3UU1A

Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs142)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
346
structure length
338
Chain Sequence
b'PSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRASGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title The Substrate Capture Mechanism of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Provides a Mode for Inhibition.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase/transferase inhibitor
total genus 117
structure length 338
sequence length 346
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2011-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 3uu1A01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 3uu1A02
1O17A 4ZOJA 4OWNA 4X5EA 2J0FA 2WK6A 2ELCA 4N8QA 4M0RA 4GIUA 3TWPA 4OWOA 3UU1A 1ZVWA 5C7SA 2WK5A 3R88A 4GKMA 4IJ1A 5BNEA 3R6CA 4X5DA 4ZOKA 2TPTA 1BRWA 5EP8A 4X5BA 2GVQA 1V8GA 1VQUA 1KGZA 2DSJA 3H5QA 4EADA 5BYTA 4GA6A 3QSAA 4X59A 4MUOA 3QS8A 4X46A 3QR9A 1KHDA 4OWSA 5C1RA 5C2LA 4N93A 4ZTVA 4ZOFA 4YYYA 4X5CA 4XR5A 4OWUA 4EAFA 4OWQA 5EY3A 1ZYKA 4X58A 3QQSA 4GA5A 4OWMA 4GTNA 1UOUA 2BPQA 4HKMA 5BO3A 4YEKA 4N5VA 4GA4A 1GXBA 1OTPA 4LHMA 4X5AA 1AZYA 1ZXYA 4OWVA 4YI7A 5BO2A 3GBRA
chains in the Genus database with same CATH superfamily
1O17A 4ZOJA 4OWNA 4X5EA 2J0FA 2WK6A 2ELCA 4N8QA 4M0RA 4GIUA 3TWPA 4OWOA 3UU1A 1ZVWA 5C7SA 2WK5A 3R88A 4GKMA 4IJ1A 5BNEA 3R6CA 4X5DA 1RRZA 4ZOKA 1RF8B 2TPTA 1BRWA 5EP8A 4X5BA 4F3FC 2GVQA 1V8GA 1VQUA 1KGZA 2DSJA 3H5QA 4EADA 5BYTA 4GA6A 3QSAA 4X59A 4MUOA 3QS8A 4X46A 3QR9A 1KHDA 4OWSA 5C1RA 5C2LA 4N93A 4ZTVA 4ZOFA 4YYYA 4X5CA 4XR5A 4OWUA 4EAFA 4OWQA 5EY3A 1ZYKA 4X58A 3QQSA 4GA5A 4OWMA 4GTNA 1UOUA 2BPQA 4HKMA 5BO3A 4YEKA 4N5VA 4GA4A 1GXBA 1OTPA 4LHMA 4X5AA 1AZYA 1ZXYA 4OWVA 4YI7A 5BO2A 3GBRA
chains in the Genus database with same CATH topology
1O17A 4ZOJA 4OWNA 4X5EA 2J0FA 2WK6A 2ELCA 4N8QA 4M0RA 4GIUA 3TWPA 4OWOA 3UU1A 1ZVWA 5C7SA 2WK5A 3R88A 4GKMA 4IJ1A 5BNEA 3R6CA 4X5DA 4ZOKA 2TPTA 1BRWA 5EP8A 4X5BA 2GVQA 1V8GA 1VQUA 1KGZA 2DSJA 3H5QA 4EADA 5BYTA 4GA6A 3QSAA 4X59A 4MUOA 3QS8A 4X46A 3QR9A 1KHDA 4OWSA 5C1RA 5C2LA 4N93A 4ZTVA 4ZOFA 4YYYA 4X5CA 4XR5A 4OWUA 4EAFA 4OWQA 5EY3A 1ZYKA 4X58A 3QQSA 4GA5A 4OWMA 4GTNA 1UOUA 2BPQA 4HKMA 5BO3A 4YEKA 4N5VA 4GA4A 1GXBA 1OTPA 4LHMA 4X5AA 1AZYA 1ZXYA 4OWVA 4YI7A 5BO2A 3GBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O17 A;  4ZOJ A;  4OWN A;  4X5E A;  2J0F A;  2WK6 A;  2ELC A;  4N8Q A;  4M0R A;  4GIU A;  3TWP A;  4OWO A;  3UU1 A;  1ZVW A;  5C7S A;  2WK5 A;  3R88 A;  4GKM A;  4IJ1 A;  5BNE A;  3R6C A;  4X5D A;  4ZOK A;  2TPT A;  1BRW A;  5EP8 A;  4X5B A;  2GVQ A;  1V8G A;  1VQU A;  1KGZ A;  2DSJ A;  3H5Q A;  4EAD A;  5BYT A;  4GA6 A;  3QSA A;  4X59 A;  4MUO A;  3QS8 A;  4X46 A;  3QR9 A;  1KHD A;  4OWS A;  5C1R A;  5C2L A;  4N93 A;  4ZTV A;  4ZOF A;  4YYY A;  4X5C A;  4XR5 A;  4OWU A;  4EAF A;  4OWQ A;  5EY3 A;  1ZYK A;  4X58 A;  3QQS A;  4GA5 A;  4OWM A;  4GTN A;  1UOU A;  2BPQ A;  4HKM A;  5BO3 A;  4YEK A;  4N5V A;  4GA4 A;  1GXB A;  1OTP A;  4LHM A;  4X5A A;  1AZY A;  1ZXY A;  4OWV A;  4YI7 A;  5BO2 A;  3GBR A; 
#chains in the Genus database with same CATH topology
 1O17 A;  4ZOJ A;  4OWN A;  4X5E A;  2J0F A;  2WK6 A;  2ELC A;  4N8Q A;  4M0R A;  4GIU A;  3TWP A;  4OWO A;  3UU1 A;  1ZVW A;  5C7S A;  2WK5 A;  3R88 A;  4GKM A;  4IJ1 A;  5BNE A;  3R6C A;  4X5D A;  1RRZ A;  4ZOK A;  1RF8 B;  2TPT A;  1BRW A;  5EP8 A;  4X5B A;  4F3F C;  2GVQ A;  1V8G A;  1VQU A;  1KGZ A;  2DSJ A;  3H5Q A;  4EAD A;  5BYT A;  4GA6 A;  3QSA A;  4X59 A;  4MUO A;  3QS8 A;  4X46 A;  3QR9 A;  1KHD A;  4OWS A;  5C1R A;  5C2L A;  4N93 A;  4ZTV A;  4ZOF A;  4YYY A;  4X5C A;  4XR5 A;  4OWU A;  4EAF A;  4OWQ A;  5EY3 A;  1ZYK A;  4X58 A;  3QQS A;  4GA5 A;  4OWM A;  4GTN A;  1UOU A;  2BPQ A;  4HKM A;  5BO3 A;  4YEK A;  4N5V A;  4GA4 A;  1GXB A;  1OTP A;  4LHM A;  4X5A A;  1AZY A;  1ZXY A;  4OWV A;  4YI7 A;  5BO2 A;  3GBR A; 
#chains in the Genus database with same CATH homology
 1O17 A;  4ZOJ A;  4OWN A;  4X5E A;  2J0F A;  2WK6 A;  2ELC A;  4N8Q A;  4M0R A;  4GIU A;  3TWP A;  4OWO A;  3UU1 A;  1ZVW A;  5C7S A;  2WK5 A;  3R88 A;  4GKM A;  4IJ1 A;  5BNE A;  3R6C A;  4X5D A;  4ZOK A;  2TPT A;  1BRW A;  5EP8 A;  4X5B A;  2GVQ A;  1V8G A;  1VQU A;  1KGZ A;  2DSJ A;  3H5Q A;  4EAD A;  5BYT A;  4GA6 A;  3QSA A;  4X59 A;  4MUO A;  3QS8 A;  4X46 A;  3QR9 A;  1KHD A;  4OWS A;  5C1R A;  5C2L A;  4N93 A;  4ZTV A;  4ZOF A;  4YYY A;  4X5C A;  4XR5 A;  4OWU A;  4EAF A;  4OWQ A;  5EY3 A;  1ZYK A;  4X58 A;  3QQS A;  4GA5 A;  4OWM A;  4GTN A;  1UOU A;  2BPQ A;  4HKM A;  5BO3 A;  4YEK A;  4N5V A;  4GA4 A;  1GXB A;  1OTP A;  4LHM A;  4X5A A;  1AZY A;  1ZXY A;  4OWV A;  4YI7 A;  5BO2 A;  3GBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...