3UTPE

1e6 tcr specific for hla-a*0201-alwgpdpaaa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
246
structure length
246
Chain Sequence
DAGVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1E6 TCR alpha chain
publication title Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 246
sequence length 246
chains with identical sequence L
ec nomenclature
pdb deposition date 2011-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utpE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3utpE02
1IT9L 5JDJA 1IGFH 3IDIA 4YFEA 2EH7H 3GSQA 1CDJA 3WSQL 4XNUH 3HUJB 3W11D 1W72A 6FABL 3NCBB 3TO4A 4LLUA 5HHQB 4YDLC 3VJ6B 3HE6D 2ZKHL 4NFDA 4OLXL 5KAQF 1DUYB 4NKIL 1I7TA 5F7YC 3MCKA 1DFBH 1JWUB 3O9WC 3D69B 4QOKB 4BH7A 2PN5A 4TPRH 2YC1A 5L6YL 1P4LB 2NNAB 1UG9A 4XAWL 4Z7UF 5F44A 3QDGB 2A74B 4YGAB 5DVLA 5DVNA 3DHJA 3KPRD 3LKRB 1HINH 4ZD3L 3D3VB 4R2GC 5HHMB 3LKQB 1E28B 3PIQA 4KKNA 3O8XB 3U30B 4MAYD 2DQEL 4M9OA 3WHE1 2ZSWB 4FQHB 5TE7L 5CMAA 1VACB 3ZHDA 3QXWA 3G5YA 4OF0A 2VQUA 1JCKA 3QUZC 5B8CC 2L7UA 1OAKH 3W11C 4OZIA 3SGKA 1BLNB 4FFYL 3S96B 5D7IB 5I18L 1UZ6E 3MCLH 1QLEH 1ACZA 2DMKA 4ZUUA 2BSRB 3MV01 4JEGB 1GAFL 5D7SH 4F58L 1QSZA 4GXUN 4HIJB 3I6KA 4DOHB 2ZUYA 2YOCA 1AGCA 1K4DA 4KKCC 3E6FB 1VFMA 1NDGA 1CIDA 1S78D 1S7SA 4Y16C 1IGYB 2AJZA 4FMKA 4TNVK 5B4MD 5ICXB 3RUGF 3HPLB 4ZPTB 1XGTB 4F7MA 1UH4A 4OLUH 1K5NA 4P2CG 2DQDH 2XFXA 3I2CH 4J4PD 4KI5C 1ZT7B 4PV8B 2UYLA 2GJ6E 2DI9A 4LCCC 1EGJL 2ZOKA 4EXKA 3BZEA 1G7LB 1WTLA 4S2SA 3PABB 1ZTXH 2HFFA 2VLRB 1KTRL 3FQRA 3LKPA 1DLHA 3LQAH 3FONB 5IROA 1QP1A 2AJUL 2DLGA 3ILQD 4UTBH 5CBAB 4HK3N 3LDBC 2CD0A 3L9RA 2L7JA 3LHPL 3MA9H 1AKJD 1GSMA 3C2AH 1RURL 3QNZB 1CE1L 1QBMH 5KTEL 4HJGB 3VD4A 1VGEH 3G6JA 3VXRD 2IMMA 1KIQA 4PRHE 1BZ7A 4PRDB 3NIDE 3ARBC 2AK4B 4BK5A 3VXQA 1LE9B 2VC2H 3MZGB 3W9EB 4JRYD 5D5MA 2R0LH 5CD3B 1XF4A 3Q2CA 5D2LE 2AJYL 1I8MB 3WL9A 3TJHC 4DZBB 4NNPL 5TF0A 3T1FB 5I8CB 2JB5H 4PJ9C 3HB3C 4TN9A 2YUWA 3S34L 5I15L 4WV1A 5IOPB 3KR3H 2CKBB 2NY4C 4NFCA 4CU6A 4A2LA 1AO7D 3CFBB 2CXGA 2R8SL 4MQ7B 1PGRB 3ILQC 3SDAD 5DJYB 1YC8A 3E3QC 2PYED 3CDGA 3M17A 2GTWB 2O5XH 2AJVL 2CKBH 5C08A 2A0LD 1ZSDB 1ZLSH 4BZ2L 5GIRB 1HSBB 3HZMA 4K8RD 3S4SG 3WJJC 4YK4C 3U0TB 4KDTA 3FO2B 4RFOH 3FN0H 4ZXBB 2R0ZH 3BGFB 5F6HJ 1KENH 2APWA 2GJZB 3CDYA 1OM3H 2AV1B 4GMSH 3QXDA 4U1GC 1U8OB 5C0BD 5ICYA 5KOMC 3GM0A 1EERB 2SEBB 1W0VA 3RWEB 3RPKA 3ARZA 1KSRA 4YHNA 3WIHL 3A67L 3JWDL 3DX8B 1X3DA 1P84K 4HS3B 4Z7VE 4XP6L 3TBVB 4LLYA 4NM4H 3CU1A 5BRZB 2ERJB 1X44A 2RJMA 4RCAA 5ACLA 1IL1A 1CLZH 3A0OA 4H8WL 3HZYB 4JPKL 3DXAB 3P73B 4K8RC 5GRWA 4P9HH 2PO6B 1MY5A 3GSWA 3VH8B 4K3DL 1HIMH 5JQ6H 2F53A 4UT7L 4UOW0 4GG6A 1FIEA 4OLYL 5C92A 3UO1H 2J5LB 4CKVX 1E6JH 1CFQB 1I7RB 1T7ZA 3U1SH 4BKLA 3GSOB 3X11A 2WWMD 3WD5H 4L9LA 2FRGP 1CQYA 5I1JH 4WDIB 3V6ZB 5SWQA 1FHGA 1QG3A 3HRPA 5DI8B 1QQDA 2X5PA 4JN1L 5IEHB 3EFFB 3TZVB 1RK1B 1Q8MA 4LCYA 5GGVY 1GOFA 3LAFA 5IB1B 4EDWH 3QG6A 4IOIB 3ZHLA 5ICZA 4FZEH 5HDOA 4P2RE 1FGVH 4ODHL 4NQVB 1DSFL 3S36H 1JP5A 4MCZA 5A3ID 4D9QE 4G80B 5FYJD 1G9EA 4LSSL 1P7QD 1JZ5A 1UM6H 4FXLA 5E1AB 1JWMA 3B4NA 3Q0HA 2WQ8A 2C3WA 4DKEH 3U36B 5EU6D 1XR8A 1LEIA 2A77H 4DGVL 3VW3L 5D1XC 1ZLUH 2WWMC 2YSSA 2ZPKH 3PDGA 3FO0L 1CBVL 1FZJA 3QIWA 5INDB 2LVEA 3BWAA 3Q3GA 3O11A 2AEQH 3EYVA 4JFQA 4XTRD 4XB7A 5C0RH 1YC7A 3QUYB 3RZCA 3DTXB 1U42A 1N6QH 3VG0H 2Q6WA 4ZUTA 5ID1B 1KJ2L 3T8XB 1KV3A 5DJCB 3UTSB 1TTUA 2RBLA 3VMOA 2A6DB 5EOTA 2J6EL 3OJDA 5CILL 1FN4B 5A3IC 4NBZB 1A14L 3K0WA 3U0PB 4KKAD 3QCVL 5FOBB 1J1OL 1CXFA 2LABA 4ODSH 4JY5L 4PJHA 1LP9E 2QQKL 4DAGL 4ZG1A 4JGJA 3GBML 2K1MA 1D5BA 3L5XH 1L4IA 4X7FC 2D7OA 3NA4A 1UWEH 4HSQA 3MJ7A 5DJ0A 1CK0L 2CLZB 1H0DA 5IP4A 1DQQA 4XTRC 3FB8B 1B9ZA 2DYPD 3CGTA 4P3DA 4XVTL 5KSAC 2CJUH 5D7JC 4Z95L 1MIMH 1YJDC 1DBML 3IAQA 4OLEA 3RWJB 2NY0D 3DJ9A 3QFJD 4BFBD 5ITFA 1I8LA 4J3XA 4C83B 3TESA 3V7AE 5IMMA 5LGKA 2AI0H 5JDSA 1S3KH 2QLVB 3CZJA 3EJYC 3IF1B 5I8EB 2WBJD 3DX6B 5IF0A 3T77B 4C56B 1LO5A 4G6FB 4EUPG 5KANG 4PUBL 3V5HA 2XTJE 5DRZA 3TFKD 3TIDA 5JHDB 4D0BA 2XKNB 4HZLA 1XZ0B 4O02L 3OKNB 5T1MA 5HXMA 1OSZA 3P4MB 3W81A 2NY5L 2I60L 5JW4R 1FIGL 4G9FB 3UYPA 5BV7B 4OM1H 4OUUB 5F3HA 3I75A 4LKCB 3FQTB 2ADFL 1PW3A 2HN7A 1X7QA 3QJHA 1BJMA 2DOCA 3O9WA 4WVRA 1I9JL 4XCEA 1NANH 2VZSA 1T1ZB 1Z3GL 2MKWA 3C5SA 4GW5B 3ZKNC 5BV7H 1M05B 4HWZB 4JKLA 3MLXH 2AQ2A 2EDTA 4M5ZL 2FATH 2YPLE 1IGJB 1ZLVH 3BKYL 1Z9MA 5C0CB 2DKSA 4Q58C 5CEXA 5J13B 1DUZB 1KLUB 1UA6L 1X6NA 2PCPA 3VFSB 5CJQH 3T3PF 4CVXB 3VXSD 1VHPA 1JWSA 2J1KA 5I1HH 2EC8A 1T4KA 4FRWA 4NO0B 5E8DL 2ZUQC 1JGVH 4NWUH 3QUZA 3MBEC 5B8CA 4XXCC 1MUJB 5DFWH 3D25B 4TSAH 4LEOA 1DVFB 2EYTA 4H26A 4NSKB 1YDPB 3EIFA 3ES6A 4HD9A 4W68A 3K2MC 3BKCL 2A9NL 2IFFH 1FNHA 1ETZB 4FFVD 1VFOA 2VDKH 4J3SA 4A2MA 2NY3C 2YD4A 3RHWF 2DQGH 4K2UH 2P24A 5F7MC 5IMLB 4AEIH 1TJHL 5AD0A 2DTML 1DBJL 5I1LB 1DL7H 4TUOB 3E6HB 1A7PH 1YEKL 5GGSA 2Q8BL 4H20L 4HC1H 1FO0L 5EZJB 1OWRM 1K2DB 4Y16A 1OAQH 2FJGA 3F7VB 5HGBA 5KG9A 2DJSA 4X0KA 3FB6B 1DR9A 4LASL 3ZTJG 4G6KH 4KMLB 5GS0D 4GSDH 3RVXD 3V5DA 2IEPA 3VGGA 4HG4J 3I50L 4WHTA 3BDBA 2MHAA 3MA7B 2FGWL 4LCCA 2HFGL 3VFMA 1YA5A 3QPXL 3ZDYE 2NY7H 3MNWA 4HJJH 4XMKH 4PG9A 4QRPE 3SE8H 4WW1A 2HH0H 1NMCB 5FOJA 5JA9A 3GSXB 3QHZH 2R4SH 1GH7A 3VFWB 1N59A 5EO1B 1S7RB 5D93C 5HI4C 1Q94B 3QQ3B 1CFTB 2VLJD 4OCWH 3PGFH 1X6LA 3O4LB 4HUKB 3O6LL 2FIRT 5FKPB 3ARBA 2Q7YA 2VR9A 4JKPH 5DQJA 4PREA 1DEDA 5GGQL 3BPLC 3H3PL 4HUUA 5E94B 3F8UB 3GMOA 4N5ED 5DQ9B 5HY9B 4OM0H 3S5LA 5GJTL 1ZGLP 4JRXE 1QRKA 1I3RB 2OM5A 4HEPG 4MB4A 4LU5L 4F3FB 3C9NB 1QR1B 3C60C 4PJ9A 2QKIA 3Q1SL 5DZLA 5E7FA 5KZCB 1EHXA 4KJWD 4V1DB 5FM5O 4Y0GA 1JHLL 2P5WA 3F7YB 3VI3F 2BNQD 1MCCA 4R97C 1NC4A 2A9ML 3N1QC 5DJ6B 4P3CH 3ZE0E 4H5SA 4HBCH 2VIRA 1R3KB 2AKRA 5CCKL 4MJ5B 3DMMC 3RUGA 1KN2H 3QULA 4N8PA 3TBSA 3ARGB 4HIIB 4WNQB 3K2UL 4CW1A 2YXMA 3OAZH 3IFPA 4MWFA 1HXYB 3WJJA 3QO0A 3U9UB 4KQ4H 4GOSA 4YFLI 1EVUA 1AY1L 5C3LD 4ELME 2C7UB 2QQNL 5IGXH 3FMGL 3WO4B 1C7SA 4XPTL 3PE9A 2WIIA 4JCMA 4NRXB 2LU3A 4ZPVB 4MA3B 2BCKB 3DX7B 2HMID 2EE2A 2VL5A 1Z5LB 4PJCB 3TPKA 4KGJA 4PRIA 1UYWL 4OCRL 4ZSOE 3SGDI 4ODTL 3WKML 5GS1B 1NEUA 5I1IH 1G9ML 2XWTA 4HAFA 5DHYB 3QUMA 3W2DL 4NO3A 2UZIL 5J7CC 4TOYH 1G0YR 4G3YL 2P45B 3L3GB 4TUJB 5D7LD 3OG4B 3GIVA 4ACPA 4G8GB 3NZHL 4JZNB 2ICEA 1ZLWK 3GEWB 4X4XA 4QRUB 3MRHA 5DJZA 3BDYL 3HI5L 2QJDA 4K9EL 2GI7A 1KPVA 4MNQE 3UPRB 3O3EB 1D9KD 1BFSA 4HGWA 1NGXA 5HD8C 3DIFA 4KJQC 4XPAL 2H3NB 3IDGB 3X3FH 4UBDC 3C08L 3DURA 3K4DA 5J6HB 4OB5L 1JE6A 3I02A 3KXFA 5GRJL 4ZFZB 5JR1H 4W6YB 1TNNA 4W4NA 3SCMC 1MFDH 25C8H 2NYYC 5SWSE 3DNKA 3VXOA 2NZ9C 1PDKA 2OI9B 2YA1A 1RULH 1DE4A 1TETL 4HK0B 4P5MB 5EZLA 3EOBA 3GMNA 1XIWC 4QRSA 1U3HB 5ABDE 5IKCB 4HMEA 1KJ2B 5EOCL 3V4VH 1ZHNA 2D31B 5IHLB 5DUML 4U1IA 3FQXA 5D1XA 3UTZA 3REVB 4K23L 1KCUH 4PY7A 4JPWH 1BWMA 5DMJB 4MJIE 1AJ7H 4LCUB 3L95B 3SJVB 2X4QB 2Z8SA 4JPIB 5AWNL 5DJDB 2KL6A 1CQKA 1S7XB 2E7BA 2ZUVA 4YFLF 1A3RH 4LCIH 4XP1L 4CBPA 3NGBC 4FXKA 3KLDA 3MC0A 5I8KH 3T0AA 1WZ1L 3MRPB 2P49B 5CUSL 1N2RB 4XXDB 4PJXB 1D5IL 2DM4A 4RGOL 4JJ5B 4GRLB 4G8FA 1VFAB 1NC2A 3KNBA 1Z0MA 2X41A 4UU9A 4XP4H 4WI6A 1U3ZA 1JMXA 3D85D 4B53A 4JLRA 3ETBF 1RUKH 4ZAKD 5HHPB 3R8BB 4F37F 1RFDL 3KAAA 5FKAA 2XN9A 5EU3B 4YQXL 1F4HA 4P4KB 4UIMA 4HUVB 2Z31C 3IXTA 4LARH 4F7CB 2XZZA 4N0YL 1YUHA 3BRDA 5KSAA 1T6WA 1CI5A 5D7JA 1INEH 5DMGD 1F4WL 1F8TL 4I77L 5E4EB 1OW0C 3LEYL 1OPGH 3TA3B 3RL1A 1ZA3A 4PGDB 1WEJL 1RUQH 3VGFA 5IFAL 3BT2H 1YEJH 4X6FA 1X5GA 1FC1A 1CDUA 5E2JA 4EXPX 2VLLB 4LCWA 2HA1A 3T4AA 3UEZA 4CADB 3MV8B 1WBZA 5LGHH 4ZAKC 1V8HA 5KANI 1P69B 2GHWB 3GO1L 1JV5A 5E2VL 1QRNE 5CZKA 1VKXB 1UWGH 1BIIB 4JFPB 5FDWB 5IT2H 4G42A 2XWBA 4N0CC 2FO1A 2R69L 4ZUVA 4QHLA 3X3GH 5ISZD 4JCLA 3IU3B 5EN2A 4WO4C 1QFWI 3KJ6L 3ULUF 1QEWA 1LK2B 2FEDC 2GYSA 3H9HB 4OT1H 5DMGC 4RGND 4HH9B 5C6PB 3WE6B 2YD8A 1I9EA 3QXAB 1EEUA 4KK5C 1G7HA 3EYQC 2BVTA 5F3BA 1RZJC 1V7NH 1YMHB 1Z9LA 1QSED 2DWEA 3RP1A 3BI9X 3PG2A 2NTSP 3LH2L 2HT4C 4DVRL 4R4BA 3RDTB 2PTTA 3BH8B 2ESVD 2DRUA 1W2KT 3KS0H 1T0NB 3HNTL 2B7DT 4X7SL 4RNRB 4N0UA 1GZPA 1S7QB 2NXYD 1JVKA 5JXEC 1C16A 1A9EA 1CLYL 3MXVH 3MBEA 3HC0A 4XXCA 3ULUD 4M48L 2KZ1B 1DBKL 4YR6B 1PVHA 1IM9D 3L6FB 4GKZA 3V95A 2QQLH 2H2SC 1BQHA 5ALBH 1JGLL 1D6EB 3CVHB 4ODBD 4M1GH 3WFCH 5CEYB 4JG1H 3V4PL 3G6AB 3OXRA 4OLZL 1S9WA 4M43H 4LSVL 4YHYC 3RL2B 1CXIA 2ICWI 3CVHH 2OSLA 1O5DT 1NJ9B 4BFIA 3MRFA 1T21A 1BBDL 2D2OA 3MGOA 2QSVA 3VGHA 4JR9H 4WY7H 4UTAL 4OZHA 4QWWC 3EDEA 3MGAA 5DEZA 3HZVB 1ACYL 3CFJB 1BJ1H 4G5ZL 4Z7QE 3LRGA 3BDXA 3N9GL 3ULUC 1A9BB 4I3RH 1FNGA 1OAUL 1KCLA 4LAQL 3OAUL 4NUGL 5H94A 4K7FA 3G6DH 4M9PA 2XV6B 1LO4L 5E8NB 3E2HB 4XGZA 3GJFB 3JZ7A 3B43A 4NHUB 4D0DB 4K7PH 4YXKH 3ULVE 3HAEA 1BFVH 3VFUB 1CD1A 5FGCE 1FZOA 1BOGB 3BO8A 4XCNA 3DBXA 4XCFH 2FIKB 2PKDA 1CU4L 1F13A 4MQTB 2B1HH 5HDBE 3CXDL 5DTFB 5TDOB 5IESL 4LIQL 1ZVSB 3GJFH 1KCRH 1JZ2A 2DN7A 3A6OA 3O81A 2A6IB 5EA0L 5FUZH 3MQIA 2ED8A 4M6MH 1Q9OB 4OFPA 2BNRE 4QXWA 2DI7A 1R3JB 5FO9B 4N1EA 3ARUA 4GO6B 3BHBB 2P46B 3TBYB 4L4VE 1KB9K 1W72L 3BUTA 1OAYH 4HKJB 2ITDB 3M8OL 3T0XA 1AE6L 1QYGH 1G7JA 1KTDB 3K4ZA 4CJ0A 4X99A 1GVIA 3ZE1E 2QR0A 2DQJL 4PRHB 1YECL 1F3JB 3C60A 4E41B 1JHTB 1F6AA 3ZSSA 4ZDHA 5DO2D 3K1KC 4PGEA 1CDCA 3WHXB 1E4XL 3IDNA 1SJEB 2P42B 4X6EB 1IC4L 2R1YA 3GHEH 3DI3B 3FT3B 3DX9B 4JFEE 5HHVL 1IQDB 4NZRL 4ZOBA 4F15C 5JO5A 5K9JL 5FYLE 3EYUL 2B1AL 3DMMA 4I3SH 3OV6A 4M6NL 4DK6A 4FQPA 3CSGA 4XZUA 3SO3B 4CNIB 1IFHL 2CLRA 1AQDB 1EK3A 1KEMH 1JGDA 2VISB 2COQA 2VABB 1A6ZA 1J8HA 4Z7UE 4YHPB 3UTPD 1IILE 4KV5F 5ESVA 35C8L 5F71A 1U8QA 4Z5RA 2H32A 3MXWH 3MR9A 2OK0L 4OKVB 3CC5B 3D18B 3MJGX 4K94L 1OHQA 2EYRB 1MI5B 2IG2H 5DO2C 4BFGA 4I48A 1RSFA 5I76B 3EDKA 5C9JA 3LN9A 1P2CA 3MODH 1RUAL 4J3VA 5C07D 3DUSA 5L2JB 4JFFD 1K4CA 3LS4H 1A7QL 5ESQA 4JY6A 4GMTL 4MLIA 3AU1B 4NM8H 4CAGA 3KLAB 1CXKA 2OL3A 4U6VL 2H9GB 3H0TB 2J4WL 4HDIA 1A7NH 4M61B 4ETQB 1R24A 2V2XA 3K8LA 1S9KC 3JBG7 1ZHKA 3BSZL 2OXHA 1EAPA 1IRAY 5EUOA 5T3XE 3SDXF 3HI6H 4RBPH 2EDEA 4XRCB 4X6CE 2FO4B 5FUCC 3IVKB 3DVNA 3BP7B 1N64H 5ETUA 2CDGB 4PP1D 2AXFB 4LSTH 1MFBL 2R0KH 2OTUA 2XXMB 4GQ9L 5L7XH 1PSKH 3DVGB 5A16B 2GSIA 1QD0A 2X9YA 3RWFA 4X4YB 1SVCP 2RGSA 5J1AB 3RWIA 3W0WE 4AZ8A 4NQUA 2J8UB 4G6JH 3P11H 1GHFL 3SCMA 1EEYA 1C7TA 1DEEB 1UWXK 1JPSL 5I74B 4KRNA 3BP4A 1C5CH 4DUVA 3GK8H 1NCAL 2CR6A 1X4YA 4PJFA 1AQKL 3CMOL 1XIWA 1IEAA 4HQQL 4NQEB 2P5EB 4Y4KB 3MJ6A 1N6VA 2CK0H 4HMCA 3TWCH 2CGRH 1MF2H 3FTGB 1NGQH 1AO7E 1EUUA 5DD1H 4GRWE 4HKXB 2ATKB 1G9NL 2J12B 1U8JB 5A43C 4UAOB 3O8XC 1X5FA 2Y7QB 3U30C 1FFNB 2HJLA 5F1OB 5EOCJ 3CK0L 4R8WL 5EDXA 3T0BA 2B2XL 3OKDB 3WFZA 5HYSB 1PZUB 3TVMD 5HHNA 3CFCL 1CDIA 3DYPA 3ZE2E 3X14B 1NH6A 1FL3A 3HMXA 2YWZA 5I1DB 1A47A 3MUGB 4XVJL 3HG1D 4WUUA 4Y4FD 3TPUB 2HFTA 4ERSL 2FX9L 4ESKA 2F15A 3WFHA 4NJAH 1A1OA 1EXUA 3HNVH 5T5NG 3ZTNH 2FD6H 3QDJB 4ZFOA 2ZCHL 2YPVH 3HCVB 3KLSA 1RZ8B 4XNZB 1OD9A 2GUOB 1B90A 1MWAA 4KZEL 2Y07L 4AY0A 5MP6L 2DQTH 1RZKH 4XPHL 2Z31A 1S9VB 4HWBA 5EIIB 3V6BR 5BMFL 1HOCA 1ZK9A 4OV6F 1Y18B 4AL8H 1D5XB 1N3NB 2CUIA 3WIFB 4PS4H 2O61B 5ID0B 5CZXD 4PJ7E 6CGTA 3PHOA 2J3SA 1OW0A 1BVKB 4JHWL 1MCQA 5EC2A 4U1MA 5BVJA 1IAIL 1QO3A 5HI5D 2P8LB 2VLKB 4YIQB 2IPUG 5EORL 2DB8A 4S1SL 4QRRD 3S35L 1TVHB 1H8OA 2R1XA 3W82A 5JPMB 1UCBH 1PZ5A 4LHUB 3BP5B 3MRLB 1A4JB 4U0RB 4ZAKA 3S35X 1T2QL 1A1MA 4FZ8L 4OGXL 2APFA 3GSUA 3U4EA 3S4SA 3MO1B 3L1OH 4HF5L 4WHYH 4HV8B 1IJ9A 2C1PA 2EDBA 4M7LL 1FFRA 2DBLH 4WO4A 4EOWH 1KOAA 1KPUA 1UXWA 5LCVH 1BBJA 1CCZA 4AH2A 1C5BL 4LQFL 2F9BT 2CK2A 4AIZA 1EFXA 1Z6JT 2JELL 1KEGH 3LMJH 1A7OL 4XPGL 3PJSB 3IAPA 1B4JL 3UC0H 1Q9LA 3UTTA 1JTTA 4O5LL 3CX5K 1RUPL 4LRNH 2G5BB 3NPSB 1EHLH 5GRXG 3OSKA 3RHWK 1GPOL 1FRGH 1KG0A 3QWOB 1FFQA 4CVZA 3PWPA 1YMMB 5L2KB 5JXEA 3BD4A 3WNMA 1KTLA 5IG7A 5DUPL 5CLTA 1FPTL 1ZHLA 3WFBL 2J8OA 1NGZB 3H9SE 5FB8B 3LCYA 1MFCH 1RMFH 4S1QL 3TYGH 4LRIC 5DD6A 1L0YA 5FHBH 1YPZE 4Y1AE 4XAKE 4GW1A 5IVZB 4OD3L 2BOBB 4JGUA 3DRTA 1V7MH 3PXHA 1FC2D 4KK9D 5M95B 1VERA 4QF1B 5T3ZH 3B3IA 1LO3L 1MVUB 1C8PA 4ZXBC 3MNVA 5I2IB 3KPSB 3T0EE 3BGFC 4CDHA 1DQJB 4GAGL 5D72L 4QT5B 5HBBA 2GAZB 1NGYB 3TO2B 3BAEH 4FQXB 2FL5A 4KDVA 3VXME 1P84J 2CO7B 5I19H 1EO8L 4I4WA 4MJ2A 2P8MA 5DJ2A 1M6OA 4ZUSA 2BDNL 1RHFA 3P77A 2EH8L 3OXSA 4TVPD 3UDWC 1WIUA 1T66C 4NN7C 2VDLH 1FYTB 2NTFA 3NFPB 3IDIB 5ILTL 3FCTB 1WAAE 4P9HC 3E1F1 4RRPA 1IEBA 2FBJH 1B4RA 3VXUA 3I6GB 3QXUA 3PDOB 1IM9A 1JNLL 1Q0XH 2XYCA 2Q20A 4P46B 1P1ZB 3QEQE 3PHSA 4X5XA 1VEOA 3G5XB 2VZ3A 2PO6C 4BQ8A 2HLAA 2YC1B 4Q2ZA 5HYJA 5E08L 3MMEA 1XGRA 2DQHL 3P0VH 4X6DA 3VWJD 1U8IB 2J5LC 3FO1A 4PJ5D 3VFTB 1AD9A 1QLRA 2FJFB 2HT2C 3PIQB 3UYRH 3QDMA 2XZAL 1A6WL 2EZ0C 2YZ8A 2VKWA 4GQPH 4N9GB 1G1CA 3B83A 1T1XA 3QR2A 2RHEA 3ARFD 4X8JB 3HRZB 3TZVC 2QADD 1RJZB 3CPLB 2Z35B 2E6JA 4AM0A 1QA9A 3NCYP 2DWDA 1EEZB 4L3EB 3LSOA 5CSGA 4UDUB 3VU2A 5HHOD 5C09A 4YDJA 1NEZB 4OCLC 4U31A 4RISL 4KTEH 4ETYA 3W9DB 1PG7X 3P4OA 4P59H 3UTOA 3TIEA 2W9EL 1IGIH 4WW2B 3VWJC 3I6KB 2EEBA 2JJTC 3SKMA 1J5OH 5K9KA 5CJXC 3VFGL 4LF3B 4J6RL 5T33H 5E2WH 1NDGB 2FJHA 2BNUB 2AJZB 1HKLL 2NY6B 2IQAB 4MD4B 3NIGE 4WENB 1SYVB 5IVXB 5HPMB 4TTDD 3MREA 3QUYC 5MERB 1F11A 1DQDH 1I1CA 2QADC 5I16B 4XH2B 3STBA 4XMLH 2F19L 4WGVB 4X80H 5F1SA 4EUPA 5F8RC 2IADB 1RPQA 4NKDA 5J9PB 1AI1L 3QXVA 5F6IB 3LKPB 3RGHA 2IJ0C 4JDZA 4NKOA 1Q9WB 3I3DA 5IB4A 2BRRL 2W0FA 3B6SA 5GRUH 4JPVL 1CGWA 3DGGA 1CXEA 3L9RB 2A6JA 1B0GA 2CMRH 2R9HD 4IRSD 4MXQC 4UOW1 5JHDD 1LEGA 1T80A 4DFHA 3UMTA 5B3JE 1F00I 4QTIL 2PXYB 2IQ9H 4LOUC 4PJAE 4X98A 5BS0D 2RFXA 3UJJL 3U48A 3IJYB 4MXWH 2A73A 1MHEA 2EDQA 4J3TA 5D5MB 1FFPB 1SBSH 2F54E 3WL9B 5E8EB 5FIEA 3WNOA 4PRPB 4J3OC 1MFAL 1M7DA 5JW3H 2VLJE 3OKLB 4XBPA 1HSAA 4JFDD 3VE0A 3MRQA 1SM3H 5F1NA 4Z7WB 2R9HC 3CDGB 5DK3A 1I4FB 3RRQA 1KXQE 4NO0D 5C0AD 1CVRA 3HUJA 3NPZB 2M8XA 2XA3A 3KJ4B 5BV7C 5C0JB 3O6KL 3VJ6A 2WK2A 4OGAD 3WNLA 2KDGA 5T5FL 3SE3C 4TYUA 3ARED 1JWUA 5L6YH 3D69A 4QOKA 2NNAA 1EHAA 1BD2E 4ZNEA 3NVQA 3WFDH 3QXDB 3BP6B 1DQMH 2A74A 3QDGA 5E9DD 2VR4A 2YPKB 3M1BB 5MEQB 4ISVB 3LKRA 4RMSA 4PJEF 3PQYD 5IIEB 5IQ7L 3LKQA 5F1KC 1E28A 3O8XA 3MYJB 5D2NB 1RU9L 2AEPH 3WYRA 4DVBB 1NDMB 5J13C 3V0VB 1BM3L 1BEYL 1RIUL 5JMOC 3EAKA 1IC5H 2ZSWA 3OKMB 4FQHA 2X1PA 3B2UC 3LEVH 4F37K 3RVTD 4PJDE 4R3SA 1MCRA 1MQKH 1GC1H 4JFHE 3FFCB 4ZS7H 4LSPL 1DVFC 1BLNA 1SY6H 2W59A 2X4SB 4LFHG 1CFSB 2Y6SD 4OGAC 5D7IA 1OP5K 3S96A 4DW2H 5IJKC 2YEZB 3OGOE 2K7QA 1B3JA 2F53B 1QFUL 2BSRA 1ES0B 3HN3A 5KSBE 4OZGE 1JPTL 2LAAA 2VDPH 4UQ2A 4BKLB 2BFVH 1CS6A 4HIJA 3QUML 1IBGL 4QRTB 3N1MC 2WNGA 3IJSA 1AXSA 1MCJA 3E6FA 1JNHB 4FQJL 2JCCB 5CJOL 4K8RL 2YR3A 1IGYA 1N5YL 2DQIH 1NLBL 1AC0A 4LIQE 4OFYA 1MAML 1S7WB 3GM8A 1L7IH 5ICXA 2XZQH 3HPLA 3PL6B 4ZPTA 1MRDL 1A6VL 2A38A 2EXWD 3V79C 2R29L 3RVTC 2OR7A 3HC3L 4O9HL 3KYAA 1YN6B 3NTCH 5H37H 4NC0B 4EQ3A 1MCIA 4X7CC 4PJBF 5C6TH 5FUOL 4LPXA 2E7CA 4OLVL 3TF7C 5E99L 3QIUB 5HYSG 3GMPB 1ZT7A 4PV8A 2G9HB 1CTOA 3TT3L 9CGTA 4GUPB 1G7LA 1T3FB 2MTPA 1YYML 3PABA 3GRWH 2VLRA 4HLJA 1ZEAL 3N50A 1NMCC 2FH8A 4Z7OF 3FONA 3LHPH 1D6VH 4NRYB 5KJRL 1WWCA 2VDQL 1MEXH 3O11B 3RIAK 5J3HD 3QNZA 4IDJL 4LK4A 1AGBB 2AJSL 4HJGA 2WP3T 2E27L 4U2YA 5FO7B 4YX2H 3RZCB 1I7ZB 4PRDA 3S9DB 1OB1B 4JHBA 4KWUA 1IEHA 2AK4A 4OGYL 2VMFA 3WS6C 1LE9A 2JIXD 5JMRA 2CRMA 3W9EA 4N1CA 1PYWB 4OZIE 5CD3A 1WVZA 2OTPA 1XH3B 1I8MA 1PFCA 1GZQB 1JZ6A 4PYGA 1RY7B 5AZ2L 5A2KH 2AXJA 5GS2H 1QVOB 1HI6B 3AMKA 3T1FA 5I8CA 3GUTB 2XRAH 4CL7A 2O5YL 4NOBA 5J11B 5IOPA 2W9LA 1ORQB 1TZIB 4XVSL 2AABL 3JXAA 2CKBA 4WGWB 3G04B 1RJYB 4RMRA 3CFBA 2OX5A 1KJVB 2V17L 5E4IA 3MJ7B 3QZWB 5DJYA 1MJ8H 3V7AG 4LRIA 2VZTA 4UV7H 4MAUL 2GTWA 4KGLA 3FZUC 3ARGC 4L8SB 4U4BA 4F57L 1ZSDA 3EYFB 4P3DB 5GIRA 2CDFB 5I1GL 2PUQT 4NQDD 5TDPB 3U0TA 2FDBP 2VO5A 3FO2A 4XC3L 4ZXBA 2BSED 3JWOH 1FVCB 5T5NF 5IMMB 3BE1L 4P0DA 3I6LD 3WO4C 1XCQA 3MYZA 2GJZA 2AV1A 1DBBL 5TQ0H 3DGCR 1U8OA 2SEBA 3RWEA 1LO5B 1NAKL 4XPFL 4DKFL 3F5WB 5SV4A 3A67H 1MCSA 3JWDH 5DRZB 4OZFH 3UDWA 3O2DH 3DX8A 3IRZA 3NMEA 3RNKB 3MRKB 3MLSL 1TNMA 4HS3A 4LNRB 4RWYL 5HVHC 1YJDL 5CP3A 3TBVA 2H8PB 1OSZB 5BRZA 4IRZL 1JGEA 2H26B 4ENEC 4QXUH 1HHJB 2VERN 5F3HB 3I75B 4N68A 4JPKH 2D7MA 2D03H 1MFEH 1NMAL 2P43B 1NCBL 3G6JE 1T6VN 3P73A 5I1KH 4I1NB 4EBQL 2PO6A 1UJ3B 2H1PH 2ZUWA 2MQ0A 4PJIF 5D70H 3VH8A 1IKFH 4MVBD 2NX5D 3ET9F 3MOAL 2BK8A 2OXGA 3LS5L 4R2GB 3MLVL 2DF3A 1CFQA 5L9DL 1A6TB 3L7EB 1I7RA 3GSOA 2PCPB 4YZFF 4WDIA 3V6ZA 1IAMA 1NBYA 3ULVH 3BN9C 2BC4B 3GNMH 5JOFB 3LOWA 4KMQA 1BZQK 5DI8A 1PKOA 5IEHA 4P2OB 3EFFA 3TZVA 4ORGB 1RK1A 4NQCD 4NC2B 2YMXH 2NY2D 2P1YA 3HE6B 5C08E 4YDIL 5IB1A 3GKWL 1I3GL 2EDKA 2JJVA 1IGCL 4AG4H 4KXZH 4NQSB 4HJ0C 2HP4A 4NQVA 5FGRA 1NFDB 4MVBC 2P24B 4G80A 3U9PH 1U3HC 2DLFL 2WUCH 5TE4L 1JUFB 1CGTA 3VWJA 3KPRB 2JJTA 3EO9L 1ZANL 1DANU 1MCDA 3U36A 1A4KB 1FJ1B 4PIRF 5CJXA 4KKBD 4OSUL 3HFMH 1LDSA 3FO0H 4G8EB 4MAYB 1UC6A 2K9UA 1FNEA 1CLOL 5E00A 3UBXG 5FYJU 4I9WE 5INDA 2XOTA 1VFBB 1FLRH 3VFVA 4KHXH 2F58H 4P4KD 5GHWL 5KVDL 7FABH 4OBSA 4AENB 1MY7A 5F7HA 3BESR 1OAZH 3MV9D 5GQBA 3QUYA 3DTXA 3HMWH 2AW2A 3WDJA 3V5DB 2X89A 5ID1A 3T8XA 4WHTB 3GMLB 3UTSA 4G6AD 3TA3D 1Q9KB 5FYLH 4H0GA 2ZG1A 4Z7UB 2A6DA 1CICD 1QFHA 1RJCA 4O4YL 2EE3A 1FN4A 4U1SB 5MHSD 4K3JH 3U0PA 4GRLC 5FOBA 4FTVD 3BEVB 2QQKH 1BREA 1N6UA 4GG6E 4OQTH 1AR2A 1UXSB 4OCYH 3GBMH 3B5TA 3V8CA 4D9RD 1B6UA 4YUEH 4J12A 3IU4H 1IC1A 3QUXD 1CK0H 3BYTA 5CEZL 4P4KC 1FSKB 5J8OA 3V4UH 3TEUA 2ZCKH 5DQJB 3IKKA 5EZOL 3FB8A 2I9TB 3N85L 5D8JH 4BZ1H 4JDTL 4M62L 3QXTA 3RWJA 1U93B 2YXFA 3TA3C 5DC9B 2BX5A 2QHRH 1A22B 4BH8B 1F90H 4C83A 1RZ7H 1P5VA 4XPBL 3VXNB 4IDLA 3BKML 1UQSB 4Y5YB 4JQXC 3A6CL 1B88A 3IF1A 3DX6A 2VDML 1GGCH 3T77A 1F97A 1UZ6F 4H5SB 4C56A 4N8VB 3VFPB 2VIRB 1YNLH 2AKRB 5KSVB 5DD0L 5T3XH 1AKJB 4M6OL 3RUGB 4DN3L 2XKNA 5JHDA 1R6VA 5I71B 3QULB 4FNLL 1XZ0A 1J86A 2JJUA 3KLHC 3VXRB 3OKNA 4YHKL 3IFPB 3P4MA 1A3LL 4WCYH 1A6AB 4G9FA 1BGXL 4LKCA 1T2XA 1VCAA 1BF2A 1T1WB 1LQSR 3FQTA 3FB7B 3H9YA 3SE3A 4UNTA 4JRYB 4QKXB 3RGVB 4OD1L 3LRSB 1FGNL 2Z8WC 2WZPD 4HK3J 2EICA 1EO7A 1T1ZA 2YD3A 4NPYB 4CRPA 5ERWA 4GW5A 4U1GB 1M05A 3OJ2C 4HWZA 1F2QA 1AIFB 2HVKB 1J87A 1IGJA 4UIKL 1ITBB 4GAFB 1AO7B 5C0CA 1J0YA 1DUZA 1KLUA 3VFSA 2EXYC 4G7VL 3SDAB 4L5FL 4CVXA 2PYEB 4NO0A 2YD1A 3BKJH 3D25A 2XT1B 4FXGB 3ISWA 1DVFA 4NSKA 2H2PC 1YDPA 3GIVB 4GBXD 5IJKA 2ICEB 4Y89A 2FWOB 4YHZL 2VLME 1JHKL 3CNKA 1ETZA 1FBIH 4CN6A 2X70B 4X4XB 1R5VA 1JTOA 1L7TH 3MRHB 5DT1L 4HC1A 2AQ3A 1MCKA 4JFFE 2VUOA 5DVMA 3BUYB 3ALWA 5C0BB 3Q6FB 5IMLA 1KPVB 4F7PB 5I1LA 5TPWH 4TUOA 1JNNL 2GJ6D 5TFSL 1RUMH 3DIFB 1BZ9B 5D2LF 1EMTL 4U1HB 5EZJA 4OJFH 1K2DA 4L8BB 2OL3L 2RB8A 1I9RL 1YY9D 4PBWD 1MQ8A 1MRFH 5JHLL 3DURB 2CPCA 2PTUA 3F7VA 3BQUD 3I02B 3WEXB 3SGEI 1K85A 3FB6A 3EOTH 1F45A 2VJXA 1M4KA 1EUTA 4Z9KB 3QQ9D 3EOBB 4PRHD 4QRSB 3E2HC 4LSRL 5CGYC 2DKUA 3MA7A 1P9MC 3IT8D 1NBZB 3KPLA 4MQXD 3TV3L 4D3CH 3D0VB 2VZUA 1H3UA 5IBLD 3GSXA 4PY7B 1ADQH 4YE4H 3VFWA 3P0YH 5EO1A 3RZWA 1INQB 1KB9J 4YWGL 4CMMB 1S9XB 3IXAB 1Q94A 3BN3B 3QQ3A 1CFTA 4MA7H 1MLCB 1T20B 4I18B 3O4LA 1LO0H 2W60B 1KIPB 3MLYH 1CZ8L 1QTYT 5H35A 1P4IH 1WGOA 3HTLX 1OGTA 3L5HA 3WS6A 5HY9A 5DQ9A 5H37G 4Z7VF 5ALCL 4G7YH 1WF5A 1I3RA 2WW8A 1NGPL 1MH5A 5IJVB 4N8CH 4TTGA 1Q72L 1EZVX 1N0XL 3C9NA 1QR1A 4ZFGH 1P7QB 2AV7B 3B2VH 3FOLB 5EZIL 4EI6B 4MQXC 1YEIH 4P23B 1JRHL 4X7EC 3FN9A 3F7YA 5EU6B 4YJZL 4LPTA 1TMCB 5DJ6A 1H3PL 3OHXB 5IBLC 5DHVB 1YY8A 4OCSL 1ZLUK 5FKAB 1R3KA 3EO1B 1TJIL 3KPTA 4MJ5A 3GIZL 2Y23A 3ARGA 1OTSD 2GTZB 4MD5B 4HIIA 4WNQA 3SO3C 5DHVH 3HMXL 1A6PA 4L3CB 2DQUL 1HXYA 3U9UA 5LAXB 2R1WB 5DDHB 1F4XL 2AGJL 4JE4B 3P40A 2C7UA 5IHZB 4KVCL 3CSYB 3QSKB 4XPTH 4ZFOL 2B20A 4KI5E 4ZTPL 3WNKA 4AJ0A 1P5UA 3C87A 3RX5A 1MWAL 4CGTA 4NC1C 4ZPVA 4JKMA 3PNWB 4MA3A 2BCKA 3DX7A 5FCSH 3UP1A 4HWBL 4APQD 4KY1L 4PJCA 5KVEH 1KBGL 1TZGL 1WBZB 4WJ5B 5D96B 5DVKA 3AXLA 1JV5B 1NUGA 4YNYA 5DHYA 5F6HI 1P4BH 4WTWA 4LFHD 2DYPB 3MOQA 5TJWK 4NQDA 5IW1B 3L3GA 4TUJA 4TULL 5ADPL 4ZYKA 5C6WH 4G8GA 1VPOL 2NY0B 3QFJB 4JZNA 4XHJC 5DWUH 5D1QD 3VRIB 2ORBL 3QCUL 2MOVA 5B22A 4I0PD 1KB5B 3NABH 4MS8D 1C1EH 1ZS8B 1GYAA 2J88L 4P2RD 5E2UL 2WBJB 1EA9C 2DDQL 1EJ6A 1URLA 1YN7B 3ARQA 2BMKB 1F02I 3UPRA 3O3EA 4D9QD 4OI9A 2P5WE 4FFZH 4OZFG 1KB5H 2H3NA 4JHAL 1GZPB 2QSTA 2Y5EA 2WLYA 5C7XH 3X17A 5T1DL 1NBVH 5J6HA 1LP9F 3E3QE 4ZFZA 4E9LA 1U3JA 1RZJL 4N0RA 4IBLT 4GKZB 2IC2A 1C5DB 1OAXH 2GCYB 4N1HB 4HK0A 4P5MA 1UADC 1FORL 1T0PB 1U3HA 3DPBA 3K46A 3OXRB 3MV7E 5IKCA 4Y4KC 1R3IL 1I1AB 1S9WB 1LK3L 3C8KB 2D31A 5EBWA 4BSVB 2JB6B 3U7YL 4NJ9L 1T21B 4TSBL 2EE6A 4KHTL 1ZLVK 3REVA 5CZVL 1J0IA 5CLWA 5JNYB 5TE6H 3TT1H 4LCUA 4O58H 4WFGD 3L95A 3SJVA 2X4QA 4PRIE 3VXSB 4F7EB 4JPIA 1G7QB 4UAOC 5MEOB 3G5VB 4PJGF 5DJDA 3UBXI 1TQBB 1S7XA 3OKYA 1EIBA 3CVIL 4U05A 5GSRB 2FECL 5BVPH 1N7ML 4RAHA 4S11A 2KKQA 2DIAA 4K7FB 4DN4L 3MRMB 4KJPD 5E2TH 4JDVB 1LDPL 3OKKB 4JVWA 3S37L 3HAEB 4XXDA 1BFOB 4PJXA 4YHMH 4NQXB 1HXMB 1ZGLM 2PYFB 4GRLA 4YDKH 4NBYB 1VFAA 4GW4B 3S37X 2CLVB 4TVPE 1RZKC 4RAUB 2M26A 4XNZC 3VCLB 5HHPA 2HLFD 4KKLD 3JUYA 4IMKC 1IVLA 2DLEA 1ORSB 2ZJSH 2VWEC 5EU3A 4XHQA 4P4KA 2FX7H 2J2ZA 2VDNL 1D7FA 3CLFH 5EWIL 3L7FB 2R4RL 4F7CA 3HE7D 3GI9L 2XTJD 3BPLB 1TZHB 1H9VA 5FYKL 2HRPL 5IHUH 1G7JB 4WI2A 3KXFE 2VH5L 3NFNB 1DBAL 4HLZH 3OL2A 1KGCE 3TA3A 1QBLL 4H0IA 4KJYB 4YGVB 3HPJA 4PGDA 3I85A 4YHLL 3P2TA 1QKZL 1RIVH 5GS0H 5DQDH 1GIGL 4S10A 2L0DA 4NO5B 4JQXA 4R97B 5E0QA 1UZ8B 2PR4H 4LVOB 3MACL 2VLLA 4M03A 5DA0B 1V3KA 3OGCB 2Y5TB 3MJ8B 5BO1H 3BW9B 4OKDA 5I30H 4CADA 1WIPA 5DR5H 3MV8A 4OD2B 2Q86B 5IBUG 4U0RC 2HLFC 2VLJB 1ZWIB 2AEWA 4BJLA 2D7PA 2YPLD 4TRPH 1VKXA 3KYOB 4JFPA 3VWKD 5FDWA 1MOEA 2EDNA 5F7LB 2FHCA 3ARSA 1VADB 3RIFF 3IU3A 3FO9B 4MHHG 4Q0XL 3H9HA 5DURD 3ARPA 3MUHL 4HH9A 3U0WH 3D9AH 3QXAA 3EHBD 2GQHA 1NCCH 2B0SL 3CX5J 5E5MA 5DC0A 1MREH 1INDL 5JTWA 4LEXH 5F7EH 2BNQB 3H42H 3BH8A 1RVFL 3EYSH 4WTZG 1T0NA 3NPSC 3RWCB 3AMLA 2EDHA 2E6PA 4GRMB 2AERT 4RNRA 1YEHL 2HJFB 4Q9RL 3ZDYF 1S7QA 1MLBB 1PX4A 4RAVB 2AP2A 4QHUB 5FHAH 1CD9B 2XN9E 4N8VG 3SQOH 1WC7B 3DUUB 2BSTB 5ITBL 5AYUL 3OAZK 5IR1B 4YR6A 5MENE 5DLMH 4V2BA 1BF8A 3W39A 3L6FA 3MCG1 3CVHA 2V9TA 3THML 5FV1L 3V4PH 4WU5B 2VDOL 3EHBC 5CEYA 3ZYIA 3G6AA 4NN5B 4Y7MA 1A6UH 4PB9H 3ZKMD 3QP3A 1MJJB 1ONQA 1SEQL 2R56H 1DTUA 4XCYB 4LKXB 3RL2A 1J9CT 1NJ9A 2UUDH 4NP4H 5TQ2H 5EU4B 5DMIL 3RWFB 3L3HB 1JBJA 3H8NA 3NAAH 1JK8B 3V6FA 5FYKU 3FHAA 4QRPD 4XC1L 1I9IH 1BHGA 1QACA 3MRGB 2MKLC 5JUEH 1ACYH 3HZVA 1JZ3A 1PKQB 5HHXL 3CFJA 2ED7A 4R0LC 3ZE0F 3MFFB 4XVUC 1IM3B 1HK6A 1A9BA 1B6DA 2YUXA 4H88L 4ODVL 5D7LB 1HH9B 5D1ZB 1OGAE 5E7BA 2YZ1A 2CRZA 2EIBA 5E8NA 3GJFA 1P9MA 4MJ4A 4NHUA 1T5XB 4O2CB 4P46C 5F7DB 1IGFL 2EH7L 1BOGA 3CXDH 4XNUL 2FIKA 4JRXD 4LIQH 5CJ8A 5TDOA 3JV5A 1A2YB 1BWWA 5DTFA 4ZS6C 3TGXA 1ZVSA 4ELMF 1D9KB 2FH6A 2IGFH 2A6IA 3FT2B 5AG8A 5BXFB 1Q9OA 1R3JA 3CCHB 5FO9A 1DFBL 1KFAH 4M7JH 4W81A 2HJLB 3TBYA 3BHBA 2FYYB 2R2BB 4X5LA 3P4NB 3NGBB 1NCWH 4HKJA 1JL8A 4N0UE 2ITDA 2XZCH 2C4XA 2GKIA 5JPNB 3T0DA 5HHNB 1RI8A 3IDXH 3MRNB 3RVWD 1KTDA 3NCJH 2A1WH 5E9DE 1FL3B 4PRHA 2ADJA 1EJOH 1F3JA 5IBTL 4E41A 1JHTA 2EEAA 1KPRA 5A2LH 2JK5B 3G9VA 5FECB 1EZVY 1FV1B 3WHXA 1MHPL 1UCTA 1SJEA 1XF3B 1ZOXA 2DQCH 4X6EA 5F7WC 3DX9A 1OAKL 1IQDA 2VITB 5LXGH 3BXNB 4WW2C 1FG9C 1QZ1A 3JV4B 2PF6A 3FOMB 3MCLL 2BY1A 4XWGH 4Z0BH 2C4FT 1QLEL 4Q6IB 2ID5A 1WLHA 1TTGA 2ZP0T 3NFSH 1NFKA 5D7SL 2WWKT 4CNIA 3EDJA 1AQDA 1G6RB 4OZHE 4UINH 5EPMB 2NY6C 4TUKH 1WZKA 4ORZC 2EDOA 4FFWD 2VISA 2VABA 1V3JA 2AEIT 4JRWA 4YHPA 35C8H 4MZ2A 4AIXA 4BYHA 1XAUA 4OUOA 4TSCH 3VD9A 4EIZC 2E8ZA 1G6RH 1QO3B 4OKVA 1W0WB 3MLTB 3CC5A 3D18A 3VXTB 3ZZ1A 5CEZE 4WFEE 2EYRA 5C2BH 1MI5A 1YQ2A 2FCBA 2IPUK 1KIRB 4JANB 4P3WA 1NGWB 4NYLB 5I76A 4OLUL 3D85B 2ZZUT 3IFNH 3OTTA 3I2CL 4ZAKB 5F6IC 5L2JA 1MCPH 4X4ZA 1RZGB 1F58H 4MNQD 3VRJB 4N9OB 4U7SA 3NOIA 3S4SB 1D5MB 3GB7B 4OQ1A 3AU1A 1ZTXL 2WWKO 4U6VH 3KLAA 1GXEA 2H9GA 3IS0X 3RKPA 3H0TA 4M61A 4FABH 2PXYC 3IS1X 4AIZB 4UTBL 4DTGH 3QO1B 3MA9L 3C2AL 5SWSD 1QBML 1PY9A 4L3AA 4NKMB 1VGEL 4XRCA 2FO4A 4S1DD 3IVKA 3BP7A 5DRNA 2CDGA 4QGTA 3ORJA 2AXFA 4XNQB 3M07A 2HYMA 4X7DC 5LWYH 3DVGA 4IOFD 3SGDH 5A16A 1OP9A 2VC2L 3PV6B 4X4YA 5KW9H 2R0LL 1O7VA 5IMKA 1BAFH 3QYCA 4HKZB 1ZA6B 2JB5L 2I27N 2J8UA 2BVUA 2GITB 4MJID 5IV2B 1T5WB 1DEEA 5ISZB 4U33A 4P2QE 2WBKA 4XNXH 1IGTB 3KR3L 4RGNB 5DD5L 3MLZL 4P99A 1FE8H 4Z78A 1J8HE 3KJ4C 4NQEA 2P5EA 4Y4KA 4LNVA 4OF7A 4Z7OE 2CIIB 1QSEB 2O5XL 3S88H 4XWOD 2CKBL 1QHOA 3FTGA 3E8UL 1ZLSL 4P2RA 2ESVB 4HKXA 4BA8A 2ATKA 4MZ3A 1OP3H 2AK1H 1U8JA 5I75C 4RFOL 4ZUSB 3FN0L 4G6MH 1P7KB 2NXYB 2R0ZL 2BOCB 5LG1A 3WUWB 5D2NC 1KENL 2Y7QA 4JN2B 1FFNA 1BFTA 2VSCA 3MTRA 1OM3L 1L9MA 1GC1C 2VDRH 4ZTOL 4JFXB 5I17B 4GMSL 3SOBH 3HHRB 1IEBB 4C4KT 1V3MA 3OKDA 3NA9H 5HYSA 2Z4QB 1IM9B 4KAQH 4OF8A 4NBXB 2RCSH 3QCTH 2AS5M 4PB0L 3X14A 1AXTH 2XXCB 3QQNA 3QAZB 5I1DA 4NM4L 2HKFH 3TPUA 1XGRB 3PP4H 2BHYA 5F9OH 1KYOK 2DM3A 3CUPB 3LB6D 4KK6D 4KZDH 4XWOC 3S6CA 1J10A 1CLZL 3WN5B 2ZCHH 3OZ9H 3QDJA 4ZO6A 5F72S 3HCVA 1RZ8A 2GUOA 4P9HL 1SMAA 3QA3B 3QUKA 4KZEH 4IMKA 4J3UA 5GGVL 2Q87A 3DVIA 4GT7A 1HIML 5JQ6L 5EIIA 1EPFA 1S9VA 3T65A 3UO1L 1E6JL 1Y18A 1D5XA 1Y6KR 5I9QB 2LE9A 1N3NA 3WIFA 2ADIB 3P9MB 3U1SL 2O61A 5ID0A 1WISA 2YN3A 3WD5L 4CMHB 4C4KO 4NCDA 1QRND 4IHOB 3PL6C 1BVKA 5GS2D 1IARB 3QHTC 1XGYH 15C8H 3IDMB 5KVGH 2IBBA 4PJFE 2NZIA 2Z91A 2P8LA 2VYRE 2VLKA 4O2EB 4YIQA 4S1SH 2IAMD 3QIUC 3DO3A 3RWGA 4UT6L 3LB6C 1TVHA 3GJFK 4ALAH 1K8DB 1YEFL 4EDWL 5JPMA 4LHUA 3MRLA 1A4JA 3T4YB 4QTHA 4FZEL 4R7DA 1RD6A 1FGVL 3N0PB 1EO5A 3S36L 1S7UA 2GK0A 2B5IB 4HF5H 3MO1A 4OI7A 1UM6L 1MCLA 2IH1B 4HV8A 1NQBA 4LLVB 1RZIA 4DKEL 5JORA 3S36X 3MREB 3IYLW 1U9KA 4LQFH 5MI0B 2ZPKL 1SVZA 4YO0B 3IETB 4MHHI 1RHHB 3TH4T 3QI9D 1CXLA 4Z7QF 4YZFE 1B4JH 2AEQL 4EUPB 3PJSA 1G6VK 2XQBH 5CD5D 4GFTB 2EDXA 5ACZB 3U7WH 4WUUE 2G5BA 3OQ3B 3VG0L 1N6QL 1GPOH 3JUZA 3QWOA 5JW5A 3B6SB 4M7ZB 3HZKB 5J11C 4J23A 4P9MH 4ONFH 1YMMA 3F12B 5L2KA 4ODUB 5HDBF 4H1LG 1NGZA 2EDFA 5FB8A 4ODSL 4PLJD 2BXZA 3L3KA 1PEZA 4L8SC 3JWOC 5IVZA 5CGMA 5IFHH 1TCRB 3L5XL 3KVQA 4OFVA 5C0IB 3EJZD 1UWEL 4FTVE 1LO3H 4W6XB 1SJVA 1X5XA 4QF1A 1MVUA 4D9RE 3E0GA 2W9DL 5I2IA 3KPSA 4Y19D 3JWDC 1DQJA 5IW3A 1HQ4B 1CDYA 3ZE1F 2CJUL 4QT5A 5BCAA 4XBPB 2GAZA 1HSAB 5JIHA 5C07B 1MIML 1NGYA 4JFFB 1BQLH 4JO4L 5TH2A 4F2MB 1L6ZA 3SKUD 3EFDH 4HPOH 2MPAH 5AAWA 3TJEH 3GJEB 1S5HB 2AI0L 2X4TB 3OF6A 1FYTA 2XA8H 1S3KL 3NFPA 4R0LA 2BNRD 3FCTA 2QSQA 4P2OD 4FQLH 5IB3B 4N90E 5B38G 4L4VD 4DK3A 4U3HA 1JNLH 4R96B 3I6GA 4OAWB 5GZNC 3PDOA 2ICWB 3JSSA 5GJSH 5C70A 3S3PA 4P46A 1P1ZA 2KUTA 3QDHA 1BIHA 3B9DA 3G5XA 2G60H 1UJ3C 1OTUC 4RBPK 2FZ3B 3ZL4H 2ZUUA 4C54A 2X40A 4OM1L 3CH1B 1U8IA 3MLRL 3VFTA 5GGRB 3ULVC 2FJFA 4LQ1A 4Y5XB 3H3KA 4LLWB 4HHAB 3MOBH 2JKXA 4JFED 5BV7L 4N9GA 4K71B 3RI5F 2XI9A 4ELKB 3PWPE 3U4BH 3O4OB 3MLXL 4RSVA 3TCXA 4CVUA 5FYLD 2FATL 4PJ8D 4R3SB 4U1KB 4X8JA 5GSVB 3HRZA 3OKEA 4P2OC 1S9YB 4KFZC 4WWKD 3ZTJH 4BQ6A 4YHIB 3D1MC 3SDXB 1RJZA 3CPLA 2Z35A 5JW4M 4Y2DB 2RIKA 1EEZA 1IAKB 4L3EA 3WIIH 1X5HA 3HE6C 4UDUA 5CJQL 5I1HL 1NEZA 5CSBA 3F7RA 2IAND 1JGVL 4NWUL 1JYWA 2QBWA 5EBGA 3PWNB 3W9DA 4TSAL 4XBGA 4UQ2B 1FH5L 1IKNC 3MPCA 3QWQB 4WW2A 2H6PB 5DEGB 1JF1B 1JN6B 2IFFL 2UWEE 2YD5A 3IJSB 4J6RH 4PD4K 1AXSB 3S98A 4LF3A 4X6CF 4L4TD 4MAYC 2DQGL 2WUBL 4K2UL 2BNUA 1YEDB 4AEIL 4X8XA 2IQAA 2APVA 4MD4A 4YXLH 3D5OF 1DL7L 5BW7C 2OP4H 1SYVA 4NZUL 5IVXA 3TVMB 5HPMA 1A7PL 1TITA 1N8ZA 3ZT7A 1PJ9A 3VFRB 5MERA 5I16A 3VXUE 4XH2A 3REWA 5I1AB 4R7NB 3OJVC 3TN0D 1OAQL 4R6UA 4Y4FB 3HG1B 4LLMB 3OKOB 3SY0B 3ECBB 4BQCA 2OYPA 5I66A 4E0RB 1G84A 4TVSa 4ELMA 2OR9H 3MJ9A 4YC2B 5FYKE 2IADA 2L4OA 5T3XD 3KDMA 5J9PA 4FA8A 5HYJE 4GSDL 4F8TA 5DJAB 4X6DE 1J88A 2XKSA 1Q9WA 1SMOA 1ZAGA 3G08A 5F96H 4BQ9A 3IDUA 3QDME 1MRCH 1S78C 1CD0A 2R0WH 4IRJD 2NY7L 4GRWF 4HJJL 4ZSOA 4XMKL 3SE8L 2JJWA 5B4MC 2HH0L 4C59B 2PXYA 1FSKC 2R4SL 3QHZL 3NCYS 3W0WD 1XF5B 3DRQA 4HX1B 3IJYA 5A2IH 1QNZH 3T2NH 2Y36H 2LU4A 4OCWL 1FFPA 3PGFL 3QG7H 3RGVD 4J4PC 4OTXH 4G8IB 5E8EA 3HLAA 4EEEA 4M1CD 4QRRB 2DKMA 4PRPA 5C09E 4FQCH 4JKPL 2Q76A 1OTTD 4OM0L 3ZE2F 4Y5YC 5IQ9B 3OKLA 3U46B 2YBRA 4IS6B 5JA8B 4JM2F 5ANMB 3RTQD 1E4KC 3ZYZA 4EN3D 1T7XA 1I1RA 4Z7WA 3CLEH 2I5YL 5DGRA 5I71C 1I4FA 3QJFB 3SKNB 2Y06L 2VXVL 4P3CL 2MCPH 2M1KA 4HBCL 3PDDA 4LVEA 4FQQB 2BVPB 4X6BB 5C0JA 3ARDD 4D2NA 4QXTB 5KS9E 1Z0NA 2Q7NA 4M1DH 1KN2L 1NSNH 3AAZB 3DROB 3RGVC 1XCQB 1JGUH 4PJ7F 2GFBB 4M1CC 4GAYB 3FQNB 1NCNA 3BP6A 3L3IB 4OCXH 2YPKA 3M1BA 3V52H 4KQ4L 5MEQA 4ISVA 1Y0LB 4UUJB 4JM2D 2F5BH 5IIEA 5IGXL 3MYJA 4NN7B 5D2NA 4DVBA 1NDMA 5DC4B 3V0VA 3RTQC 3SDAC 3OKMA 1SY6A 2EC9T 1JGEB 3FB5B 3WV0A 4WI5A 1X5KA 1LE5B 2A0LC 3FFCA 3VD5A 2X4SA 3VXPB 1CFSA 5I1IL 3P0GB 1U8MB 2YEZA 1KN4H 2YWYA 2D9QB 5DK0B 4TOYL 2IH3B 5FUCE 1ES0A 1UEMA 1DLFH 8FABB 3KPOB 5FFLA 1S8DB 1XF2B 3LIZH 4JM2C 4QRTA 2ZUTA 5E03A 1NBYB 1VA9A 3O45B 1JNHA 1GGUA 2JCCA 4KRPD 1QBBA 1S7WA 4Z7NE 5KVFH 3VDAA 1MRDH 4Z18A 2X4NA 3PL6A 1KCVH 3EO0B 3HC3H 3WUWG 4TVPH 3QISA 2M2DA 5I8OL 1U6AH 1IAOB 1YN6A 4U6HB 3X3FL 3GRWA 2CIKB 3QIUA 3GMPA 3CXHK 2G9HA 1YPZF 5JR1L 3JV6B 5EOQL 3VWJB 4GUPA 1MFDL 1MCBA 25C8L 4QOKE 1T3FA 5BJTB 4PJ5B 4P23D 2UVFA 3RX7A 3RY4A 4XI5D 1RULL 1EHNA 5K9QG 2NW3B 4JO1H 2X9WA 3GKZA 2IPTH 1FNEB 2DJUA 5E00B 1TVDA 3D3VE 5AAMA 1FFOB 3VFVB 3AM8C 4JQVC 4NRYA 1XFPA 2VN7A 3V4VL 1G7IB 4U0QB 1AGBA 4OZ4B 4I18C 3ARFB 2YHGA 5FO7A 1I7ZA 2V2WB 2QADB 1OB1A 1KCUL 3D39D 5HGHA 1FDLH 4J1UB 3H9SD 1AJ7L 2FX8H 5HHOB 3DO7A 2BY0A 4MDJA 3L5WA 1WAAF 1PYWA 3DV4B 4Y1AD 4XAKD 1XH3A 1A3RL 4NNXB 1GZQA 4OF6A 3VG9B 5D7IE 4LCIL 4HCRA 1QVOA 1HI6A 3GUTA 4GKNB 4WFGE 1DN2A 1T03H 5I8KL 4ODXB 2D7TH 1FZKB 4P23C 3FJTA 3RPIA 1ORQA 1TZIA 5GRVK 3T0ED 2F8XC 3G04A 1RJYA 1UGNA 2Y4SA 5K59E 4DOHE 1KJVA 2VXUL 3JTSB 3QZWA 3RQ3A 4LSDA 2BXYA 3VXMD 3RAJH 3K7UA 1MCWW 4XP4L 2APTA 3SDYH 4L8SA 2E5EA 3EYFA 4YHOH 2CDFA 1U92B 1RUKL 5EBMB 5TDPA 1S7VB 1BOYA 1XR9B 4XC3H 4JQIH 4FQ2H 2VZVA 5KBNC 1XEDA 1G7MB 5MENB 4LARL 4I3GA 1FVCA 1DDHB 4LLDB 3DLQR 3GHBH 4OZFA 5DFVD 3O2DA 3QH3B 4PJGE 3QEQD 1INEL 1GOGA 2HRLA 4KKAC 1AR1D 1OPGL 3L3JB 2C3GA 2VLRE 3F5WA 4L9DA 3UCRA 1Z2KA 4IRSB 3MLSH 2NY1D 2DI8A 1KCSL 2YS4A 1RUQL 4GAJH 3P4LA 5D96C 3MRKA 4LNRA 3RNKA 3B9AA 3QDAA 3BT2L 1YEJL 2H8PA 4IRZH 2E7LC 2H26A 1HHJA 3EOAA 2XPGB 4TNVF 4KMTH 5BS0B 5DA4A 1MJ7H 4XMPH 1RAMA 5LGHL 4LL9A 3CMGA 2AK4E 1UJ3A 3ROLB 1R3LB 2VXTH 2NY0C 1UWGL 1DQLL 3NIGF 4UI2A 5ERWB 1RIHH 5IT2L 1IC7H 3P3YA 1E6OH 1I1AD 3X3GL 3MRDA 4OT1L 4M3JA 1A6TA 3L7EA 3EZ8A 4JFDB 2WBJC 1DCLA 2YRZA 4YLQT 3U6RA 4D8PB 4FQ1H 3CFKB 1CR9H 1V7NL 4EVNB 3OJMB 2NY1C 3TFKC 4DJMA 5L88H 2BC4A 4OF5A 3MFGB 3INUH 5JOFA 4OBRA 2A83B 1U8PB 1OLLA 5DRXB 4P2OA 5C0AB 4ORGA 1GGIH 4L4VA 4U6YB 2HFEA 3HE6A 4KC3B 3U82B 5J06A 4HW6A 3N1PC 3AREB 5B3JF 4NQSA 1R5VB 3U2SB 2BSSB 8CGTA 1IZKA 3MXVL 4ZODA 2GT9B 5HYEA 1NFDA 2OQJB 3Q6GH 4D9LH 2E7HA 1B2WL 4PJAF 4X4ME 1IE5A 1D3CA 2N56A 3O0RH 5E9DB 3RVVD 1IKNA 3DUHA 1JUFA 1I1AC 1ZANH 3KPRA 3PQYB 4QY8B 2NXZD 2QQLL 4KROD 4R4ND 5ALBL 1A4KA 1FJ1A 1NUDA 4G8EA 3EGSB 4L8CB 4MAYA 4M1GL 1CLOH 3WFCL 4PGCB 5DUBB 3KPQB 1VFBA 5GHWH 4BELD 4UQ3B 5BW7A 4M43L 3VRLE 4JVPA 1NBQA 4AENA 1YNKH 3CVHL 1TQBC 4M02A 2Z93B 3MLWL 2BZDA 3KPPB 1UEYA 4JR9L 4WY7L 3GMLA 2GK2A 1Q9KA 1T1YB 3ZKQD 1ZT4B 3DXAE 4FFVC 4OQTA 4Z7UA 5CWSB 2OMNA 2F5AH 3KPLB 4R4FH 1R0AH 3GSRB 4U1SA 1E4XI 2JJSC 4PJEB 3HNSH 1UB5B 4I3RL 5LVEA 5IEKB 5TGBB 2F54D 1JPFB 3BEVA 1MHHA 1KUMA 1UXSA 4HPYH 3P9WB 1A64A 4K7PL 4YXKL 1BFVL 4BFEA 5IB5A 1J12A 2WANA 4XCFL 3LVEA 2OR8A 2B1HL 3D2UD 4HBQA 1KCRL 5H35B 4K7PX 2HT3D 3ALPA 5FEBA 5FUZL 1OGTB 2VXSH 5DMKB 2I9TA 4M6ML 5F1IB 4NO2B 3BOVA 5GS0C 3NZ8B 1P6FA 3RVXC 3LD8B 1U93A 4J4PA 1MH5B 4NZJA 4BH8A 2YK1L 4WTZA 4PJDF 3TM6A 3VXNA 1QYGL 1UQSA 4Y5YA 2GW5A 2GEEA 1J05B 4LVOC 3SE9H 4ONOA 5GISH 5T1LD 2MNUA 4AT6B 2YD2A 1YY8B 1N4XH 4N8VA 3U83A 1E4KA 1BD2D 3VFPA 2ARJQ 3PUCA 5KSVA 4Z0XB 1AKJA 5DFTA 4WEUD 2BVQB 2W0LA 5KSBF 4OZGF 4TNWK 3BWUC 2WSKA 3VXRA 2NR6D 5EUKB 3BJLA 4M4PA 5EC1B 1A6AA 4PJBB 4D0CB 5AG9A 1UVQB 4JZOB 1T1WA 1U58B 1UH3A 4N5EC 2JIXB 5GGTH 3FB7A 4JRYA 3UJIH 1WWAX 2LTQB 3RGVA 3LRSA 3F7PC 3UTSE 2LU7A 4JFHD 4NPYA 5DSCB 4HXAH 2UY6A 2QEJA 4U3CA 1F4YH 3STZB 4BZYA 1AIFA 1IAIM 5JIIA 4KJWC 2HVKA 5E6ID 1AO7A 3AXLB 5HVHB 1CFNB 3RTQA 5BZWB 4YNYB 3A6BH 3S5LG 3O6FD 3B9KD 3SDAA 2IG2L 3LZFH 1WBXB 2PYEA 4BUGA 4Q97A 5J6GB 1V3LA 2NR6C 3MODL 4FG6D 4P57B 4NQDB 4FXGA 1FL6A 1W0YT 2Z8VC 5GS3A 5D1ZD 3LS4L 4ZYKB 4WHCA 3CSPA 4I2XE 5DGQA 3V5KB 2FWOA 1JYNA 5DT1H 2FSEB 2X70A 3L3DB 4KVNH 1T2JA 1CFVL 3CAFA 3BUYA 4NN5C 5C0BA 3Q6FA 1A7NL 4F7PA 2HMIC 5TFSH 3ULSB 4JM2A 1J1PH 3TNNB 4OZIF 1BZ9A 3AS2A 2OL3H 4YEEA 4U1HA 4L8BA 3HI6L 4C56E 3F58H 1A7RH 4V2CB 4MA1B 3O6FC 1N64L 3WEXA 1PLGL 4LSTL 3O2VH 2R0KL 5A2JH 4JVUA 3IKCB 1PSKL 4LPCA 1HWHB 4NZTH 5D1ZC 1QFPA 4G9FE 2VR5A 2NX5B 4PJ7A 1ADQA 3VGEA 4G6JL 1UFUA 3P11L 1KJ3L 1MIEH 1NBZA 5EBWB 1C5CL 2EE9A 3CFDB 1A5FH 1VEPA 5D7KE 3D0VA 2PTVA 4PY8I 3KYNB 2DJ4A 1D9KC 5L0QB 1CGSH 1I3VA 1INQA 5K9QI 1FAKT 3AM8A 4JQVA 2V6HA 1HHIB 5AZEH 1S9XA 1Y6NR 2CK0L 3IXAA 3TWCL 4CMMA 2CGRL 1LD9B 5C0CE 1MLCA 5F9WB 1MF2L 1T20A 4I18A 1NGQL 4HUXB 2X2YA 5DD1L 2W60A 3STLA 1KIPA 3W5NA 4WU7A 3K81A 4NQCB 3FKUS 4XBEL 2EDDA 3R06B 3NH7H 2NY2B 3FN3A 4NHCH 4PJIB 3EOYG 2ZG3A 4PP2A 1HHKB 1IAII 3IFOB 5IJVA 1MPAH 4XNYH 3BJ91 1P7QA 4GXVH 2AV7A 3FOLA 4M93B 4MYWB 5E6ZA 4EI6A 1P53A 3G6JF 1KTKE 4Z77B 4P23A 3K3QA 4NWTH 3DI2B 5EU6A 3WNNA 2WV3A 1H3PH 3OHXA 1VSCA 5DHVA 1LEKB 5E70A 4F80A 2IWGA 3EO1A 4DQOH 4Q6IC 1E27B 4R9HA 2GTZA 3HNVL 4MD5A 3ZTNL 3MV9B 1D5ZB 2FD6L 5HI3D 1HZHL 3LV3A 4UB0H 4L3CA 1RZFH 5I0DA 1Z9SA 5LAXA 2R1WA 5DDHA 4A6YB 1OARH 2DQTL 1RZKL 4ZFFA 4OIAA 1KC5H 3HPJB 1K6QH 3B5HA 5IHZA 3CSYA 4Y2OA 1CICB 3T2PA 1K9TA 4Y1AA 1ZVHA 1FZMA 3CU7A 1I1FB 1QSFE 1XGUB 3H2WA 5F88B 4AL8L 2CH8A 4PS4L 4A6YH 3K1DA 4FTVB 3PNWA 4MJ6A 4FQIH 2OZ4L 1J1XL 3QB7C 4LP4A 5ADOH 3LQMA 4WJ5A 1PQZB 1MCNA 1QOKA 1UACH 4K3EH 3QUXB 4Y5VB 4LPUA 2XY1A 4QRQB 2E7LA 3VXMA 2Y25A 1IGMH 4OLWL 4HT1H 3O4LE 1UCBL 2VB5A 4WUKH 2DYPA 4WTXA 3BPOB 1JI1A 3S8WA 1FL5B 2HTKD 5IW1A 2OJZH 1WAAA 1R5IB 3RWDB 4NGHH 3QRGH 3QFJA 5JZ7D 4R26H 1ZT1B 1G0XA 3VRIA 2LV4A 2B4CH 3L1OL 5E5MB 2QSCH 5C08D 1KB5A 3KYKH 5J12B 2DBLL 1CXHA 4EOWL 1NMBH 1ZS8A 3LN4B 3MRCB 1JF5A 5LCVL 2WBJA 1ZVYA 1YN7A 4W6WB 4H0HB 5DD3H 2BMKA 3H7LA 4V1DE 1I8KB 1KEGL 4PR5B 3LMJL 4KQ3H 4WI7A 4F9PC 4GXUM 4PLKD 3UC0L 2FEEL 4LRNL 4GG6F 3SO5A 1EHLL 2Y1VA 4I9WD 1FRGL 2E9JA 1JFQH 3W39B 4Y88A 2OMBA 1ND0A 7CGTA 1C5DA 4RGNC 2GCYA 2UV3A 5J4MA 4AMKL 1BQUA 1FCCA 1HCVA 1MFCL 1RMFL 3TYGL 1I1AA 3BZFB 3C8KA 1ONQB 5FHBL 3TLRA 1KT2A 4BSVA 3KS0J 2EO9A 2JB6A 5CZVH 3CFIC 1DN0B 3L3OA 4DGYH 3V6FB 3CFEB 5JNYA 4PJCE 5BOPA 5T3ZL 1ITCA 1S7TA 3VXSA 1NAMB 4F7EA 1G7QA 2NXYC 3T0WA 3G5VA 5MEOA 3CVIH 3GGWB 4P5TB 2UWEB 2FHFA 3PWLB 5GSRA 1N7MH 2CKNA 4GBXB 1NAMH 3ESUF 3MRMA 4Y19E 4JDVA 5HYQA 4KUCF 3OKKA 3P30H 1MJUH 2FLRT 1KYOJ 2VDLL 1BFOA 4G8GE 1HXMA 4NQXA 2JJSA 2IMNA 3H7BB 2PYFA 3QAZC 5C0FB 4GW4A 3WLWD 3BVNB 2FBJL 3BIBX 2O5ZH 5I0ZA 4I5BB 2CLVA 2BP3A 5AYQA 1KELH 2GJ6B 2FGZA 4RIRA 4DGIH 4RAUA 3PV7A 2C5DC 3WN5C 2KQMA 1WUNT 3VCLA 4JFOB 1F3DH 3SPVB 3ABZA 2ICCA 1ORSA 1OF2B 1BQHG 1BJ1J 3IFLH 3BQUB 3B5GA 3P0VL 4OIIH 3L7FA 4BSWB 5K33A 4RMUA 5FAAA 4U49A 4TQEH 3RKDD 3U4AA 4X9HA 4R90L 1TZHA 3SE4C 1GGBH 4PJHF 5I9QC 3UYRL 12E8L 1KIUA 4K7PY 2V7HB 3GMQB 5EG6C 4CMHC 4KUCD 3NFNA 3QIWD 3UJTH 2ADJB 4KJYA 4YGVA 1U8NB 4YHLH 1OSPL 1KPRB 1GIGH 3LKNB 4NO5A 1XGPA 3MACH 1UZ8A 2LQRA 5D2LB 1VGKB 3OGCA 3ZDXE 2Y5TA 3MJ8A 3BW9A 1CL7H 1HDMB 1YEGH 3WDHA 2AJ3B 4OD2A 2Q86A 5FO8B 2PETA 2VLJA 1ZWIA 3AUVA 4KTEL 5DXWA 4NFBA 3SJVE 1T7VA 2B5IC 2DD8H 2ED9A 3KYOA 4P59L 5I1EH 1IGIL 3MX0A 3AGVA 2ZNWA 1TIUA 1C08B 1VADA 1J5OL 3FO9A 3PF2A 2IANE 3ZKXB 1EAJA 5MI0C 5T33L 3KPNA 1XMWA 5E2WL 3MROA 4UV4H 5FM8A 4Z8FH 1PG7W 1RV6X 3IDYB 3QQ4B 2X44D 4E42A 2DL9A 1INDH 1NUNB 3UPCA 1EDQA 1QR4A 1M1SA 4PV9B 5KS9B 4L4TE 2EYSB 4Q6YA 2VLMD 2BNQA 1YYLH 3O6MH 1EBPA 1DQDL 5T1LA 3ZDZE 3QHFH 2D3VA 3BZDA 4XMLL 3RWCA 4EI5D 4CU8A 3CSBA 2FBOJ 4JO2H 4LVHB 4GRMA 4M7ZC 5KN5B 5B38A 2HJFA 3WCYA 4X80L 5I6XB 2F74B 5JLZA 1MLBA 4RAVA 4QHUA 5DVOA 3C6LD 4MNHA 1WC7A 3DUUA 1I7UB 2BSTA 3GSNB 4Z7VB 1F2XK 1X5IA 3MGTB 5IR1A 4P4RB 5GRUL 2N7AA 5C0DB 3MJ9L 3TBWB 4PYHA 2CMRL 4PJDA 5CINH 5F7NC 1IQWH 2CXKA 1T0MB 4WU5A 4UILL 3GSNH 2DM7A 1T89C 5DRNB 1MELA 2HJKB 1E4WH 3GBLA 2MSPA 5LBSH 1MJJA 2H45A 4APQB 2IQ9L 4XCYA 4LKXA 2I9LB 4U1NB 4LSQH 4MXWL 3U79A 5EU4A 1DJSA 3L3HA 1SBSL 2C3XA 5E24E 1JK8A 1X9QA 3MRJA 5IMKB 4EI5C 3O6FA 2MWCA 1G0DA 1MAKA 3MV8E 3MRGA 2VL4A 4KPHH 3NN8B 3BD3A 4J2XA 4HUNB 1PKQA 5JW3L 3PWVB 4N0FB 3C6LC 3MFFA 1IM3A 4FOMA 1FG2B 5D7LA 1HH9A 5D1ZA 4Z78B 1SM3L 3RX8A 2BVEA 5LQBH 4Y2DD 2W92A 4N5UA 5D1QB 1QBAA 1T5XA 4O2CA 5F7DA 4X5WB 3CZFB 4I0PB 4QHMB 3OWEA 3QUZD 4YEFA 4ZMAT 1TQCB 4P2RB 5H8DA 4AEHH 1A2YA 4PP1C 4PFEA 4MMZC 1D9KA 4QNPF 1E0OB 3FT2A 5BXFA 4KI5F 3CCHA 4K07A 4PG2C 4Y5XC 1R3HB 4QHKJ 1HWGB 2FYYA 2RR3A 2WBWB 2Z9TA 2R2BA 3FHQA 3P4NA 3WFDL 3SGEH 1DQML 4I8DA 4K71C 4BSJA 3O4OC 1IMHC 4L4JA 5JPNA 4KKCD 3MRNA 1MNUH 2IBZX 2AEPL 4Y16D 3FL7A 2X6MA 2G2RA 5IBTH 4Y2DC 4PTTB 1IC5L 2ZOLB 1V5JA 5FA3B 1CYGA 3LEVL 5INCB 1MHPH 2JK5A 5FECA 1FV1A 5D4QA 1XF3A 1MQKL 2R23B 4OF3A 1GC1L 4ZS7L 4PD4J 1QPXA 3HR6A 4WIQA 3PHQB 2VITA 4KI5D 3QUKB 3GI8H 1LO2H 3BXNA 1SY6L 3V0WL 4DW2L 3JV4A 5TF1H 3ELAT 3FOMA 3TBTA 1CGUA 3Q5TA 4PPTA 4Q6IA 1LP9B 1YEEH 3T65B 1AFVH 3GBNH 3IRPX 5AUMB 1O0VA 1G6RA 3K8KA 4D94A 5EPMA 2VDPL 2BFVL 4P2YA 3TVMC 4QXGH 3WXWH 5F7KC 2YA0A 1TTFA 5D6CB 2V5YA 2Z91B 1W0WA 3MLTA 5HYFA 1A7BA 3VXTA 2DQIL 3OPZH 3ARBD 4W4OC 3RWGB 3B9VA 1L7IL 4LDOB 2XZQL 4Y4FC 3LQAC 1KIRA 4HIHB 4JANA 1NGWA 2BRQA 2VUYA 1WTGT 3PWJB 3QNXB 4NYLA 3D85A 4YC2C 4Y4HD 3NTCL 1J0JA 3LN5B 4QTHB 4R7DB 2XQYG 4F33B 5C6TL 3TJHD 3WXVH 4PJGB 4Q9QL 1MCOH 2PW2B 1S7UB 1RZGA 2GK0B 4PJ9D 3VRJA 3HB3D 1JIBA 1XCTB 3HE7B 1D5MA 3GB7A 1ED3B 2OJEB 2P5WD 2XTJB 3BPNC 3GRWL 1RZIB 1NC4D 4RZCB 3DHMA 2NY4D 3JTTB 5JORB 2XG4A 4PRNB 5CZXC 2BJMH 4PBVC 1EEQA 3RNQB 4JB9H 3TP4A 1D6VL 3QO1A 3UXFA 1AXIB 4NDMB 1MEXL 5F70A 1F6FB 4JO3L 5HI5C 5E8OB 1TPXB 4NKMA 4YX2L 1J11A 4M3KB 4E41E 1OQOA 2HG5B 5FA4B 2C1OB 4XNQA 1CG9B 2XKUA 4I0CC 3MV7D 5JW5B 4Y4HC 1GGYA 1TJGH 4X9GA 3PV6A 2VKXA 4F9PA 2YPLB 3D39E 4HKZA 1R5WB 1ZA6A 3VWKB 2P4AB 2XRAL 3MUZ1 5FF6B 2GITA 3SKJH 5IV2A 1T5WA 5ISZA 4U7MA 4PRID 3L3KB 2P48B 5DD5H 5DURB 1IGTA 5B39B 3MLZH 4HFUH 3DSFH 3NIFF 4HCRL 1O7SA 1X5ZA 1J18A 1N0LA 3MUY1 4UT9L 4J8RB 1MJ8L 4UV7L 2CIIA 4YXHH 3E8UH 1QSEA 1JMZA 1MI5E 4NC1E 1KACB 2ESVA 3T2QA 4LDEB 5JXAH 4HXBH 5TH2B 5M7QA 1P7KA 3JWOL 2BOCA 4MD0B 3WUWA 4JN2A 4ZTOH 4R0LB 4JFXA 3RY5A 5I17A 1NFIA 5FCUH 5TQ0L 5D9SB 4MNGE 4QYOB 4QHNB 3BX7C 1FNLA 2Z4QA 1QLFB 2NMSA 3MRRA 3I84A 4FMFA 4PB0H 3O2DL 3FQWB 2QV2A 2F8OA 4KK9C 1ZHBB 3KXFD 5IVOA 1Q1JH 2D0FA 1KGCD 4QXUL 3CUPA 3UBXB 3WN5A 2D03L 1MFEL 5CP3H 1QUNA 2X4RB 3WKNA 3QEGH 5I1KL 2UUDK 3P9LB 5GGVH 43CAB 3QA3A 2H1PL 3O41B 4QRPB 5D70L 1IKFL 1CFBA 2WIMA 2KZWA 2AJXH 5HGAB 4HWEH 3OAYH 4IIQC 2V9RA 2YRLA 4S1RH 3SE4A 5BQ7B 3HC4H 5D1XD 1B0RB 4OI8A 2ADIA 1S5IH 3OKEB 3P9MA 2J8UE 2UVEA 4IHOA 5C8JB 2ZG2A 3T3ME 2ADGB 4OFKA 5DF0A 3PWUB 4LHQB 4YPGB 1PG7L 3WMSA 3CXHJ 3X13B 3IDMA 1NL0H 4YBLB 4M7KH 5GPRA 3LY6A 2HKHH 3ULVL 4U1JB 1BMGA 3GNML 3R1GH 3IJHB 5C2UB 4O2EA 3MBXH 2E9BA 4UT6H 4JRXB 4NQEE 2P5EE 4XBGB 1HH6B 1YQVH 5EIQA 4JJHA 1WWBX 2YMXL 4MB5A 1YEFH 4KUZH 1K8DA 1FAIH 4F7TB 4WWID 2XICA 4RRPG 2MQ3A 3T4YA 5D71H 4AG4L 5CHNB 4L29B 3U9PL 1NC2D 1RK0B 2WUCL 4YFDB 4QLRA 4CN4A 4DZ8B 2IH1A 4OCMC 5DJ8A 4LLVA 3ARFC 1N8ZB 1CE6B 4HS8H 5HTSA 3HFML 4GS7C 2XN9D 4YO0A 3I9GH 3IETA 3REWB 1RHHA 2VRAA 1Z9OA 1FLRL 3OR7B 5JQHC 4FP8H 4MXVE 4KHXL 2F58L 7FABL 5MEND 5I66B 1XF1A 4ELMB 5E6YA 5KSAD 1OAZL 4RDQF 5D7JD 1I8IB 3KDMB 2HVJA 3VG9C 5ACZA 4NT6A 3HMWL 1Q0YH 5EFIB 4MDIB 4NZDA 5FYLL 3G08B 5SWZE 3HZKA 3QDJE 4AK1A 3BZ4B 1NCDL 3F12A 1CF8H 4OFDA 4ODUA 1LGVA 1TFHA 3EJYD 1U8HB 5CGTA 3RY6C 2VWEE 4ZSOB 2APBA 4K3JL 4O51B 2X1XR 5JOPE 4LCWD 3WFEH 4OQTL 3UTQB 4OCYL 3DRQB 3FQUB 4O00A 1AD0B 4XCCH 3BGMB 4TTDC 1WCBB 2FR4B 1TCRA 1VESA 4YUEL 2MFNA 5C0IA 2YKLH 1KJMB 3IU4L 4HFWB 3VI4E 3HLAB 4JFZH 1T89A 2W9DH 1OGAD 3V4UL 4I2XB 2ZCKL 2E3VA 2VLKE 2Q76B 4AIOA 4CVWA 5D8JL 1HQ4A 5C07A 2YBRB 4BZ1L 5EB9A 4JO4H 4JFFA 4EI5A 3ZKND 1H3TA 4EJ1C 1ZGLB 2QHRL 4MNQB 4F2MA 3O2WH 1HNGA 1IT9H 1F90L 1RZ7L 3DECA 3GJEA 4IRSC 1S5HA 4K3GA 2X4TA 3WSQH 3C6LA 4GLRI 1GGCL 4CN1A 2GSGB 3TNMB 5IB3A 6FABH 2XIDA 1YNLL 2ZKHH 4OAWA 4R96A 2ICWA 4OLXH 2X4PB 4NKIH 4PRAB 5T3XL 3VGAB 4OZHF 5SWSB 1A1NA 3MBED 4HH8A 1G1YA 4XAWH 3UZEA 2GY7B 2FZ3A 4WCYL 4G43B 5CIPB 4FS0A 4ZD3H 3CH1A 3MLRH 5I75B 3KPMB 5GGRA 1SBBA 2NY3D 4PG2A 4Y5XA 2DQEH 4IJ3B 4LLWA 4HHAA 4CU7A 2W1NA 5CIPH 3OR6B 5TE7H 4ELKA 5H2BB 1YMME 2DLIA 5L2KE 4MJIB 4GKSB 4NCC1 4M8QB 4U1KA 5GSVA 1EX0A 2V7NB 2NW2B 1S9YA 4YHIA 5ESAB 3SDXA 4FFYH 5T3ZE 5I18H 4Y2DA 1IAKA 2IBZY 3VA2C 1X4XA 5F9JB 1N5AA 4LGPB 3AREC 1GAFH 1T04B 4F58H 4G9DB 3BKJL 4WI4A 3PWNA 3QFDA 1FH5H 1DQTA 1I85C 1II4E 5FGSA 5IMOB 3KPSE