ATC B;  5FRM A;  2B86 A;  5LJ3 e;  1YN8 A;  4FYW B;  4ORZ A;  2DZC A;  3EGD B;  2YRV A;  1FMK A;  2L3P A;  3SWN C;  1UEB A;  1WHM A;  1QVG A;  1C6V X;  3GOX A;  1MV3 A;  1WHK A;  2BE7 D;  2JM9 A;  3CCS Q;  1S72 A;  4LDU A;  2EYQ A;  3MEV A;  2RHU A;  2FEI A;  1ZSG A;  3P8D A;  1BCO A;  1OZ3 A;  2DL5 A;  2DVJ A;  4M75 F;  3NMZ C;  4E7J A;  2E3I A;  3EFO B;  1PRL C;  2F2W A;  4QQD A;  4C8Q F;  3FLG A;  2HQX A;  2CP0 A;  1WXT A;  3F70 A;  3L2Z A;  4C92 A;  1VQ5 Q;  5D6X A;  2RJD A;  2Z0W A;  1FXX A;  1Q86 R;  1GBR A;  2M51 A;  4ZN3 A;  5GAN 8;  2QGF B;  1QKW A;  2YLC A;  4A63 B;  2AKK A;  2NUP B;  2R5A A;  3M0Q A;  3VS7 A;  1VQ8 A;  5LL6 S;  3LGL A;  3CCQ A;  2CT3 A;  4C8Q A;  2A28 A;  1ZBX A;  1D1A A;  3CC4 A;  3GNF B;  2M0O A;  1X27 A;  2KVQ G;  5FRO A;  4PJO D;  3JAM E;  1KFZ A;  1VQL A;  2OAW A;  4ZTF A;  3M59 A;  3JB9 F;  4AFU C;  8AT1 B;  2JTM A;  3REA B;  3OB9 A;  4LDV A;  3RBB B;  2E5K A;  1Y07 A;  4RG2 A;  2E4H A;  3EG1 A;  4J9B A;  1QLY A;  4FIB A;  1QVF S;  3M53 A;  4Y28 E;  4M77 B;  2DD4 A;  2MAM A;  2V26 A;  2PZ1 A;  1X6B A;  5D6W A;  1Q86 C;  1S1N A;  3C94 A;  3OYD A;  1K73 U;  4ELY C;  2BZY A;  1YCS B;  5GAN j;  2JS0 A;  2D1X A;  5C6S A;  2HCK A;  1OV3 A;  4D8D A;  1YIJ T;  1WZO A;  1PWT A;  3QO3 A;  3CD6 A;  1VYT A;  4IUT A;  4IKF A;  3C95 A;  3QBY A;  1MMA A;  2FO0 A;  3OSV A;  4KGX B;  1U3O A;  1VQ7 T;  2W0Z A;  1BI3 A;  1EFN A;  4RTU A;  4BY6 B;  4PKC C;  2E3H A;  1WPY A;  2E1H A;  1M9S A;  2LVM A;  4J9C A;  1B34 A;  2DBM A;  4C0D C;  5GAN h;  3CPW S;  2QA4 Q;  1QVG P;  3V7S A;  3WXM B;  1F1B B;  1YWP A;  4A54 A;  1SRL A;  2K5L A;  1JJ2 S;  2ZZD A;  2V8I A;  1MMN A;  3ULR B;  4QVC A;  1SEM A;  2J6F A;  4BE1 A;  3E19 A;  3L2W A;  4QVD A;  1Y96 B;  4PJO A;  3A1P A;  3QDF A;  1JU5 C;  1U5S A;  2K79 A;  3H41 A;  1HK9 A;  4MDX A;  1BIA A;  4OB0 B;  4PFP A;  3JRZ A;  4M78 C;  2PTK A;  1G5V A;  1MND A;  4RKU E;  4FT4 A;  2DL7 A;  1VQ8 T;  3HPW A;  4JS4 A;  2ESW A;  4XTX A;  3CCQ T;  4RG8 A;  2CP7 A;  3L2Q A;  3V7C A;  5GAO q;  4BDY A;  1VQL T;  2JS2 A;  3ZEH A;  3OYB A;  1VOM A;  4FU6 A;  4J83 A;  1M2O A;  2P4T A;  2KT1 A;  1P92 A;  3OS5 A;  1YHQ T;  4FM4 B;  4M7D D;  2X3W D;  2SRC A;  1G3S A;  5IT9 E;  4ZGD B;  4XTV A;  2CRE A;  1G83 A;  4OB1 B;  3QUI A;  4XTW A;  3QHS A;  3S3M A;  1NLP C;  4IUQ A;  2VKN A;  5KYY B;  2JOY A;  2GBQ A;  2OX7 A;  1LJO A;  1QCO A;  1VYV A;  1RLP C;  3S3O A;  4JLG A;  1YFN A;  1AVZ C;  3CCJ T;  2O9S A;  2QAS A;  2EW3 A;  1QVF A;  2HL3 A;  3CD6 T;  4E7L A;  2KNB B;  3OYE A;  3VS4 A;  1D3B A;  3OYA A;  5GMK m;  1NEB A;  2CZ6 B;  1YJ9 A;  3VS6 A;  4CC2 A;  3CC2 A;  1FMW A;  1JBM A;  2ED1 A;  4F16 A;  1IGQ A;  5GAM h;  2LJ1 A;  4M75 C;  1B3Q A;  2KK4 A;  2ED0 A;  1M2V B;  2V1R A;  4C8Q C;  2WSC E;  4FSX A;  4OP0 A;  2X3X D;  1UGR B;  2GTO A;  1NBE B;  2ZPB B;  4MML A;  1Q86 U;  4P5N A;  2E6N A;  3M0S A;  3A8H B;  1OEB A;  5FU7 C;  5GAM f;  3SEM A;  3P8H A;  1HSQ A;  1W4S A;  4XTU A;  3ZBD A;  1NJI R;  2XG8 D;  4AFS C;  4E7H A;  3EGX A;  3QYG B;  4EIK A;  2LQN A;  4J8O A;  3V8L A;  1M8M A;  3H0I A;  1SKU B;  1K0X A;  1JJ2 A;  2COW A;  3H0H A;  5EC7 A;  3M56 A;  4ZTJ A;  1BIB A;  3JCM V;  4M7D E;  1UFF A;  2E12 A;  2XK0 A;  5J3B A;  3OW2 S;  4NL3 A;  2JMC A;  3SB2 A;  2LQ8 A;  4L59 A;  3QPH A;  4LD6 A;  4J9D A;  4ZGJ B;  4J6Y A;  2J7I A;  2XD0 A;  2VC8 A;  2QQA A;  3M0R A;  3VS3 A;  3J81 E;  1N9R A;  1WJQ A;  2SEM A;  2CZ0 B;  2BTT A;  2VB6 A;  3H0F A;  3JCM e;  4DEX A;  4ESR A;  4A4H A;  5CKF A;  3VUZ A;  2HKN A;  2K2V A;  3OYF A;  2MK5 A;  3M58 A;  1YIJ Q;  1YJW T;  4F17 A;  3PGG A;  4X1V A;  5CR2 A;  3H9N A;  3VS5 A;  5DLO A;  2O9V A;  1WJS A;  4BAC A;  1NJI C;  3VYG A;  2LT1 A;  1YP5 A;  1D0Y A;  3SFM A;  5LJ5 f;  2KXD A;  4RTW A;  1RAI B;  4R55 A;  4FCY A;  1WDX A;  2QQS A;  5GMK h;  1RI0 A;  5FU6 C;  3MKD A;  4C5E A;  2HSP A;  2EPD A;  1T3S A;  4N4I A;  4F14 A;  2KT8 A;  2LZ6 B;  2X4W A;  1R0B G;  2AHJ B;  4C92 G;  2EGE A;  4JJC A;  2JT4 A;  4M4Z A;  2GFU A;  3OMG A;  4F7U E;  3CCE A;  4JRI A;  1YIT T;  2DD5 A;  4J9E A;  1KG1 A;  2AZS A;  5GAN d;  4C5I A;  1QVP A;  1Q95 G;  4Z8A A;  5DM7 R;  1UUE A;  2EGA A;  2CSI A;  4KH1 B;  4DEY A;  1WIE A;  2RQT A;  3EGD A;  3MO8 A;  3LX7 A;  1VQO A;  3OMC A;  1VYU A;  4N4H A;  1HXD A;  4C8Q G;  2ATC B;  1H8K A;  4X34 A;  1W6X A;  3FJP A;  3JCM J;  2BZX A;  5A0L A;  4BD3 A;  2FPD A;  3FRN A;  2GTJ A;  4LDX A;  3EFO A;  2VGM A;  1A0N B;  2P0P A;  1WFW A;  2PVD B;  4OMM A;  1N8R R;  2CSQ A;  4HCC A;  1R77 A;  4F04 B;  1PCX A;  4KGV B;  5GAN 3;  1T0H A;  1YHQ Q;  2RNA A;  2KQW A;  1K1Z A;  3CPW P;  2R57 A;  3OSS C;  2RM4 A;  5GAO p;  4GLK A;  1UE9 A;  2QEX A;  1D09 B;  2HBW A;  3X26 B;  5CCA A;  4BE2 A;  5I11 A;  4JRQ A;  1JJ2 P;  2A7Y A;  4HT8 A;  2K4Y A;  1RAE B;  3M0P A;  3DB3 A;  3CCR Q;  3OYC A;  3E2U A;  3JB9 G;  3L1A A;  1J3T A;  1TOV A;  1VQ6 T;  1RI9 A;  1N6A A;  2NUP A;  2Y90 A;  2JTE A;  3CCJ Q;  1BCM A;  1XTD A;  3CQT A;  1FWZ A;  1I07 A;  4QVZ A;  4A53 A;  2LX9 A;  5L23 A;  3FB9 A;  1GBQ A;  1QKX A;  3TRE A;  1N8R C;  1T0J A;  2VXE A;  2OTJ Q;  4J9I A;  5CKH A;  3MP8 A;  3BW1 A;  3S6W A;  2DZ9 A;  1TG0 A;  3HKS A;  6AT1 B;  4N4G A;  2CS7 A;  4M7D B;  1LNX A;  2DIG A;  5GAM d;  2X4X A;  4M77 A;  4C5H A;  4E6R A;  3JCM c;  2VYT A;  1Y71 A;  1U8R A;  3EG3 A;  3CCE T;  2E10 A;  2Y4Y A;  4LNP A;  3I55 A;  4PJO G;  3TSZ A;  5ECA A;  2RK2 A;  1K9M R;  4FL6 A;  4UC4 A;  5I2M A;  2KYB A;  5KCO A;  4MZP A;  4BUG A;  1AWW A;  5IHN A;  1NJI U;  3OA6 A;  4EPC A;  1ZUY A;  3G4S Q;  2M1H A;  3I5R A;  2NLU A;  1X6G A;  2DVE A;  1BI2 A;  1NPP A;  1C0M A;  2E6Z A;  3NFC A;  5IH2 A;  3L2U A;  1VQM T;  3E1S A;  3RKX A;  1OU9 A;  2EWN A;  3CXC S;  4NOY A;  3M9Q A;  1KIK A;  1OU8 A;  4C5G A;  4WTO B;  1M90 R;  4ANJ A;  3X24 B;  1M4Z A;  2E70 A;  1YJW Q;  5IAY A;  3MEU A;  1D1B A;  4QW2 A;  1ZHI A;  4F7U B;  5J26 A;  1WQ7 A;  2QQR A;  4R56 A;  2QEX T;  4E7Z A;  2XID A;  2FPF A;  1Y96 A;  4BDZ A;  4JZ3 A;  1M27 C;  1NLO C;  2MWO A;  2V1Q A;  4X9C A;  1K9M C;  1H64 1;  3X20 B;  3CMA Q;  2DXU A;  2OAU A;  4XQ3 A;  3SWN B;  4C92 F;  2M02 A;  1W2B P;  2HDA A;  4RTY A;  2C0T A;  2EJG A;  2X9H A;  2DTO A;  2IVW A;  3AHU A;  2XHC A;  3A8M B;  1VQ9 A;  3BDL A;  1NEG A;  2ZPE B;  2J05 A;  5D7U A;  3A98 A;  4EMK B;  3JCM Q;  1BYM A;  1AEY A;  3NGP A;  4JRP A;  3OW2 P;  1YIT Q;  3QZ9 B;  4J9H A;  3WVD B;  2YSQ A;  1M90 C;  3CME T;  2M0Y A;  1JXO A;  2OTL Q;  4OGC A;  4YTL A;  1I5L A;  2ROT A;  4RCC A;  2MWP A;  4OVA A;  3CBP A;  5KYW B;  2ABL A;  1TH7 A;  1SHG A;  2GFA A;  3CCL A;  3CEY A;  2CZ1 B;  1YJN T;  5KYY A;  2DE0 X;  4Z88 A;  1C1A A;  4IUV A;  5L8R E;  3I55 T;  2CUB A;  2JXB A;  1VQP Q;  2RB6 A;  3L2V A;  4GBQ A;  2RJF A;  4OB2 B;  2QYZ A;  2F1L A;  2QTV A;  5CKD A;  1Q81 R;  3HSB A;  2PUO B;  3TCJ A;  2XDD A;  5J39 A;  5EG2 A;  3QWY A;  2EYW A;  2KSS A;  2JMA A;  3CC7 Q;  4M7D G;  3PTA A;  2A0F B;  1N8R U;  2KGT A;  3QYH B;  4E7I A;  5LJ3 j;  1LCK A;  4HKE A;  3EG2 A;  3WVE B;  1M2V A;  3I35 A;  1WGS A;  5GAO l;  2JZ2 A;  1VQN A;  3E9F A;  3CCU A;  1QW1 A;  1W70 A;  2KDS A;  4TVR A;  2ZCF B;  3G71 A;  4HCB A;  2YT6 A;  4RTV A;  3G6E T;  4DBQ A;  1VQ6 Q;  4OGE A;  1IHV A;  1VQ4 A;  2JTF A;  1OPL A;  4J6X A;  2D0N A;  4Z89 A;  3CXC A;  1YI2 T;  3N5B B;  3OS1 A;  3MJX A;  1VQK Q;  1QP2 A;  2EFI A;  2DFU A;  1WX6 A;  3H6Z A;  1UJ0 A;  2HZY A;  2GGR A;  2HKQ B;  2ZGW A;  3RUX A;  3T9N A;  3L42 A;  2L0A A;  1Q81 C;  2LX7 A;  2E41 A;  4XU1 A;  4JZ4 A;  1PHT A;  2WAC A;  2X51 A;  1JO8 A;  2F5K A;  2RHY A;  4PJO F;  1S72 T;  1QQJ A;  3JB9 H;  1VQ9 T;  3CCV Q;  1SRM A;  2P0Q A;  3JCM g;  3HRU A;  4C0D B;  2EJF A;  1U06 A;  2RPN A;  2BUD A;  2KRO A;  1H3H A;  2DYB A;  2L2P A;  3UPU A;  4B9X A;  4A4K A;  1N27 A;  4BY6 C;  2K5F A;  2KI7 A;  3UA6 A;  4JS5 A;  1ZUK A;  2DAQ A;  5GAM e;  3LH0 A;  3MET A;  1K9M U;  5GAN f;  1NYF A;  2PQW A;  5A2Q E;  3VKI A;  3I56 A;  2ZPH B;  1YCY A;  3Q1J A;  1JB0 E;  2KRN A;  4Q5W A;  1VQM Q;  3REB B;  5FWB A;  5HK3 A;  2J6K A;  2G6F X;  2AKL A;  4DOV A;  2E5Q A;  2NUT B;  2QDL A;  2XKO C;  3CC4 T;  2CP5 A;  4M7A D;  3RIR A;  2LNH B;  5AYF A;  1M3A A;  3M57 A;  2F2X A;  5GAN 6;  1M90 U;  2ZPI B;  2FYK A;  3VS1 A;  5KCH A;  2QK0 A;  3P8B B;  3VS0 A;  2QDY B;  1RAB B;  2FL7 A;  5FLX E;  1Q82 R;  1TXQ A;  2DEU A;  2RQR A;  3QKJ A;  5CKE A;  2EYZ A;  1VQN T;  1WNL A;  3CCU T;  1RAC B;  4JJD A;  3PT9 A;  3UT1 A;  4KRT A;  4L5G A;  2EQJ A;  3G71 T;  5A0D A;  2LTO A;  2KEA A;  4ZGE B;  1X2K A;  4GLM A;  1TS9 A;  4FT2 A;  2PVG B;  1KD1 C;  5IXF A;  3HTR A;  3CCM A;  1U1S A;  2BE9 B;  3UAT A;  1NE8 A;  4LDW A;  5LJ5 e;  1BBZ A;  3E9G A;  2K3Y A;  3JCM X;  1RUW A;  5GJV B;  4RTX A;  4C92 C;  3EGU A;  1TTH B;  4LDY A;  1XQH A;  1GFC A;  1ZA1 B;  5I2S A;  3CME Q;  3M5A A;  2FG0 A;  3CXC P;  3RER A;  3CMA A;  2D9T A;  1MHN A;  4M77 G;  3SD4 A;  4M75 B;  1JXM A;  1WA7 A;  3CCS A;  3OYK A;  3EAE A;  1Q82 C;  2X35 A;  5GMK e;  4AG2 C;  1YJN Q;  1AWJ A;  1UEC A;  2YUO A;  3J7A F;  3JB9 J;  4PJM A;  3TEE A;  4M7D F;  2DNU A;  4HVW A;  2VUB A;  2YWW A;  2ECZ A;  2RHX A;  5GAO r;  2JJ9 A;  3MP6 A; 
#chains in the Genus database with same CATH homology
 3CBO A;  2PVD B;  1I4K 1;  3DLL A;  4O5V A;  2M16 A;  2DKG A;  3ASK A;  4J7F A;  3GNG A;  5CAI A;  5GAO m;  4HCC A;  3ER0 A;  4XAX B;  2HD0 A;  5LJ5 d;  2K5I A;  4M7A E;  1KHC A;  3CPW A;  5GAN 3;  4XK8 E;  5CK9 A;  2FHD A;  2L5Q A;  1I81 A;  3GPL A;  2KQW A;  2LT4 A;  3HHT B;  1W2B S;  5FRM A;  3URG A;  4JJN K;  2R57 A;  2R58 A;  4KBM B;  3KXT A;  1Q81 U;  3OSS C;  5LJ3 e;  2RM4 A;  4L6V 5;  1VQ5 A;  1X6O A;  2DZC A;  2LRQ A;  3I56 T;  5GAO p;  2YRV A;  4GLK A;  4IUU A;  3O8V A;  3SWN C;  2QEX A;  1UEB A;  2HAX A;  2OTJ A;  1QVG A;  3X26 B;  5CCA A;  4BE2 A;  3GOX A;  4JRQ A;  4HT8 A;  2A7Y A;  2K4Y A;  5KE2 A;  4EMG A;  3DB3 A;  5GAO n;  1S72 A;  4LDU A;  4XTY A;  2EYQ A;  4D6W A;  3OYC A;  3MEV A;  2RHU A;  2F5T X;  4A4E A;  4A4G A;  5HKC A;  3CCL T;  4M7D A;  2VGN A;  3P8D A;  3C12 A;  1N9S A;  1OZ3 A;  3OBW A;  4E7K A;  3JB9 G;  1XNI A;  3L1A A;  2DO3 A;  4QQ6 A;  4PLL A;  1VQ6 T;  1N6A A;  1IZ6 A;  4M75 F;  2Y90 A;  4E7J A;  4M78 B;  1XTD A;  2XU8 A;  4QQD A;  1FWZ A;  1M8V A;  4ME7 A;  4C8Q F;  2K3X A;  4J6W A;  4QVZ A;  3DB4 A;  4PJO E;  4A53 A;  3FLG A;  2HQX A;  3EFR A;  2LX9 A;  2DXB A;  2LQK A;  4CI0 C;  3FB9 A;  3LYI A;  3F70 A;  3A8G B;  3M55 A;  4V2S A;  2D0Q B;  1PSE A;  4KUL A;  4BI3 A;  3L2Z A;  4C92 A;  3S3N A;  5D6X A;  4KT0 E;  3G4S A;  2RJD A;  3TRE A;  1N8R C;  1M1F A;  1Q7Y C;  2VXE A;  1KQS S;  1DJ7 B;  1FXX A;  5CKH A;  4F7U F;  3MP8 A;  2IG0 A;  3BW1 A;  2DK3 A;  3S6W A;  2DZ9 A;  3UDC A;  4ZN3 A;  3OYY A;  5GAN 8;  5CO7 A;  3HKS A;  4IUR A;  4N4G A;  3INZ A;  3V8J A;  2CS7 A;  3GF5 A;  2XDB A;  3NTH A;  4M7D B;  2YLC A;  4VUB A;  1LNX A;  2DIG A;  5GAM d;  2X4X A;  4MZM A;  3OS2 A;  4JUV A;  4M77 A;  4C5H A;  1VIF A;  3JCM c;  1VQ8 A;  1UGP B;  2R5A A;  3PMT A;  4RCB A;  2MI6 A;  5FU6 B;  3LGL A;  5LL6 S;  2VYT A;  3CCQ A;  1Y71 A;  2PU9 B;  4C8Q A;  1VQ4 T;  1U8R A;  3CCE T;  1ZBX A;  2E10 A;  5GMK i;  2Y4Y A;  3CC4 A;  3GNF B;  3I55 A;  2M0O A;  1NZ9 A;  4PJO G;  2CYZ B;  1YJW A;  2KVQ G;  5FRO A;  4PJO D;  2RK2 A;  2WSF E;  3JAM E;  4PJO C;  4FL6 A;  4UC4 A;  3OS0 A;  5I2M A;  1VQL A;  5KCO A;  4MZP A;  4ZTF A;  1YJ9 T;  3M59 A;  4BUG A;  3CC2 T;  3JB9 F;  1KHI A;  2LCL A;  4C92 B;  5LJ3 g;  3OA6 A;  1NJI U;  4EPC A;  4F7U A;  4XU2 A;  2JTM A;  2K57 A;  2M1H A;  5GAM j;  2BIV A;  2RD1 A;  2NLU A;  5I21 A;  3RES A;  3OB9 A;  4LDV A;  2DVE A;  1BI2 A;  3CCR T;  1Y07 A;  1NPP A;  4RG2 A;  2E6Z A;  4M7A F;  3NFC A;  3OYI A;  1K8A C;  1KD1 U;  3L2U A;  4HT9 A;  4FIB A;  2X4J A;  3SWN A;  1SSF A;  3E1S A;  3RKX A;  4BI8 B;  1VQM T;  1QVF S;  2EWN A;  3CXC S;  2QA4 A;  3M53 A;  4Y28 E;  4M77 B;  4NOY A;  2DD4 A;  2MAM A;  5D6W A;  3M9Q A;  1Q86 C;  3C94 A;  3OYD A;  4C8Q B;  4C5G A;  4N0A C;  1K73 U;  4ELY C;  4EDU A;  5GAN j;  3MHX A;  3X24 B;  2PVO B;  1M4Z A;  2ZPG B;  4OMF B;  5C6S A;  2E70 A;  1O9S A;  4EMK A;  1YIT A;  3OYM A;  3JCM P;  3SDZ A;  5IAY A;  1YIJ T;  3MEU A;  3OYJ A;  1X75 C;  1BI1 A;  3RMS A;  4QW2 A;  3QO3 A;  3CD6 A;  4J7I A;  4IUT A;  5FU7 B;  1VQ5 T;  3C95 A;  3QBY A;  4IKF A;  1ZHI A;  2RA2 A;  4F7U B;  5J26 A;  1WQ7 A;  2QQR A;  4R56 A;  3OYN A;  3OSV A;  3DLM A;  2QEX T;  2OTJ T;  2XID A;  1Y96 A;  4NS5 A;  1VQ7 T;  2OTL A;  4BDZ A;  2HBP A;  4IUP A;  4M7A A;  1BI3 A;  2MWO A;  4X9C A;  4BY6 B;  1K9M C;  4PKC C;  1H64 1;  1G3T A;  3X20 B;  1WPY A;  2E1H A;  1W2B A;  1Q82 U;  2DXU A;  1KC8 C;  2OAU A;  4A4F A;  3GLX A;  4XQ3 A;  3SWN B;  3M54 A;  4C92 F;  1M9S A;  2LVM A;  1B34 A;  5GAN h;  4C0D C;  4O6J A;  3CPW S;  2LDM A;  2WSE E;  2EJG A;  3JCM h;  2DTO A;  2IVW A;  4E47 A;  3AHU A;  2XHC A;  3M4Y A;  2RI5 A;  3QJ6 A;  1KQ1 A;  3A8M B;  3HFN A;  3V7S A;  3WXM B;  2O4X A;  3JCM b;  1VQ9 A;  5M9O A;  3BDL A;  4A54 A;  1VQP A;  5LJ5 j;  2ZPE B;  2K5L A;  2RJC A;  3OW2 A;  1JJ2 S;  4EMK B;  3JCM Q;  5HK0 A;  1BYM A;  2ZZD A;  1OYX A;  2V8I A;  4JRP A;  3MP1 A;  3QZ9 B;  4M77 F;  4QVC A;  3PIP A;  1OI1 A;  2JVV A;  3WVD B;  4ATO A;  3A8L B;  5GAN 7;  4J5Y A;  2EKO A;  3G4S T;  1M90 C;  3FC3 A;  3CME T;  4BE1 A;  3E19 A;  1M1K C;  1XOV A;  3L2W A;  3CC7 A;  3QG1 A;  4PLI A;  4QVD A;  1Y96 B;  4PJO A;  4XTZ A;  4LD9 K;  4OGC A;  4YTL A;  4M7A B;  5KH6 A;  2CKK A;  3A8O B;  1I5L A;  3OBY A;  4RCC A;  2MWP A;  2X4Y A;  4M78 G;  4OVA A;  3CBP A;  1HK9 A;  1Y7X A;  3BFM A;  4M78 D;  4MDX A;  1TH7 A;  1BIA A;  2HNI A;  4OB0 B;  3JRZ A;  5CVI A;  4M78 C;  5DY9 A;  1G5V A;  1B34 B;  4RKU E;  5CIU A;  4BI4 A;  3CBM A;  4BB7 A;  2GFA A;  4FT4 A;  3UWN A;  5LJ5 h;  3CCL A;  3CEY A;  3HPW A;  1VQ8 T;  2CZ1 B;  4JS4 A;  3CCM T;  5GMK j;  1YJN T;  4XTX A;  1O75 A;  3CCQ T;  5LJ3 d;  2H3J A;  2O4X B;  4RG8 A;  2RH2 A;  4IUV A;  5L8R E;  3I55 T;  3L2Q A;  3V7C A;  1VQ6 A;  4OF1 A;  3DKM A;  2KAF A;  4HA8 A;  2RB6 A;  4KUI A;  5C0M A;  2RJF A;  5GAO q;  4OB2 B;  3L2V A;  2GCX A;  4BDY A;  1I8F A;  1V29 B;  2DIQ A;  1VQL T;  2E64 A;  2QXF A;  5CKD A;  1GXI E;  5GAN 5;  3ZEH A;  2DXT A;  3OYB A;  3HSB A;  2PUO B;  2L8D A;  3TCJ A;  1AHJ B;  1UGS B;  2XDD A;  1VQK A;  5J39 A;  3HP9 A;  2V8K A;  4FU6 A;  5CQX A;  4J83 A;  5EG2 A;  2P4T A;  1BKB A;  1P92 A;  2KSS A;  1JRI A;  2VV5 A;  3OS5 A;  2P0K A;  4FM4 B;  3VU3 C;  3PTA A;  1YHQ T;  4M7D G;  4PJO B;  2DEQ A;  4M7D D;  2JNG A;  1N8R U;  1Q7Y U;  4M7D C;  3QYH B;  4WF2 A;  5LJ3 j;  4HKE A;  4E7I A;  1G3S A;  2DPP B;  3X28 B;  4JDS A;  5IT9 E;  4ZGD B;  4XTV A;  3CMA T;  5GAN 2;  4Z02 A;  2RI2 A;  4OB1 B;  3WVE B;  5GAN 4;  4BE0 A;  2RJE A;  3QUI A;  1VQO T;  4MZT A;  1WGS A;  4XTW A;  5GAO l;  2JZ2 A;  1VQN A;  3E9F A;  3QHS A;  1QW1 A;  2YLB A;  3OYH A;  2KDS A;  3CCU A;  4TVR A;  2ZCF B;  3CCS T;  3S3M A;  3QJY A;  3G71 A;  4HCB A;  4IUQ A;  3G6E T;  3C4S A;  3CCV A;  1R8O B;  2JOY A;  1VIE A;  3KBG A;  3ZFJ A;  2EIF A;  1LJO A;  4OGE A;  5CQY A;  3VUB A;  1VQ4 A;  3PIO A;  4C92 D;  3S3O A;  2JTF A;  4JLG A;  2RI3 A;  3GIB A;  3CCJ T;  4J6X A;  1QVF A;  3CXC A;  2RK1 A;  4DQ2 A;  3N5B B;  3OS1 A;  1NPR A;  1X01 A;  1YBY A;  4QQG A;  4E7L A;  3CD6 T;  5A0G A;  3OYE A;  1QP2 A;  3OYA A;  1D3B A;  1WQW A;  5GMK m;  2EAY A;  2CZ6 B;  1YJ9 A;  3R6O A;  3CC2 A;  2EFI A;  3H6Z A;  2OTL T;  3VJP A;  1JBM A;  2L3R A;  2RHI A;  4M75 G;  5GAM h;  3M4G A;  3GP8 A;  4M75 D;  2ZGW A;  3RUX A;  3BY7 A;  4M75 C;  3T9N A;  3L42 A;  4M77 D;  1Q81 C;  2KK4 A;  3MEA A;  3JB9 I;  4JLI A;  2E41 A;  3QXE B;  4C8Q D;  4DOW A;  3L2R A;  4XU1 A;  2QQB A;  4NL2 A;  4C8Q C;  2XI9 A;  3OY9 A;  1K8A U;  2VXF A;  2WAC A;  2O01 E;  3HL8 A;  1WJR A;  2F5K A;  2RHY A;  2WSC E;  4FSX A;  4OP0 A;  1UGR B;  4PJO F;  3KUF A;  1S72 T;  1VQM A;  3JB9 H;  1VQ9 T;  5GAN g;  4M78 E;  3NTK A;  4II1 A;  2P0Q A;  2ZPB B;  3PMI A;  4MML A;  3JCM g;  3HRU A;  3RMQ A;  3A5Z B;  1VQP T;  1Q86 U;  4P5N A;  3BDU A;  5DLQ E;  2E6N A;  2PUK B;  2RO0 A;  3EFS A;  2D6F A;  3A8H B;  4C0D B;  3FDR A;  4RMO A;  2EJF A;  3LWI A;  3V7R A;  5FU7 C;  5GAM f;  1VQN T;  3P8H A;  1W4S A;  4XTU A;  1PSF A;  2L89 A;  2BUD A;  3ZBD A;  4C0F A;  2XG8 D;  3TU4 K;  4E7H A;  3UPU A;  1D3B B;  4B9X A;  3QYG B;  1YIJ A;  4A4K A;  1N27 A;  3PNW C;  3CC7 T;  4J8O A;  4OB3 B;  4BY6 C;  3V8L A;  2B8A A;  2K5F A;  1QVG S;  2CGH A;  3RKW A;  3J80 E;  3CPF A;  2XIC A;  5FRN A;  2EJ9 A;  4JS5 A;  2HQE A;  4KUD K;  1JJ2 A;  2DAQ A;  3OYG A;  3LW5 E;  4Y91 A;  3FEO A;  3LH0 A;  5GAM e;  3MET A;  3PFS A;  1VQ7 A;  1YI2 T;  3M56 A;  1K9M U;  1UB4 A;  4ZTJ A;  2YHT A;  1BIB A;  1IRE B;  3JCM V;  4M7D E;  5GAN f;  2E12 A;  1KQ2 A;  2XK0 A;  5J3B A;  3JCM f;  3VYH B;  2PQW A;  5A2Q E;  3QZ5 B;  4NL3 A;  3OW2 S;  3JSC A;  3VKI A;  3I56 A;  2ZPH B;  2LQ8 A;  3SB2 A;  1KC8 U;  1YCY A;  3Q1J A;  4L59 A;  2JUF A;  2QQ9 A;  1JB0 E;  3MEW A;  3QPH A;  4LD6 A;  4Q5W A;  4ZGJ B;  4F7U G;  3JB9 D;  4EMK C;  4J6Y A;  5LJ5 g;  2MF2 A;  5HK3 A;  2XD0 A;  2VC8 A;  2QQA A;  1UGQ B;  3J81 E;  1N9R A;  1WJQ A;  2CZ0 B;  4CRI A;  4DOV A;  1G3W A;  2E5Q A;  1LOJ A;  3OQ5 A;  3OYL A;  5GAN e;  1KQS A;  3HRT A;  3JCM e;  2GQV A;  1VQK T;  2XKO C;  2V8J A;  2DJZ A;  4A4H A;  3CC4 T;  4M7A G;  2DTI A;  4MMK A;  5CKF A;  3VUZ A;  2K2V A;  3OYF A;  3RIR A;  4M7A D;  5HY6 A;  4C92 E;  3LWH A;  3M58 A;  1YI2 A;  4M7A C;  1YJW T;  3PGG A;  2BKD N;  3HRS A;  5AYF A;  5CR2 A;  3M57 A;  1EIF A;  1FX7 A;  3LLR A;  3QII A;  5GAN 6;  1M90 U;  1M1K U;  2ZPI B;  2FYK A;  5DLO A;  2FVU A;  5KCH A;  3CME A;  2Y4X A;  4N0A A;  3P8B B;  5KE3 A;  4PNO A;  4X9D A;  2QDY B;  1M1G A;  1OZ2 A;  2FL7 A;  4XU0 A;  1WJS A;  4XU3 A;  5FLX E;  4BAC A;  1H3Z A;  1NJI C;  3VYG A;  3QKJ A;  5CKE A;  5GMK l;  2LT1 A;  1WNL A;  2G3R A;  3CCU T;  3SFM A;  5LJ5 f;  4M75 E;  3PT9 A;  2QTX A;  3UT1 A;  2F69 A;  3MCA B;  4L5G A;  2EQJ A;  3G71 T;  4M77 E;  4R55 A;  2RHZ A;  3NTI A;  5A0D A;  2LTO A;  4DA4 A;  4M75 A;  4ZGE B;  3CCV T;  1M5Q 1;  4C8Q E;  2LC4 A;  2QQS A;  4PL6 A;  5GMK h;  1RI0 A;  4FT2 A;  2PVG B;  1KD1 C;  5FU6 C;  3QSU A;  3CCM A;  4JRK A;  1U1S A;  4MDW A;  1YJN A;  2LCC A;  2QA4 T;  2KY9 A;  1NE8 A;  2DTH A;  2M9U A;  4C5E A;  3G7Z A;  4LDW A;  2I2L A;  4N4I A;  5LJ5 e;  3E9G A;  4ELZ C;  2DXC A;  1K73 C;  4C0Z A;  2X4W A;  2AHJ B;  4C92 G;  2K3Y A;  5IN1 A;  4F7U E;  2GFU A;  3OMG A;  3JCM X;  1BI0 A;  2CZ7 B;  2QI2 A;  4JRI A;  3QDR B;  3CCE A;  3LGF A;  1YIT T;  4C92 C;  2DD5 A;  4M78 F;  1KG1 A;  4LDY A;  5GAN d;  1RL2 A;  1XQH A;  4C5I A;  2E65 A;  5I2S A;  3JCM d;  1QVP A;  2A3L A;  1YHQ A;  4HCZ A;  5DM7 R;  5LJ3 h;  4B9W A;  3M5A A;  5GAM g;  5D6Y A;  1MGQ A;  3RKY A;  1VUB A;  4GY5 A;  1QP3 A;  1U1T A;  2LNV A;  3RER A;  3CMA A;  4ZN1 A;  3MO8 A;  3X25 B;  2D9T A;  1MHN A;  3LX7 A;  1G3Y A;  4M77 G;  1VQO A;  3OMC A;  4M75 B;  3SD4 A;  3VV0 A;  4N4H A;  2ZPF B;  1HXD A;  2EQU A;  4M77 C;  2MMP A;  4C0G A;  2FB7 A;  2KMT A;  3ME9 A;  4C8Q G;  3OYK A;  3CCS A;  3EAE A;  4X34 A;  1Q82 C;  2X35 A;  5GMK e;  3G6E A;  2XDP A;  3FJP A;  3CCR A;  3JCM J;  2JN0 A;  3J7A F;  2C06 A;  5A0L A;  3JB9 J;  3TEE A;  3HFO A;  2GF7 A;  4BD3 A;  3JCM W;  4M7D F;  3FRN A;  3H8Z A;  5CKB A;  5LJ3 f;  2VUB A;  2R5M A;  1ZQ1 A;  4EMH A;  4LDX A;  3CCJ A;  2RHX A;  4M78 A;  2EQM A;  3FIF A;  2VGM A;  5GAO r;  3V8K A;  2P0P A;  3MP6 A;  2EQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...