3UTTE

1e6-a*0201-alwgpdpaaa complex, triclinic
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
244
structure length
244
Chain Sequence
GVIQSPRHEVTEMGQQVTLRCKPISGHDYLFWYRQTMMRGLELLIYFNNNVPIDDSGMPEDRFSAKMPNASFSTLKIQPSEPRDSAVYFCASSLWEKLAKNIQYFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural basis for the killing of human beta cells by CD8(+) T cells in type 1 diabetes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 244
sequence length 244
chains with identical sequence J
ec nomenclature
pdb deposition date 2011-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uttE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uttE02
1NMBH 3BGMA 3BW9A 4P4KB 4HXBL 5C0CD 2P46B 1PBYA 5H37H 3NIFE 4JPKL 5JOPE 4MXVF 4HFWA 3QDGA 5FYLD 1U2HA 1OAQL 3MV8B 4EDWH 5JHDB 2ZJSH 4FQXD 4Z7VB 1YN7A 1FLRL 4X5WA 3RPIB 3OR6A 2XZQL 5CIPH 4A6YA 3VXRE 5JQ6H 2Z93A 4HX1A 5I8CA 4O4YH 3EUUA 5DEFB 5L2KD 4YUEH 1CLZH 4L3CB 1HWGB 1F58L 5CGTA 1BF2A 5HHXH 3QQNA 5GGUB 1JFQH 4YBHA 3TNNB 1DBKL 1I3RA 4PJ9B 3S35H 1UC6A 4JO4H 5BO1H 3E6FB 5IGXL 2CDEB 1VEMA 1JPTL 1FYTE 4J4PA 2FR4B 2E5EA 3C9NA 4TVPE 3KPOB 3OAZH 3SJVA 1WTLA 1CVSC 1KT2A 3S5LA 3RHWK 3VFOA 2X7LA 32C2A 3CFCL 5BMFH 4J7RA 1T4KB 3L9RA 1PYWA 1ADQA 3IJSB 5HI4C 4BK4A 5F71A 3EYFA 2NQCA 1ZVYA 3JVGC 1FE8L 2E9IA 1IAKA 1RZGB 4JHWH 2B7DT 3IGAA 1JIBA 5F7LB 2NXZC 3CU1A 2VDQL 1MFAL 4NRYA 4R26L 2C26A 3VI4E 3D69B 2WBWB 4G42A 4NQCE 1MCHA 3EKCA 1I7TA 5GIRA 1S9XB 4MWFA 4WHTA 4YX2H 1F3JB 2EYRB 4PJIA 1ZT7A 5HDBF 3DX9B 4I18A 1S7VA 5AZEH 2R56L 2VLKA 2X4RA 4Q9BA 5KSBA 4A6YL 4R96B 2XTJC 1DBMH 1B6UA 3KYMA 4ENEC 2Y06L 3UPCA 1MREL 3CZFA 2Q3ZA 3UTSD 4Z5RA 4C57C 1N5YH 3T3ME 4TSAH 5SWZD 1KGCE 2AXJA 3BKYL 1MFDL 1LK3L 2OI9C 3VMOA 3P9MA 1JHKL 2CGRH 3CFDA 1NFDA 2P47B 2BRRL 5EO0B 5ERWB 4GLRH 1CDUA 4R3SA 4PG2A 4OIAA 4X6EA 4G5ZL 3DUSB 5FUZH 3E3QC 2AJ3A 4L9LA 4G8GB 1NKRA 3MRRA 5C0CE 3NFPA 2CIKB 4F7CB 1NAMB 1EFQA 4FZEL 3BPCB 4NQTA 4WTZG 4D94A 1R5VB 2FHCA 5FDYA 1YMHA 1T2QH 1HYSD 2AJSH 3V5HB 3SGKA 2JCCB 1TZHB 4GFTB 3RZCA 3HS0B 3GSRA 1A3LH 3G5YB 3C6SB 3JUYA 1Y6KR 1HH6B 4KKLD 2VH5L 5TGBA 1TQBB 3BRGC 2YSSB 1J0ZA 4PTTB 4PTUB 4FQQA 5B38B 4H5SB 1P4BH 3QNZA 2J12B 3ZDZE 1B3JA 3DUHA 3VG0H 3WYRA 2D7OA 3K3QA 4PJAA 5JUEL 5M95B 2Q8BH 1QYGL 4K8RH 2PTTB 3D85D 2F19H 2GFBB 4QHUA 1KTLA 1UFUA 3NTCH 1J05B 3C60D 4BFBD 3HMWH 4NSKB 1CL7I 3DVNB 4QXUH 2JF1A 2MHAB 4XNYL 1DVFB 4AQ1B 1EHXA 4Y19B 3ZYIA 4DUWA 1RUML 3MLVL 3ILQC 3VFTA 1LEIB 1LEKA 5FO9A 2P5WE 4XC1L 3LPWA 4KGLA 2JIXB 5EUKA 1G9ML 4LPCA 1GZQB 2W65A 5TF1H 4D8PA 4TSBH 3CMOH 1EZVX 3BPLC 3TGXA 2VB5A 5L2JB 4ODVH 1PG7L 4YHKH 3O4LA 2GHWB 3RWFB 1XGPA 2HTLD 5DHVB 5HDQH 2CLRB 3VXUB 3ZTJH 2XKSA 4NC1E 1MUJA 4E41B 4ESKA 2FO4A 3BE1L 4EIGB 4F7MB 3E0GA 4IRZH 1INQB 2IG2L 4PJCF 3QEQD 4U1LB 1XGQB 6FABH 4L4VB 5FYLH 3WS6C 4YHOL 3IU3A 1JF1B 1I9RL 4N0YL 3AFLA 5CSBA 3X3GL 3SKNA 1H3UA 2FO1A 3DV6B 3DRTB 3DIFA 2CRZA 5HVFB 4YLQT 1U58A 5EU6E 2OZ4H 3D2UA 4N0CC 1VACB 3ROLA 4HKXB 2A77H 3QHTC 1N3NA 4P9HC 3HR6A 3NACH 5ESAB 4PRDB 1NAML 3QUXC 3MRBA 5F70A 1VHPA 3DURB 4YO0B 2X4SA 4XP9L 2GT9A 3LKOA 4MQTB 3MCKB 4LGPB 5ICZA 2RJMA 2VLRE 5LBSH 1GJIA 3FHQA 5I16B 3KPQA 3JWOL 3E1F1 4KROC 1D5MB 1IC1A 1A7NL 4NPYA 4U3HA 3G5XB 3BKCL 4MD0B 3VXQA 4AIZB 5IQ7H 4K2UL 4YR6B 5KANI 5FYJL 2ICWJ 3UYRH 4J3XA 3QJFB 4Y5VC 4GRMB 4XNZB 4JQXA 2ICWB 5D1XC 4H88H 2CR3A 4L8DA 3U6RA 3H9YA 4XPFL 1JRHI 4J1UB 3QEGH 2DBLL 4X8JB 4X99A 1NLBH 1PQZA 1CDIA 4Y1AB 5D5ME 5F44A 1LD9A 5DJYA 5TE4L 4W70A 5ALCH 5DMYA 3I6KA 3MRCA 3SDXA 4JANA 4GW5B 1UQSA 3SGJC 1KXVC 2F54A 5I1EL 1JNNL 3UTTD 4YGAB 1HQ4A 2BC4A 3CIQA 3ES6B 3QG6B 3UJTL 4ETYA 2F53B 1YZZA 4JAMA 3EGSA 4TUKH 4NRXA 5E94A 1E6OL 2DQTL 3H3PH 3GB7B 4NGHH 4UU9B 1ZHKB 1KJ2H 3U4AA 3ZKXC 1DUZA 5E1AA 3WD5L 1AIFB 4NC2B 3RDTD 1SJEA 2HG5A 4GQ9L 4JFHD 1RQ5A 5C3LD 1QFHA 2XY1A 4P59L 5CJOL 2YPKA 3M07A 3ULVD 1IQDA 1Q9LA 4JG0H 4X0KA 3HG1B 4OLXL 1A2YA 4HJ0D 3ARPA 5EOTB 3L7EA 4OZHE 4R97C 4XVUC 1CF8H 1OGTA 3VXTB 3G6AB 2IALB 3LQZA 3O0RH 3B6SA 5TPWH 1SYSA 4IBLT 4XBEL 4HKBA 1Z3GH 4KI1A 3ARUA 3V7AE 4OZIA 1V7NL 4PBXA 3CFEA 3RIFK 1OPGH 1T5XA 1HXYA 2AEPL 1FAIL 3I6LD 3TA3B 5IFAH 3OHXB 2I60H 4U1NA 4XPGL 1QRNE 1JN6B 5TF0A 5EIQA 1S3KL 5IEHA 3IFPB 1L0QA 3MFFB 3SDXF 1G7JA 4APQB 5SWQB 3LKRB 4JGUA 5J13B 5E5UB 1FFNA 1G0YR 2ZG3A 1AJ7L 2FSEB 1CN4A 3BJLA 3ZDYE 4OZFA 4U1KA 1MQKL 2W38A 3UBXB 3OAUL 1AH1A 1PX3A 4JY6A 5BS0E 4L8BA 4OLYL 5C0AB 3RVUC 4BUHA 5E8OA 3TC9A 2I27N 2FX8H 1U8JB 1NQBA 5D71H 4IIQC 3SPVA 3SDCA 1QLFB 4HJGB 3VRLF 1G6VK 2VAAB 4R7DB 4F8TA 1W0WA 2OMBA 4M7JH 4D0CB 4L8CA 3QFJA 4HIIB 4HUXB 1F02I 4QY8A 5EZJA 2XXCB 3RIAF 1A1NA 4HWBA 5CJQH 1ZLUH 2XKNA 4NHCH 4M7LH 5HGBA 1W0VB 5HVWA 3BAEH 1CD9B 4M3KB 4XNUL 4JFOB 1UCBH 2ZCHH 5J11B 2NY0C 4J3WA 25C8H 4LASH 4Z7UA 2CIIB 3QG7H 2GJ6A 2A6JA 7FABH 5IESL 4NN5C 4F7TA 4KUCF 6CGTA 3D18B 4ZSOA 3PV7A 2YK1H 4OZIF 2XA8L 2AK1H 5GJSH 5F7NC 4JRXE 1YYLL 4LQ1A 4W4NA 3GBML 3LS5H 1JHLH 4E42B 1R5IB 4HWEL 3QULA 4PJ5A 1VGKB 4JE4B 2R9HD 2AV1A 5K9QI 4NO3B 1T5WA 1N6QL 2D4DA 2W60A 1V7MH 2WIIB 3LN5A 1NLDL 1AC0A 3GRWH 4PRIB 4F2MB 5IR1A 4JFHE 3HN3A 2QSQA 3ULVE 4L3ED 4P99A 1A6UL 2CK0H 2D7QA 2QQLL 3O4OC 4PPTA 1XF4A 4PGBA 3RP1A 2QKIB 5IBUB 5I1DA 4XGZB 1BLNB 3Q48A 4IRJC 3RWCB 3TNMA 2UVFA 4YHMH 5IB4B 1OWRM 4QRRE 4OGAD 2HTKD 5A16B 1OW0C 3SDYL 3TH2T 1SVZA 12E8H 4R4ND 3B43A 4P5TC 2NXZB 5D72H 2YPVL 3QPXH 3V6FB 1W72H 2DLTA 3TCLA 1EAJA 2HWZL 1HSAA 1WC7A 3B9DA 4HWBL 1NMAH 4AH2B 1OLLA 4FRWA 5CMAB 4I2XB 4NQXA 3MBEA 5EU4A 3I6LE 1JPFB 1WVZA 1T66D 1UM5L 5E0QA 4YAQA 4EZMA 1J8HD 2CDGB 2OTUB 4XB8A 2DQFB 4OGZA 4Z7UF 5ICXB 3EYOA 4NC0B 2ESVD 1EEUA 2FHFA 4FTVB 4H8WC 5EC2B 3RUGE 4JKLA 3VWJB 1BEYL 1RU9L 5IB1A 3UTZA 1ZT4A 5INDA 3GBNH 4HH9A 1H8SA 4FQHB 3GGWB 2FATH 2OSLB 3NZ8B 2P5EE 1I7UA 1Q94B 4XBGA 2XI9A 1MHEB 2FD6L 5DD1H 2L0DA 5EBMB 3S97C 3GI9H 3WLBA 3LEXB 4OLEA 2Q7YB 2OI9B 3WNKA 5I1LB 1MRDH 2OK0L 5T1LA 4YPJA 1NGYA 1RMFH 4XRCB 4NFBA 4Z0XA 3FOLA 4FFWC 4MHHG 3H7BA 1TPXC 4Y5XC 2BSTA 1CE1L 5DQ9B 4CRPA 3WO4B 4ELMB 5C9KA 2EDOA 2D03H 4UMGA 5LAXB 4UINH 4XVJL 5F9AC 1A9BA 4OZ4B 2D7MA 5T1MA 2EYTA 4HUNB 4HBCL 1XCTB 4WW1B 5C0GA 4POZD 1F45A 3ULVH 4P5MA 4H25A 4PJDB 2V7NB 1RZJH 5AD0B 2FYYB 3VXOB 4NHUB 4QXGL 3WN5A 4U0QB 1QEWB 2DQDH 4JGMA 3UC0H 5C0RH 5MI0C 2R0WL 4MD5A 1QSFA 3L3IB 2LTQC 3VW3H 2AS5M 1M7DA 1S9YB 4XVSL 4MJ4A 1BQLH 3W5MA 2HRPL 4ZS6D 4DN4H 3HI1A 2DQCH 3DO7A 3CFJA 5H35A 2XPGA 1HSBA 4E5XA 3VFPA 3QJHB 2ATKB 2XFXB 4YXLL 3HE7A 4L3EE 4HIHB 3AUVA 4OSUL 4DVBB 1SBSH 4Z77B 4WUKH 1Q1JL 5D9SB 4GRLD 4OI8A 4ODWA 2FDBP 3TJHD 1AGCB 2CKBA 2Q1EA 3V6ZB 4PBVC 3SGEI 2HLAA 5DFWH 1WWAX 4HKJA 3RQ3A 1M1SA 1HHIA 3PNWB 3QWRA 3CFBB 4N0UE 1G7HB 4RA0C 4GG8B 4DEPB 1UZ6E 5LXGH 4S1QH 4GKOA 1URLA 1F6FB 1QA9B 4X4ME 5DD0H 1MIML 3ROOB 2P1YA 2VDML 3HAEH 1EBAA 4P2RD 4GKNA 2I9TB 2HJKB 2FLBT 1A6TA 2VLJD 2X4NA 2ZUQC 5DTFB 3TIDB 4OLVH 3P4OA 1J8HE 2G75B 5MHSD 1SMOA 4ZUVB 3DRQB 2VZUA 2A6KB 3S6CA 4J4PC 2PW2A 5E95B 1J1XL 5D7IE 3X17A 3QZWA 5EA0H 1B90A 4X5LA 5HHPA 3BXNA 1UCTA 1BBJA 4NCC2 4FXGB 4LF3B 1O7SA 1XGYL 1R3KA 1I3GH 2AV7A 2IAMB 3UPRB 5GS0L 2BVOB 1N8ZA 2CRMA 3HLAB 3K0WA 5TH2A 3PWUB 2BY2A 4LEOB 4OM0L 1U3HB 5BVPH 1QFUL 1LP9E 4Y2OA 3MROA 3CVHA 4MCZA 5J6GB 2XRAL 3PHQA 4YC2C 3QIUB 3ULSA 4HS6B 5IOPA 2DIJA 2NY3D 4MDIA 5CEZE 2JJVA 1BGXL 3H9SE 3MLZL 4D9LL 2DKMA 4LLDA 2CUIA 5ADOL 1NH6A 4PJXA 3ARGD 5TE6L 1B0WA 2O5ZL 3IDGA 1EHLH 3REWA 1ZWIB 3BN9C 4ONGL 5JPNA 5J12B 1CZ8L 1CFBA 1JHTA 3IS1X 1S5IL 4OI7A 4JB9L 5GS1A 2AEIT 5EC1B 2X4TA 3MLWL 2BDNL 5IP4A 2E7BA 4MXWL 2Y23A 4YHPB 1Y0LA 3WDIA 3MRDA 1RSFA 4IRSA 3QXDA 3B9KD 2VR4A 4NN6C 2BXZA 1ZANL 4DUXA 2BOCB 5F1KC 1DEDA 4GKSB 5GS2D 3MRQB 4PG2C 2EDJA 2EIDA 4P57B 3EHBD 4P2QE 1G7QA 4U49A 1JNHB 5ICYB 2YXFA 5I15H 1TJGH 3PWPB 4FFVD 4PBWD 3OGCA 4AIXA 4XNMA 3NA9H 1LDSA 5I1IL 3MJ9A 3NPZB 5IF0B 4L4TE 2ZUXA 4PJ7E 4F80A 4K94L 4MQ7A 3X3FL 1P7KA 4IMLA 2LAGB 4EVNA 4Q97A 4PP1C 3SGKC 3RZCC 2HKFH 4YXHL 3FO9B 5GRUL 2PO6D 2BP3A 4IDLA 3OR7B 3R06B 3DI3B 3FMGL 4U6HB 3RPKA 4O51A 3VXNB 5I1JL 5GRWA 3RNQB 5FA4B 4DKFL 4RMRA 4YEFA 2X4OB 5MHSE 2BNRA 4RFOH 1WGOA 1QQDA 4PJXF 2H1PL 3QH3B 5HI3D 3LS4H 1I75A 3S88L 3I2CH 5FHBH 3KPTA 1A7OH 1MJ7L 3CH1B 4EDXA 3DMMD 4JG1H 1FNLA 2OLDA 4K7FB 1SQ2N 1QACA 2IBZY 3TO2B 2IJ0C 2N7AA 1RUAL 1MI5B 5L0QC 3HPLA 1CE6B 4KRPC 4OFYD 4D9QE 3IDJA 3C08H 1G7MB 4KV5F 4G8IB 2HT3D 5CEXA 4ELKA 3MUGA 4WGWB 3GJFH 2IBGA 4CW1B 5EIVA 3V4PL 4NZUL 5IHLB 5FA3A 1MWAH 3RJQB 4NO2A 4RWHA 3TBVB 5BXFA 2UY6A 1N2RA 1NUNB 3QXTA 1FVEA 3TO4D 1V3MA 1LNUB 5DUMH 1YYMH 1KEGL 3EJJX 3GMLB 4M48L 2CDFB 4IIQB 3SGDI 1I4FB 1YQVH 1MCJA 1U91B 1MCPL 4ZAKA 2CXGA 3BVNA 1F4XL 3FQXB 2XQYK 3HZVA 2AXGB 4HS8H 1H5BA 4NZTL 1YEEH 1OGAE 4MJIA 2ZUUA 3A6OA 3PWVB 3Q5YA 3RGVB 4LHUB 4WGVB 4Q6IB 4P48A 1A0QL 3FT4A 3WHE0 5DMIH 4HJJL 4OT1H 2JELL 2F5BH 1MCWW 1Q9OB 1SJHA 2NY0B 5I1CH 2VDPH 1OAKH 5IQ9A 1C08B 4JR9L 5CIPA 2D7PA 5DI8A 5MP6L 3OG6B 2IFFH 3FQNB 4FZ8H 1EO8H 3E2HB 3UZVB 1T21B 2HFGL 4Y2DD 3TVMB 5A3ID 5F7DB 3SY0A 4Q7DA 5BVJB 4XP5L 1FG9C 3VXMB 4WRLA 2H6PA 4OLZL 4PD4J 4ZXBD 4I9WD 1G7PA 4MJ6B 4PJEA 1V3JA 1X5AA 2YPLA 4X80L 1FZKB 1BJ1H 2V7HB 1CL7L 1HHHB 5BZWB 3PWLA 1B4JL 4WI9A 3L3GB 3S96B 2P8MA 1PZUB 5E2VH 3IS0X 2HYMA 2P48B 3P3YA 1WUNT 4IOFC 4JQXC 4P5KB 4HT1H 2F9BT 4HULB 4RGND 3O4OB 3GKWH 3U4EB 4QRSA 2Q8AL 1FZOA 4F58L 2NLJB 1P9MA 1I1AD 4ZTPL 1I3VA 1REIA 3KPSD 1BOGA 1LMKA 4QRPB 4HHAA 1RIUL 5F72S 3P9LA 2H32H 1OF2B 4OQTH 1RK1A 4Y4KA 5I2IB 1WFOA 2V9TA 4BFIA 2VXVH 4JY4B 1MCLA 4HIEA 4YBQC 4D2NA 4OB5L 1KPRA 4QXTB 1NCDH 1HI6B 2BOBB 4K23L 3V8CA 4PG9B 2EZ0C 2D2OA 4N0FA 1QOKA 4JQIL 5DHYA 1YEDA 5J9PB 1WIUA 3GKZA 3TZVB 4AK1A 1MHPL 4JJ5A 1CLZL 4MA7L 3ZMRA 4XP6H 1KUMA 4FQLH 2VITB 1EEYB 1OD7A 1UB6B 2BHYA 2ICEA 3C6LA 1ES0B 3TM6A 3VGBA 4PJEF 4GXUM 5HI5C 5GS2H 2X2YA 1IC4H 1IZJA 4J8RA 5F6IC 3IJYB 4QNPE 1HQRA 4HEME 1DLHB 5F97E 4KTEH 4JFDE 4YIQA 3W11C 2EDKA 4N8VB 1JYXA 1IKFH 1J1OH 3I75A 4PLJD 4NOBA 4XZUA 2JLLA 3AY4A 1TPXB 2Y5EA 4Q9QH 1F5WA 4ZPTA 3SQOL 5FOBB 4W68A 1JRHL 1FYTA 1LO4L 3V0WH 2GEEA 5C07D 3CUPB 3I84A 1IBGH 5FGCE 4RWYH 5EPMA 5F7UA 1KV3A 3D9AL 2CXKA 1MAKA 1MNUL 1NMCC 2EYSA 4J3SA 1S7UB 3N9GH 3RGHA 1X5ZA 2DQEL 5ISZB 3KPMA 5MEQB 4FG6D 1HOCA 5HGDA 2RB8A 3BZ4A 3MBXH 5BJTB 5IKCA 2VMFA 3CCHA 4XHJC 4LLYB 3ME0A 1TZIA 4P2OA 4XPAL 3OF6D 3MZGB 4CVXB 4NQCA 2VWEE 4JPIA 2EKJA 4XAKD 4XX1E 3RX5A 2D4FA 3BZEA 1IAIH 3MACL 1H15B 2CRYA 3NIFF 4U6XB 3KYOB 1FFOA 3EDJA 4LRNH 1MHHA 4LQFL 4XMKL 4MZ3A 4O00A 4P46B 1N4XH 3KPRD 1V3KA 2K1MA 1A7RH 5IK3B 3QDGB 3HE6D 3DUUA 1JZ7A 4KU1A 1IEHA 3ARFB 2W92A 1WV7T 1FL5A 2DLFL 4D9RD 5L7XL 1LO0L 4HPOH 3O2VH 5E6IA 2K9UA 5HHOD 3BWAA 4BQ8A 2E8ZA 4PJFF 4KVCH 2VE6A 2GSIA 4LSVH 2YD3A 1A8JH 1OSPL 2NR6C 4PLKC 5HHQA 1CLYL 2ZUQB 3LZFL 5DMGD 3LVEA 2DLGA 2V17H 3G6JE 3LKSB 1IGTA 3AS2A 4KRMB 4TVPL 1KJ3H 2NXYD 4UILH 3O2WH 2ADIA 1UXSA 3BN3B 1FYHB 3FJTA 3QUMH 5IVZB 4KI5C 4XMLL 5C0CA 1KT2B 2AABL 4QGTA 2PYEB 2C5DC 32C2B 2A9NH 3MCLH 3K2UH 4AG4L 4F15C 3T4AB 5J1AB 4M9PA 4TPRH 3D3VE 4Y5YA 4F7EB 2D31A 1D9KD 1FLTX 2EDQA 1L0YA 4NQDD 2DTML 2V2WB 5IBLD 1CGTA 4LHUG 5HI4D 4G3YH 2OZ4A 2WIMA 4FOMA 5MEND 2XZAH 5J57B 4DGYL 5JPMA 1ZHLA 2A6DA 1I9JH 1M7IB 2IAND 1AO7D 5T1DL 5IB5A 3MBEC 5I1HH 3IXTB 4P23D 5CP7B 5F7HA 5KSVA 3CDYA 1NGWB 4HK0B 5IIEA 4M7ZC 4MWFB 3KXFD 4JFYB 5J3HD 2AKRA 1FGNL 2UUDK 4K71B 5CS7A 1K8IB 4LNRB 1S7VB 1C5CH 2X4RB 4GOSA 4PV9A 3MRKB 3RVWC 3P0YH 3K4DA 5KAQG 2J3SA 1U8HA 3L5XL 4NM8L 5HY9A 3T3MF 3EO1B 4O02H 4LFHG 3DSFL 1M05B 2JJSA 3CMOL 4LCCA 5IFJA 2OS7A 1D5BA 3DV4A 1GC1H 5IM7B 2YRZA 2P5WA 2OQJA 4Z95H 1ONQA 2W0FA 1MH5A 2NY5H 2W9EH 1E6JL 3W9EB 2EKSB 1QRKA 5HD8C 3FFCB 4QO1A 4RAVA 5CINL 4Y4FB 1A7PH 3ZTNL 4ZUSA 4TOYH 5FXCH 3SKUD 2AJ3B 4F33A 4QGYA 2FB4L 4KKCD 1FVCB 1U8OA 2NW3A 2MPAH 5HVHC 4BSVB 1RZFL 2VIRA 3TN0B 4MNQD 4U7SA 5HDOA 5KOVC 4RSVA 1KCUL 3LPFA 1CXLA 3UTSA 5KTEL 5BV7L 1U8MB 5DMKB 3GSRB 4JHAH 1AD0B 4PJCB 3FQWA 2BVPA 3WN5C 1IRAY 1OLZA 1HN1A 1KTRL 2ADFH 5EU6A 1I1FA 1PZ5A 1T0NB 5LBSL 4HEPG 4JZOB 3V4UH 1MJ8L 4FQQB 3DXAD 9CGTA 1DBBL 4MNGA 3VFMA 3QNZB 3BHBB 5HYQA 2EDRA 4AM0B 4HW6A 3VGAC 4JRWA 4N1EA 3MLYL 2X41A 1FNHA 2IMNA 3HE7C 3A67H 5B4MC 1XR8B 2VLRA 4BFEA 1SEBB 1FPTL 3GHBL 3C8DA 3CVIL 5ANME 1PAMA 4H88L 1CD1A 4JFFD 3IDMA 4S1DC 2M8XA 5L0QB 1L7TH 4KRPB 1KTLB 3O8XD 1NLBL 1NDGB 1RURL 4N8VG 3U0PA 4RIRA 3BJ91 4TUOA 1AY1H 2ZCLL 3OX8B 2C7UA 2KH2B 4M1DL 1UH4A 4V1DB 1YECL 2B20A 4I13B 4HIJA 1BMGA 2UYLB 2X4UB 2IANE 5E2UL 3SN6N 2H3NB 1DN0B 4FFYH 5D5MA 3GMMA 1D5IL 1KCRL 4RFEA 3U4BL 5GRZA 5DRNB 4ODTL 3KHOA 5HGHA 4CDHA 5C1MB 5D2NB 4LDLB 1XGPB 3L5IA 4ZQKA 3HRZA 4JRYD 4MQXC 1K5NA 4GRWE 1S9VB 2EXWD 4WCYL 5I75C 1PFCA 2BVQA 4GJTB 5AEAA 4N90D 2DQGL 4BH7B 3HCVB 4PRPB 4JG0L 1UZ8A 3QIBD 5FHAH 1B2WH 3FB7A 2AXFB 5C6TL 4RFNB 1R3JA 1U58B 5TFSL 4J6RL 2FGWL 1XGRA 3RWDB 3QUYA 4LLUA 3QP3A 2VOTA 4LARH 4KQ4L 4JFEE 2LVCA 3L95B 3OPZH 5DURB 4KMTH 1V3LA 1GIGL 4L8SA 2Y07H 5DWUH 4H26A 4XPTH 3LKPA 4OZHA 5JZ7C 3V0VB 3LKOB 3VRJA 2V6HA 1UYWL 3BISA 4O9HL 4XPBH 5CBEB 4I4WB 3QPQD 1AQKH 1H0DA 2GK0A 2RAMA 4LHQB 1UM6H 4LSRH 1HKLL 4M7KH 1K9TA 4KHTH 3F65A 3CDCA 2AJVH 5IG7A 2O61A 3W0WE 3ZYOA 1IFHH 4YDVB 2Z8SA 4UV4H 1FO0B 4Q0XL 2XWBA 3CMGA 1QRNA 3GMNA 5GS1C 3HC0B 4I0PD 4QTIL 3BI9X 5DZLA 4WU7A 3NCJL 2FX8L 4K9EL 4L29B 1PQZB 4FXLA 4EQ3A 4ODUA 5I0DA 4PP2B 5EUOF 4RAUA 3OB8A 4OCYL 4YK4C 4IRSC 3GMOA 3VFNB 3IJHB 5E5MB 1A1OB 3SDXB 2A1WL 1QBLL 1QLEL 4JANB 1OTTD 4U4BA 3LRGA 3WL9A 1W72A 5BS0A 4E0RB 1VDGA 4QRTB 5DJ6A 4NNPH 4LLMB 5GGVL 2QBWA 5A2JH 4MAUL 1TVHA 3K46A 5L9DH 5D1QA 1FL3A 1GPOH 3TH3T 1A9EB 3MRJB 3U1SH 2GTWA 4ZD3H 3RBGA 1ERNA 1YUHB 5DD3H 4AZ8A 3MLUH 3TIEA 3U9UA 3PP4L 3JWDH 3U79A 1YEKL 5AWNH 2VQ1B 5DJZA 4Z8FH 3KJ6H 4HKZA 5T3XD 5F9DC 5FGRA 1JI2A 3VWKD 2NZ9D 2O26U 5HHVL 3QFDB 3RRQA 2JJTA 1K6QL 5EO1B 3RWEB 1OGTB 1U8IB 3DBXB 4IOIB 5HJ3A 4GAJL 3LQZB 3B6SB 4EUPA 1SYSB 1MIEH 2G5RA 1YEFH 4HKBB 4JRXA 1JWUA 2J4WL 2AQ3A 5F89B 2NX5B 2MNUA 4OCMC 5T1KB 1MCBA 2VDLL 5I1GL 5E24E 1IZKA 1F3RB 1TLKA 4S1SH 2J6EH 3H7LA 1IC5H 2E7CA 3QDHA 2H26A 4AY0A 1TETL 2FLRT 1G6RA 2GITA 2R0KH 2Y36H 1VEOA 1T1XA 2D9CA 4UT6L 1X4ZA 5MEPA 2ADGB 1EEZA 3WBDA 3QPXL 4KK8C 2YC1A 4EN3A 2WZPD 3JV4A 3DECA 1RFDH 5ESVB 4Y89A 1R24A 5DFVC 4WO4D 1BJ8A 3LSOA 4NQEB 3KS0J 4QRRA 5KZCB 2ZSWA 4JPWL 3WEXA 4MX7A 4RISL 1F90L 3NN8B 4RX4D 2W59A 3PWJB 3VD3A 2I9LA 3RVUD 5EBWB 5DC0A 2NY7L 2PUQT 1KXTB 2MKWA 4BZ2H 1DQML 1FO0L 1FQ9C 8CGTA 4GMTL 3OXSA 4LIQE 1H5BC 1TJHL 4X6CF 1YY8B 4G6KL 4M43L 2EIZA 2B4CC 3K8LA 1I8MB 2VDNL 3L1OH 4Z7WE 4KK6C 4WJ5A 3U9PH 4X7SL 3F5WA 5F1OB 1VGEH 1JWMB 3V95A 3Q3GA 3RUGA 5GGQH 1QNZH 3IDXL 2HFTA 1DQJB 1BHGA 2HN7A 3EYSL 4I3GA 1TQCC 1Q8MA 3GO1L 1KENH 3W2DL 3WFCH 2C9AA 4QRQA 2OJEA 1BX2A 3B2UC 4YHIB 1X5KA 4F57H 1YDPB 5JXAL 2A9ML 2HRLA 2W9LA 3PGDB 2VISB 4DTGL 1D6EA 5CGYC 3B3IB 1IL1B 3LQAL 1PVHA 3EO0B 5E9DE 1G6RL 1ED3B 3ARYA 1EEQA 1HHJA 2YD8A 2XNAB 5IVXF 3ULVF 5CSZA 1KTDB 4LKXA 4N5ED 1RVFL 5T3XE 4NYLB 2CD0A 3U7YH 2FRGP 5DVLA 1KFAH 3WIFA 3HNVL 2EDTA 1ZHNA 3BD4A 1F13A 2QQKL 4M6ML 3HI6H 1MCOL 1BBDL 4HPYL 1NCCH 4PRHB 2LFGA 3V52L 4U05A 2EO1A 1Q0XL 3PIQA 5F3HA 1DUYA 4AEEA 4ODSH 4JM2A 5C0IB 3O3EB 1KELH 5MERA 3QDJB 1X5XA 3BQUC 1CFSA 4IMKA 5DC4B 2YD7A 4Y4KC 4P9HH 4P5TD 1EH9A 4XTRD 1B0GB 4C56E 4OGYL 2RR3A 3IETA 3K8MA 3WHE1 4NO0B 4YAQB 4LAJH 3VFRA 4M5YL 3QNYA 1IGJB 5EOCH 1LE5A 4M7ZB 5HYSB 4LIQH 3O41A 1IAOB 3HZKB 4L3EA 1KJMA 2N56A 5C0BD 1CU4L 4XVTH 3IAQA 1ZT4B 1U95B 3HFMH 3MA9L 3BP7A 3D39B 1LDPL 4LPUA 3EOAA 1IGFL 4YNYA 5M94B 1I7UB 3T0ED 5DEZA 3UO1H 1Q9KB 2DYPA 4OLVL 4NCC1 4M62L 4N0UA 5DJXB 1XF3B 3GMQA 3BP5A 1QD0A 1R3LA 3WLBB 2ZCKH 2R1XA 1GZPA 4X4MA 4QCIB 3MRPA 3O9WD 1MCSA 3BYYA 3AREA 3WNNA 1WSST 4P9ML 3VD9A 1NGYB 4CUCA 1WT5A 3EJYC 5E08L 1A3RH 1J8HA 3AY4C 2CLVA 1A7QL 1MVFA 4M1GL 1CXIA 1T89A 4GS7B 3BGAA 2WWMD 5DJ8A 4S1RL 3ARWA 4M6NH 1Q0YL 4PJBF 3OZ9L 1A9BB 2Y7QA 1A3QA 3AGVA 5D7IA 4AEHL 3WDHA 3EDKA 4UT9L 3ECBA 4KUZL 5EU7E 5T3XH 5E8PB 1D6VL 2PXYD 2G2RA 3BUYA 4B41A 3BRFA 5F9OL 4K3DH 3LV3A 5TE7L 1J11A 2DRUA 1AFVH 4RNRA 5D7LD 1GOHA 4PRBA 4GG6B 4IJ3C 5K9KB 3SDDA 1LP9A 4JN1L 3VXSB 5IW6B 5GRXG 3G6DL 4FXKA 1QSFB 1TTFA 5DJ2A 1JP5A 3BIKB 3MR9A 3ORJA 4RMUA 1S7QB 4WWKA 3QO1A 4P2OC 4OIBA 3BMWA 3CFJB 3V6BR 3H9SA 3KR3H 4YWGH 4NQVB 3VGAB 2AEWA 1K2DA 3HNSL 1RJYA 1YNTA 4AT6B 2PW1A 4A2LA 1CFQA 1ZSDB 3OKLB 1S5HA 4K8RC 4P2QB 1D5ZB 5F9JB 2DQUL 3FAXA 1UWEH 2XQBH 1YA5A 2YA0A 3GJFA 1WLHA 4NKOA 4MB5A 4NUGH 4Q74A 3T77A 1RZKL 1YMME 1M71A 4UOW0 2B5IC 3MOAH 3P77B 3SBWC 1UB5B 4TULH 1MWAA 4MCYA 4NNYB 4D3CL 1TFHA 2XYCA 5BW7C 5I76A 4KJYA 5INCA 2Y25A 3FQRA 4HUVA 1AR1D 1TVBB 3NIGF 4M61A 5CKGA 3PWNB 1UXWB 2B0SL 2E6PA 1AKJA 5EDXA 3RBSA 5GISH 2H41A 5GS3A 2BFVL 5KVFL 5CUSL 5D7IF 4LL9A 3CC5B 4ZFZA 4G43A 1DLFL 3ARBA 3PE9A 3A6CL 3O6MH 4FFZH 2GKIA 2JKXA 4Z0BL 3GSVB 1BBJB 4Z6AT 1NL0L 2FX9H 3MXVH 4P4KD 1O0VA 5DK0B 2EH8L 2WW8A 4Y5YC 4L4TA 5HSFA 4KZDH 4PJ7A 3LIZL 2WWKT 4JDTL 1SMAA 3QCVH 4OCXH 1N8ZB 3SJVD 1INEH 4W4OA 5DSCB 5TH2B 2UZIH 5JHDD 3EZ8A 3MREB 5KS9A 1RIHH 1CGWA 8FABA 4Y7MA 5BV7C 5FF6B 4RMVA 2FJFA 4LEXH 5CEZL 3GMRA 4CNIB 5IOPB 3X11B 2EXYD 5FFLA 5EBLB 4G9FB 2XN9B 4LLWB 2D3VA 1T1YA 3PQYE 3TT1L 4EI5B 3Q6FA 5LWYH 3BGFB 3U46A 3VH8A 4PJ9D 4FQIL 5C0DB 3LCYA 3H42L 2OTPA 5C08E 5I8EB 3SDAA 1XGTB 2ZP0T 5GSVB 5LCVL 3IDGB 4LBEA 1A1MA 3LKQA 5IB2B 3REWB 3BO8A 3HZMA 1MWAL 4WY7H 2ID5A 3GIZL 5D7LE 1JGEB 4OLWH 4O2FA 1NCWL 1ZLSH 2JJSC 3OKNA 2VLKD 3QAZC 3QISA 1AHWA 4MSWB 5GS1B 1YYML 2X4TB 3IF1A 3LH2L 2KDGA 1BQHB 1Y18A 3ZKNC 4F3FA 5ILTH 2DD8L 3TH4T 3TV3H 1Z5LA 2UWEB 3U83A 1BFVL 4X9FA 2IQAA 5IV2B 5C09B 1QSEB 3ZE1E 1DANU 2IH3A 1UA6H 2D7NA 1P6AB 2H32A 1EIBA 4FABL 4G6MH 3VGGA 4ZPVB 4XP1L 1JGUH 3QUZB 1X9QA 3ARGA 2YZ1A 5JLZA 3EYVA 1A6WH 4PJ7F 2YMXH 2BSSB 3L3KB 5DGRA 4FP8H 4ZYKA 1FIEA 3FO1B 1QBML 2R2EA 5KS9F 3F6IA 1FGVL 1OGAA 2IPUK 4KVNH 4NUJA 3PJSA 1LO3H 4FQ1H 5HYSG 4R8WL 2QHRH 5BRZB 1HEZB 2XWTB 2R2BB 4PP1D 5D6CA 5KVEL 4HXBH 1BIIA 3TWCL 3RZCD 4G8EA 4JPKH 2VTFA 3L5WB 4WHYG 3T1FB 1KEML 1MJUL 1OAQH 2BMKA 2JB5L 2M2DA 4X4XB 2YZ8A 4UV7L 4EIZC 1FLRH 1CXFA 3B4NA 2XZQH 1UKQA 3ULUE 3IU4L 1I9EA 2OL3A 3N85L 1F58H 1NC4A 2FZ3A 2GCYB 2KBGA 3QEHA 2UV3A 4P0DA 3QDMB 3RHWF 4M6AA 3MV8E 1DBKH 5JHDE 1JMZA 2PO6A 5IGXH 4ELKB 3PDDA 5FM4A 4Z7VE 1JPTH 1KN2L 3MGAA 1TVDA 5HGAA 4KKLC 3HUJF 3V6OE 5DUBA 3SKOB 1YEJL 1MOEA 3VGFA 3CFCH 1JZ2A 5FYJD 3K74B 4S0SD 3F7RA 3IKKA 4HLZH 5CHNB 2VABB 1U8NA 2YUZA 1U8QA 4XCYA 3JV5A 1DQQA 1FE8H 1MAML 1PJ9A 2DWDB 3K1KC 2R4RL 2FCBA 4IDJL 4IHOA 4HAFA 4OV5A 4YDJA 1BD2B 2VKWA 1XH3B 1ZHBA 2VDQH 1WEJL 1MFAH 4R26H 2OBGA 5F88B 5KN5B 1AI1L 3REVA 3FOMB 3O4LD 5JOFA 3C60C 4V2BA 3G5ZB 1E4WL 1P4LB 5HHNB 1GGCL 5JW5A 4BKLA 4U1IA 4QF1A 3CSPA 3OKDA 4RRPA 1S7XA 3W39A 3O81A 4U6VL 5ITFB 3IFLH 3MJ7A 5HDLA 2R56H 3DTXB 1NGPL 3DVIA 5BQ7B 1TQCB 3CSGA 2D0GA 1BJMA 3SCMB 4AQOA 4ETQB 4A6YH 2JIXD 4NWUL 4L8SC 4H0HB 2Y06H 1MREH 3D2UD 3S4SB 1JGVL 2OL3L 1VKXA 1P6FA 4IS6A 2YWYA 2HTLC 3LN4A 1AP2B 4WDIA 3X12B 1V8HA 2C3XA 2COQA 2H6PB 3BKYH 3IAGC 2VZVA 3TLRA 1MFDH 1LK3H 4PJEB 2YPLB 3I85A 1UVQB 1VA9A 2MKLC 1JHKH 2I07B 3MNZA 3CFKA 2BRRH 2AI0L 3QUMA 2R4SL 4UTBL 1A6VH 3MV01 5SX4I 5AYQA 2B1AL 3M1BB 3TBSA 3QNXA 4G5ZH 3KLAA 2BY0A 4RMTA 1AGDA 5FO7A 5H94B 1UKTA 4DQOL 3KJ4B 1FZOB 4FZEH 4CN4A 4PB0L 1OCWL 3MBXL 3NIDF 3ISWA 4B5EA 5DLML 3W9DB 1PSKL 3R0MA 4HHAB 3FL7A 4PD4K 5F8QC 1A14L 3BQUB 5I74C 5D2LF 3BD5A 4ZXBA 4G8GE 2VUOA 4Y4KB 2F54D 2VH5H 5D1QC 2KZWA 5EB9A 3QI9B 5J56B 3O6KL 4YH6A 2EIBA 4MB3A 5IJVA 3FQUB 2JCCE 5K59F 4PYHA 2M26A 4W6XB 1KPUA 3O2VL 1VFAB 4WIQA 4PRAB 2UUDH 1FVDB 4Y4HB 5JUEH 1C5DB 4XBPA 2AJUL 4NNXA 3RWGB 3TYGL 1QYGH 2AJZA 4JVUA 1I1AA 4WI3A 2E27L 2EZ0D 2JJTC 2HFFA 3M17B 4LPVA 3OG4B 4XNYH 4J8RB 1OP5K 2E8YA 2FBJL 1RUMH 3MLVH 2GK2A 4QHNA 4S2SB 1BZ9A 4XC1H 3QUML 3VFSB 5HI5D 4PJFB 1NFKA 1G9MH 3VCLA 5FGBA 4NDMA 2NY4B 3NMEA 1EFXA 1GH7A 1T04A 5KSAB 3BPOB 3LQAC 3Q6GL 3WLWC 3MOQA 3MNVA 1J7VR 1PG7H 4I5BA 1JMXA 4Y19E 5D1ZA 1U92B 4PY7A 2GUOA 4ONHB 2OX5A 3FT2A 3ULVC 4LCWB 4JZJA 3GSNB 3BE1H 1RZJC 3VFVB 5CZXC 3JTSA 2IG2H 4HJ0C 1LWRA 3D3VA 4B7IA 5LKNA 3L3JA 3ZE2E 1ZVSB 3MV7B 1RUKL 4YHOH 2X9YA 3DOSA 2ATPA 1I9RH 4N0YH 3KPMB 2PCPA 3X3GH 1NC2B 1WBYB 5JW4Q 3BZ4B 1ZLVK 4Z78A 4CADB 3VXUE 1A6AB 4E41E 3VRIB 1K3IA 2DM2A 1JPGB 3SDCD 3EFFB 5CWSB 4U1HA 1NAMH 4L4VE 4XHJD 4OBRA 3MLPA 4CVZB 4XP9H 5C9JB 1MHHB 3QFJD 5E70A 2CH8A 2CO7B 3U82B 3JWOH 5J0BA 1QFOA 2A73A 3RWJA 3DUUB 3DETC 1A7NH 3H0TB 1EUTA 2W0PA 1S9KC 3PXJA 4OUUB 4K2UH 1NJ9A 1YJDL 4OV6F 3L3HB 5FYJH 1KJVA 1NSNL 1XIWD 4WFGD 3GFUA 1ZA3A 3BWAB 3QA3B 5CD5C 4LPYA 2L4OA 3G08A 2GJ6D 2APXA 2YN3A 3K81A 5SWSB 2E6QA 4XPFH 3B83A 5MEOA 3T0BA 2Z31A 2DBLH 2VDOH 4DN3L 3FTGA 3S9DB 1ORSB 2WBJB 5TE4H 1WAAF 1FNEA 3P4NA 1IGTB 4BM7A 2X6MA 3D48R 3KPPA 2Z9TA 4HV8B 3U36A 1WBZB 3O6FD 3MJGX 1HILB 5I1EH 1UJ3A 3F7QA 1JNNH 4KJQD 4PJ5D 4OCSL 4Y16D 1CYGA 1BFOA 1O5DT 3UJTH 3WCYA 4YBLB 4FQPA 3HE6A 3L3DA 4BSWA 3A6BL 1E6OH 4Y1AE 4FQXB 2DQTH 1VEPA 5AAWA 1OOAA 1SY6H 4V2CB 3RL2B 5C6WH 2OP4L 5CD3A 4JM2C 3WD5H 1P2CA 2AJYL 5H37G 2F8OA 3VXPB 4DCQA 5L2KB 1G7IB 4BFGA 1IGYB 3VFUB 2AQ2A 4IMKC 3FRUA 3IVKA 2F53E 1SM3L 4GQ9H 4UUJB 4ONFL 4P59H 5CJOH 3IT8D 2BJML 2YRPA 3TJEL 4OLXH 3WJJA 1S7SA 3TBWB 2DKSA 2DKUA 5ID0A 5KSVB 3RIFF 2V2XB 3GSNL 4JCMA 3S4SG 5E2JA 3MBED 3PDOA 4H20L 4PRID 2EDYA 4XBEH 5ANMA 2ARJA 1JZ5A 1U42A 4ZO9A 5EFIB 4JO2L 2B39A 5HY9B 2HTKC 4AENB 3HG1E 1ETZB 4R4NC 1M7XA 2AEPH 2NY1C 3KPLA 3TT3L 1FAIH 3HNTL 3QAZB 2DS4A 4R7NB 4CDGC 1XEDA 5LGKA 2VSCA 4XPGH 4JKKA 4CMHC 2GTZB 1S3KH 1J86A 1KCVL 2R29L 3GSQA 4JN2A 5K9JL 2IANA 3ZE0F 1TZGL 5HXMA 1T66C 1LHZA 1AJ7H 1ZA6A 2YS4A 2K3TA 5EU3A 1WT5C 5DQDL 1MCCA 1X5YA 1MQKH 4U1GB 3OAUH 4LSUL 4OLYH 5E5RB 5IMKA 3C5JA 2YOCA 4DZBA 3IKCB 1DE4A 1KNOA 2A74B 4NT6A 1KJ2B 4M1CD 4FMKA 1WBXB 1OAZL 1L9MA 5KW9L 5EBGA 1A47A 2XIDA 3VWJD 4JDVA 3IDYC 4HZLA 4WFGE 3UTSB 4R90L 5C0AE 2AEQL 3K80A 3QIWD 5I73C 5SWZB 1KCSL 5FKAA 1EGJA 5ECJE 2DMKA 2ZUWA 4G6FD 3DX8A 4MS8D 4XNUH 2OJZL 1FV1A 2ZG2A 2Z91A 4WWKC 5GS0D 4J3VA 4MNGB 2WV3A 3TPUB 1ZKAA 4AEFA 5IESH 2YRLA 2Y4SA 1G1CA 1I1YB 1ZT1A 2AK4E 2XA8H 2G5BA 2Q76A 5DJDB 3O3BA 4M8QB 4RGMC 2VXSL 5FYKE 1YYLH 3PDGA 2YA2A 4Y88A 3GBMH 1FCGA 4HWEH 2A2QT 3HE7D 4RIRB 4TUOB 4MDJA 1T1WB 1N6QH 2X4QA 2GJZA 2QR0B 3W0WA 1H3PL 3NCBB 1NLDH 2R1WB 5ENWB 3D25A 1AGBA 1NCTA 4XNXL 1OY3B 3QWRD 4OZFH 2A0LD 2QQLH 4OD2A 2XZCL 2QJDA 1CGSL 4ZS6C 3MNWA 5L9DL 1QZ1A 4ACPA 3BP4B 4O5LL 5EUOB 2BHUA 3NCCB 3SDYH 2QV2A 2YBRB 1QHPA 4QOKB 2VXTL 3GK8L 4PRIE 2YPVH 5DD3L 4ZQKB 4GRLC 4WW2F 3ARBC 3TJHC 3JXAA 2HWZH 1PKOA 4K3EL 4HWBH 1P7QD 1FZMA 3D85B 4ZUWB 4M9OA 1XGUB 3O8XA 3C60B 2FIKB 2P7TA 2C1PB 1CLOL 4MJ5B 1UM5H 3C5ZB 1EGJL 5D4QA 4W4OC 3QB7C 3OKKB 5E8DL 4KDVA 3QSKB 4YGVB 5JO5A 3Q5OA 4ZODA 2IPKB 1PDKA 1NANH 3FO2B 1GGIL 1BEYH 3U2SB 1RU9H 3X14B 4I2XE 4X7CC 3B9VA 2HA1A 1YC7A 1EAPB 2FD6H 3MRGB 5DD6A 3GSWB 3BP6B 1LK2A 5ACZB 2B1HL 5C71A 1RHHA 3S34L 1BZ7B 2QADB 5JZ7D 4FTVE 3UYOD 5DA4A 1EUUA 1ORQA 3T2QA 3QEQB 3ZKQD 2OK0H 2X89A 1BOYA 1NEZB 2F8XC 3UZEA 2XT1B 3AAZB 2BNUA 3QIBA 3ZTJG 5DVKA 3DYOA 4JPVL 2IAMD 3X13A 2YN5A 1CE1H 1AHWC 5JNYA 1GGBL 4PJHF 2HJLA 2X05A 4XVJH 1F3DJ 1U3HD 2Z35A 1C12A 1F42A 3U48A 1T0MA 4HD9A 4HBCH 5LQBL 5I19L 2VQTA 3BKML 3CAFA 1MFCL 4HG4J 4TNWF 4XMPL 1J0YA 4IRSD 5I6XC 5I74B 4QXGH 2X1QA 2VC2L 4I0CC 3ARGC 4ELME 2IPTL 4OJFL 3T8XB 3ARDB 5H2BA 2R0WH 3JV6A 4GBXA 4XVSH 2HRPH 1INDL 2H9GA 4PGCB 1VPOL 4X6DF 5BZDA 2NW2B 3OKMA 1NCUA 4PJDE 4Z7WA 4YXLH 3LEYL 4CN6A 4X6CB 4I0PA 2OTWB 4OSUH 5DRZB 5TDPA 5IW1A 4HAGA 1Q1JH 1XF1A 4PUBL 2ZUVA 2K7QA 3B9KC 5CKAA 5DJ0A 4XC3L 1LILA 3UTTB 3EHBC 3LMJL 5DJAB 2HVKB 3MYJA 4QEGA 2BNRD 1HDMA 4WUUD 2BX5A 2Z8VC 5LGJB 1I8KA 1MIMH 5CEYB 4NO5B 2VDMH 3KWWB 3MLTA 5FM5O 4NKMA 3U0TA 1BP3B 5E9DA 1YC8A 4UDTA 4F7PB 2PO6C 5EZLB 3RDTB 2DLHA 3KVQA 3RFZC 4HGWB 4LKCA 3PGFL 3S37X 1HXMA 2ICWI 1Q9WB 2R0LL 3JTTB 2DI9A 3LEVL 3VWKA 5IVXB 1MHCB 3WNLA 4H1LH 1J1XH 1YQ2A 4OKVB 4PV8B 1AGEB 4DK3A 5F1NA 4LSTL 1XGYH 5HI3C 4YHLL 4MHHI 5GS0H 4KK8D 5IB3A 3WEXB 4NKQB 4OM0H 4AIOA 2BSRA 2Q3AA 3VI3F 5CBAA 1QFUH 5DFVD 5K33A 1J9CT 2VL5A 5FV1L 3UEZA 3CXDL 2V9QA 1T7WA 1CCZA 2XRAH 1TITA 2DDQL 2J8OA 4DGVL 2P44B 3GSXB 3DI2B 5A2FA 1CICA 3G9VA 3HZYA 2MCPL 4ZAKD 2HT3C 1BGXH 1XF2A 1A4KA 3MLZH 3P30L 5TJWK 4D9LH 1WITA 1OL0A 1S7WB 3MRNA 4P49A 1HHKA 1RK0A 4L9DA 3OBAA 5ADOH 1FG2A 4MJID 4JGJA 3Q3GB 2DQIL 2BCKA 5E8EA 5TE6H 3Q1SL 2JK5A 2Y6SC 4GW1B 2O5ZH 2VZ3A 4WO4A 3TO4C 4KWUA 2WLZA 2WQ8A 4HC1L 5F1IB 2OJEB 3MRIA 4ONGH 1BX2B 3JWNC 3IDIB 1CZ8H 3HAEB 3C8KB 4RX4A 1KB5L 1S5IH 2ITDB 1P84K 4JB9H 4BZ1L 4XPHL 4PGJA 4XCEA 3UDWA 2YWZA 3MLWH 5DVMA 1X3DA 5JIKA 1PG7X 2BDNH 1YPZF 3FONB 4MXWH 4N9OB 3B2UD 2EDEA 2DOCA 5EU5B 3BKJL 1IEAA 1ZANH 3NGBC 2ZKHL 3RWHA 3G5VB 1NGZA 3LKNA 4JREC 5JA9A 2J1KA 4OD1L 3M45A 3O11A 2PKDA 5I1IH 2A6IA 4WTXA 4PJBB 4K3GA 4MYWB 4ERSL 5GRJL 3BSZL 4K94H 1N26A 3DX6B 3X3FH 5A3IC 3BWUC 4YXHH 4G7YL 5GRUH 4MA3B 5DC9B 1ZLWK 3PL6A 2C4XA 4ZXBC 3IDUA 4WU5A 1IAMA 3SKMA 3TVMD 3FMGH 3PWPE 1WCBB 5GQBA 2CRIA 5I1JH 1YN6A 3N1PC 5A2LH 5SV3A 4DKFH 1OM3L 1Z9OA 1LE9B 1JPSL 4PJGB 3PV6A 2M1KA 2H1PH 3T0AA 1A4JA 2VWEC 3FB8A 3S88H 2DJ4A 2KZ1B 3FN3A 4PR5A 1MJ7H 2MJWA 4YJZL 2VL4A 2VLMD 5DGQA 2BNQB 3N1MC 1RUAH 3BP7B 4BH8A 1I1AC 1F6AB 2NY2C 1NEZG 4HWUA 3O3AB 5FYKU 5F3BA 2VUYA 1WFUA 1YMMA 1GC1C 5JOPD 3BP5B 2RHEA 3KYNA 1EXUB 3MGOB 4CMHB 4MAYD 4XCNA 2NY5C 4R2GC 1HNFA 3V4PH 1N5AA 4NZUH 1S7RB 1UACL 3MRPB 1RJLB 1OAXL 3C6LD 4YQXL 5AUMB 3OJDA 3GHEL 5J06A 3VXRD 4LVOC 3O6ML 1MI5E 2FWOB 5JDSB 4JKWA 2LAAA 4HIXL 1KEGH 1UT9A 4M48H 5DJ8B 2FEEI 2ESVB 2R69L 5C0BA 4LVHC 5D1ZC 2Y7QB 4UIMA 1MCPH 3MRLA 3V5KA 2FL5A 2HJFA 3ECBB 1VFBA 1F4XH 1QLRB 3KNBA 1FYTD 4JZJC 5C8JB 4ZFFB 1Y6NR 4NZTH 2Z0BA 5C0ND 4TVPD 3BT2L 3MRMA 3LV3B 3K4ZA 4FHBD 4RNRB 4PRBB 3RY5A 1A0QH 4NJAL 3PHOA 1IEBB 4OM1L 4HJJH 1A6ZA 3O9WA 1WICA 4ZNEE 4Q2ZA 2JELH 3V8OA 4QHMA 4UB0L 2QSTA 4KJPC 4JZNA 4WTZA 4PLJC 4JR9H 4XAWL 5MP6H 4NRZB 1ZS8A 1GGTA 3AU1B 3PQYA 1U8PA 4YFLI 1JJUA 1S5HB 4XP5H 1OAYL 3CSYA 4NQCD 4RQQB 4OLZH 5C08A 1S9WA 2H8PA 4QTHB 2PXYA 2EICA 5GGRB 4X80H 3BEVB 1CL7H 4C83A 2Y1VA 3DGCR 4YXKL 3HB3C 4HUWB 3BZFA 5GSRB 4R6UA 5D7LA 2J8UB 2YD4A 5DDHA 1S78C 4MCYB 1ULVA 4LPXA 43C9A 4YHNB 4KJYB 4J3TA 2ERJB 3FQRB 4CN1A 3VXME 4HUVB 4G6ML 5E6ID 3MJ8B 5ISZD 4I0KA 3KLHD 2JE8A 2Z31C 4JQVA 2Q8AH 3U7WL 5ACLA 2L7UA 4F58H 1WF5A 3FB6A 5IHZB 3HPJB 3P40A 3WHXA 4ZTPH 1ND0B 4ODXB 4YPGB 1RIUH 1UJ3C 5CSGA 4X4YA 4DKEL 4X7TA 5DJCA 4GRLB 3KLSA 2QTEA 1JGDA 5E00A 3QXAA 3HE6C 2C3VA 3STZB 5TDNB 5D8JL 4ZFOA 1DTUA 1EA9C 3IFOB 4OB5H 1CFTA 4I3RL 2BSED 4KKBD 5IFHL 1S8DA 3ARFD 5KS9B 4QRPE 3PABA 4K23H 4G6JL 2DL9A 1Z0MA 4P2RB 1B0RA 1VESA 3OXRA 2VLJB 5DMGC 3UTQA 3CLFL 3NFNB 4JQIH 2IADB 1D5XB 1JGLL 1MHPH 4F9LA 4MA7H 3WJJC 2GJJA 4LCUA 4I48A 2NXYC 4NQSB 2NY6C 2NTFB 1HZHL 3VH8B 3HAEG 4HMCA 4NKDB 1FIGL 3T0DA 4ORGB 1RV6X 4JFQA 4Z76B 4P4KA 4ZUTA 3P4MB 4QRUB 4MGXA 3D0VB 1D9KC 3IXAB 4JO3L 3MV8A 5JHDA 5IBLC 4MXVE 4KKNA 1PY9A 4Z7VA 3SQOH 1N59B 1JRHH 1FZJA 1LO4H 3RPIA 2DJUA 1FBIL 1AXTL 4IM8A 1JNJA 3DVFA 4XXCC 5FECB 3OAYK 1Y18B 4K7PX 4F3FB 1PEZA 3V6OA 2NY3B 1FFPB 4L3CA 2YD2A 1WZLA 1EMTL 3D9AH 3HUJB 3L3OB 1MNUH 3RNKB 5GGUA 4P23C 4R0LA 4UTAL 2P5WD 3HC4L 5DEGB 3ZKND 3TNNA 4PJ9A 2DQEH 3E6FA 2CDEA 5GJTL 4KGJA 5T33L 5J3HC 2FR4A 1D7FA 4ZFOL 1FP5A 3F12B 3KPOA 3U30C 4I1NB 3UJIL 3JWDC 3IFLL 3GSOB 3I3DA 4WW2C 4XPAH 5GXBB 4NP4L 1T4KA 1U6AL 3IJSA 1QVOB 1QG3A 4D0BB 3MACH 3UJJL 3KPNB 4PGDB 1RZGA 4XMKH 4JFZL 4LAQL 4LQFH 5ISZE 1KBGL 5JMOC 3B9KB 2NYYD 1FJ1B 1KPVB 3E8UL 5DVOA 2DLFH 3ULUL 5L7XH 1LO0H 4GW4B 5EU6D 2ZOLB 4XCCL 1VFUA 2P24B 1D3CA 3K7UA 1JBJA 2VSDA 3QBTB 4KKCC 1A6VL 3FFCD 5I9QB 3SHSA 1OP5H 1NDMB 4OLUL 4Y4FD 1HH9B 2VERN 1OSPH 4CVWA 1F3JA 2EYRA 2XKUA 1CLYH 5J89A 3LZFH 3QDGE 3TCXA 2SEBB 4KK5C 2VLRD 2PO6B 5HDBE 5ID1B 4IOSD 4R96A 4TVPH 1UWXK 3LDBC 4LSPL 3NZHL 4Z7NF 2X70B 4XMLH 5D70L 2EDDA 2AABH 1DBAL 4AG4H 5C0EB 3L6FA 4RMWA 2EDNA 1BQUA 2YUWA 3DMMB 5EO0A 4LDEB 4XCYB 5ERWA 5IWLA 5KSUA 2DTMH 3SEPA 1CFVL 3MGTB 2YKLL 5KVDL 4PJIF 4IHOB 3U0WL 4P2YA 4YDJB 3BESR 2Y5TA 4G8GA 1ZLVH 4N9GB 4DGYH 3ILPB 4NFDA 1NAMA 4F7CA 3GIVB 5KSBF 5D2LB 5HVGB 2PYEE 3O8XC 3WFZA 1E4JA 3BPCA 4HF5L 1ZGLB 2E7LC 5T1DH 1R5WB 2C3GA 1R5VA 3VFWB 3V9FA 5JW4M 1LEGB 2JCCA 1TZHA 4U1IB 2PYFB 1T20B 1SBBA 1DFBL 3W39B 1E27B 4QXWA 1FGNH 2OM5A 3C6SA 3P0VL 1HH6A 1NFDF 5IROC 3TO4B 1EDQA 5DRXB 3VGEA 2YSSA 3L5XH 4NM8H 4PTTA 4PTUA 3FQTB 3MO1B 3QUYD 3HMXA 5B38A 4H5SA 3DSFH 5DXWA 2D9QB 1U2CA 3LN4B 2QSVA 1X7QA 4X7DC 1QPXA 1E0OB 2EXWC 4KAQL 1EO7A 4JKMA 3MNZB 4WFHE 5IW3A 3RVXD 1E6JH 5GRYA 3JZ7A 5GZOD 5JW3L 3NGBB 3VU2A 2GFBA 3CLEL 3QIBC 1J05A 5CINH 4NSKA 1YY9D 3ZTNH 3CH8A 2APTA 3DVNA 4P4RB 3VDCA 1J87A 1DVFA 2FB4H 4Y19A 1E28B 3MODL 5F7FA 1RZFH 3NPSB 1SY6A 2JIXA 1QRND 1RHFA 3S36X 1KCUH 4Y2DB 4ORZC 1N7ML 1KG0B 2AAVA 2XV6B 3FFCE 5KTEH 5BV7H 5DURD 4PJAF 3WMSA 5L2JA 4ZXBB 4NZJA 1DBJL 3QPQC 3RWFA 4EKXA 5BS0D 5DHVA 1AE6L 2CLRA 3VXUA 2P8PB 4E41A 4I3SH 3T4YB 4GBXC 1FCCA 4F7MA 1MJ8H 1DBBH 1INQA 5IJVB 4U1LA 1XGQA 5IMMB 5D1QD 1MFEL 1JF1A 3FFDB 1PKQB 4PJCE 3VH8G 4I0PC 3ARQA 4RGNB 4U0RC 3MLYH 4N1HB 3DV6A 3DRTA 1LQSR 3OKYA 5FV2A 5TQ0L 1FPTH 3GHBH 4G80B 5E8NB 3CVIH 4OUOA 2KPNA 4PIRF 5I17B 3HMXL 1I1AB 2C1OB 3THML 4XP4L 1OTTC 1IGIL 3KPSB 1I7RB 5EORL 3VD7A 1VACA 5IMOB 2VDOL 4HKXA 5JR1L 1RURH 4KC3B 4KJWD 1T1ZA 2ZCLH 3ZKMD 5ESAA 4PRDA 4U2YA 3WFHB 4U1MB 3DURA 4M1DH 5B39B 4YO0A 5E99L 1X4XA 1YECH 3BDYL 4BK5A 1RJCA 4HDIB 1HNGA 3MCKA 5E2UH 1IGML 3PG2A 5I16A 2GW5A 5JXEA 1D5MA 4LVOB 2CO6B 1MJJB 1D5IH 1KCRH 3G5XA 1QTYT 4JRXD 4MD0A 3U4BH 1BAFL 4AIZA 4YR6A 4ZTOL 4ODTH 3FKUS 3MNVB 5IMLB 3QJFA 4V1DE 4GRMA 4LVHB 1ZEAL 2GUOB 2ICWA 1FNAA 1SY6L 4PLNC 2HLFC 4LU5L 2ADJB 3VWKC 2NZ9C 1RZIA 1A64A 2G60L 1XCQB 3WLWD 3OJVC 2APVA 1H8NA 1HINL 2HFEB 4J1UA 1NBZB 4X8JA 2WANA 3JTSB 4WCYH 15C8L 4Y1AA 4PRNB 5GGSB 2DQGH 3LHPL 1TNNA 1ITCA 4NOFA 3ZZ1A 4EN3D 4XI5D 4GW5A 3BH9B 2WUBL 5CZXD 5C6TH 5E4EB 5D2NE 1MEXL 4LOUD 2VAJA 1W0YT 2FJHB 3ES6A 3QG6A 5KVGL 5TFSH 4J6RH 4QRRD 2F53A 2FGWH 4H0IA 1II4E 4MXQD 3GI8L 1MRFL 4Q9RL 1HHGA 4GAYB 4KQ4H 1KXQE 1CICC 3G9AB 3QYCA 4POUB 5J6HB 5C0JB 2NX5D 3TBYB 3OB0K 3GB7A 1GIGH 4UU9A 1ZHKA 5I1KL 3GZKA 3OGOE 4PRPE 4FQ2L 5C07B 1UYWH 3UMTA 2ARWA 1AIFA 4O9HH 3SGEH 4JLRA 4WVRA 3BDBA 1HKLH 4WO4C 1TXKA 1JE6A 3P9WB 5JIPA 3KDMB 2RIKA 3HG1A 1O7VA 3DETD 5EOTA 2HAZA 1YEIL 3G08B 4Q0XH 4NQED 1JVKA 2IBBA 4LCYB 4QTIH 3UDWC 3VXTA 3ZL4L 2IALA 5MEOB 2P5ED 3NCJH 3HR5B 4K9EH 2ZG1A 1MAJA 5CD5D 1JCKA 3O3DB 4OCYH 4CMMB 5IJKC 1P4IL 1F4WL 1JUFA 3CK0L 2A1WH 1QBLH 1QLEH 4YHYB 4RMQA 4I8DA 4NN7C 4JFPB 4O2CB 3TA3A 2CUMA 4X5XB 5FO8B 1OARL 3KPRB 3MV9B 5GGVH 3MMEB 2PNDA 1JN6A 2AK4B 3HE6B 4MAUH 1C5BL 4LLQB 4P3CL 3IFPA 3MFFA 4BSWB 1ZV5A 5SWQA 1E4KA 4APQA 3LKRA 2CKNA 1S7TB 3RL1B 1K4CB 2Q86B 5HHOB 2FSEA 1XIWA 4BQ6A 3SDXE 1I8LA 4OCWL 3UBXA 4HMEA 3PP4H 1H8OA 1YEKH 1KLGB 5DO2D 1QO3B 1AGFB 1KF9B 4RRPG 5JMRA 1U8JA 3FRPA 2D7TL 3WO3B 1QLFA 1BVKB 4JFXB 4HJGA 2WINB 4UAOC 2IC2A 3QQ3B 4KQ3L 2VAAA 4JM2D 4R7DA 5CCKL 3RI5K 1DQDL 3RKDC 5HHMB 4D0CA 1J1PL 2WBKA 5HHVH 3O6FA 4HIIA 4HUXA 1K6QH 1I7ZB 3B5GA 1FFQA 4Y16A 3WFBH 4N5EC 3T3PF 4GAJH 5ITBL 4KK9D 4MA8L 2YHGA 3QO0B 1W2KT 2J4WH 3GNML 2ARJB 2NNAB 1CS6A 1E4XI 1H3XA 1D9KB 4JFOA 1XR9B 4NQDB 2VDLH 5I1GH 4UNUA 1OAUL 2CIIA 1EJ6A 4WI8A 3HI5L 4PRHD 3W82A 1TETH 3QDAA 1JTOA 3GM0A 5MENB 3D18A 4UT6H 1TJIL 3L7FA 2GSGB 1EHNA 2NY1D 2HKHL 5F93C 2DYPD 4XTRC 2XZZA 3QDJD 1AO7B 1CT8B 1NAKL 3H9ZA 3VA6A 2NX5E 5DYOB 4E42A 1R5IA 3V5DB 4P23B 4UQ3B 4OF5A 1AXSB 1VGKA 3ARED 3KXFB 4NO3A 2W0LA 2WIIA 4JPWH 1RZ7L 3QQ4B 4PRIA 4RISH 1F90H 2FGZA 3MV11 4M00A 3ALWA 4NT6B 4F2MA 1HK6A 2DICA 43CAA 2NY7H 4DAGL 1DQMH 1FO0H 2F58L 5IUSA 4WW2B 4GMTH 3GSUB 3T0EC 3DWTA 1TJHH 4G6KH 4M43H 4XGZA 1BLNA 2BVUA 5I0ZA 3RWCA 5C0FB 4NQEE 2VDNH 5IB4A 2XTJB 3WE6A 5A16A 1P1ZA 5HPMB 4X7SH 3NOIA 1BM3L 3O9WC 3V6FA 2Q6WB 1UWGL 3S35X 2J5LC 4M93C 4M4RA 3IDXH 3SDDD 4AH2A 3EYSH 4LLVB 5CMAA 3MUY1 1KIPB 3RY6A 1G9NL 3GO1H 4I2XA 4EUPH 3ARXA 1JPFA 3W2DH 2WWMC 5FYKL 3TF7C 4WWKD 5JW4R 3EOBB 2W07A 2CDGA 4KI5F 1F11B 5B39G 5JXAH 2A9MH 2OTUA 5CEZD 2DQFA 1FRGL 1OQOA 3H9SD 5ICXA 4MNQB 4U3XA 4DTGH 4XB7A 5AYUL 5EC2A 2PXYC 4FTVA 1JV5B 3VWJA 3LQAH 1DQLH 1G6RH 2R2HB 2QSCL 4FQHA 3QIWA 1TCRB 2OSLA 4H1LA 2E9BA 4Z7QF 2RQ8A 3VE0A 1Q94A 1MHEA 1RVFH 1AGBB 5EBMA 3HNVH 3LEXA 5E1HB 2Q7YA 3DXAB 3T04D 2QQKH 4M6MH 5I1LA 2X9XA 4PJHB 1YNKL 4WI4A 1MCOH 1BBDH 4HPYH 5I8KL 5SX5K 1U93B 3V52H 4Z7OF 3VG9C 3QUKB 4XRCA 1Q0XH 3QRFM 1IT9L 1KCKA 3H9HB 5DQ9A 1OP9A 1AKJD 4ELMA 2EC9T 3ZDXF 4JFFB 3DYMA 5LAXA 1JNLL 2VN4A 4GAGL 2P7TB 2R23A 4OZ4A 4P2QD 1KC5L 3STLB 2OMNA 5LGHL 2FEDD 4OGYH 2MOVA 3F7VB 4WW1A 1XCTA 3ARBD 4PRHE 4ISVB 4M5YH 4L5FL 5HYJB 4KDWA 4PJDA 2V7NA 1M6OA 1T3FA 1XZ0B 4L4TD 3WIHL 4P2CG 5AD0A 2FYYA 3QDJE 4X6DB 3VXOA 4NHUA 2ITCB 1AR1C 2KUTA 2WUCL 1CU4H 1QEWA 3VFGL 3T65B 1RJZB 3R1GL 4S10A 4FNLL 4F9LC 3L3IA 3MA9H 5DMJB 1S9YA 1LDPH 5FGSA 1DANT 1IGFH 5EZOL 3N50A 3V4VL 3BPLB 4GXVL 4M62H 4G9DA 1QUNA 3QJHA 4JRYB 2ATKA 3ULUC 2XFXA 4GT7A 1P7QA 4HIHA 1QR1B 4DVBA 3EFDL 4OZGB 2V5TA 4Z77A 4P4KC 3UYPA 2QLVB 5D9SA 4G8FB 1A5FL 5KG9B 4P9MH 1I9IL 1AGCA 3V6ZA 2AJXL 5E08H 3D39E 3LB6D 3QIBB 3SDAD 1A7QH 1PY4A 4M1GH 3PNWA 3RAJL 1CDJA 5EN2B 5FKPB 1G7HA 4S1RH 4GG8A 1HIML 3C2AL 4D9QD 1Q0YH 3OZ9H 4WNQB 2IH1B 1QA9A 4TUJB 1T0MB 3SOBL 3I02B 4AEHH 3ROOA 4UT9H 3TBTA 4KUZH 3WXWL 2EXYC 1ZGLP 1NGXA 2I9TA 1D6VH 2Z92A 2HJKA 5DTFA 4UBDD 4BZYA 3TIDA 4R0LC 1CDGA 5F9OH 4ELMF 4WFFD 5TE7H 3KG5A 2G75A 4PJ9C 3MLXL 4G9FD 4ZUVA 3DRQA 3N1GC 1T22B 3QUXB 3QHFL 1ZLWH 2A6KA 4EI5D 1ACYL 4JN1H 3VD5A 5EOCJ 3G6DH 2N1KA 4DKAA 2LVEA 1CFNB 3UPAA 4KROB 4I18C 1GGYA 4FXGA 4LF3A 3DPBA 2IAMA 3UPRA 3WS6A 2BVOA 3HNSH 3HLAA 1KSRA 1UJTA 1X5IA 3PWUA 4GG6E 4Y5VB 1U3HA 1OGAD 1H9VA 3O45B 5TDOB 2PF6A 4K55A 5D1XB 3VXSE 3MRFB 2AP2A 2DQUH 3NH7L 5J6GA 1QSFE 3QIUA 4HS6A 3RX8A 3TYFB 1RZKH 3MRHA 1FL6B 1QSED 2WM0A 4MD4B 2OCFD 1HDMB 4GUPB 1CVRA 2Q87A 1G9MC 3I6GB 4D3CH 4X4ZA 2VDKL 3QUZD 4L9LC 3MLTB 1YPZB 4X9IA 2B0SH 3NABL 1ZWIA 1NC4D 2BFVH 5KVFH 5CUSH 3ZKXB 2HT2D 4LVNC 2F74B 4RCAA 3VWKB 1DLFH 1R3HB 3CDGB 5EC1A 3A6CH 5CGMA 1CDCA 1JPST 4Z0BH 4YHPA 4RGOL 2WNGA 1NL0H 3ARZA 2MMXA 2EH8H 3LIZH 1OWWA 4JDTH 1RAMA 5IB3B 3QWOB 5IWLC 2BOCA 4GKSA 1AQDB 1EJOL 3MRQA 3QCTH 4WUUA 2DB8A 2BSRB 3RWIB 4P57A 3MLRL 2JTDA 4R97B 2VL5B 1JNHA 2IFGA 3RY4A 4NZRL 3PWPA 3WSQL 2OXGA 5CEZH 5IHUL 4O2EB 1SYVA 1AXIB 1EBPA 4OI9A 3ZYZA 5JQHC 5E56A 1IARB 3WS3A 2J7LA 3TT1H 3NBNA 3JWOC 3QDMD 4OCRL 1RK0B 3FO9A 3EYQC 4FQIH 1X5FA 3OR7A 3R06A 5JTWA 3H42H 3MUZ1 4U6HA 2V2TB 4TRPL 5GGVY 3EO9L 5LCVH 3VXNA 3RNQA 3DVGB 5FA4A 4D0DA 1TQBC 4WFFE 3GIZH 4G9FE 5E2WL 4X98B 2XN9E 1NCWH 3D6GA 2Y6SD 3QH3A 3ZSSA 3CH1A 3LH2H 4PGEB 4QYOB 3BH8B 3QEUA 5E6ZA 5JIIA 3CX5J 4U1JB 2DD8H 1CDYA 3TO2A 3OL2A 1BFVH 5EIIB 1IEAB 4FMFA 3OSKA 4LRIA 1MI5A 1BVLB 1CE6A 2ENSA 1G7MA 3RWHB 5DZOA 4G8IA 4FABH 4JFDD 3AMLA 3DGGB 4XP1H 1DVFC 4ZDHB 1C16B 4L4JA 1U8LB 4CW1A 1HYRC 3Q0HA 1QBMH 2UWEE 1G7LB 3TBVA 5C09E 1QSEE 1FGVH 3E6HA 2O5XL 4XXDB 3NCEB 3SE4A 2X4PB 3GMLA 3MOBL 4NN5B 3TFKD 2CDFA 4R8WH 4GKZB 4QHLB 2WP3O 4ZNEA 5KVEH 4U6TA 3TWCH 1U91A 1Q72L 1YN6B 3RZWA 4WEUD 1KEMH 1MJUH 3FQXA 2FBOJ 2JB5H 2AXGA 5DR5L 3OKOB 4DW2L 1A4JB 3UCRA 5I18L 3I9GL 4UV7H 3PWVA 4N0RA 3RGVA 4HWZB 3IU4H 2ZZUT 4LHUA 5ETUB 1MY7A 4KFZC 1AD9A 4Q6IA 3SE8H 5BRZE 1I8IB 1K3ZA 3N85H 4HXAL 2CLZB 1XMWA 1Q9OA 2IBZX 1C08A 5L88L 1SEQL 4IRJB 1GYAA 5B3JF 3F62A 1T21A 1KN2H 2NY2D 3TVMA 5F7DA 2R39A 4YDIH 1N5AB 5BVJA 2E7MA 3EZJB 4P5TB 5FK9B 3VXMA 3OAYH 4ZMAT 1YEJH 2P49B 4MJ6A 5JXEC 3OMZA 5DK2A 3W81A 2V5MA 2ZPKL 4R2GD 4YFDB 1FZKA 4P3DB 2V7HA 1HHHA 3QDME 5BZWA 2N4IA 3L3GA 3S96A 1MAMH 5F96L 4U1SB 5C0BB 3FT3B 5IEKB 4P5KA 4XNZC 5HTSA 1EFXD 2ICCA 2R4RH 4IDJH 3MRLB 4U6YB 5FDWB 1MCQA 3KLDA 3IDNB 2DI7A 1WEJH 3KNBB 3DSNA 5I1AB 1AI1H 4BSJA 4Y4HD 1EX0A 3T0EB 5D1ZD 1E4WH 1BZQK 1B9ZA 2NLJA 5ADPL 3T0XA 1IM3B 3OTTA 3EDDA 1KIRB 4MAYA 1MLCB 1GGCH 3D3VD 2DQJL 1CGVA 4DFHA 4U6VH 4M93B 1OF2A 1BD2E 1OSZB 3VXRA 5I2IA 1NGPH 5DVNA 4MNHB 2C3HA 4JY4A 1NBYB 2J88L 3BPNC 4NWUH 1JK8B 1MY5A 3GMPB 4HSQA 4KJPD 3G04A 1JGVH 4QXTA 2OL3H 4XH2B 2MQCA 4B7LA 1HI6A 2BOBA 4JJHA 4Y5XB 1CG9B 2P8LB 3TP4A 4XCFL 1NFIA 3CSYB 1U9KA 4PG9A 5DQJB 3VGDA 4OCNC 2PXYB 1KIUA 5FB8B 4EI6B 5SV4A 2VDRL 4LCWD 5J9PA 3TZVA 5ESQB 4ZUUB 3QQ9D 2AI0H 1ZGLM 2R4SH 4UTBH 4U3CA 3V7MA 3M8OL 2B1AH 1RUQL 2VITA 2YEZB 1EEYA 1UWXH 1UB6A 4ALAH 1ES0A 2IWGA 3HB3D 3UP1A 4DQOH 5T5FL 2R1YB 1FNSL 3ESUF 4FS0A 1S78D 3SDCC 4PJEE 4PB0H 2YPLE 5MI0B 1IM9B 1DLHA 1OCWH 5F7MC 1CD0A 4DUVA 1J5OL 2LTQB 3I50L 5DLMH 4N8VA 2Z31D 1PSKH 4KTDL 3TA3C 1BREA 3CPLB 1JWSB 4GSDL 5FOBA 1A14H 3FB5B 1QSVA 2C3VB 4JDZA 1N0XL 3B9EA 3BFOA 4APQC 1E4KC 1L9NA 2O5YL 3BGMB 3BW9B 3CUPA 3O6KH 5J13C 1XIWC 4HFWB 3MXWL 2C4FU 1I8LC 3P73A 5JORA 1X44A 1S7UA 1PX4A 1U41A 1YN7B 1MCEA 5ISZA 4X5WB 3OR6B 4TQEL 5MEQA 4A6YB 1JZ8A 3BYTA 2Z93B 4HX1B 2AJUH 5BJTA 3TYGH 5I8CB 5DT1L 5DUPL 4LLYA 4LCUB 5EULV 2E27H 3O6FC 2WBJD 1QHOA 1DQTA 4KJQC 2EEDA 3OKEA 1H3TA 2Q20A 4Y16C 4CVXA 2J8HA 3RTQD 1I3RB 4H8WL 1G9NC 3WNPA 4MVBD 1H15A 2FBJH 4U6XA 3KYOA 4JFQB 2NY6D 4ZUTB 2QQNL 3C9NB 1RPQA 3KYKL 4P46A 5IK3A 4QKXB 3SJVB 5J11C 3S5LB 3VFOB 2X7LB 3ARFA 3BRDA 2W0KA 3L9RB 1PYWB 3HKFA 4DK6A 3Q6GH 1FZJB 4WEMB 1CGUA 3EYFB 1IAKB 4DGIL 2J2ZA 2XQYG 3IGAB 2BZDA 3VI4F 3QR2A 2VNCA 4PJFE 2GY7B 4NRYB 4EOWL 4YC2B 4R0LB 4X7EC 1RIVL 1U8KA 4HBQA 2DM7A 3LKSA 2BERA 1RUKH 3MJ6A 4Y8AA 5C6PB 4G42B 5C3TA 3T0WA 4M6OL 4KMLB 1I7TB 3ZSTA 5IVZA 5GIRB 4WHTB 1XT5A 4LCWE 4PJIB 1ZT7B 2PYEA 4PB9L 4N5UA 4I18B 1WIOA 3MSPA 3T4AA 1YNLL 4TN9A 5J1AA 2VLKB 4F7EA 5KSBB 3MV7E 3LY6A 3KYMB 2V2WA 3CZFB 4PJ8D 4Z5RB 2HT4D 2ZUYA 4AL8L 1UH2A 4LGRB 1M7IA 2QL1A 1C1EL 4X9BA 2HH0L 3P9MB 3RY6C 1YJDH 4F9PA 4NN6B 3CFDB 1NFDB 1NSNH 3IXTA 5CP7A 4R3SB 1NGWA 4CGTA 4HK0A 4JFED 2DTSA 4X6EB 4M1CC 2AW2A 1E4XL 3JUZA 3LRSA 4JFYA 2VYRE 3BDXA 4L9LB 1K8IA 3MRRB 2DJSA 3NFPB 4DN3H 4LNRA 5C70A 1B88A 3VWJC 1R0AL 4C59B 3MRKA 3C09C 4X8XA 1EZVY 3QIWC 3EO1A 1L6ZA 1YMHB 2FX7L 5IVNA 4LVNB 5I30L 1M05A 4KK5D 4OCSH 3WIIL 3RZCB 1X5JA 3IYLW 4K07A 1NCNA 2KQMA 4PYGA 4RBPK 4MS8C 5SWSE 3W0WD 1MLBA 5IM7A 5GS0C 3L6FB 4ODBD 1RI8A 3A6BH 2HMID 1T2XA 2XACC 5CLTA 5TGBB 3W9EA 4I3SL 3ZDZF 2EKSA 3L5HA 2VJXA 5KSUB 2RFXA 3FFCA 2OP4H 4Y4FA 1U0QA 2AJYH 3NFSL 2Y5TB 5KOMC 3WO4C 2VXQL 3WFDL 1FVCA 1SM3H 3HC3L 1ADQL 4PJAB 4ONFH 5FYLE 3EW3B 4PS4L 4BSVA 2APWA 1F6LL 4Z18A 3TN0A 2BJMH 2K7PA 3TJEH 3FZUD 3OB0H 3S37L 4QHUB 4KXZI 3GSNH 1U8MA 4OKDA 5DMKA 1AD0A 4PJCA 4XWGL 5L2KE 1BIHA 3NAAL 4H20H 2A0LC 3H8NA 2EH7L 3EDEA 3VFTB 1LEKB 3FN0L 5CAYB 5FO9B 3QXUA 1T0NA 4JZOA 1GAFL 4JO2H 4WENB 2BVTA 5EUKB 2W65B 3RU8L 4D8PB 2I24N 3TT3H 3MLSL 3HNTH 1TDQA 3BHBA 1X7QB 4AM0A 3INUL 4BUGA 4R9HA 4QOKD 3O4LB 1KCVH 2R29H 4HLZG 5K9JH 4KPHL 1XR8A 1SEBA 3AXLA 1TZGH 5DF0A 1MUJB 2FO4B 2LE9A 5DQDH 2P43B 1UADC 3WV0A 1PGRB 1NDGA 4LSUH 4Y0GA 2X89D 2Z8WC 3DROA 3OX8A 3SO3C 3C5ZD 4OAWA 2FH6A 3IU3B 4V1DA 4DEPC 3CFIC 3SKNB 2OXHA 4K94C 3DIFB 2UYLA 2X4UA 1OAZH 1CWVA 4MZ2A 5KW9H 2H3NA 1MFBL 1DN0A 3T2NL 4DVRH 3D2UB 3ROLB 1VB9A 1OD9A 4R90H 5DRNA 2AEQH 1N3NB 3MRBB 1KCSH 1J0HA 2X4SB 4J3UA 5D2NA 2GT9B 4NBXB 5ICZB 3O2DH 4J2XA 4CU8A 4L1HA 2OJZH 1S9VA 3KPQB 2QADD 1QFWI 3QWQB 5AG9A 4NPYB 3VXQB 1WISA 4BH7A 3UTSE 2IAMC 3HCVA 4OFPA 4PRPA 4GBXD 5SWZE 1RUPL 1U3HC 2AXFA 3QCUL 2VXSH 1Z9LA 3QRGL 5D5MF 4L8DB 3U6RB 1DCLA 3RWDA 3VDAA 5D7JD 4X99B 2FJGA 3QIUC 4BA8A 1LD9B 1T1ZB 4MNGE 4XWOD 5DJYB 3S5LG 3L95A 1DL7L 3I6KB 3MRCB 4HFUL 5FUCC 1H3PH 3V0VA 2I5YL 1UQSB 5GGTA 2F54B 4XNXH 5CBEA 1HQ4B 2BC4B 1IQWL 4I4WA 2XZCH 4JAMB 3ARDD 1CGSH 1CDHA 3EGSB 4KKAD 4NRXB 3ZT5A 5E94B 1I85A 5I8OL 4O5LH 2IQ9L 2IGFL 4YDVA 5J12C 1DUZB 2VXTH 1L7IL 3GK8H 4GRWH 5E9DD 1FO0A 4KRLB 3ARTA 1RZIB 5E1AB 5KVMC 1QKZL 3HC0A 4K3EH 2DIAA 5CP3H 1JYVA 4L29A 1SJEB 4OD3L 1J12A 2HG5B 1HKFA 4PP2A 1MF2L 3KAAA 2HLFD 1CLOH 1MCWM 2YPKB 3VFNA 3N0PB 1IQDB 3C8HA 3IJHA 5E5MA 1A1OA 1EGJH 1Q9LB 4OZHF 4X0KB 5EUOE 3SE9L 3HHRB 5E8DH 1A2YB 4E0RA 2XY2A 3FCTA 2W9DL 4QOKE 3L7EB 3DYPA 4QRTA 2ED7A 1CQKA 1TENA 3WFBL 4Q6YA 2DI8A 4LLMA 2ORBL 5F6IB 1G1YA 1GGIH 1HHGB 4NKIL 1WFNA 3BPNB 4N68A 4OZIB 3DJ9A 1A9EA 3MRJA 3CFEB 1YUHA 1T5XB 1HXYB 3JV0A 4C56D 1CICD 5ALBL 2VQ1A 2NZIA 2B1HH 4JLRB 5C2BL 4U1NB 3S34H 4WWID 5IEHB 3ZDYF 1G7JB 2DMCA 4JY5L 1WFTA 1FFNB 4WTWA 5DZNA 1CK0L 3QFDA 5GGTL 5FM5M 1NMCB 4OZFB 4KHXL 4JPVH 4U1KB 3EYUL 5EO1A 3RWEA 4JY6B 4L8BB 1U8IA 4KMQA 5E8OB 1GGBH 3DBXA 4IOIA 1LO2L 2LU4A 4GLRI 3SPVB 3SDCB 1KLUA 1CR9L 2V5RA 5F89A 1JZ3A 3QEQE 2NX5A 4ZAKC 1JUFB 1W0WB 4LRIC 5LQBH 5SX5H 5T1KA 5I19H 3BKMH 1MFCH 4L8CB 3QFJB 4QY8B 5EZJB 1CBVL 1L4IA 4XMPH 1A1NB 2VZ1A 4OGXL 2XKNB 2VC2H 5DD5L 2IPTH 3B9AA 4FQJL 4OJFH 2ADGA 5HGBB 4MMZC 1P53A 5KJRL 3F58L 2ZWLT 1XIWB 5ESVA 1INDH 4Z7UB 1VPOH 1PG7W 1FSKC 1T7ZA 4NQEA 2GJ6B 3NA4A 3SE4C 2A6JB 4FQCL 3C5SA 3DHMA 3LEYH 4HCRA 2ZNWA 3C87A 4HS3A 3WJLA 4F7TB 2P5EA 5CZVL 4ZSOB 3NN8A 4PUBH 3PWJA 5E2TL 4W6WB 2OR9L 5EBWA 2EDXA 1I1RA 5F7WC 3PL6D 3O6FB 4XC3H 1B4RA 1UM4L 3QT2A 3QULB 5C7XL 4PJ5B 1YY8A 4Y16B 3LMJH 1DQLL 5D7SL 4C54A 2AV1B 4G6AC 5B38G 1I8MA 4CU6A 1T5WB 3RKDD 4UQ2A 4OFVA 3Q5TA 2W60B 4O58L 3RGVC 2AQ1A 4X6CE 4Q6IC 3LN5B 2EO9A 5A40E 3BIAX 5IR1B 1JWMA