3UTPD

1e6 tcr specific for hla-a*0201-alwgpdpaaa
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
199
structure length
199
Chain Sequence
KEVEQDPGPLSVPEGAIVSLNCTYSNSAFQYFMWYRQYSRKGPELLMYTYSSGNKEDGRFTAQVDKSSKYISLFIRDSQPSDSATYLCAMRGDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 1E6 TCR alpha chain
publication title Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 199
sequence length 199
chains with identical sequence K
ec nomenclature
pdb deposition date 2011-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utpD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utpD02
2CMRH 5K9OA 4L3CA 1L9NA 5DD6A 5F1IB 3BKML 3WIHH 5LCVL 1GGCH 4UTBL 1L6XA 3BP6B 4XVJH 3ULUD 4A6YH 2PCPA 4NO3A 5IWLC 4LSUL 3DX8B 5FGBC 5I76A 2IANB 4N8CL 3BP5A 3IJSA 1HI6A 4KI5D 4MSWA 4ODSL 2XACC 1ZLUH 4NKDB 4RAVA 4J7RA 1G6VK 4P5KB 3U1SH 4LLMA 3TO2A 4PIRF 4D9RD 4K8RC 3OAUH 1T5WA 2QHRL 3B6SA 2HN7B 3FL7A 2M8XA 2J7LA 4M7KH 3S37X 3SKMB 3RWCA 1HE7A 2F19L 4LLWB 4X7SL 4KPHL 4QTHA 3CSGA 2D9QB 1LWRA 4ZO6A 3GMOB 1KJ3L 1A1NA 3ARGB 2VDKH 1MJUL 5F7KC 4DUXA 1JN6A 1BQSA 2VISB 4KQ4L 1QYGH 3VXUE 1JGDB 3VGBA 2AGJH 3OKOB 1JBJA 3TN0D 4L8SA 1B0GB 1DBJL 2P8MA 3QZWA 3QFDA 2A9ML 2X70B 2NW3B 3IETB 2X40A 2FGWL 3TCLB 4OFPA 5BO1L 5CIPH 1YEHH 1NCCH 2MKLC 2J8OA 2Y4SA 4QNPF 5D1QB 1TZHB 3RPKA 2W91A 4B53A 5F7HA 1KG0A 2PYED 4MNHB 1XR8B 4I9WD 4PJDF 3CFBA 1CD9B 1T66D 3T1FB 4OB5H 5EIQA 4HXBL 3NN8A 4XCCH 3MA9L 1IGIH 2VDNH 1DQTA 2C4XA 3ILQD 4K3DL 4XP9H 1P6FA 1EFQA 2DI8A 2P5ED 4BFEA 1AJ7L 3WJLC 5DQJB 5JOPD 5EC2A 4M93C 4MB5A 1U8KA 4PRPE 2IAMA 1DANT 5D1XC 1MIMH 1BBJB 1YMMA 4U1LB 3LV3A 5T1LA 1UB6A 4F7MB 3AREC 4YDVB 2QQLL 1IGJA 3E6HA 2VDMH 2CXKA 4I3SL 2L0DA 1D9KD 2VN4A 4M03A 2IFFL 3L3GB 3EYSL 3TIDA 4MNGE 1MHCB 3LCYA 3ZTJH 4Y4HA 1XF2B 1L0QA 3HR6A 5DZLA 5EWIH 4MA8L 1J8KA 1DQDH 3SBWC 1U42A 5I0DA 5HI4D 1IL1B 1T6WA 2R39A 4LDEB 4LMQE 1NL0L 3PE9A 1IGYB 1T83C 5D1ZD 1J1XL 3VD3A 3VFWA 1MF2H 3O3AA 4Y5XC 3TCXA 3VGHA 2XICA 4XI5D 3T0BA 1UJ3B 3IRZA 3MRGA 3QUML 4KTEH 1GHFH 4ODHL 1G0YR 1MRFL 3F65A 4F7EB 2A73B 4HX1A 4MXWL 1M4KA 4FZ8H 5CD5D 2Z31A 3ZMRA 3NACL 2H6PB 3VG0H 3TP4A 4WI2A 4G5ZH 2R4SH 3W11D 2K3TA 1DL7L 4HS3A 5T5NG 3O4OB 4XHJD 4RFOL 4G8FB 3NIDF 3LS5H 1B88A 4XMKH 4M62H 1FNSH 5IVXF 5AG8A 4HMCA 1A1OA 3KXFB 1NCNA 3WIFA 1BF2A 3MREB 1R3JB 5JW3H 4L9LC 5IB1A 1JGEB 4WO4A 1YN6A 5E6ID 1FN4A 3B2UD 3QO1A 1XIWB 5EDXA 5I8CB 1XGTB 3IF1A 3LS4L 4PJFB 2Y07H 5C9JB 4U6YB 1A6ZB 4UDUB 1UVQA 1HXYB 1OCWL 2D31A 5E4IA 3L3JB 2IF7A 2LTQB 4PRHA 2WWKT 4YO0B 4EVNB 2UUDH 3MRDB 3DRTA 3GFUA 1IBGL 4BK5A 3V9FA 3QYCA 1VGKB 4WWKA 4XP5L 1AKJA 4GS7C 4HJ0C 4M8VA 3UJJH 4NDMB 1GC1L 2PR4H 4NQEA 1P84J 4KI5E 4P49A 1T7XA 5EBWB 3DARA 3VFSA 4D9RE 5F72S 3HFML 2CDEA 3CSBA 1C08A 4M6AA 2BSTA 3RY4A 4NWUL 2CKBH 3WUWB 5K59E 3UJTL 3RU8L 4OLVH 5DTFB 1INQA 4F9PA 3MLXL 4XVSH 5F3HA 4JM2A 1WISA 5EOQL 2DD8L 3ZE0E 5E2JA 4RAUB 4JFDA 5FYJU 2XT1B 3OKLB 2EYSB 4OLUL 5T3ZD 1I3VA 3FO1A 4LSDA 1KIPA 3GSNB 3P9WB 4P46D 3QQ9D 1HWHB 2ZJSH 3O6ML 3R8BB 1BQHA 5EOCH 1DLFH 1MCSA 2AEQH 4O9HL 4DGIH 2X41A 3V79C 4XVUC 4MNQA 2OR8A 5TDOA 1AHWA 1HINL 3UTQB 1H3GA 2IWGA 4ZAKA 4YWGL 4JN2A 5GS0D 3W2DH 4PLKD 5EU7C 5ESAB 5D2LB 3ARPA 2A77H 1U3HD 2DQJL 2XQYK 3T2OA 4AY0A 2FATH 5DUPL 4DOHB 1OAKL 4L3EA 5AZEL 3JV6B 5F8QC 3UYOD 1NAMA 4WHYG 2P5EE 2ZSWA 1WTGT 4GW5B 3MRMA 3S6CA 2ED9A 4HKXA 3GSQB 3TH4T 1HHHB 3GI8H 5DSCB 5EB9A 3T65A 4OLYL 1HYRC 1PKQB 1F02I 4D94A 3GNML 1EHLH 1NBVL 4MAYD 5DEGA 4G80B 4BFIA 1BIHA 3IU4L 5SX5K 4KJYA 3KPTA 5IJKA 1T0PB 5HGAB 1UWGH 1PX4A 4R26H 2FX8L 5I6XC 4L4VB 4TN9A 2VLKB 4OCRH 1YJDL 5GGQH 1N7MH 5DQDH 5EU3A 4U1SA 4DKEH 2RCSH 4BSVB 4JEGB 4UINL 3TZVB 4QRPD 2CUHA 5IP4A 4WHTA 5I9QB 1T2QH 4ZYKA 4LRNH 1FFQA 4XCNA 5IESH 3ZHDA 3KJ4B 4DKFL 8FABA 4WVRA 1IQDB 3BVNA 3EW3B 5FA3B 3T0AA 2W0PA 4GRWH 3FN0L 1CGYA 1OHQA 1W0YT 3PP4L 2YBRA 1NC4A 2E6QA 2YPLB 4Z7VA 3QI9B 2GK0A 4RSVA 3SDDA 3WFBL 1A2YA 4IDLA 3MLSL 4TUOA 4WU7B 1HHJB 2XV6B 1NGXB 2GFBA 3R0NA 1SY6H 4D9LH 1G7QB 4R0LC 5D7JB 4R9HA 1I9JL 2H2PC 3IXAA 4POZC 5CEXA 5L0QB 2I5YL 5INDA 4OCNC 1IM9A 4JY6B 2X89A 5JOFA 2XG4A 3BPCB 3HPLA 3N85L 4HH9B 4OZHB 1G9MC 5C07B 4Y16A 3S4SB 1JGUL 3GSRA 3VI4E 2FWOB 2Q6WA 3GMQA 3WUZA 2YZ8A 4UQ3A 1RZIB 3IDMB 3NA9H 1MCCA 3F12B 3NOIA 4PJCA 1PLGH 3BXNA 5EU4B 4K3EH 1UEMA 5I17A 3RWGA 3O6FB 1BECA 5LGHH 2KUTA 2I24N 1B0WA 3BGFB 1ZA6B 3S5LG 2YHGA 1PG7H 2QTEA 4U1GB 4C56D 3G6DL 1P53A 3RVVC 4A6YA 2DQHL 3VGAC 2AI0L 1NEZA 1QLEL 2DL2A 2DICA 3MRHB 4Z0XB 1NFDE 2NCMA 5C0AD 4R3SA 5L8KB 3LZFH 3LB6D 3U9UA 3NCJH 1WBYB 3SE3C 4JG0L 1KJVB 1ORSA 3PWNB 3LQAC 5I1JH 3M17A 1X5IA 3EUUA 4L4TD 4XNUH 1BIIB 4AQ1B 3QCTL 5DURD 4NM8L 4RGNE 4WUKH 5KSAC 1ZS8A 3GJFH 5EOTB 5IMLA 4V1DA 1AR1D 1E4XH 5JUEH 1B0RB 5EFIB 4PJ9C 4J8RB 1HEZA 3MCLL 3ARXA 4U0RB 5BV7C 1ZVSA 3CDGB 3QIUD 4MQ7B 5F9DC 3HE7D 4PJFF 3KYMB 3VA6A 1T6VN 5E7FA 1H8OA 1PSKL 1T0MB 4IOFC 2NY0B 5T3ZE 5J13B 3AMKA 4DK6A 1T1YA 5HVHC 3LD8B 2R1WA 4EDXB 4QRUA 1NCCL 1JMZA 5DUBA 2RFXA 4HS8L 2KZ1B 2CRYA 2QQNH 1KLFA 5HGBA 1Z9MA 2GJ6A 2N1KA 4JFOB 1H0DB 4OB5L 3FFDB 4ZFZA 5C92A 3OB8A 4HUXA 5JW4Q 4N9OB 4ZS7H 1BOYA 3EOBA 2PUQT 4X7CC 1G7JA 5EZJB 5C86A 3V6FB 2VDLH 3PL6B 3QUZB 4PUBL 2AKRA 2HT2C 2LU4A 1MIML 4RFNB 1HYSD 4Y5YC 5HYQA 4I2XB 2BY1A 5DMIL 1BZQK 1OF2A 1KB5A 2VDML 4EXKA 1FG9C 4QOKD 1UQSB 5DK0A 1MEXH 4HJJL 1RUML 2FIKA 2W0LA 2DM3A 4U7MA 1MAKA 2J12B 2XZAH 5ESVB 1CS6A 3HZKB 1PBYA 4X83A 1N64L 2E7HA 4C54A 2XY1A 3MNZA 2VABB 4MJ2A 4QRPE 3FQUB 4XGZB 1MFDL 5D2LF 4YHKL 5BXFB 4JPIB 1DUZA 2EYRA 2E7MA 3FB6A 5C8JB 3H7BB 3WD5L 1R5WB 3H0TA 5IB2A 2VAAA 2W0FB 1XR9A 3O11A 4X6CE 1K8DA 2ADFL 3NCYP 2ZKHH 4S2SA 5IW6A 1ZVHA 3F7VB 1P7HL 1MWAH 4XMKL 2QQQA 4M62L 5J6GB 4JQVA 5SX5H 3GSXA 5I8EB 4APQD 4XXDA 4P99A 5FK9A 3OJMB 1UXWA 1L7TH 5ITBH 4Z78A 2DQEH 3K46A 5I75C 2DQCH 2FB4H 1TVHB 1LEKA 4KDTC 2ED8A 3VFGH 5TQ0H 3RKPA 3MZGB 4DZ8A 1C5BL 1ETZB 2Q20A 2H1PH 3B2VH 2Y07L 2YKLH 2OP4H 3UXFA 3QIWD 3F5WA 2FJFB 5I16B 1WBXA 1JPSH 3MROB 4OFDA 3FHAA 1RIHH 3JSSA 1CG9A 4YXHL 3L9RA 4NZTH 1J5OL 3MLVL 4CRPA 4WNQA 1ZT7B 4F33B 4LCUB 1PEZA 3A67H 3FQWB 5I1GL 4ZUTB 3ES6A 4PRBA 4NC1E 3KYNA 4MCYA 3EO0A 2V2WA 1YEIL 3ARDB 4CW1A 1XGQA 3Q3GB 4KU1A 3UJJL 2I60H 4HEME 3CVHH 5C0AE 2YPKA 5HGGS 3AB0B 4GRLD 3TBTA 5FKAA 4JKLA 3TPUA 3VFNB 4DTGH 3DHMA 2DQTH 2Q7YA 43CAA 4Z95L 4M5YL 5HGDA 3GHBL 2RJMA 1KTLA 1LEGA 2KQMA 1RD6A 3NAAH 1TNMA 4L4TE 1IT9H 4H26A 4OLVL 1AGEB 1LNUA 3CFIC 2K9UA 4LSQH 2JIXD 4OZHF 4ZO8A 3WE6B 4MXQD 4XVSL 5T1KA 1ZHBB 3UAJD 3VRJA 1IC4H 2IPKA 1G7PA 2ZUQC 4ODWB 4GRMA 4XMPH 4OGZA 4ELME 3UTTD 1HKLH 3C09C 1WQVT 2G60L 2DM4A 2ICWI 2NY2B 5GS1A 4HCRA 1R3LB 3QXWA 5H37G 4DGVL 1X4XA 2ZOLB 3VD5A 4GMSH 1DLFL 5D7LB 5KSBB 4QXUH 4DVRL 4CMHC 2DLFH 4X98A 2CRMA 3U6RB 4PJAF 1V3KA 3O3UN 1L6ZA 2FJGA 3S98A 1I8IA 3DJ9A 3QWOA 4HIXH 3W2DL 5HHXH 1QG3A 1I3RB 5CSZA 1WAAE 1OTTC 1C12B 3TNNA 1M7DA 3LKNB 1RVFH 4NO2A 4NO5A 3L95B 1AGCA 3KYOA 4QYOB 1A22B 3C6LA 1G9NL 3AGVA 3N1GC 1QSFA 1Q8MA 3GI8L 4HUVA 3STZB 1FZKB 1IAOB 3PIQA 1RJZA 3R4DA 5FDWA 2Q8BL 5D7IB 4E5XA 1YEGL 2FEDD 4QOKE 4UMGA 4XWOC 5FGRA 2NXYD 4KVCH 4JRYB 5FUZL 1UWGL 5KS9B 5DJDB 2AQ2A 1CICB 3H3KA 5TH2B 4KUZH 5BW7A 3MUJA 1HILA 4Y1AB 5F93C 4FXGB 1N7ML 2NY4B 1H5BC 4JANA 4ELKB 1U8MA 4X4YB 1BZ7B 1NMBL 1OAQH 3VW3L 1MRDH 4L5FL 3QEHA 3CLEL 1T2QL 3LKQB 3D3VB 5D5MA 4WY7H 3Q6GH 2VKXA 4BSWB 3AU1A 2WWKO 4JKPL 4YHPA 4IOSD 3UZEA 2B5IC 2V7NA 3MUGA 1S7SB 2FO4B 2ZZUT 1D5ZA 32C2A 2WBJC 5D72L 1T7ZA 1NDMA 3Q6FB 4ZSOA 4EQ3A 5KANI 4M4PA 2EDEA 5K33A 4GW4B 4K8RL 4F15C 3B9VA 5C0CB 4Q9RH 1E28B 1PZ5B 3T0VA 4KJQD 3VFPB 4OD3H 4CKVX 3TPKA 4OQTH 2WINB 2ZOKA 1SY6L 4D9LL 4FXLA 4JHWH 4CVXB 5HHQB 2DTMH 4ONFL 4P2OC 5C09B 2X4NB 1HH9B 3ZKMC 2VXUL 3AAZA 3IS1X 1MLBB 3MV7D 3OKKA 4OIBA 5KANG 3KR3H 3FTGB 1A6AA 3UPAA 2EC9U 3UTSB 1F8TH 3MGAA 5GSVA 4KJWD 1GPOH 4PJ7E 1YPZE 1JCKA 4RBPK 2O26U 2I25N 3WKMH 1P7QB 4HFWA 4QHKJ 3MV8B 4OCXH 2VR5A 3K81A 1PLGL 5KW9H 3PNWB 4RMTA 5DYOB 4RAHA 4X9IA 1FZJB 4EJ1C 2K7PA 1UADC 2X1XR 4LEOA 1PG7L 4FQ2L 3PJSA 3TJHC 1MPAH 5TF1H 2FR4A 2DJUA 3IAQA 2YRPA 4AM0A 1I7ZA 5SX4I 1PYWA 5GGTL 2HKFL 3GMPB 3OG4B 3LZFL 4XP4H 5I15H 3RAJL 3QQ4A 3MTRA 4K7FB 4OCLC 1GL4B 3MBXH 2XQBH 3OXSA 1CFNA 4ETQB 4P4KC 3T8XA 3H42H 3MUZ1 1Y6MR 1A9EB 3MYZA 3W9DA 2NY7L 1H3UA 5EU6D 2YD4A 4U31A 1RHHB 1A7RH 4OM1H 2ADIA 4PJBB 5JUEL 1FVDB 5HVFB 2PTTB 2CPCA 2EDWA 3ME0A 4GG6A 3ARBC 4NYLA 5J1SC 1LO0L 2EE2A 3D39A 3GSOA 3LHPL 2R1XA 2EXYC 4FQCH 1ZT1A 5EO9A 2DQFA 4WTWA 3UTTE 4HKBA 4LLVA 43C9A 4NFBA 4P2RB 4CAGA 3QCUH 3WS3B 1MJJA 5IB5A 3AROA 3I6KB 1B6DA 3VWJA 2FGZA 5T1LD 4GXVL 4ODXA 4LQFL 2VQ1A 1HXMA 2D4FA 4EXPX 2RB8A 1S78D 4U6VH 4FFVD 5I8OH 1I7TB 4CGTA 5HHME 1CGWA 3SDXA 3RTQA 3T77A 2OI9C 4LARH 3NH7H 5GZND 5MEPB 4N8VB 5DHYB 5GRZA 4ZS7L 1QFWH 3KPSD 5MEOB 1Y6NR 3PF2A 3N1PC 3VFVA 1J0KA 5IHBA 3SY0A 4FFWC 3MRBA 1J1OL 1RZKC 2W38A 2PTVA 3BUYB 4K94C 1CYGA 1NEUA 2YD2A 4RZCA 4IRZH 4XMLH 5B38A 3GSNH 5EC1A 1G7LA 4N68A 3VU2A 3GK8H 5LAXA 3WHE0 1TZIB 2BMKB 2GAZA 4FABH 4TUJB 2I9LB 1A9BA 3K0WA 3ULVC 2QKIB 4HKZB 4P3DB 4KK9D 5KTEH 4DEPC 3ZE2F 1KPUB 1MJ7L 2Z31D 3V0VA 1CDJA 5CJQH 3ORJA 3I6GA 1E4KC 1A02N 3GMNA 3EDJA 4TNWF 4JFFA 4D9QD 5KSBF 5EUKB 3X17A 1K6QL 5EU5B 1OTUC 4M93B 1N2RB 2WV3A 1YY9D 5DMGD 3WLWC 4FRWA 3V6ZB 4E42B 4UAOB 5FO8A 3HRZB 5DC4B 3S35L 4OD1L 1C7TA 4HWBH 3D9AL 1MHHB 2PO6C 4YK4C 3DMMB 4LCWB 3ROOB 4K55A 2MOVA 3QUXA 4OUUB 2Z35A 1NAKH 1C1EL 2WSKA 3TBWA 1GZQA 2HWZL 4KJPC 5E5RB 5DJZB 4CJ0A 1TQCB 4E41A 1ZEAL 4QRQB 3TYFA 5TJWK 3TWCH 3JVGC 4X6DB 4OLWL 2NXZC 5IFHH 3FT2A 4Z7NF 3PWVA 3Q5YA 1UYWH 3FT3A 3MV7E 1Q0YL 5D7IF 4Y5XB 2O5XH 2FZ3A 3Q0HA 3E1F1 3PV6A 2GK2A 3U2SA 5KS9F 4U6HB 4O4YH 4MX7B 5K9KA 5KVMC 3VXOA 4CUCA 4YAQB 2BOBB 2OP4L 3BT2H 3SDAC 4P59H 4F8TA 1JPSL 3UTZB 4P9HH 1FBIL 1TIUA 4NQDB 4NZTL 4YBQD 2XRAL 5DJAB 2WW8A 3ARTA 1VFBA 4XWGH 4PRPB 5FA4B 4JM2D 5MEQB 1JHLH 4OF7A 3U83A 4L8DB 4JFDD 2X4SA 1RK1A 4OUOA 1YYMH 4YUEL 4L9LB 2XTJC 3EJZD 3RL1B 3L5IA 3LH2H 4N9GA 5J1TC 5F88A 3ZE1E 3EOAA 2CR3A 1CIDA 4GKSA 3SE8H 4I48B 3MV9B 3MJ7B 3X13B 3P73B 3PWPB 2F8OA 3MGTA 4PJ5A 4MNQD 1IT9L 5DUML 1KC5L 1RSFA 3U46A 5EU6E 5EA0H 4ZAKD 4RBPH 1BJ8A 1IC4L 3S36X 3WEXB 1V8HA 3MXVL 3N9GH 4XMPL 3V5HB 2FHBA 4EOWL 5HYJE 2HTKC 1W0WB 7FABH 2E6JA 3S37L 2APBA 2VDOL 3C6SB 1QZ1A 3OHXA 1XZ0A 1HSAB 5FF6A 1OD9A 3SE4C 5KVDH 4GMSL 4YH6A 4MLSA 3SGKA 3U36A 1PQZB 1UM6L 1YC7A 3THML 5I1EH 3CU7A 2GI7A 1I7RA 5E8NA 1KCKA 3C8HA 3BX7C 5KVGH 1GOFA 1ZWIA 2J5LC 5FM4A 4P4RB 3O8XC 1VADB 4FP8L 3SKMA 5IM7A 4OD2A 4HIXL 1UT9A 2F53A 1BX2B 2GITB 4RMSA 3TVMC 4P5TC 2X4UA 3KPNA 2VL5B 3G5YA 3GMOA 1RUKH 3ARGA 1G1YA 4JFED 3GRWA 3KPSE 2VDRH 3JTSB 5ACMA 2E7LC 1JGDA 1BREA 1JWSA 1MI5B 4R2GC 2V2XA 4YR6B 3HUJE 3BZEA 1F3JA 4PJBF 2AXJA 1CWVA 2UVEA 2NW3A 2X10A 1A21A 3N1FC 3N1MC 4X5LA 1BD2B 2Y1VA 5EO0A 3Q5OA 3BMVA 1NC4D 4DGYL 1QSVA 2QADB 2VZTA 4JG1L 3SDDD 4N0FB 3OX8A 1BAFH 2E3VA 3EHBC 4MNHA 3ZO0A 4URTB 4PV8B 2YEZB 4UB0L 3RGVC 4IIQA 2PF6A 4HJGA 3M45A 1K4CB 1MRDL 4CMMB 1I3GL 1CLOL 3OKNA 1A47A 3E6FA 1G6RB 2A6JA 4JZJC 4NQCA 4D9QE 3Q6GL 1IM9D 1DEEB 2X89D 3RWJA 3O6LH 3VA2C 5DK3A 3RWDB 4J23A 5F7UA 4Y16D 3FQTA 3VXRB 4U1LA 4YHNA 3VRLE 3STBA 3KAAA 4FOMA 4R7DB 5F9JB 4G6KH 4EKXA 4YDVA 1OAZL 5DD3H 1GXEA 3LQAL 3I75A 3DX9A 3L3GA 3QWRA 4OQTL 2M26A 3VJ6A 5I6XB 1SM3H 35C8L 4JJ5A 3I50H 1KELL 4N0RA 4NBZB 2C3XA 4Y4HC 3TBVB 3ZTJG 3BN3B 5CEZD 3BMWA 2UZIL 4JDTH 1EUUA 3UJIL 2P45B 5BV7L 4H20H 3TN0B 4QGTA 5EZLA 2GTZA 3BPOC 2EC9T 3V8OA 4RGMB 3ULSA 2W60B 1GPOL 2DQGH 2H8PB 4PJHE 1KIRB 3IFPB 4O5LL 5IK3B 5IMKA 3WKML 2ICWA 1MCIA 4OCXL 3NPSC 3FB5A 5ESQA 2PYEB 5IEKB 4XCFH 3CFEA 4GSDH 1N3NB 1T89C 3E0GA 4W4NA 4Z8FH 1CN4A 3HS0A 3PWUA 5E94A 1EGJA 4O58L 4R0LB 2H6PA 4X9FA 4V1DD 1X5LA 3IJHA 3OWEA 4U1HA 4ZFOB 4XPBH 3OKEA 1MPAL 25C8L 1YEJL 4FQQB 1JYVA 2A0LD 3RVUC 4OJFH 3MRJA 3I2CH 1EZVX 5E9DD 4X5WA 4XP4L 4F80A 5I15L 4JFDE 2H9GA 5FCSH 2DQIH 2YA0A 3MREA 3UDWA 4YLQT 2XQBL 4YFLI 1NGPL 1JGEA 1Q1JH 1DTUA 4D3CL 4ZPTB 2OR9L 1D9KB 1F00I 5ICZB 4X6DF 4TTDD 4J4PD 2W65A 5DVMA 4AIZA 2PXYD 3MO1A 2B2XL 4LLYB 1A7RL 4PY8J 4ALAH 4MNQE 4UTAH 4BZ2H 4LFHD 3JUZA 1UKQA 3S3PA 5IHZA 5DI8B 5BOPA 3GGWB 3BDYH 1K2DA 1MCJA 5DRZA 2OQJA 3V2AR 2NR6C 1A7QL 3OKDB 3QCUL 2X4TB 5F97E 2WP3T 4JR9H 4LOUD 4B50A 2NY5C 4LCCC 2VITB 1SJHA 5BRZA 2Q76B 4X5XA 4BYHA 5I8OL 4HIJA 4UU9B 1OGAB 1X5YA 3VD4A 1OW0C 2A6KB 1XF3B 5EPMB 1O0VA 2QQKH 1F13A 1CD0A 3U9PH 3BYYA 3RX5A 2C1OA 4U6TA 1UFUA 2EYTA 4PJIA 3VMOA 1W0VA 4JFEE 4P3CL 1OWWA 2VC2H 4R97B 5E6IB 5BMFL 4XMLL 3RZCC 1VEPA 3QFJB 3QPXL 2YUWA 3GSNA 2EIDA 5CSGA 1F3RB 3RIAF 1PW3A 4CU7A 3OR6A 3FONB 1HOCA 1KFAL 4PRID 1UZ8B 3ECBA 3QUYC 2BVQA 3BN9D 4KKAC 1DN2A 3M8OH 4GG8B 2P46B 2VL4A 1ORQA 3HPJB 4KXZH 3BIKA 4M6MH 5CJQL 4Z7VE 4PJ8D 2F74B 3BE1H 2NQCA 5JNYB 3RY6C 3CFKB 3B8SA 2NYYD 4JFXA 3LQZB 5C7XH 1TJIL 3WNOA 4NZUH 5FO9B 2BY2A 3DUHA 4HWBA 1JHTB 5IVZB 3NFNA 4FQHB 4S1RH 1RZFH 3EO1B 3T08A 2PN5A 4XPHH 3L3DB 2MPAH 5FOBB 3QG6A 3VGEA 2NX5B 1U95B 1CU4H 1HQ4B 3HCVB 3D25B 4PJCE 3MJGX 1QFUH 4UV4H 1U8NB 1A64A 3RNKB 3EFFB 5D2NB 3PGFH 3PDOA 1FNGA 1DBKH 5IFHL 3O6KH 5D71L 5FGCE 2EH8L 5C0FA 3DETD 3TEUA 2X9YA 2O5XL 4CVZB 2JK5B 2AXHA 3OPZH 3MFFB 4KFZC 1A8JH 3ULUF 2PYFB 4NKOB 3BEVB 3JV5A 1U58A 1TENA 3GB7A 5ID0B 3O3EB 4HUWA 4MGXA 1CD1A 4NOBA 1U3HB 3NZ8B 5E1AA 5IBUB 1NGXA 5IOPB 4XWGL 1T1WB 4U3XA 5K59F 2ENSA 3P11H 5A1AA 3BGAA 4PJEB 4OCWH 3BEWB 2YD6A 4MS8D 2V9TA 1G7IB 5E9DE 3ZE0F 1JPTH 4RRPG 1FVEB 5C0GA 3RIAK 3WFCH 1MCQA 2XWJA 4WENB 4NC2B 2C1PB 2ZP0T 2FD6H 2HT4D 1RZGA 5E8EA 1DFBH 3SGJA 4NQVB 2R0ZL 4Z7OE 3QEGL 4FNLL 9CGTA 1JV5A 5KSVB 4KY1H 3QIBC 4YHOH 2BFVH 3I9GH 5C0JB 4MA1C 1K4DB 3AS3A 1VKXB 2VH5L 4K2UH 3W0WD 4ZD3L 4KI5C 4XNQB 5A2IH 1S7VA 5IQ7L 1P4BL 2BVYA 2RAMA 4FQJH 4YZFF 3VH8G 1S7UB 3C6LD 4UOW0 3WN5C 2Z0BA 4IJ3C 1CE1H 2DMBA 2Z93A 1M71A 1QRND 2J8HA 3WNNA 5GISH 3DGGA 1E27B 4LSSH 1A6TB 1ND0B 3J8F7 5LG1A 5CGMA 4DW2L 1NBYA 1SBSH 3LOWA 4KKNA 5GRJH 2GJZA 3VGFA 3GMMA 4QXTA 2WQ8A 4ZUUA 1I1RA 3PGCA 1QLRB 4L29A 4PJXB 1F58H 3WFEH 1N5YH 5F6HJ 4LVOC 3ZHLA 2VDRL 1CFQB 3EFDL 4F7TB 2F5BL 2HTLD 1NCUA 2OL3B 4G8GB 1INEH 1C5CL 3UYPA 1T4KB 1ACYH 1PFCA 1T0MA 5I2IA 2YRZA 4CMHB 1MUJA 2GSGB 1T20A 4Q7DA 5CKAA 5A3ID 3CXHK 5FO7B 5C08A 4Z18A 2WMPA 2UWEB 3HR5B 1IAIL 4MD5A 1JHKH 3VXTB 4PRIE 3CFCH 3EYVB 1EJOH 5JIHA 4C56B 3ILQC 2BNQD 4GQPH 4ZS6D 4JFOA 3VXNA 1IAKA 4DN4H 5C0EB 1R3KB 3B8YA 4PJGB 5SWQB 1VGEL 4XNYH 1P2CB 3O6LL 3QDJE 2HVKB 2BNRA 2FRGP 5HPOA 2J8UE 1KJ2A 4G8EA 1CLYH 4ZTPH 4Y4KA 2DYPD 2J88H 4IMKC 5SWZB 2NTFB 3KLHC 2R69H 1C5DA 3FQXB 3WHXA 4XCYA 3IDXH 3CUPB 5DHVA 5DD3L 3MLPA 1HK6A 1QFWM 5LBSH 4RGOH 2WLYA 2CDFA 1SM3L 1J88A 5HI4C 2CK0L 5C0BB 1AI1H 1J05A 5CCKH 2F8VA 3LKRB 3QIUB 3V0AC 4WW2B 5ITFB 4ZOBA 3UPCA 4QTIH 3MBEA 4FZEH 1KLUB 2XOTA 1RHFA 4B7IA 4XI5C 4ZFFA 3F6LA 5D8JH 3MOAH 5AD0B 1V3MA 3EKCA 5ISZA 4PGEA 3RFZC 1VACA 2DQGL 4AMKL 4HGWA 3U0PB 1IGTB 3C5ZC 4XGZA 2FJHB 5J6HB 3G04B 5CD5C 1NFDF 5F9WC 1XF5B 2I9TB 4XCFL 2XQYG 4GSDL 3O2DA 4Y2DC 1F6FB 3W11C 4Z8FL 2DDQH 4KMLB 4XHJC 5DMJB 5EUOB 1KIQA 1TJHH 4P2OB 3IKKA 1X5KA 1WBZB 3KPLB 2PW2B 4XPBL 4TSCH 3LPWA 2AJVH 4TVPD 3OB0K 5EORL 4LLUA 3V4VH 3X12A 4LQ1A 4OJFL 5KN5B 4L8CA 1RI8A 1CXLA 5BJTB 5KG9B 2GCYA 3B2UC 4J1UA 5CEYA 3LEYH 3P9LA 4O00A 1JWMA 1RZKL 5DHXB 1QVOB 4JPKH 4K94L 5J12B 3CH8A 1LD9B 4XAWH 4PRDA 5DMKA 3NFPB 4QOKB 2YWZA 1XAUA 2F5AH 3G5XA 3VWJD 2OX5A 4TULL 2HJLB 3MSPA 3QG7H 2OTWA 3V4UL 4U2ZA 3MRLA 2H3NA 3EZJB 5IJVB 3O3BB 2H26A 1JFQL 4G6AD 4QGYA 3GI9H 2XN9B 1HHKB 5I66B 4IRJA 4HK0B 1U91A 1I1AD 1RIVH 2P44B 4F33A 2NY3B 5L2JB 5AG9A 4RIRB 2F58H 4JZOB 3W0WE 1RULL 2FSEB 5F7FA 4QRRA 5CLWA 5FUOH 4O02H 4X7FC 1MAMH 4RGNC 4JR9L 4IRSD 1KT2B 2R2EA 3TYGL 2XXCB 5JDSB 4NUJA 1CE6B 1GOGA 3DVGB 4EDWH 1QRNE 1A6VL 1A7OH 3OAZK 1F42A 4U05A 4KAQH 5JW4N 3B5TA 2FECL 3P2TA 4J2XA 2AEPH 4KZDH 4PJEF 3OV6A 1AGEA 4MAUH 3JXAA 4JPWL 3U9PL 2CO6B 3WFZA 3FB7B 5EG6C 1Q9LB 1N5AA 4APQB 3QXUA 3H9SB 4JFFD 5TDPA 1I1FA 3QQ9C 4P46C 5FV2A 2F54A 3HAEB 4OIAA 3RVTD 1BBDH 4R4BB 1JGVH 2X4PA 3QXTA 4M02A 5EBLA 1T21A 1R3LA 4JQIH 4DZBA 3BUTA 3FRPG 1ERNA 5GS0C 4X7EC 4HWUA 3K4AA 3SPVB 1TNNA 5DS8B 4ZSOE 3ZDYE 3SQOH 1U92B 3ZYOA 4M6ML 3HE6D 1SYVB 1KN2H 3BE1L 2IEPA 4HIEA 4JGUA 3KLSA 4M7LH 5BVPL 2BNQE 3QXAA 4Q0XH 2IMNA 3JWOC 3LAFA 3MRPA 3RVWD 2J6EH 5CSBA 5CMAB 4X6CF 1XGRA 3QEQA 3QDGA 2WIIB 1F90L 5L9DL 3K2UH 1GRWA 1KENH 2OJZH 2EKSB 1LO3L 5HHOD 1ZGLB 1H3VA 4MAYC 3H9YA 3SKJH 4S1RL 1RZFL 4PG2C 3K8MA 3C5JA 1UXSB 4PJXF 4MQXD 4JO1H 3ZZ1A 1IAOA 2A6DA 4NWTH 4H88H 3C9NA 5T1DH 1SJXA 3GDBA 3GO1H 3P0YH 5HPMA 4IEFB 5JW4M 1EK3A 4NNPH 4P2YA 1QFUL 3SHSA 3MOBH 5K9JL 3ULUH 2R0WL 3PGFL 4JFYA 1AQKH 4XRCB 1AGBA 2GHWB 1FDLH 2VRAA 4WW1B 4ZUWB 5I73C 5MENA 1BZ7A 5E08H 1G6RH 4S0TD 4XCEB 3X14B 4NN5C 2UWEF 5E8DH 4JVUA 1BFSA 5BZWA 3LKQA 3OPZL 2UV3A 5AYQA 3WNKA 4Q9QH 5D4QA 3O2VL 2NW2A 4NKMA 4PJGF 3D85B 2GSIB 3PWJA 2WP3O 3FRUA 4U1NA 1HSBB 1BFVH 4WTZA 5FGSA 3VFPA 3BWUC 1NMCB 3G6JB 5I0ZA 5F7LB 2V9QA 1SBBA 4TTGA 4LKCA 4QXWA 2Z9TA 1ADQA 1S7RA 5HHQA 5F7DA 5C09A 5IROA 1EMTH 3P11L 4LCIL 3B3IB 1G0XA 5ICXA 3BH8A 3SCMA 1GGYA 4TVPE 4LP5A 4OCWL 2R2BA 1SVCP 5IW1B 1DN0B 3UTSA 4QNPE 3QB7C 1JZ2A 1JPTL 3DTXB 3MRRB 3TT3H 4PJDE 3WFCL 1WEJH 2VE6B 2X4RB 3BGMB 4P0DA 3TESA 4WW2F 2VWEE 2FD6L 3DROA 4JRXA 1T22A 4LSPL 1DFBL 4G42A 3G6AA 1I9RL 1P9MA 4KY1L 2FX9L 1OQOA 5EZIH 1YEDB 4YHOL 3CK0H 1XCQB 3MRIA 4WU5B 5DYOA 3I85A 2IBGA 3FAXA 3QH3A 1AC6A 3WXVL 2VLRA 4QY8B 1LQSR 3LB6C 3ARGD 2EEDA 1FRGL 1EFXA 1CE1L 1FORL 5EUOF 4PG9B 2HFEB 4K7FA 2VIRB 4P23A 1HCVA 2IADB 1X6LA 2VXSH 4RISH 5K9OB 5B39A 4L3CB 1EHXA 5GRJL 5DD6B 5IT2H 1RHHA 4JDVB 1JNHA 3HE7C 1BJMA 1I3UA 1F58L 1PY4A 2PCPB 3ZL4H 4NO3B 5C0IA 1F4XH 4UIKH 5IWLA 2PTTA 2G75A 2V5RA 5DWUL 1AY1L 1Z9OA 5I76B 1JK8A 5FGBA 3STLA 2DL9A 2G5BA 3BP5B 4XZUA 4GBXC 3IJSB 3L1OL 4NQCD 4WJ5A 1HI6B 1A7PH 4MSWB 1R24A 3H3PH 1NQBA 1ACYL 4RAVB 4TSBH 1SEQH 1CR9L 4LLMB 3TO2B 2O5ZL 3B6SB 4HQQH 3PABB 4QO1A 2Y5TA 1QFWI 2VXVH 4JY4A 3O8XB 4Z7WA 3SE9H 3BWAA 3AS0A 1JHKL 1VPOH 2XKSA 3NIDE 4QTHB 1YA5A 3PV7A 3QWRD 5IVXE 2W92A 2VSDA 2XZCH 3WUWG 2JELL 1A1NB 4WIQA 1F4YH 5MEPA 1JN6B 1UGNA 3EGSA 5SWSB 4OT1H 5DDHA 1S5IH 4XAKE 1C16B 4XNYL 2UZYB 5ILTH 4L8SB 2MQ0A 2BXYA 5A2FA 1CLYL 1J1PH 2AAVA 2P8MB 3QFDB 3QZWB 4ZTPL 1RZ7H 2VXQH 3VXQA 1ES0A 2R69L 5HHOE 4XH2A 4WI7A 4BH8A 4JHBA 1ZHNA 4Y4FC 3MJ9H 4NKIL 3J7HA 1KG0B 2D2OA 5LBSL 3CFBB 4UBDC 3UPRA 2QKIA 1AI1L 1YPZF 2QLVB 4HKZA 4P3DA 3I3BA 3RGVB 1KSRA 2JJTC 3NN8B 2ZWLT 1FL6A 3VXMA 1UWXH 4M7LT 3OF6A 5I18L 1FC2D 4JZJB 4FZEL 5GGTA 3BJLA 2E9JA 3QPQD 1YDPA 3D69B 2ZUWA 4S1QL 4ZO7A 5EU5A 1Z0MA 3WJLA 5EC2B 1U8KB 3DV6A 2IAMB 5D1XA 5DA0B 5C0RH 4E42A 4UIMA 2DKMA 1YMMB 4RWHA 3LV3B 4OF3A 5T1LB 1UB6B 1U8HB 5CILH 2HRLA 2FBOJ 1IGJB 2IBZY 3AREA 2B1HH 3TT1L 1XIWD 2JTDA 3P0VH 3TIDB 1OARH 3PDDA 4U1IA 4F58L 3FOLB 4QRQA 2EE9A 4Y4HB 3VGGA 2AJYL 4Q97A 3JWDH 1RK0A 3V4VL 3UBXA 1QFPA 4FQIH 1QNZH 3LEYL 1T3FB 3IDUA 1T83A 4KRNA 2XWTA 4NFCA 3VFWB 4G9FA 4PFEA 4Y5XA 4Q9BA 4LEXH 3NPSB 3BJ91 1CLCA 2F5AL 1B2WL 3MRGB 4Z7QF 5FECA 3QG7L 2P1YA 4HX1B 4I3RH 5BRZD 1VENA 2Z31B 2YWYA 4WCYL 3ETBF 3E3QE 4HS3B 4EIZC 1RIVL 5E5MA 1JYNA 4YHLL 2YS4A 4OBSA 5A40E 1UWEH 4LSRL 1MCWW 2F58L 1A1OB 3D18B 1KCVL 4GRLC 3DO3A 3WIFB 3QDHA 1K3IA 1MAML 5IB1B 3LKPA 4WO4B 1YN6B 1FN4B 3QO1B 4TUKH 3H3BC 4ZNEE 3W9EA 2MKWA 3G6JF 3U7AA 3S36L 4YDJB 1U8QA 4H1LH 2APFA 3S4SG 3IDJA 2A38A 1LO4L 2C3HA 2HMIC 4MXQC 4NKQB 3MJ7A 2KZWA 2OTUA 1FG2B 3UAJC 1UVQB 2D31B 4POYA 4KZDL 5F7EL 2W59A 4PRHB 5TFSH 4Q74A 3H2WA 3NZHH 3FCTA 4M43H 4PGBA 1FYTA 3DRTB 4ORGA 2QHLA 3F7YA 2ORBL 4ZQKA 4WWKB 4E0RA 4MHHI 3V5HA 1RU9H 1AKJB 3ZKXC 5J89A 1LDPH 3VFMB 3ILPA 3C6SA 1CL7H 1OGTA 1S7TA 3OKMA 1WTLA 4NQEB 5LWYL 3QA3A 3ARRA 1PVHA 5GGSB 5AYUH 3VFSB 2HLFD 2A74A 4LHUA 4XC1H 4C55A 2CDEB 3DWTA 1C08B 2BSTB 5I1HL 3LRSB 3ARFC 3HNVH 3REVB 5IF0A 4MHHG 4WI3A 4DCQB 3P30H 3QRGH 1KEMH 3O45A 1INQB 4WFED 4M6OL 2VLLA 2YK1H 3CFDA 2BVPA 5F3HB 4JM2B 4Q0XL 1P7KA 4JFDB 4F57H 2J6EL 2VLKD 1RFDH 3KYKH 4OZFA 1QR1A 5IIEA 2OL3H 1KXQE 5JIPA 3FO1B 3F58L 4U33A 1KIPB 4XTRD 1MI5A 3TZVD 4LNRA 1OT2A 3SKJL 2P49B 1BQHB 4PLJD 4OGXH 5H2BB 5L6YL 2BHYA 2NXYC 4J3VA 3WLBA 2R0LL 4MNQB 4PP1D 1RY7B 5TDOB 1AHWB 3HZYB 3K1KC 3GO1L 4AT6A 4ZAKB 4JN2B 4NIKB 4EN3C 2YPLD 3QI9D 3MOBL 3ULUL 4NNYA 3IVKB 2Y06H 4PPTA 3PGDA 3WDHA 4CBPA 1PY9A 1G6RL 3DRQA 4MDJB 1AO7A 4LHQB 5D7JD 5FHAL 4L3EB 1NAMB 1YNLH 2ZSWB 5IFAH 3MRMB 1CXEA 4HKXB 3HC3H 4NZRL 3SO3B 1Z3GH 3T65B 5C07D 1AGFA 5F96L 4QRSA 4Q9QL 1MOEA 3WXWH 4M48H 3VXRA 5KOMC 1KEGH 4BUHA 3ZE1F 4R7DA 2D03H 2H2SD 5IG7B 4OCSH 4ZTOL 3FZUD 3HMXH 4N0UB 4PJFE 4ODVL 3KWWA 3O6FD 3GBNL 5A2JH 4HHAA 2FHFA 4U1SB 2GUOA 3CDYA 4KJWC 3EOTH 4PB9H 5LQBH 4WHTB 4R90L 4ZYKB 4H8WH 4XCNB 3Q2CA 5D70H 5HYSB 4YGVB 5LJYH 8FABB 3HB3D 3TT3L 3VXSA 4ONGH 1F3DJ 2C7UB 1AH1A 1KIRA 4BKLA 3BISA 3IFLL 3IFPA 4B41A 4WEBH 1CGSL 4Z7VB 2GK0B 3SDDB 1AIFA 1A2YB 2NY6C 2YD9A 4TUOB 1OAUH 2BDNL 2NZ9D 2GFBB 4X0KA 1YY8B 5DD1L 4Z7UA 4MD0A 2MMXA 3IXAB 1P4LA 5CEXB 3DECA 5INDB 4CN6A 3L7EA 4JO3H 4K7PH 5JOFB 3HPLB 4K3GA 1JF1A 5TE6L 3GSRB 3D6GA 1FQ9C 3MRKA 4KTDH 3IDNA 2Q6WB 2VXTH 5F9AC 3GMQB 2NY0D 3DBXA 5F70A 4UQ3B 4ZPTA 5C08D 1U8LA 2IH1A 5IMOA 3BXNB 1G84A 3HI6H 5I17B 3RWGB 5IT2L 2YMXH 3HUJF 4O2FA 5FEBA 2DB8A 4P3WA 4NN7C 1OP9A 4X9GA 4EI5C 1WICA 3RNQA 4XPFH 1INDH 2V2TA 1OPGH 4UIKL 2Z4QA 4N5ED 1ZOXA 1NEZB 3MJ8A 1XGPA 4JLRA 5D2LE 1YC8A 3RA7H 4R3SB 5JR1H 4HFUH 3H3PL 2VUOA 3U9UB 2FECI 1EEYA 1SEQL 4F7PA 1S78C 3O2WL 3OKDA 4XNXH 4Y4KD 4DOHE 2Y6SC 4PY7A 3M17B 2R0KL 5T1MA 3SE9L 2VITA 1LP9A 5KSAA 2YA2A 4Q9CA 5IMLB 2L7UA 2YXMA 4ENED 4V1DB 3VRIA 1PKQE 4NCC1 5JQ6H 1F4YL 3DSNA 2RGSA 4I77H 4PJ9A 3TF7C 5H8DA 4WFEE 1DQMH 1ZVSB 1YUHA 3VWKC 1I9IH 1VFMA 4NT6A 4OT1L 3IDYB 3MBED 1EDQA 4L4VE 2IGFL 2VLKE 3HAEH 1YNTA 4AEIH 1AE6L 1RZ7L 3B4NA 4KXZI 1RIUH 3SJVA 1T1YB 3MR9A 3TA3C 2GQHA 5JHLH 5ISZD 2R1WB 5D6CA 1FH5L 4QRUB 5DUBB 4KK9C 2RFXB 3PQYA 4HIIB 3ZT7A 3CDFA 2AK1L 4LIQH 4PBVC 4NN6C 2D0GA 1UZ8A 1CI5A 4YPJA 5HGBB 2GJ6B 4QCIA 1EEQA 4XPGH 2YPLE 3BKYH 1YY9C 4HUXB 3QNZB 5DMGC 4XPTH 2QSTA 3SDCC 4CVWA 1G7JB 1H8NA 3MMEB 3CFKA 2AKRB 2B4CL 3EDKA 3HNSH 1RQ5A 5HYQB 2WBKA 4Y5YA 5I1LA 4AL8L 4M7ZC 1OF2B 2W07A 1KB5B 2JCCA 4JM2F 1ZSDA 1NBQA 5C07E 1QKZL 2PNDA 5DK0B 2E27H 3DX6A 1CZ8L 4MLIA 3ZT5A 2LABA 1NGQL 2FIKB 2AJZB 3CDCA 3O0RH 4UT9H 3CMOH 1EAJA 3HCVA 5JXAH 2RR3A 3JWDL 4EZMA 4QHLB 4IRJD 4K7PY 1TTUA 3L5WA 3M1BA 4JREC 5T3ZL 4RX4A 3BOVA 3MNZB 4HWNA 3BP4A 4QWWD 1UCBH 3QEUA 2F15A 5E8OA 3ARDD 3IU3A 3KPOA 3RWEA 2GKIA 4LEXL 5I8KH 5F9WB 4NGHH 4ZOAA 4QHUA 2HJKA 2DM7A 1DUZB 2EYRB 3GM0A 2FHCA 4ZXBC 3OXRA 3GBML 2PYFA 4NQXA 3BEVA 4I3RL 3H0TB 1BFOA 5IB2B 2VAAB 4JCMA 1XR9B 2FH6A 5GS0L 4OZGB 3VDBA 1MCHA 3O11B 3CC5A 4KDVA 4K9EH 4S2SB 5IW6B 4LSTL 3SOBH 1WITA 1UWEL 1YEEH 5EBMA 2WUCL 1T1WA 4CN4A 1CTNA 4HBCH 1OP3H 1UXWB 3BPLC 4Z78B 3GSWB 2YUZA 3SDYH 2NY2D 5CGYD 1LEKB 2P43B 3QJFA 1FIEA 5E2WH 3DLQR 1YNKH 4KDTA 4DZ8B 3V4PH 2BZDA 3F5WB 1IARB 4P9MH 1WBXB 3ZKND 2C1PA 3NVQA 1QSEA 3ZYZA 5C08E 3P4MA 3SGJC 1CG9B 5HD8D 4ZFGH 5TFSL 3L9RB 4K71B 1CGUA 5BZDB 4WNQB 2IG2L 1K4DA 2KDGA 3ES6B 4PRBB 4MCYB 3EO0B 2V2WB 5ACZB 1KTKE 5C0NC 5FCUH 4CW1B 1LDPL 4Z7VF 1XGQB 3EYUL 4N0CD 5T5FH 3QDGD 4RWYL 1S7QA 2YPKB 3TBTB 2ENYA 5FKAB 5AYUL 3TPUB 5I1IH 3JBG7 2Q7YB 5DO2C 43CAB 1ITBB 5GGUA 5HGDB 1KTLB 1LEGB 3BSZL 3HG1B 3HNVL 3GMRA 4LKXA 4I2XE 1A6UH 1MHPH 4H26B 2ZUSA 3WHE1 1LNUB 3P30L 3QRGL 4N90E 3BKJH 4DUVA 4RMUA 2GT9A 4KV5F 5T33H 5T1KB 1YJDC 5IW3A 3VRJB 2OK0L 2IPKB 4I0PC 1G7PB 1FLTX 1IC7L 1W72L 4GRMB 1Z6JT 4F57L 1GAFH 5HVGB 5FHBL 4M3KB 4QF1A 2DWEA 5GS1B 4PJCF 3SQBA 2YR3A 1MCKA 2XA8H 1GGIL 3QHTC 4G8GA 1KJMB 4UQ2A 3D3VD 3VXPA 2P24A 4OGXL 4K3HA 1AFVH 2X44D 2BERA 2GSGA 3FB8B 4X98B 4YDLC 2VDPH 5E2UH 4GKNA 2CRIA 2FJGB 4G3YH 3U30C 1DQLH 3KPRB 4HMDA 3QWOB 5CUSL 3RI5F 4XBPA 5TF0A 2VLJB 5CSZB 2AEWA 1XGUA 4OF0A 3BZFA 2CO7B 3TNNB 1M7DB 4KRPC 4NO2B 3QNXA 2AJSH 4N8VG 5C09D 5E99H 1AGCB 3KYOB 1IGMH 1VFAA 3LMJL 1YNLL 4XXCC 1XF1A 3C6LB 3SCMD 1A14H 1QSFB 4X7DC 1B90A 3UTSD 2EDLA 3WNLA 3REWA 5DR5L 5MI0B 4AG4L 1Z3GL 3V0WH 1SYSB 4HUVB 4R4FH 4YE4H 3D48R 3PIQB 1RJZB 2NTFA 5E70A 1ZTXL 5FDWB 1AC0A 4E5XB 3BQUC 2BSRA 1P7QD 1F6AA 3VFOA 1ZVYA 3FJTA 4HF5H 5IFJA 5ANMA 1HILB 2WBWB 3D0VA 3C08L 4JANB 1U8MB 1H5BA 2VZVA 1ZA3A 2VERN 4Z7OF 1TLKA 3QEHB 3TO4A 3QO0A 3UTPD 3EOTL 4LU5H 5LQBL 2DMCA 5D5MB 4H8WL 1T80A 3AU1B 4YHPB 4LVEA 1FO0L 1O5DT 1T04A 4TOYL 5GS3A 4ACPA 2E5EA 1D5ZB 1KACB 32C2B 1NDMB 1JWUA 2WBJA 3D2UA 5E03A 3T0EA 2D7OA 2QSCH 3G04A 5DC0A 4GAGL 1HQRA 2AJXH 1E4WH 2ZOKB 4HZLA 4L4JA 4XVTH 1NANH 3AAZB 1V5JA 3W81A 3OKKB 3W82A 1ZLVH 4K7PL 1A6AB 4WHCA 3JV0A 3K4DA 4NZJA 1A6PA 5GSVB 4WFGE 4J4PC 3VCLA 2AS5M 3U4AA 1UACH 4KTDL 2VXTL 2PXYC 4P2RD 4G7YL 4HFWB 5J4MA 3U0WH 2VB5A 2ZCKH 3VFTA 4YDKL 3G5ZA 2YMXL 2FO1A 5D7LE 5KSBE 2ESVA 4LEOB 3W39A 1QRKA 1GIGH 3GSVA 1OPGL 4XP6H 3VE0A 4D2NA 2FR4B 2XN9A 4KHXH 6FABH 3K8LA 5HDQL 3UYRL 5I66A 4AM0B 4X6EA 1I7ZB 2ZCHH 1OM3L 1PYWB 3PWLA 4HFUL 1IM3A 4JO2L 2ATKA 3QQ4B 5FYKH 1XCTA 1FNEA 3IJYB 4WV1C 1PG7X 3OXSB 4XNXL 1CFNB 1MJ8L 2W9DH 4LMQI 3T8XB 4P4KA 1FSKC 4M8QA 5GRVL 3W9DB 1Z5LA 1BQLH 1A3RH 1P1ZA 1MCOH 4Z7NE 2ADIB 2VR9A 5JQ6L 3EDFA 3LDBC 3WNPA 5EH1A 5D7IE 1I9IL 4PTUA 4GG6B 2VZ1A 4NYLB 1RZ8A 3ARBA 3ARSA 3D39B 3GSOB 3PXHA 5KS9E 4JRYE 2R1XB 1ZT1B 5GIRA 5EO9B 4OV6F 3H9SA 4Y1AE 4HKBB 3OJDB 5DRXA 43C9B 5GQBA 4GAJH 5DFVD 2CKNA 5TDNA 5IB5B 1FZOA 4TSAL 4OFYA 3R1GH 1WFUA 4F3FA 4ODXB 3D3VE 4LAQL 1HXMB 3ARED 1NLDH 4PJ8C 1QBLL 4P2QB 1WT5C 1MCPH 2ADGA 3SDXB 3RTQB 2CLZA 3T77B 1TVDA 3Q1SL 4HPOH 3A6BH 5KJRH 1D7FA 5BVJB 4D0CA 3C60C 3BKYL 1MCBA 3BKCH 1SYVA 3ARUA 4J3TA 5C0CE 5HSFA 1OP5K 2YZ1A 1ZLSH 3VFVB 5E00A 5GHWL 2E9BA 2HVJA 3SY0B 3MRBB 4JVPA 5IBLD 2C3WA 4X6FA 2WAHA 1NMAL 5CMAA 5C09E 4RZCB 1FFNA 2WIIA 5B38B 5EC1B 1G7LB 3CVIL 4LPTA 1T03H 3UTSE 2GAZB 4MJ6A 3S5LB 1A9BB 5CP3A 2E27L 4OCMC 4FQXC 1PDKA 5GRUL 4EEEA 1KCUH 5KSUB 4CVUA 1B4JH 3MV8E 4S1DC 3I6GB 15C8H 2XXMB 1E4KA 4LPYA 3GMNB 1MFAL 4JFFB 3ROLA 2HT3D 3NFSL 3AC0A 1OY3B 5F7WC 3IS0X 5FO8B 3FMGL 4YXKH 1NAMH 3FQRA 3X14A 2R56H 4J6RH 4HAGA 2PO6A 4MA3A 1CDGA 5D6DC 3QUXB 2Z35B 3RUGB 3B5HA 4Y19B 1OT1A 1HIML 1GZQB 1VERA 3T0XA 3MV9D 4U1KA 3L5XL 4OLXH 4E41B 3PWPD 3TYFB 4PBWD 2Z91A 4NQSA 1I4FA 4JFHD 4LBEA 1RUPL 2DAVA 2UY6A 3JVGA 3SOBL 3HLAA 4IOIA 3PWVB 3BAEL 4MS8C 3FT3B 5IROC 4PJBE 4K3JH 4XPAH 3B3IA 1FV1A 3H6JA 4AEHH 1JPGA 2FZ3B 3PV6B 2K1MA 3SDYL 3U2SB 4FA8A 3P4OA 4BK4A 5E2WL 3BD4A 3VXOB 4JPVH 1OSPH 1JZ7A 4HWEH 4P2RE 4HD9A 4P9ML 2VE6A 2X4RA 3SDAA 3V52H 1KYOK 1H3WM 3IAGC 1L4IA 5D5MF 1IEHA 1IGCL 1S8DA 2Q3ZA 5BS0A 4JO4H 2HP4A 4OCYL 4W70A 4ZFGL 4I0CC 1S9WB 1XCQA 1JF5A 2VZOA 3BYTA 5F1KC 2X4SB 1RK1B 1VB9A 4QY8A 4N9GB 2FBJL 5F88B 3MLUL 4N0YL 5T5FL 3EOAB 5DA4A 1HHIB 2ZG3A 5DJ0B 1J8HA 3MLWL 4GKSB 5CINH 1MI5D 5DVNA 5DFWH 3LN9A 2WM0A 3SGEH 4RMVA 2IADA 4XVUD 2NY1C 4PJ5B 1A6UL 1MHPL 5L7XL 3TV3H 3U46B 1FPTH 1BD2D 3DVNA 1IGFH 2QADD 4XNMA 1WZ1L 2X9XA 4LPCA 5CEZH 4JDVA 1IQWL 4LGSB 1GAFL 2HLAA 3HMWH 1IEAA 5DD5L 2DKUA 1K8IB 3QHFL 3HNTH 2HFGH 3IDIA 4XNZB 3OHXB 1XZ0B 5A3IC 2XA8L 5FF6B 4GLRI 4L1HA 1S7WA 2IQ9H 4WUUA 1Q94A 1RJLA 3SE4A 2B1AH 2R8SH 2LE9A 1AFVL 3U36B 5E8NB 1I7RB 4U1MA 3V6OE 5E2TH 4MMZC 2VDPL 4ORZC 4R8WH 5E2UL 3ARFB 4CU6A 3PABA 4NRYA 1ZWIB 3VXRD 3KJ6H 2EE6A 1JIBA 2DQUH 4LVHC 2V5YA 4LCWE 3O8XA 5IM7B 4OD2B 4QLRA 1MQKH 2F53B 3UMTA 2W1NA 1ZGLP 4JRWA 3ALWA 2X09A 1WIPA 4FTVA 2X4UB 4ZODA 3TVMA 4P5TA 12E8H 3KPNB 4JY5H 3G5YB 3CGTA 1BVLA 3MLYH 1JL8A 4CL7A 2AJSL 2EDRA 5E99L 5SWSA 4KK8C 2E7LA 1TPXC 1JWSB 4YHMH 5ENWA 2Y36H 5DFTA 2A83A 4YXLH 1A14L 4BA8A 5FAAA 5GSRA 4X6DE 1C16A 2NNAA 2V2XB 1KCRH 3P4NA 3BZEB 1F3JB 3MLZH 4R4FL 3O9WC 1CIUA 3VXSD 1QTYT 1BP3B 2ERJC 4BELD 3X3GL 3ZDXE 4UT6L 1QSZA 3W5MA 5EO0B 4LASH 1MFBH 4HG4K 4Y5VC 3OX8B 1TQBC 4HF5L 3MRNA 5F7YC 5I19H 5E24E 5CAYB 4BZYA 4IIQB 3RGVA 4R96A 3MODL 4HJGB 1CBVH 4YHYB 3OKNB 4HIHA 4M4RA 3E6FB 2A6JB 2EDOA 1CD8A 3EYFA 2H2PD 4NQDE 4JZJA 4NQCB 4XVJL 5DRNA 3IT8D 4EIGB 3D69A 3RWJB 5I74C 3SDXF 1QQDA 3E8UH 1EAPA 4HC1A 5FUCE 3FQTB 2DLHA 3RDTC 1KB5H 5FYLD 4YHNB 1U8HA 1FL3B 5L2KA 1S9VA 1WUNT 1KGCD 3MGOB 4OF8A 5LGKA 4JQXC 4UT7H 3I75B 3DX9B 1PAMA 3U7WL 1E4WL 3DVFA 3VJ6B 1NCWL 1JTTA 3MV9E 4JJ5B 5HDOA 3CH1A 3AY4C 1PEWA 4RNRA 3PWPE 4HZAA 4ZDHA 3FOLA 5LXGH 1X6NA 2GW5A 5JIKA 4JFHE 4LPXA 5H35A 5IBTL 2W9EH 1ZGLM 2VZSA 4UV7H 3KPMB 5EZLB 2GTZB 1QBML 1D5MA 5ICYB 1RZJH 1T3FA 3ULSB 1OLLA 4KRLB 2BVUA 1U8OA 1I7UA 3IRPX 1S7XA 5IMKB 2P5WB 1R0AH 2ICWB 3PDGA 3LPFA 4MDIA 3FB5B 5ESQB 3VG9C 3CFEB 1OAYH 4UOW1 2ZCKL 1YECH 1MRCH 4G6AC 4NSKA 3T2NH 1T89A 4OTXH 1HZHL 3LPGA 3HS0B 3PWUB 3QXVA 1I1AC 5E94B 1DP0A 2ZG2A 4M6NH 5IGXH 3IJHB 4U1HB 1DBAL 1OGAD 2AJUH 3OKEB 3C2SA 4OSUH 4KHXL 4PJ9D 4DK3A 6FABL 3B9KC 4HXAH 5C9KA 3TJEH 3MRJB 2ZCHL 4IRSC 4X5WB 5CJ8A 3D18A 1DUYA 2H9GB 5F6IC 2J1KA 4IOFD 2HKHL 5I71B 2JF1A 2IQAB 1N6QL 2IALA 1MI5E 4QHMA 5I30H 3QFJD 2W65B 4YDJA 4AIZB 1KLGA 4H1LG 3MO1B 4EI5B 1FG2A 1CFBA 3PHQA 1D5IH 4AH2A 5K93A 1BD2E 2Z92A 2C5DC 1A7NH 1A4JB 3S9DB 1V7NH 2EDTA 5IHZB 4CDGC 1R5IA 3RVTC 1UM5L 3UC0H 5EU7E 3NGBB 5L88H 2DIJA 1K2DB 3FOMB 5DRZB 3ULUE 2XZQH 2IH3A 2OQJB 1AXTH 4NO0A 4YFDB 1RUAL 4UDTB 4N5UA 1CFTB 3VFMA 4ZUSB 4KKCC 2EICA 4J12A 3R1GL 4LCCA 5ELIA 1SJHB 1NLDL 3OR7A 5BRZB 3PP3K 3QULB 3HE6C 5GGSA 5AAMA 4X5XB 2MFNA 5K9QI 4YDIH 3MV11 1H3PL 4HIJB 1YEFH 3LRSA 3VXRE 4HPOL 3A6BL 5MP6H 4HGKC 1G7MA 3REVA 1OW0A 4DCQA 2DKSA 2XPGA 3RVWC 2NX5D 3BKCL 4HUUB 4OF6A 1ONQA 1AD9A 5JXED 2AK4B 1LEIA 4MB4A 2C1OB 4PJIB 2EYTB 1WFTA 2XG5A 1W0VB 5K9QG 1A7BA 4RX4D 4QHKI 4HCRH 3MX0A 3RZCA 3HI1A 3QUMB 4OQ1A 3WO3B 2E9IA 4JB9H 3DUSA 3OR6B 2MCPH 1NSNH 1HOCB 2YPVL 4YIQB 5H2BA 3ECBB 4D8PA 4GQ9L 4MJIB 5ALCH 2BVQB 3QUYA 3RIFK 5DVOA 2N4IA 3HZYA 4G7VH 5CZXC 1ORQB 3BIKB 1NFKA 3EYQC 2PYEE 3LKOA 4YZFE 3SDCB 4I9WE 3QAZC 3IVKA 4U1JA 3RY6A 1JNNH 3WIIH 4JFXB 3KHOA 1A5FH 2BHZA 2C3VA 1IKNC 4YXKL 4MDJA 1NAML 1EO7A 4R7NA 2R56L 4J6RL 3NFNB 5JOPE 5E6YA 5GGRY 4FQPA 1RUQL 3N06B 3QG6B 5FYLE 4KZEL 1KGCE 2B7DT 1LO2H 5CHNA 2XIDA 4UILH 5LGJA 2HH0L 3B9DA 5IG7A 4F9LC 3W5NA 4F2MB 3GJEA 3PDOB 1FNGB 4N0UA 1R3HA 4YQXL 5B8CC 1JUFA 1F6LL 2AXFA 3IXTA 5C2UB 3MRFA 4JN1L 5C0FB 1V7MH 4FMKA 5J11C 2ITCB 4AEHL 3DV4A 1NPUA 5HYSA 4YGVA 4BQBA 1CF8L 3CD4A 4ZXBB 1KCSH 4JM4H 2CLVA 1U58B 3KNBA 2C7UA 2MWCA 3E3QC 3GB7B 4ISVA 5ADPH 4HUWB 1QR4A 3WDIA 1CD1B 5AWNH 3HC0A 2WWMC 1GGBH 4JO4L 2ARWA 4XC3H 4IBLT 5AZ2L 5E1AB 2OZ4L 1OSZA 4EI6A 1CTOA 1P69B 5JIIA 1IZJA 1TFHA 1OGAE 1YY8A 4OLZH 3RWIA 1XGYL 4NC0B 2BSED 3LEXB 4MCZB 4G8GD 5C0GB 1QFOA 2XI9A 2XWJB 2YUXA 3OGOE 3BW9A 1MREH 4WFFD 5D1QC 5ID1A 1RZGB 5E8EB 1MIEH 2ZSVA 3L3OB 4U2YA 5F7NC 3WJJC 1JV5B 3DXAA 1NGZA 2CMRL 3QFJE 1FPTL 4X8JA 3CXHJ 3QIBA 3AM8C 2A9NH 4BH7A 3TNMA 3WIHL 3L3IA 5E4EB 2I27N 1GGCL 2YD5A 1FHGA 4A6YL 2OXHA 3MRCA 3S3SA 1S7VB 5FYJH 2CJUH 5IHUH 1A3QA 2D3VA 3WN5A 2Z93B 1M71B 3QQ3A 2R8SL 4I18C 3U1SL 3DGGB 1G0DA 5E2TL 3OAUL 5AUMB 5SWZD 1MHEA 2ZCLH 1NBYB 4M7KL 4WI9A 4O2EA 1MQKL 2GJZB 3GMMB 3V8CA 1FCGA 4QXTB 4ZUUB 4XWOD 5IVNA 3PGCB 1K9TA 4L29B 1CDIA 1ZANH 4TVPH 5C0BD 1BJ1H 2VDKL 1MCLA 3FN9A 2NX5E 2H32A 3PG2A 1QYGL 2BK8A 4EUPA 3RVXD 2OBGA 4YXLL 2AGJL 5D2NE 4DAGH 4P57A 5I2IB 3MLZL 1UJ3C 1MUJB 3BH9A 1T20B 3KYAA 4YDLB 5C08B 4LPWA 1YEHL 2CGRH 3D2UD 1GYAA 4LASL 4HIIA 5ALBH 1MFBL 1DJSA 2NZIA 4MD5B 3AXLA 2BVEA 1JZ3A 2P5EA 3O4OC 5F1OB 3VXNB 1IAKB 2YD1A 5JA9A 3CX2A 4XCCL 4P2OD 3QNZA 1IGIL 1F4HA 1MFEH 2VDNL 5J9PB 1AXSA 1CGVA 4XP9L 1NJ9A 2BNRB 3MMEA 3G5VA 1KJ2B 2X1PA 3BI9X 2J4WH 4G8EB 4Y4KB 4ZOEA 5JW5A 1XIWC 1JNLH 4IMKA 2IBBA 4QT5A 1C5DB 5GRWA 4PJEE 4XCYB 3WHXB 5E8PA 5DHVB 4HW6A 4PJIF 1RPQA 2CDFB 2CIIA 2FLRT 2GYSA 2LTQC 2BNUA 1J05B 4FG6C 1OD7A 4U49A 2ESVD 5LXGL 2AJZA 3QT2A 1FIGH 5EZOH 5EWIL 2Z8RA 2FYYA 1DQDL 3MBEB 2WLZA 2XN9D 4QHLA 2DTSA 4ZFFB 3RBSA 4YBLB 2NY3D 2FL5A 4PGEB 5ISZB 3QNYA 1VACB 4NRZA 4RCAA 3CLFH 2R9HC 4HGWB 1MF2L 3C5ZA 1TXKA 3HI5H 1JI2A 2COQA 3ARYA 3R0MA 4P4KD 3PHOA 4Y2DA 4KTEL 1GHFL 4OTXL 4QKXB 2EDJA 1TVBA 4DQOH 4FZ8L 1KIQB 1AP2A 4OZGA 3CCHA 3CSYA 3VG0L 2DJ4A 1I8LC 1A0QH 4Y89A 3E2HB 4G5ZL 1NC2B 2R4SL 4OSUL 4GMTH 4LLUB 3X12B 4DKDC 4L8CB 1T0NB 3CFJA 3ARBD 2GCYB 3LS5L 4J1UB 4M1GH 4NHCH 1FNSL 5CEYB 5JO5A 3BDBA 3P9LB 4PJXE 1O7VA 1LK3H 3H9SD 4M61A 1FAIH 1JWMB 4HUNB 5JW3L 5CIPB 5HJ3B 1EO5A 3GSWA 3V7AG 4PRDB 5DMKB 3G5XB 5I30L 1RURH 4G8GE 4MD4A 2OTWB 4KK6C 3OMZA 3MRLB 4WFFE 1E6JH 2H3NB 4DN3H 2Y25A 1WK0A 3VFUA 2H26B 4HLJA 2UWEE 2P4AB 2AABH 2JB5H 4IRJB 1V7NL 1U91B 1Z0NA 5BZDA 2YRLA 4C56E 3GSUA 4J3SA 4QRRB 4FFWD 4BZ1H 2DRUA 4GJTB 5ACZA 5IQ9B 1DVFC 2X5PA 1IE5A 1U8IA 5F9OH 5D7SH 2XWBA 3TIEA 4PJGE 2R2EB 4PGCA 2LVCA 2PR4L 2R2HB 4XB7A 4NUJB 4YDIL 3RJQB 3P3YA 5SWZE 3RZWA 4WI6A 1Y18B 3ULVD 5HHPA 3HG1A 2CKBL 1NH6A 3UZQA 4UUJA 3V5KB 1IKFH 1DQJA 1N5AB 1XH3B 5TDPB 1I1FB 3TZVC 3ESVF 5C0BE 4P46A 5I9QC 2M1KA 2F54B 1OTUD 4JGJA 4YGAB 3WLWD 2AV7A 4H5SA 2X4PB 5EBLB 3CNKA 1TJGH 1T21B 2BSSA 4PP1C 2ZJSL 1KJMA 5E2VH 1NSNL 5EOCL 4DZBB 2AEQL 4Z0BH 3QI9C 4DGIL 5CLTA 1F3DH 2Y9RT 3FB8A 3SEPA 4NM4H 4P9HC 4KJPD 2KBGA 1A1MA 3KPRA 3D85D 4NNXA 4HIEB 2Q87A 5D7JC 2A77L 3OZ9H 2VLJA 3QXAB 3RWHA 3MRPB 5L0QC 5EUOE 4AK1A 2LV4A 2NXZD 2OM5A 3GRWH 1XGRB 2FATL 3QEQB 3QDGB 2X1QA 1CDHA 5HBBA 4A2MA 5IEHA 4JHAH 4MAYA 3C5JB 1KV3A 1DR9A 4PG2A 3QZWG 5TE7H 2UY7A 1SYSA 4FQXB 5FM5O 1RMFH 2A2QT 2OR7A 4PY8I 1GZPA 2A6DB 3FZUC 1EHLL 1TITA 3C9NB 2F9BT 3O6FC 1JPFB 5HPMB 3GZKA 1JZ5A 3BGFC 2DBLH 3MNWA 4R26L 1TMCB 4JFYB 4QRPA 1AGBB 4OCRL 3NPZB 5GGQL 5DQDL 4RMRA 5MENB 3TO4C 5FOJA 4YNYA 4DKEL 2RCSL 5DLMH 4LRIC 3L5JA 2XN9E 3QQNA 5BZWB 3ARVA 4LRNL 2XTJD 3K2MC 5D93B 5IESL 3C8DA 2IPTH 4H0HB 4PGDA 4OI8A 4JM4L 1X4YA 2NW2B 4PP2A 1NANI 4NKMB 2ICEB 2NZ9C 4MVBC 2ITDA 3T0EC 1IILE 3PWJB 1WC7A 3FRUB 5LCVH 4U1NB 2VMFA 1GGBL 2R1YA 4UTBH 2LAGB 1W72A 4LKCB 4U0RC 2MQCA 1S7RB 5F7DB 4L3AA 4OLZL 4WI8A 4BQCA 4FQ1H 5ICXB 3BH8B 3SCMB 5JLZA 2DWDB 4ODSH 2HTKD 5EO1A 2R2BB 5KVFH 3P9MA 1MLCA 1W2KT 2NY0C 5J13C 5B4MC 2QHRH 1D6EA 1X5AA 3LD8C 3QISA 4J3OC 2YN5A 4WUUD 3H9SE 3WL9A 5GZOD 2F19H 3DROB 4JRXB 4X7SH 1T22B 1MIEL 4G42B 4BSJA 2EDDA 3G6AB 3NA9L 1I85C 4K3EL 5IKCA 3MRIB 3O8XD 4N5EC 1SJEB 1MJUH 1EGJH 5LGHL 5HHNA 1YN7B 4KQ4H 3QH3B 4LIQE 4Z9KB 2VLRB 3TVMD 2EDXA 4P5TD 4PGZA 5C0AA 3EJYC 4KH2A 3PL6C 3QUZC 5IB3B 1SJVA 2WZPD 5SWSD 1DBJH 4RFNC 2A9MH 1EFXB 4R2GD 3B9AA 4XP1H 2FGWH 2Z8VC 4L4TA 3KDMA 5BO1H 3BFOA 4RFEA 3IJYA 4JAMB 3KHQA 4P23B 3NCJL 2DLEA 3I3EA 4ENEC 5I1JL 1LGVA 5B39B 4XNUL 5DQ9A 4ELMA 4WUKL 4DFHA 4HXBH 5J57B 5HI5D 3MA9H 1JNHB 4IM8A 1L9MA 3HE7A 1E4XL 3FO9A 4TVPL 5C0IB 3RGVD 4K3DH 1SMOA 2G75B 1JK8B 3STLB 2G5BB 4XZUB 1W8OA 4GBXA 1FO0A 4WJ5B 1EVTC 1R24B 4Z7QE 2YA1A 1GGTA 3OJDA 2QQLH 2G9HB 1QA9A 2IAMD 5HYEA 4I3SH 2IFFH 2Y5TB 1YMMD 5GS2H 1T5XA 1WAAA 4JY4B 5CD3A 5L2KD 4Z7WB 1QEWA 3BWAB 3JTTA 1OTSD 5J8OA 4P2QA 3I6LD 2QQNL 3I02A 5BVJA 4F7CA 3EGSB 4RDQF 1NL0H 4Y4HD 1TPXB 5DDHB 1KTDA 4OGAD 3G6JE 3KVQA 1NBZA 2VDLL 5DRWA 3WKNA 3O9WB 1JNLL 2CIKB 4LGRB 1QFHA 3VXQB 2O93L 1ES0B 5TQ2H 4X6BA 4XH2B 4ODHH 4BH8B 1MRFH 1MH5B 1ZHNB 3V7AE 4Y4FA 4MXWH 2B20A 1BQHG 5GPRA 3BD3A 3L3HA 3KLAA 3NACH 3S5LA 4MXVF 7CGTA 1MEXL 3UPRB 1N8ZA 1WCBA 5D7KD 1DL7H 4RFOH 2BVOA 2JJTA 2XZAL 5KSUA 1LHZA 1XF4A 1FL6B 2PW1B 3VXMB 3D1MC 1YDPB 4TYUA 3ARDC 3RVUD 5I74B 3DV6B 4TQEH 5D1XB 4UIMB 3QRFM 3LS4H 5FYKD 2XNAA 1DLHA 3AREB 4WO4D 1WJ3A 1F4WH 3RUGA 1OCWH 4Y19A 2DI9A 1KPVB 4DQOL 4U1IB 3KPQA 5J1AA 1QP1A 5CBAA 5F6HI 4YPGA 4M7JH 1HH6A 4GOSA 3HZMA 4GMTL 2ZKHL 1RK0B 4XP5H 4PRHD 4WEMB 5FKPA 4PJ7A 3UBXB 1BEYH 5CJBA 1MWAL 3QJHA 5CGYC 3BO8A 1CDUA 5JTWA 3T3MF 2XWTB 1GC1H 1J11A 4NO0D 1L7TL 3C8KA 4G9FB 4IDJH 2NR6D 2DQEL 4WWKD 5ITBL 4OGYH 1AKJD 2DQCL 2FB4L 2WANA 1QACA 3VFGL 4NQED 4Q6IC 5TQ0L 5FECB 4NWUH 3O41A 1F11B 2H1PL 3B2VL 3ZDZF 2YKLL 2X4QA 3RU8H 2V5SA 4DN3L 3BZ4A 3MLXH 4PRNA 1BPVA 1RIHL 4NJAH 4IHOB 5EOQH 2DD8H 3DO7A 5E5MB 1S9WA 1SEBB 3A67L 3SGEI 1EXUA 3O3DA 1MAJA 4UNVA 4GRLA 5F6IB 5DJ8A 3LKPB 4B5EA 3O6MH 5SWSE 3K7UA 2NPLX 2I60L 1HHIA 3CVHL 3BDXA 5DJ0A 3W9EB 1K5NA 1TCRA 1U8QB 3NCEB 4DTGL 3IDJB 2DQTL 1HINH 5I1AA 2EDQA 4H25A 2OTUB 4GKZA 1FVCA 2B0SH 2V7HA 2AERT 3NAAL 1CICC 3RX8A 4LSQL 4KKAD 3UTTA 2DQJH 2NY4C 3FCTB 4HK3N 1MVUA 4PGBB 1FYTB 1IKFL 4ORGB 4A2LA 3F7YB 4S0SD 5H94B 5CBEA 4ZQKB 1OAKH 5AZEH 4E0RB 1HKLL 4M9OA 4UNTA 1FNHA 1K8IA 3ILPB 4GS7B 4Z76A 1OGTB 3S34H 1S7TB 3OKMB 5JPNA 1TJGL 1QBBA 4L3ED 3QA3B 1OOAA 3QHZH 3GNMH 1NBVH 4Z0BL 4QXUL 2A74B 4LHUB 4AIOA 3IU4H 2DLFL 1CFVH 2OSLB 1YMME 3ARFA 5IF0B 2FX8H 3O45B 4N1EA 1Y0LB 2VLLB 1YJDH 3CFDB 5HHXL 2BVPB 3OGCA 1T2JA 3I6LE 1P7KB 1WFNA 4OZFB 1RVFL 3GRWL 1ED3B 1QR1B 5IIEB 1BF8A 5JDJA 4DKFH 1U2HA 3OQ3B 4NP4H 4LNRB 3FN0H 5TE7L 3PP4H 1GVIA 2EE3A 3WLBB 4JDZA 3WFBH 5C71A 3P0GB 4RQQA 3MLSH 4ODTH 4AT6B 1BOGA 2HG5A 2VKWA 1M7IA 4EN3A 4KVCL 4NNYB 2KH2B 1I9JH 4KROC 4KUZL 5D7KE 2I5YH 4LFHG 3PGDB 2KKQA 1JZ6A 5FXCH 1D5BA 1OAQL 3AFLA 3DRQB 3KPPA 3N85H 1AO7B 4Z7WF 2BY3A 1JGUH 1U93A 1R3IH 3L6FA 4GW1A 4WY7L 5CKGA 1KJ2H 5IMMA 5ERWA 5DJYA 1AGFB 4QRSB 1NGYA 3MC0A 5A16A 3VD9A 2E6PA 3MOQA 3C5SA 3EDDA 5FYKE 2X7LA 3CU1A 1FL3A 1J0YA 1II4E 3DIFA 5DHVH 3MGOA 1T2XA 4Q9RL 1FGVH 3DXAD 4OD3L 3A6CH 2HAZA 5JORA 1CGTA 3MV7A 1PJ9A 3FQNB 3G6DH 3KWWB 3QIBD 1WWBX 4GAFB 2DQHH 4JHWL 5B8CB 2AI0H 4NUGH 3IFOA 2DTML 2AQ1A 1QLEH 1Z9LA 3RWFA 4HHAB 4LF3A 4FQ1L 2GUOB 4FQLH 5J11B 3KR3L 4PRHE 5KVFL 3KPMA 2DS4A 1F8TL 1KXVC 4Y8DC 4JG0H 3VXSB 5ICYA 3WCYA 2NLJA 4BKLB 1LK2B 3QCTH 2P5WA 4NM8H 3TFKD 3FO2A 3NIGE 3O2DH 3BRDA 1AIFB 4NQEE 4X80H 1S9KC 3IKCA 5KW9L 1EGJL 3MCLH 4X0KB 1BZ9A 4MD0B 4Z7UB 1P4LB 5TF1L 2IBZX 3CPLA 3L7EB 2VAJA 1PSKH 2Y7QA 1JF1B 5DMYA 4D0DA 4XP1L 3MRKB 1OB1A 3IDNB 5EU6A 3MBXL 4HS8H 1ROWA 3DBXB 2IQAA 3TBSA 3H42L 1U8LB 2IH1B 5IMOB 1U8JA 3K8KA 3ZSSA 4O2FB 5HYJA 3DYMA 1JRHH 3RNQB 4CNIA 4EI5A 4GAYA 4OM1L 1J0ZA 3ZDXF 3CZJA 4AENA 2V2TB 2GJ6D 2Z4QB 5DFVC 1G7HA 3MJ8B 1XGPB 3VGAB 3ZSTA 1A4JA 2CRZA 4PUBH 5GJTH 3MPCA 4JLRB 4YX2H 4RA0C 3V6OC 4UAOC 4FQCL 3SKNA 3FOMA 1EEYB 5DMIH 3DMMC 4F7PB 1KBGH 4I18B 4UDTA 1CFTA 4BQ8A 4ZUSA 4PY7B 4NQTA 4L3EE 3MXWH 3KLHD 5F1SA 1T1XA 1W8NA 4PLNC 4OZIA 5T1MB 5CWSA 3LVEA 4HJJH 4W4OC 1RUMH 1LP9B 4U6VL 1TQCC 2OLDA 3QULA 5KSAB 1LE5A 3LSOA 3KPSA 3VRIB 4LARL 1VA9A 3CX5K 3NH7L 4PYHA 4NBXB 4PJ9B 5IBLC 1N64H 3VI3E 1YUHB 1J0JA 3VWKA 5BV7B 3HUJA 4HUUA 4NT6B 1QFWL 1Q72H 5HDBF 1I9EA 4ONHB 3CXDH 2AK4A 4N0UE 3T3PF 3EBAA 2AJ3A 1YNTB 4OKDA 1Q9WA 5MERA 1MFDH 3SJVB 4YHKH 3MR9B 3TA3A 4IRZL 5TQ2L 5HVHB 4PTTA 3GSNL 5D6CB 4AIXA 5JMRA 3WD5H 3QUMA 3GK8L 3C5ZD 3PQYB 4QRTA 4FABL 3IFNH 4YIQA 4Y2DD 2ADFH 4MJIA 4AJ0A 1BLNA 5SV3A 1LE9B 5KTEL 5KVEH 4MA7H 4U7SA 2HT3C 3H8NA 4QCIB 3MLTA 1H15A 5T3XD 1Q9OA 5F89A 5CP7B 1FLRH 5FUCC 3SDCA 2X1OA 2R29H 3HA0A 3B43A 3QWQB 3GJFK 5B21A 1D6VH 3EZ8A 3MRQA 3F7RA 4TQEL 2BRRH 1MELA 3C87A 4F37F 2UVFA 4R4NC 3UP1A 4Y5YB 5I1LB 2BCKA 4HWBL 3WFHA 4Y2OA 5DF0A 2VNCA 1C5BH 3AUVA 4NCDA 2JCCB 4LDOB 1F4WL 2EDHA 1ZSDB 4KV5E 1NAKL 3DX6B 4PD4K 4YXHH 1J5OH 4NRXB 3MLVH 4M7JL 2CQVA 3RGHA 3DXAE 1VDGA 1ZK9A 1MCWM 2AVGA 2P8PB 4XBGA 5I1GH 5CFHA 3TWCL 4KK5D 4F2MA 1HCFX 4PJHA 1YEIH 1D3CA 3L5WB 1BEYL 3M1BB 4LL9A 1UYWL 3BP4B 1UKSA 3QEUB 5CEZE 4IDJL 1WZKA 4OGYL 5E8OB 2ITCA 3IU3B 4F8QA 3KPOB 3RWEB 2Z8SA 4ZPVA 4RGND 4O4YL 1FYHB 4Z95H 4M5YH 2HJKB 1RJCA 4QHUB 3T2PA 2KPNA 3GHBH 1B9ZA 3OXRB 2EH7H 1X5ZA 4ZXBA 4HV8A 4NQXB 1DDHA 1BFOB 4E9LA 3BT2L 4JKKA 2HFTA 4G6MH 4P59L 3CC5B 1GJIA 1YQVH 3HG1D 4NJAL 1X5XA 4KTYA 3GEWB 2F8XC 1F45A 4P9HL 4MWFA 5EIVA 1BVKA 5EBMB 1ADQH 5T1KD 2G60H 3X3FH 1JHLL 4V1DE 1UZ6F 3R06A 5HI3D 4DGVH 1YYML 4DVBB 3LH2L 2CDGA 5IR1A 5I75B 3QJFB 4DVRH 3SE8L 4ZMAT 3LEXA 4MCZA 1U41A 2ATPA 2YSSB 3OG6B 2QADC 2B0SL 1QSEB 3P4MB 5DJ2A 1KB9K 1IEBA 2X6MA 3L3OA 3WMSA 1U9KA 2ED7A 4HMEA 3ULUC 4OFKA 3WS6C 1KN4H 4LCYB 3KPRD 2W0KA 5EA0L 1UA6H 1I8MA 5CJXC 3QDMB 3TBYA 4FMFA 2VLJD 3N9GL 2YC1A 4G43A 2GJ6E 1G9NH 1YQ2A 4UOJA 1DVFB 3EIFA 3DURA 7FABL 3GIVA 3G08B 1ZHKA 5DVLA 3S34L 4F37K 1S7QB 3HHRB 4ODBD 3QHZL 5KVDL 4I13B 1E4XI 2ADJA 1QSFD 2Q8BH 5I1EL 1YEGH 5GGUB 4WI4A 4Z7UF 4D0BA 1CFVL 3GMRB 2X42A 4LKXB 5FUZH 5AUMA 5KVGL 4L8BA 4X99B 4HSQA 4MQTB 2GT9B 1WFOA 2EECA 1S9XB 4JFEA 3G9VA 1NMBH 3VW3H 3JWNC 4L5FH 2A6IA 4I0PA 1ZMYA 2ZUQB 4JVWA 3CLEH 4U0QB 3C09B 1RUKL 4J3UA 4QF1B 3TN0C 2DWEB 4JKPH 5C0DA 3QXDA 4RGMC 1VSCA 3M07A 1ZHLA 4NP4L 4UQ2B 1JJUA 5D72H 3VXPB 2P24B 3ELAT 1URLA 4K8RH 4GKNB 4HDIA 5INCA 3ET9F 3FO0H 1T66C 4ODTL 5E95B 5BQ7A 4OKVB 2OZ4A 4GXUN 2OCFD 3UEZA 1HHGA 4XBPB 5F44A 1BAFL 4ONFH 3L3KA 3QDAA 4MJ5A 1XGUB 3BZFB 2VXUH 4LLQA 1OLZA 1QO3B 4OFVA 3QNXB 4PREA 3Q48A 4OZGE 5T3XE 1RAMA 5ETUA 5JPMA 1MCFA 1VFAB 1JF6A 2APWA 1ODAA 4XXCA 3U4EA 4HKJA 5J9PA 3I84A 1R3IL 1LP9F 4HGMA 1KJ2L 2OMBA 3O4LB 2LFGA 3REWB 1QOKA 1D9KC 4HPYH 5B38G 1EJ6A 2FX7H 2BSRB 4G6KL 4BQ9A 3BQUA 1F6AB 1FGVL 3WIHA 4G8IA 3A6CL 4FQ2H 3VFOB 5IFJB 2XY2A 5ANMB 1BVZA 3D0VB 3I50L 4PJAB 1MCEA 4V2CB 4NUGL 1H5BB 1ZA3B 4N1CA 4HWZA 3TO4B 3QO0B 1CQKA 5D1ZC 5GGTH 1X5HA 2HKFH 4FQLL 3T04D 4JDTL 4CADA 1NCBH 3MNVB 3RAJH 4R6UA 4H20L 5FYJD 2M2DA 2B5IB 1T04B 1X44A 4JZNA 1FJ1A 4HT1H 2WBJB 1JWUB 4KUCD 5C6WH 5JZ7D 3V95A 2NY7H 3D2UB 1NGWA 3T0EB 3O2DL 4F15B 3GM8A 1HQRB 5IB4A 1YMHA 4ESKA 4RA3A 4X80L 5C70A 3DX7A 2BY0A