3UU3A

The glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
311
structure length
305
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 83
structure length 305
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu3A01
2XQ7A 4AFHA 2WNLA 4TWHA 3UUBA 5KZUA 2BG9C 2XZ5A 4NZBA 4ZZBA 2XYSA 3UU5A 4TWDA 4QACA 5J5IA 4Z91A 2BG9A 5AINA 1UV6A 4UM3S 5BW2A 3U8KA 5L4EA 3JAFA 4HFDA 5L4HA 4PIRA 3WTHA 4AFGA 2KSRA 2WZYA 5LXBA 4LMLA 4IL4A 2M6IA 3UQ4A 2QC1B 3EHZA 5HEHA 3WTNA 3UU4A 4HFEA 2YMDA 2XQAA 5AFMA 1OEDE 5CFBA 4IL9A 4HFIA 3TLVA 2BYRA 3UU8A 3TLTA 4ZRUA 3WTJA 4X5TA 1UX2A 3T4MA 2XNVA 2XZ6A 3U8NA 4LMKA 1I9BA 4UXUA 3WTOA 4BFQA 4ZK1A 4HFHA 3P50A 3WTKA 4LMJA 2XNTA 4QH4A 2X00A 2ZJVA 4Z90A 2Y58A 3P4WA 3C79A 4B5DA 2BYPA 4A97A 5J5GA 4HQPA 3RQUA 3RI5A 5HEJA 5FJVA 2X00D 5BRXA 4IREA 5IUXA 3ZDGA 4F8HA 2XQ6A 4QH1A 3UU3A 3SQ6A 4EZ1A 2WN9A 3SH1A 5HCJA 3UQ7A 4ZK4A 2W8GA 2XQ4A 5TVCA 4XK9A 4NPPA 5SYOA 2WNJA 2LM2A 5HEUA 4UY2A 4QH5A 3RIFA 4HFBA 1OEDB 2XQ5A 3RQWA 3WTLA 2BR7A 2YN6A 2MAWA 2ZJUA 2BG9E 2LKHA 5HEOA 3ZKRA 5L47A 5CO5A 5HEGA 4ALXA 4ZJTA 5J5HA 2XQ3A 2M6BA 5HCMA 3IGQA 4TWFA 2Y54A 4FRRA 3SQ9A 4DBMA 5JMEA 3WTMA 4AFTA 3PMZA 3UU6A 2UZ6A 2PGZA 4BQTA 4ILBA 2XQ9A 3EAMA 2BYQA 3C84A 3LSVA 2LKGA 3JADA 3WTIA 4TNVA 1OEDC 2Y7YA 4UM3A 1UW6A 3TLUA 4UM1A 2LLYA 5AFNA 4QAAA 4QABA 1OEDA 3RIAA 4WV9A 2BYNA 3U8LA 5KE4A 3U8JA 5J5FA 2BJ0A 4COFA 2W8FA 4D01A 3RHWA 4HFCA 4A98A 5BP0A 4XHEA 2BG9B 3TLSA 2Y56A 5J0ZA 2XNUA 4ZZCA 4ZJSA 2Y57A 3U8MA 4ILCA 3ZDHA 4TNWA 2XQ8A 3GUAA 3WIPA 5AFHA 4ZR6A 2VL0A 5AFKA 3JAEA 2YOEA 3EI0A 3TLWA 4UM3P 3SIOA 5AFLA 2BR8A 5AFJA 2BYSA 2PH9A 2XYTA 3PEOA 2C9TA 2YKSA 2WNCA 2YMEA 5LG3A 4ILAA 5AFMB
chains in the Genus database with same CATH superfamily
3AEBA 2W66A 2GK9A 5LG4A 2XQ7A 4AFHA 1FMVA 1XNRT 1DU2A 2HPJA 4NZBA 3AVSA 3EABA 3RKOA 4JI3T 1BR2A 5M4YA 3PJAJ 2KSRA 3F2EA 4ADZA 2QC1B 3MKDA 4G63A 2CM0A 3S4UA 2PJQA 3CQGB 1N34T 3T4MA 2CBIA 4HFHA 2K48A 5DABA 2A9UA 4CN6A 1CHUA 4WW0A 1YKHB 3UFEA 1MMDA 4OYJA 2LHNA 4YTMA 4LFCT 4CI3B 3PU3A 2LM2A 1CUNA 4L5GA 1I6ZA 5FP3A 1E2AA 3CWZB 3FZMB 2CWOA 2QYWA 2BBJA 1IZNB 4DNDA 2UUBT 3ZCJA 3O9XA 2SPCA 3WAKA 3PUYF 4YY3T 2LSYA 5LB7B 2E9XD 2UU9T 3RIUC 4P0BA 2V7KA 1WR6A 4EB6E 1R8IA 3RIUA 2CPTA 4H9SE 3NRYA 2W2UA 4GKJT 5KE4A 5DQVA 3Q2MA 4XHEA 4DR6T 4DR7T 4TX5A 1H7CA 3GUAA 2WDRA 2NW9A 4PAGA 5ABFA 3EI0A 3L39A 2BR8A 2LSKA 4HTEA 2BZBA 2BYSA 3OYZA 2KWIB 2X51A 5CA0E 4JBWF 5AQSB 3FB2A 5FNVE 4TWHA 4O8SA 4UVBB 5ETWA 4DMWA 3LK42 2ZM2A 1B7TA 2IC9A 2WP9A 3HKDE 3FBZA 2YINA 4IE4A 2BS2A 2WBLA 2IDOB 2A3DA 3QNUA 3WTNA 4IDNA 3CX7B 3UUNA 3BQIA 3U78A 3FZHB 4TN7B 1BR4A 3VHLA 3N9LA 1MMAA 3RKGA 1SUMB 1I9BA 5JR9C 3P50A 3GN5A 3I0OA 4Z90A 2YDRA 3C79A 5JR9A 5FJVA 5L3DB 2E2AA 3RF1A 2PFVA 2PTFA 3OYXA 5JDGA 1T7SA 4DR5T 4MBQA 3AA7B 3WTLA 4ZI3D 1UK5A 5LMNT 3SOLA 4ALXA 5J5HA 4FI5A 4DV2T 3SQ9A 5ABFB 4ZI2C 3MJXA 2JRKA 4IDQA 2CEAA 2NW8A 3I9YA 4HFVA 5AFNA 4G2AA 2C5JA 2W67A 4HE8A 1IBMT 3RIAA 4B6XA 3RHWA 5FXZA 2J62A 3TLSA 5J0ZA 5FXXA 4HEAA 4X20E 2BBHA 2W4XA 5AFLA 4JI6T 3KINB 3CVRA 4HWFA 1UCUA 1IBLT 1NENA 3AE7A 4EV6A 2ES0A 3ZMUB 3GN5B 3AE9A 3AEGA 5JR9B 1WLXA 4X1KE 4O4HE 3C50A 3LJCA 1WYCA 3KBUA 2MTQA 3SFDA 4M1PA 4IL4A 4UVAB 1WR0A 3AAIA 4YTPA 2H88A 2VKDA 2X9WA 4H9QC 2XNVA 2XZ6A 5HWXA 2IC6A 5LGUB 4X1IE 4QX7B 5J5GA 4E7SA 1HR0T 2VQET 2I59A 4IE7A 1UURA 1SA0E 2JMKA 3VRAA 3B57A 4XBFB 3PJAA 2Q9QC 4XK9A 2Q9QA 1KF6A 4CZZB 2CMRA 3N9MA 4UV9B 1JNRA 1XDOA 5LHHB 4DVDA 3AEAA 4EZ4A 3C51A 4JUYA 4ILUA 3EAMA 4AQFC 1OEDC 2NOXA 4CI2B 4KI0F 2V8SV 1OEDA 5LMUT 4KBMB 4GOUA 3R84B 4EXTA 4ZS3A 4C90A 2VL0A 5H6QB 3EVYA 2NTXA 3CX8B 3OVUA 2Y6XA 3ZSTA 2E8IA 2LSIA 2VASA 2VKHA 4ZZBA 4BA9A 4CXWA 4EZHA 2KXPB 5BW2A 2NWBA 5L3GB 4HFDA 2VL8A 4AFGA 4YSZA 3PU8A 2D9DA 3NWIA 2WMNA 4ZS2A 4IL9A 2Q9QB 3ABVA 3UU8A 1UX2A 3AEEA 1XNQT 5JQGE 3PUVF 4GKKT 2C0SA 3WTKA 1E7PA 3RGLA 4H9PC 4B5DA 5ABEA 1MNDA 3U3IA 3N9NA 4O4IE 1NAFA 4ZK4A 2VVSA 4NPPA 2BVLA 5HXSA 2HN2A 3V5SA 3P4SA 1OEDB 4QXBB 5JTGA 3LBXA 4WBNE 4EAHA 2BG9E 2LKHA 4PJLA 3AE5A 3HA4A 4FJOA 4JI2T 4U7IA 4H63H 4X64T 3F57A 3C84A 3AECA 5JDHA 3N5LA 4X66T 1L0VA 5HXHA 4QABA 4LF4T 4AXPA 4P0AA 4ZZCA 3NZPA 3OKQA 2XQ8A 1FMWA 4DV6T 4EOZB 4OX9T 2WMOA 3ZC0A 3UULA 2RP4A 2XUEA 4JV5T 2YMEA 2IUBA 4MFRA 3HKBE 4AQYT 2DCFA 3J7Yq 5AQUB 2XPKA 3EDVA 5FVLA 5ABGA 1UV6A 3AAAB 4IDOA 1OXZA 3C64A 1MNEA 1I94T 1YXRA 3HL6A 3J9X1 5BR8T 3LBXB 1HG2A 1D1AA 3JC6C 4IDPA 4MLKA 2J1DG 3ZT7A 4U31A 5AQOB 2IIUA 4EZ1A 3LDQB 5HCJA 4HWDA 4DV4T 2H7OA 4HFBA 1FJGT 3IBPA 5L47A 4B3ST 2XM2A 2VKJA 4JI5T 2FUPA 3LSVA 3RYHE 4YJ2E 4H9RC 2N1GA 3WTIA 3T1YT 5FVKA 4ASKA 2HN1A 4LF9T 4ZOLE 4A98A 3GA8A 2LT3A 1KNZA 3E22E 3HI2A 2BS4A 3O1JA 3M65A 4KX6A 2UUAT 1HS7A 3SIOA 4NIQA 2PH9A 2C9TA 5KXJA 3SRZA 2V5CA 2V7LA 4QACA 2BDEA 1Y01A 4Z91A 5AQPB 4UM3S 3PURA 3RX6A 3FZFB 1AJ3A 4PK4A 1FIOA 4TV9E 1MMGA 1NWMX 2DNXA 2L8KA 2A72A 4O4JE 3ZYLA 1IBKT 3PUQA 3A8YC 2Y58A 4F6RC 5L3FB 4IE6A 4CN1A 2QRXA 4XAXB 2X00D 4WZXA 4IREA 4H9OC 5AQJB 1WCRA 3L09A 5E0OA 2WN9A 2BKOA 3UQ7A 4GYSA 2W8GA 3A5XA 3CQCB 4O2BE 1YD8G 3ZT6A 2E9XC 4CI1B 5CGMA 2E9XA 4HWIB 5AQVB 1YW0A 4TWFA 4X65T 2UZ6A 2X9HA 4ILBA 4PJMA 2Y7YA 5LOVE 5HXEA 2LLYA 2CXFA 2IAKA 2W63A 4UVCB 4QXHB 5J5FA 3IHRA 2C5KT 2E5LT 4HKAA 3AE1A 5FL1A 2UXXB 5AQMB 2WY2A 3UUMA 5DQWA 2QGSA 3TLWA 5A1LA 1N36T 1MIYA 4U33A 2JQ9A 2W0GA 3N2GE 1U5PA 1UUSA 3OBVE 3NKZA 1S94A 2ZM0A 2CCQA 3CKDA 3PUAA 3KV4A 3U8KA 5LNKA 3JAFA 4EEDA 2ODUA 1KFYA 3UQ4A 2YMDA 2XQAA 2UXCT 2WWUA 3VR8A 5L3CB 4A5XA 1IAPA 3U8NA 2LOSA 5LCYA 2E9XB 5L3EB 2D0TA 2CHOA 3KVAA 3RI5A 2V7IA 4ZI3C 5F3JA 4U2YA 1SHZC 2XQ5A 3ZYMA 4LF5T 3ZKRA 2HH7A 2LSGA 2WS3A 5HAXA 3QB5A 2EHOD 4IIJE 5HCMA 4FRRA 3KV5A 3QB5K 4DBQA 3WTMA 4AFTA 4P1NA 3CMLA 4L9IA 5DJQC 4GIWA 1MIWA 4MALA 3I0QA 2VVNA 3VKHA 4DV0T 2CBJA 3K3NA 2ZMAA 2D5UA 3RH3A 3KV6A 1EZ3A 3ONJA 4WBOA 5BP0A 2UXDT 5LHGB 4KHZF 2XZEA 5FKYA 3MA9A 2K24A 2XSBA 5LA6E 4XZCA 4N78D 1G8XA 2V6XA 1UX4A 4E7ZA 4NUVA 3L3PA 2VK9A 3H3MA 2XASB 1HFAA 2FBWA 4PFOA 4IE5A 3NVOA 3PTRB 2W62A 2WU5A 3X1DA 1T72A 4BAYB 5LHIB 4AKHA 4LMLA 3P4PA 4I50E 3FZKB 1Z8UA 1OEDE 5CFBA 2VQFT 4HFIA 3TLTA 4LMKA 5HXCA 4HWHA 5LGTB 1FEWA 4DV5T 2XNTA 1NEKA 1KNPA 2BYPA 4CXYA 5HEJA 3K8PC 5AQLB 4ZEYA 2K9AA 3KV9A 4EIWA 5TVCA 1XWMA 3RRWA 3ZN0B 4QH5A 2DLRA 4IE0A 4DUZT 3ZC1A 2YN6A 3Q5DA 1HTJF 1ZHCA 3QC9A 3RC8A 2K3WA 3IGQA 1Z0PA 5JMEA 3DJBA 5AQQB 3WI3A 4BQTA 4YTNA 1U4QA 2H89A 4LF6T 1GQEA 2HPLA 3U8MA 3H3AA 4ZR6A 5KMGP 5BMVE 2BS3A 3ZN1B 4JYAT 1J5ET 3PE0A 4AQFA 2B1EA 5KZUA 5FL0A 1W09A 1YKEB 3KVBA 2XTLA 3K3QC 5AQIB 2X0YA 1HX8A 1E1HB 2YU2A 4EYUA 4AIUA 4UXUA 4AQGA 4HGAA 2Q9QD 2Y48B 2JJ9A 1T98A 3P7IA 3OTOT 5IUXA 2K5BB 4F8HA 5EZYE 1D1CA 1J5WA 4AKLA 2J4GA 2V5DA 5AQHB 2RPAA 2LSJA 3QK6A 5JDFA 4QHOA 3AVRA 3P4RA 4EGWA 1LVKA 4IDZA 2M6BA 1HNXT 3PUXF 5AQKB 3UU6A 2N9DA 2XQ9A 2X0LB 3AA1B 3AAEB 4TNVA 4BJNA 4UM3A 4DR1T 5F8PA 4WV9A 2H3RA 3SS1A 2I6HA 3E0ZA 2BJ0A 3GMIA 5AQFB 3SFEA 3D0TA 4QKNA 4LFBT 1UX5A 5AFKA 3P4QA 3EDUA 2X66A 5LG3A 5GONE 3FBLA 4Z8XA 5J2UE 3ZPOA 1X9BA 2B76A 2CLYC 1X79A 3RLFF 5LXBA 2JQKA 5HEHA 3B13A 3UU4A 3ZCIA 2BYRA 3PV0F 3WTJA 4ZK1A 3DTOA 1LKXA 1W0BA 1HF8A 3N2OA 5BRXA 3O1HA 4DR2T 2W00A 2XQ6A 2NP9A 3SQ6A 3ZT5A 5JH7E 5FXVA 3VRBA 4YT0A 2WNJA 5JREA 4A56A 4PW8A 1WRDA 3RIFA 2WU2A 5L3BB 4LF8T 5LXTE 2WCAA 4PK5A 4YXDA 4U3CA 2BKPA 1KK7A 4CXXA 1BR1A 1LVFA 1O3XA 2WZIA 3LG7A 3W15B 4DR4T 4DV3T 4U74A 3KDSE 5FYMA 2D2SA 4WYVA 4UELA 4ISTA 3ETVA 2CLYB 4UM3P 2HHHT 3CPZA 3KBTA 4YHHT 5AFUL 4PK6A 5LYJE 2XZ5A 3G06A 2ACXA 2OLTA 4DV1T 1XZYA 5AINA 3UTKA 3ZLIA 3AE6A 3T8OA 3NBXX 4AKGA 3JC6D 4YJ3E 4AISA 4GYRA 3AE2A 2M6IA 4KMCA 2UUCT 4HFEA 5ABHA 5LGNB 5AFMA 4P09A 3ZMSB 4O2AE 4DO0A 4ZRUA 3N2KE 2H7VC 2MPKA 3WTOA 3MZKB 2BKNA 1J1JA 4LMJA 4QH4A 2X00A 3Q5XA 2CXLA 2PG8A 4HQPA 4KP3C 4QH1A 2WZHA 2WWVA 5LP6E 4MHCA 3K1SA 4JLEA 5HEOA 2QA7A 3AA0B 4DBRA 3MK7C 2Y54A 3H37A 2CA5A 4X1YE 2JMHA 5C2TA 3AXJA 4Q25A 1ZV4X 3TLUA 3PUGA 1KEYA 5EK2A 2XAGB 4X62T 2XAQB 4D01A 1S35A 3ONLC 2JIWA 3LK2B 2ODVA 2E5VA 2LRKA 4QX8B 4ILCA 4QWNB 2QVAA 3A7MA 2WAUA 5JDMA 2WSSV 2KINB 2YKSA 3F31A 4ILAA 5AFMB 2RA1A 2WQYA 3DP7A 2X9YA 2KNDA 2WNLA 2XM1A 3IF8B 3MACA 3OPCA 5J2TE 4GK5E 2XYSA 3N9OA 1D0XA 5JDQA 1KNRA 4IT4A 3P8CD 3HR0A 2IHR1 5L4HA 2KLQA 3C4WA 4JEUB 3QUJA 1IJ6A 4H63V 1SE7A 5LBMA 4I4TE 3VU7H 3WAJA 5HYAA 4I55E 1WYBA 3EUHA 4HN9A 4JI1T 4OYKA 2UXNB 3UU3A 5CB4E 2FJDA 3AXJB 3SH1A 2XQ4A 3ONXA 1HNWT 2OV9A 2LEHA 2EHOC 3K3OA 2YU1A 3MXZA 2EHOA 2ZJUA 2V7MA 1IJ5A 2CRBA 5AQRB 3ZMTB 5KDMC 4AI6A 3PMZA 3C98B 1D0YA 2ZM6T 4QAAA 4NXNT 3U8JA 1HNZT 3O4XE 4YSXA 2W8FA 4HFCA 4GK0E 2DWGA 5L2LA 4JI4T 5FY1A 3ETUA 3O1IA 2CE7A 5AFJA 5JRCA 4OFZA 1QLBA 2V26A 4ZI7E 1M7KA 3UUXB 5TAOA 4UF0A 2CXDA 3HKEE 2J47A 2JQHA 2N2NA 4U72A 5EK4A 3ZMVB 3PUSA 1ZOYA 2AXDS 3AB3B 5L4EA 1HG5A 1M62A 2IW5B 4ANJA 1ZEEA 2XJ7A 4L0RA 4X5TA 2EHOB 2DI4A 1D0ZA 3GWHA 4OK0A 5J1GA 2ZJVA 3ZEFB 5CA1E 1HCIA 4DIDB 5JDNA 4EYYR 3RYFE 5SYOA 4JI8T 3R6NA 3RQWA 2WDVA 4QXCB 4K0KT 5CO5A 5KX5E 4K0UA 5LBQB 4DUYT 5JRCB 2FJAA 2LKGA 4TUYE 4UF0B 1N32T 3N9QA 4ZI2D 1YQ3A 2FJBA 2XAJB 3UT5E 2Z6EA 4ERRA 3BQLA 2LRLA 1QUUA 3C4XA 5FXWA 4IHJE 3ANWA 2C5IT 2YOEA 5EK3A 4DV7T 5HXRA 1WFDA 2XAFB 2XYTA 2DL1A 3PEOA 1MIVA 3CX6B 2VKOA 2G0UA 1OWAA 2XAHB 3FXEB 4TZ4C 3RYIE 4PJJA 3VR9A 4PNIA 1ZKEA 2MYSA 3WTHA 4HWCA 2WZYA 3C4ZA 4TV8E 4I43B 3CIRA 1US7B 5ADXL 2LE8A 3KFWX 4BFQA 2BVMA 4DMVA 5F5WA 5IWAT 3PUWF 4I0UA 3ZJ2A 1D1BA 3RQUA 2R6GF 3NRXA 1ZP0A 2X68A 3AE3A 3ZDGA 4UV8B 4EEBA 2A2FX 3IA3A 4B3RT 4YLHA 3N9PA 4ISSA 3AE4A 5C8YE 5HEUA 4LFAT 2AE9A 2WB5A 3Q5EA 2WM9A 3ANWB 5AQTB 2XQ3A 1V9DA 2X67A 2KT9A 3CK6A 2PGZA 4OHFA 2D0UA 2BYQA 4JEHB 1UW6A 2WDQA 2KMFA 3Q9DA 1VRBA 2F4VT 3VKGA 2VURA 4COFA 2NTYA 3RRCA 2Y56A 4PJNA 4B3MT 2XNUA 4ZJSA 3I1AA 3ZDHA 4DR3T 3M3ZB 3WIPA 1YQ4A 3I9WA 4U7YA 5IYZE 5JVDE 2XHEB 2VB6A 3ZYKA 3FXDB 3CQXC 2JPFA 3NZQA 2PBIA 4TWDA 3RC3A 3IEEA 4C91A 4CQIA 5FMNA 1HX1B 2LOPA 2KWHA 2UXBT 2L3LA 2YDQA 3AA6B 3AE8A 4LF7T 3EHZA 3HKCE 4B3TT 1UGOA 2YK0A 3PDYA 2V1DB 2P9BA 3TLVA 2YEVC 2NR4A 2DHRA 4UXNB 4IGUA 2OA5A 5IHYA 1W9RA 4A97A 3LFMA 3OJAA 2M67A 3FHNA 5CJ5A 3ZSSA 4UY2A 4U2ZA 5AQNB 2V6YA 5FY0A 2BR7A 4NXMT 3Q5WA 5H6RB 2X9XA 4KHPT 4O4LE 3RYCE 2VWAA 2CWYA 5HWYA 3JCFA 1XMQT 2ZLYA 2LHRA 4YFSA 4UR9A 2KZ7B 2ACZA 2BYNA 2LJLA 4V1Av 1BR0A 2IMLA 5C3JA 1Y64B 5AFHA 2W61A 3JAEA 4ZXLA 3T1HT 2CHNA 3ZMZB 1N33T 4JI7T 3TKLB 3UUBA 4KUMB 2BG9C 4UIGA 4PFPA 4BJMA 4CN4A 2XY8B 1XMOT 3ESLA 5J5IA 3UU5A 1XDPA 2BG9A 2XQYA 4PIRA 2NW7A 5AQGB 1VOMA 4JI0T 2V6YB 4ZHQE 4AKRB 5LJMA 3QOFA 3BQKA 1LRZA 3LK3B 4YSYA 3P4WA 4J2CA 2FJEA 2XSAA 5FY7A 3RPUA 2JQQA 4H9NC 2Y8DA 3FZLB 3V5UA 3UFGA 4NUUA 5JDLA 4AKIA 3ZJ1A 2ZM8A 3E08A 1W0AA 2L9QA 2V7JA 2MAWA 5HEGA 1MMNA 4ZJTA 2LM9A 2MBGA 4UEMA 3AEDA 1G73A 4DBMA 3AEFA 1QSDA 2MOZA 4WNKA 1VCSA 3JADA 4UM1A 2DWKA 3U8LA 2X0HA 1T8BA 3BK9A 2YDSA 2BG9B 3L8RA 4YHJA 2Y57A 1VCTA 5LJNA 4TNWA 2I0MA 1JNZA 3SWHA 2WNCA 3PUZF 3B5MA
chains in the Genus database with same CATH topology
2XQ7A 4AFHA 2WNLA 4TWHA 3UUBA 5KZUA 2BG9C 2XZ5A 4NZBA 4ZZBA 2XYSA 3UU5A 4TWDA 4QACA 5J5IA 4Z91A 2BG9A 5AINA 1UV6A 4UM3S 5BW2A 3U8KA 5L4EA 3JAFA 4HFDA 5L4HA 4PIRA 3WTHA 4AFGA 2KSRA 2WZYA 5LXBA 4LMLA 4IL4A 2M6IA 3UQ4A 2QC1B 3EHZA 5HEHA 3WTNA 3UU4A 4HFEA 2YMDA 2XQAA 5AFMA 1OEDE 5CFBA 4IL9A 4HFIA 3TLVA 2BYRA 3UU8A 3TLTA 4ZRUA 3WTJA 4X5TA 1UX2A 3T4MA 2XNVA 2XZ6A 3U8NA 4LMKA 1I9BA 4UXUA 3WTOA 4BFQA 4ZK1A 4HFHA 3P50A 3WTKA 4LMJA 2XNTA 4QH4A 2X00A 2ZJVA 4Z90A 2Y58A 3P4WA 3C79A 4B5DA 2BYPA 4A97A 5J5GA 4HQPA 3RQUA 3RI5A 5HEJA 5FJVA 2X00D 5BRXA 4IREA 5IUXA 3ZDGA 4F8HA 2XQ6A 4QH1A 3UU3A 3SQ6A 4EZ1A 2WN9A 3SH1A 5HCJA 3UQ7A 4ZK4A 2W8GA 2XQ4A 5TVCA 4XK9A 4NPPA 5SYOA 2WNJA 2LM2A 5HEUA 4UY2A 4QH5A 3RIFA 4HFBA 1OEDB 2XQ5A 3RQWA 3WTLA 2BR7A 2YN6A 2MAWA 2ZJUA 2BG9E 2LKHA 5HEOA 3ZKRA 5L47A 5CO5A 5HEGA 4ALXA 4ZJTA 5J5HA 2XQ3A 2M6BA 5HCMA 3IGQA 4TWFA 2Y54A 4FRRA 3SQ9A 4DBMA 5JMEA 3WTMA 4AFTA 3PMZA 3UU6A 2UZ6A 2PGZA 4BQTA 4ILBA 2XQ9A 3EAMA 2BYQA 3C84A 3LSVA 2LKGA 3JADA 3WTIA 4TNVA 1OEDC 2Y7YA 4UM3A 1UW6A 3TLUA 4UM1A 2LLYA 5AFNA 4QAAA 4QABA 1OEDA 3RIAA 4WV9A 2BYNA 3U8LA 5KE4A 3U8JA 5J5FA 2BJ0A 4COFA 2W8FA 4D01A 3RHWA 4HFCA 4A98A 5BP0A 4XHEA 2BG9B 3TLSA 2Y56A 5J0ZA 2XNUA 4ZZCA 4ZJSA 2Y57A 3U8MA 4ILCA 3ZDHA 4TNWA 2XQ8A 3GUAA 3WIPA 5AFHA 4ZR6A 2VL0A 5AFKA 3JAEA 2YOEA 3EI0A 3TLWA 4UM3P 3SIOA 5AFLA 2BR8A 5AFJA 2BYSA 2PH9A 2XYTA 3PEOA 2C9TA 2YKSA 2WNCA 2YMEA 5LG3A 4ILAA 5AFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQ7 A;  4AFH A;  2WNL A;  4TWH A;  3UUB A;  5KZU A;  2BG9 C;  2XZ5 A;  4NZB A;  4ZZB A;  2XYS A;  3UU5 A;  4TWD A;  4QAC A;  5J5I A;  4Z91 A;  2BG9 A;  5AIN A;  1UV6 A;  4UM3 S;  5BW2 A;  3U8K A;  5L4E A;  3JAF A;  4HFD A;  5L4H A;  4PIR A;  3WTH A;  4AFG A;  2KSR A;  2WZY A;  5LXB A;  4LML A;  4IL4 A;  2M6I A;  3UQ4 A;  2QC1 B;  3EHZ A;  5HEH A;  3WTN A;  3UU4 A;  4HFE A;  2YMD A;  2XQA A;  5AFM A;  1OED E;  5CFB A;  4IL9 A;  4HFI A;  3TLV A;  2BYR A;  3UU8 A;  3TLT A;  4ZRU A;  3WTJ A;  4X5T A;  1UX2 A;  3T4M A;  2XNV A;  2XZ6 A;  3U8N A;  4LMK A;  1I9B A;  4UXU A;  3WTO A;  4BFQ A;  4ZK1 A;  4HFH A;  3P50 A;  3WTK A;  4LMJ A;  2XNT A;  4QH4 A;  2X00 A;  2ZJV A;  4Z90 A;  2Y58 A;  3P4W A;  3C79 A;  4B5D A;  2BYP A;  4A97 A;  5J5G A;  4HQP A;  3RQU A;  3RI5 A;  5HEJ A;  5FJV A;  2X00 D;  5BRX A;  4IRE A;  5IUX A;  3ZDG A;  4F8H A;  2XQ6 A;  4QH1 A;  3UU3 A;  3SQ6 A;  4EZ1 A;  2WN9 A;  3SH1 A;  5HCJ A;  3UQ7 A;  4ZK4 A;  2W8G A;  2XQ4 A;  5TVC A;  4XK9 A;  4NPP A;  5SYO A;  2WNJ A;  2LM2 A;  5HEU A;  4UY2 A;  4QH5 A;  3RIF A;  4HFB A;  1OED B;  2XQ5 A;  3RQW A;  3WTL A;  2BR7 A;  2YN6 A;  2MAW A;  2ZJU A;  2BG9 E;  2LKH A;  5HEO A;  3ZKR A;  5L47 A;  5CO5 A;  5HEG A;  4ALX A;  4ZJT A;  5J5H A;  2XQ3 A;  2M6B A;  5HCM A;  3IGQ A;  4TWF A;  2Y54 A;  4FRR A;  3SQ9 A;  4DBM A;  5JME A;  3WTM A;  4AFT A;  3PMZ A;  3UU6 A;  2UZ6 A;  2PGZ A;  4BQT A;  4ILB A;  2XQ9 A;  3EAM A;  2BYQ A;  3C84 A;  3LSV A;  2LKG A;  3JAD A;  3WTI A;  4TNV A;  1OED C;  2Y7Y A;  4UM3 A;  1UW6 A;  3TLU A;  4UM1 A;  2LLY A;  5AFN A;  4QAA A;  4QAB A;  1OED A;  3RIA A;  4WV9 A;  2BYN A;  3U8L A;  5KE4 A;  3U8J A;  5J5F A;  2BJ0 A;  4COF A;  2W8F A;  4D01 A;  3RHW A;  4HFC A;  4A98 A;  5BP0 A;  4XHE A;  2BG9 B;  3TLS A;  2Y56 A;  5J0Z A;  2XNU A;  4ZZC A;  4ZJS A;  2Y57 A;  3U8M A;  4ILC A;  3ZDH A;  4TNW A;  2XQ8 A;  3GUA A;  3WIP A;  5AFH A;  4ZR6 A;  2VL0 A;  5AFK A;  3JAE A;  2YOE A;  3EI0 A;  3TLW A;  4UM3 P;  3SIO A;  5AFL A;  2BR8 A;  5AFJ A;  2BYS A;  2PH9 A;  2XYT A;  3PEO A;  2C9T A;  2YKS A;  2WNC A;  2YME A;  5LG3 A;  4ILA A;  5AFM B; 
#chains in the Genus database with same CATH topology
 3AEB A;  2W66 A;  2GK9 A;  5LG4 A;  2XQ7 A;  4AFH A;  1FMV A;  1XNR T;  1DU2 A;  2HPJ A;  4NZB A;  3AVS A;  3EAB A;  3RKO A;  4JI3 T;  1BR2 A;  5M4Y A;  3PJA J;  2KSR A;  3F2E A;  4ADZ A;  2QC1 B;  3MKD A;  4G63 A;  2CM0 A;  3S4U A;  2PJQ A;  3CQG B;  1N34 T;  3T4M A;  2CBI A;  4HFH A;  2K48 A;  5DAB A;  2A9U A;  4CN6 A;  1CHU A;  4WW0 A;  1YKH B;  3UFE A;  1MMD A;  4OYJ A;  2LHN A;  4YTM A;  4LFC T;  4CI3 B;  3PU3 A;  2LM2 A;  1CUN A;  4L5G A;  1I6Z A;  5FP3 A;  1E2A A;  3CWZ B;  3FZM B;  2CWO A;  2QYW A;  2BBJ A;  1IZN B;  4DND A;  2UUB T;  3ZCJ A;  3O9X A;  2SPC A;  3WAK A;  3PUY F;  4YY3 T;  2LSY A;  5LB7 B;  2E9X D;  2UU9 T;  3RIU C;  4P0B A;  2V7K A;  1WR6 A;  4EB6 E;  1R8I A;  3RIU A;  2CPT A;  4H9S E;  3NRY A;  2W2U A;  4GKJ T;  5KE4 A;  5DQV A;  3Q2M A;  4XHE A;  4DR6 T;  4DR7 T;  4TX5 A;  1H7C A;  3GUA A;  2WDR A;  2NW9 A;  4PAG A;  5ABF A;  3EI0 A;  3L39 A;  2BR8 A;  2LSK A;  4HTE A;  2BZB A;  2BYS A;  3OYZ A;  2KWI B;  2X51 A;  5CA0 E;  4JBW F;  5AQS B;  3FB2 A;  5FNV E;  4TWH A;  4O8S A;  4UVB B;  5ETW A;  4DMW A;  3LK4 2;  2ZM2 A;  1B7T A;  2IC9 A;  2WP9 A;  3HKD E;  3FBZ A;  2YIN A;  4IE4 A;  2BS2 A;  2WBL A;  2IDO B;  2A3D A;  3QNU A;  3WTN A;  4IDN A;  3CX7 B;  3UUN A;  3BQI A;  3U78 A;  3FZH B;  4TN7 B;  1BR4 A;  3VHL A;  3N9L A;  1MMA A;  3RKG A;  1SUM B;  1I9B A;  5JR9 C;  3P50 A;  3GN5 A;  3I0O A;  4Z90 A;  2YDR A;  3C79 A;  5JR9 A;  5FJV A;  5L3D B;  2E2A A;  3RF1 A;  2PFV A;  2PTF A;  3OYX A;  5JDG A;  1T7S A;  4DR5 T;  4MBQ A;  3AA7 B;  3WTL A;  4ZI3 D;  1UK5 A;  5LMN T;  3SOL A;  4ALX A;  5J5H A;  4FI5 A;  4DV2 T;  3SQ9 A;  5ABF B;  4ZI2 C;  3MJX A;  2JRK A;  4IDQ A;  2CEA A;  2NW8 A;  3I9Y A;  4HFV A;  5AFN A;  4G2A A;  2C5J A;  2W67 A;  4HE8 A;  1IBM T;  3RIA A;  4B6X A;  3RHW A;  5FXZ A;  2J62 A;  3TLS A;  5J0Z A;  5FXX A;  4HEA A;  4X20 E;  2BBH A;  2W4X A;  5AFL A;  4JI6 T;  3KIN B;  3CVR A;  4HWF A;  1UCU A;  1IBL T;  1NEN A;  3AE7 A;  4EV6 A;  2ES0 A;  3ZMU B;  3GN5 B;  3AE9 A;  3AEG A;  5JR9 B;  1WLX A;  4X1K E;  4O4H E;  3C50 A;  3LJC A;  1WYC A;  3KBU A;  2MTQ A;  3SFD A;  4M1P A;  4IL4 A;  4UVA B;  1WR0 A;  3AAI A;  4YTP A;  2H88 A;  2VKD A;  2X9W A;  4H9Q C;  2XNV A;  2XZ6 A;  5HWX A;  2IC6 A;  5LGU B;  4X1I E;  4QX7 B;  5J5G A;  4E7S A;  1HR0 T;  2VQE T;  2I59 A;  4IE7 A;  1UUR A;  1SA0 E;  2JMK A;  3VRA A;  3B57 A;  4XBF B;  3PJA A;  2Q9Q C;  4XK9 A;  2Q9Q A;  1KF6 A;  4CZZ B;  2CMR A;  3N9M A;  4UV9 B;  1JNR A;  1XDO A;  5LHH B;  4DVD A;  3AEA A;  4EZ4 A;  3C51 A;  4JUY A;  4ILU A;  3EAM A;  4AQF C;  1OED C;  2NOX A;  4CI2 B;  4KI0 F;  2V8S V;  1OED A;  5LMU T;  4KBM B;  4GOU A;  3R84 B;  4EXT A;  4ZS3 A;  4C90 A;  2VL0 A;  5H6Q B;  3EVY A;  2NTX A;  3CX8 B;  3OVU A;  2Y6X A;  3ZST A;  2E8I A;  2LSI A;  2VAS A;  2VKH A;  4ZZB A;  4BA9 A;  4CXW A;  4EZH A;  2KXP B;  5BW2 A;  2NWB A;  5L3G B;  4HFD A;  2VL8 A;  4AFG A;  4YSZ A;  3PU8 A;  2D9D A;  3NWI A;  2WMN A;  4ZS2 A;  4IL9 A;  2Q9Q B;  3ABV A;  3UU8 A;  1UX2 A;  3AEE A;  1XNQ T;  5JQG E;  3PUV F;  4GKK T;  2C0S A;  3WTK A;  1E7P A;  3RGL A;  4H9P C;  4B5D A;  5ABE A;  1MND A;  3U3I A;  3N9N A;  4O4I E;  1NAF A;  4ZK4 A;  2VVS A;  4NPP A;  2BVL A;  5HXS A;  2HN2 A;  3V5S A;  3P4S A;  1OED B;  4QXB B;  5JTG A;  3LBX A;  4WBN E;  4EAH A;  2BG9 E;  2LKH A;  4PJL A;  3AE5 A;  3HA4 A;  4FJO A;  4JI2 T;  4U7I A;  4H63 H;  4X64 T;  3F57 A;  3C84 A;  3AEC A;  5JDH A;  3N5L A;  4X66 T;  1L0V A;  5HXH A;  4QAB A;  4LF4 T;  4AXP A;  4P0A A;  4ZZC A;  3NZP A;  3OKQ A;  2XQ8 A;  1FMW A;  4DV6 T;  4EOZ B;  4OX9 T;  2WMO A;  3ZC0 A;  3UUL A;  2RP4 A;  2XUE A;  4JV5 T;  2YME A;  2IUB A;  4MFR A;  3HKB E;  4AQY T;  2DCF A;  3J7Y q;  5AQU B;  2XPK A;  3EDV A;  5FVL A;  5ABG A;  1UV6 A;  3AAA B;  4IDO A;  1OXZ A;  3C64 A;  1MNE A;  1I94 T;  1YXR A;  3HL6 A;  3J9X 1;  5BR8 T;  3LBX B;  1HG2 A;  1D1A A;  3JC6 C;  4IDP A;  4MLK A;  2J1D G;  3ZT7 A;  4U31 A;  5AQO B;  2IIU A;  4EZ1 A;  3LDQ B;  5HCJ A;  4HWD A;  4DV4 T;  2H7O A;  4HFB A;  1FJG T;  3IBP A;  5L47 A;  4B3S T;  2XM2 A;  2VKJ A;  4JI5 T;  2FUP A;  3LSV A;  3RYH E;  4YJ2 E;  4H9R C;  2N1G A;  3WTI A;  3T1Y T;  5FVK A;  4ASK A;  2HN1 A;  4LF9 T;  4ZOL E;  4A98 A;  3GA8 A;  2LT3 A;  1KNZ A;  3E22 E;  3HI2 A;  2BS4 A;  3O1J A;  3M65 A;  4KX6 A;  2UUA T;  1HS7 A;  3SIO A;  4NIQ A;  2PH9 A;  2C9T A;  5KXJ A;  3SRZ A;  2V5C A;  2V7L A;  4QAC A;  2BDE A;  1Y01 A;  4Z91 A;  5AQP B;  4UM3 S;  3PUR A;  3RX6 A;  3FZF B;  1AJ3 A;  4PK4 A;  1FIO A;  4TV9 E;  1MMG A;  1NWM X;  2DNX A;  2L8K A;  2A72 A;  4O4J E;  3ZYL A;  1IBK T;  3PUQ A;  3A8Y C;  2Y58 A;  4F6R C;  5L3F B;  4IE6 A;  4CN1 A;  2QRX A;  4XAX B;  2X00 D;  4WZX A;  4IRE A;  4H9O C;  5AQJ B;  1WCR A;  3L09 A;  5E0O A;  2WN9 A;  2BKO A;  3UQ7 A;  4GYS A;  2W8G A;  3A5X A;  3CQC B;  4O2B E;  1YD8 G;  3ZT6 A;  2E9X C;  4CI1 B;  5CGM A;  2E9X A;  4HWI B;  5AQV B;  1YW0 A;  4TWF A;  4X65 T;  2UZ6 A;  2X9H A;  4ILB A;  4PJM A;  2Y7Y A;  5LOV E;  5HXE A;  2LLY A;  2CXF A;  2IAK A;  2W63 A;  4UVC B;  4QXH B;  5J5F A;  3IHR A;  2C5K T;  2E5L T;  4HKA A;  3AE1 A;  5FL1 A;  2UXX B;  5AQM B;  2WY2 A;  3UUM A;  5DQW A;  2QGS A;  3TLW A;  5A1L A;  1N36 T;  1MIY A;  4U33 A;  2JQ9 A;  2W0G A;  3N2G E;  1U5P A;  1UUS A;  3OBV E;  3NKZ A;  1S94 A;  2ZM0 A;  2CCQ A;  3CKD A;  3PUA A;  3KV4 A;  3U8K A;  5LNK A;  3JAF A;  4EED A;  2ODU A;  1KFY A;  3UQ4 A;  2YMD A;  2XQA A;  2UXC T;  2WWU A;  3VR8 A;  5L3C B;  4A5X A;  1IAP A;  3U8N A;  2LOS A;  5LCY A;  2E9X B;  5L3E B;  2D0T A;  2CHO A;  3KVA A;  3RI5 A;  2V7I A;  4ZI3 C;  5F3J A;  4U2Y A;  1SHZ C;  2XQ5 A;  3ZYM A;  4LF5 T;  3ZKR A;  2HH7 A;  2LSG A;  2WS3 A;  5HAX A;  3QB5 A;  2EHO D;  4IIJ E;  5HCM A;  4FRR A;  3KV5 A;  3QB5 K;  4DBQ A;  3WTM A;  4AFT A;  4P1N A;  3CML A;  4L9I A;  5DJQ C;  4GIW A;  1MIW A;  4MAL A;  3I0Q A;  2VVN A;  3VKH A;  4DV0 T;  2CBJ A;  3K3N A;  2ZMA A;  2D5U A;  3RH3 A;  3KV6 A;  1EZ3 A;  3ONJ A;  4WBO A;  5BP0 A;  2UXD T;  5LHG B;  4KHZ F;  2XZE A;  5FKY A;  3MA9 A;  2K24 A;  2XSB A;  5LA6 E;  4XZC A;  4N78 D;  1G8X A;  2V6X A;  1UX4 A;  4E7Z A;  4NUV A;  3L3P A;  2VK9 A;  3H3M A;  2XAS B;  1HFA A;  2FBW A;  4PFO A;  4IE5 A;  3NVO A;  3PTR B;  2W62 A;  2WU5 A;  3X1D A;  1T72 A;  4BAY B;  5LHI B;  4AKH A;  4LML A;  3P4P A;  4I50 E;  3FZK B;  1Z8U A;  1OED E;  5CFB A;  2VQF T;  4HFI A;  3TLT A;  4LMK A;  5HXC A;  4HWH A;  5LGT B;  1FEW A;  4DV5 T;  2XNT A;  1NEK A;  1KNP A;  2BYP A;  4CXY A;  5HEJ A;  3K8P C;  5AQL B;  4ZEY A;  2K9A A;  3KV9 A;  4EIW A;  5TVC A;  1XWM A;  3RRW A;  3ZN0 B;  4QH5 A;  2DLR A;  4IE0 A;  4DUZ T;  3ZC1 A;  2YN6 A;  3Q5D A;  1HTJ F;  1ZHC A;  3QC9 A;  3RC8 A;  2K3W A;  3IGQ A;  1Z0P A;  5JME A;  3DJB A;  5AQQ B;  3WI3 A;  4BQT A;  4YTN A;  1U4Q A;  2H89 A;  4LF6 T;  1GQE A;  2HPL A;  3U8M A;  3H3A A;  4ZR6 A;  5KMG P;  5BMV E;  2BS3 A;  3ZN1 B;  4JYA T;  1J5E T;  3PE0 A;  4AQF A;  2B1E A;  5KZU A;  5FL0 A;  1W09 A;  1YKE B;  3KVB A;  2XTL A;  3K3Q C;  5AQI B;  2X0Y A;  1HX8 A;  1E1H B;  2YU2 A;  4EYU A;  4AIU A;  4UXU A;  4AQG A;  4HGA A;  2Q9Q D;  2Y48 B;  2JJ9 A;  1T98 A;  3P7I A;  3OTO T;  5IUX A;  2K5B B;  4F8H A;  5EZY E;  1D1C A;  1J5W A;  4AKL A;  2J4G A;  2V5D A;  5AQH B;  2RPA A;  2LSJ A;  3QK6 A;  5JDF A;  4QHO A;  3AVR A;  3P4R A;  4EGW A;  1LVK A;  4IDZ A;  2M6B A;  1HNX T;  3PUX F;  5AQK B;  3UU6 A;  2N9D A;  2XQ9 A;  2X0L B;  3AA1 B;  3AAE B;  4TNV A;  4BJN A;  4UM3 A;  4DR1 T;  5F8P A;  4WV9 A;  2H3R A;  3SS1 A;  2I6H A;  3E0Z A;  2BJ0 A;  3GMI A;  5AQF B;  3SFE A;  3D0T A;  4QKN A;  4LFB T;  1UX5 A;  5AFK A;  3P4Q A;  3EDU A;  2X66 A;  5LG3 A;  5GON E;  3FBL A;  4Z8X A;  5J2U E;  3ZPO A;  1X9B A;  2B76 A;  2CLY C;  1X79 A;  3RLF F;  5LXB A;  2JQK A;  5HEH A;  3B13 A;  3UU4 A;  3ZCI A;  2BYR A;  3PV0 F;  3WTJ A;  4ZK1 A;  3DTO A;  1LKX A;  1W0B A;  1HF8 A;  3N2O A;  5BRX A;  3O1H A;  4DR2 T;  2W00 A;  2XQ6 A;  2NP9 A;  3SQ6 A;  3ZT5 A;  5JH7 E;  5FXV A;  3VRB A;  4YT0 A;  2WNJ A;  5JRE A;  4A56 A;  4PW8 A;  1WRD A;  3RIF A;  2WU2 A;  5L3B B;  4LF8 T;  5LXT E;  2WCA A;  4PK5 A;  4YXD A;  4U3C A;  2BKP A;  1KK7 A;  4CXX A;  1BR1 A;  1LVF A;  1O3X A;  2WZI A;  3LG7 A;  3W15 B;  4DR4 T;  4DV3 T;  4U74 A;  3KDS E;  5FYM A;  2D2S A;  4WYV A;  4UEL A;  4IST A;  3ETV A;  2CLY B;  4UM3 P;  2HHH T;  3CPZ A;  3KBT A;  4YHH T;  5AFU L;  4PK6 A;  5LYJ E;  2XZ5 A;  3G06 A;  2ACX A;  2OLT A;  4DV1 T;  1XZY A;  5AIN A;  3UTK A;  3ZLI A;  3AE6 A;  3T8O A;  3NBX X;  4AKG A;  3JC6 D;  4YJ3 E;  4AIS A;  4GYR A;  3AE2 A;  2M6I A;  4KMC A;  2UUC T;  4HFE A;  5ABH A;  5LGN B;  5AFM A;  4P09 A;  3ZMS B;  4O2A E;  4DO0 A;  4ZRU A;  3N2K E;  2H7V C;  2MPK A;  3WTO A;  3MZK B;  2BKN A;  1J1J A;  4LMJ A;  4QH4 A;  2X00 A;  3Q5X A;  2CXL A;  2PG8 A;  4HQP A;  4KP3 C;  4QH1 A;  2WZH A;  2WWV A;  5LP6 E;  4MHC A;  3K1S A;  4JLE A;  5HEO A;  2QA7 A;  3AA0 B;  4DBR A;  3MK7 C;  2Y54 A;  3H37 A;  2CA5 A;  4X1Y E;  2JMH A;  5C2T A;  3AXJ A;  4Q25 A;  1ZV4 X;  3TLU A;  3PUG A;  1KEY A;  5EK2 A;  2XAG B;  4X62 T;  2XAQ B;  4D01 A;  1S35 A;  3ONL C;  2JIW A;  3LK2 B;  2ODV A;  2E5V A;  2LRK A;  4QX8 B;  4ILC A;  4QWN B;  2QVA A;  3A7M A;  2WAU A;  5JDM A;  2WSS V;  2KIN B;  2YKS A;  3F31 A;  4ILA A;  5AFM B;  2RA1 A;  2WQY A;  3DP7 A;  2X9Y A;  2KND A;  2WNL A;  2XM1 A;  3IF8 B;  3MAC A;  3OPC A;  5J2T E;  4GK5 E;  2XYS A;  3N9O A;  1D0X A;  5JDQ A;  1KNR A;  4IT4 A;  3P8C D;  3HR0 A;  2IHR 1;  5L4H A;  2KLQ A;  3C4W A;  4JEU B;  3QUJ A;  1IJ6 A;  4H63 V;  1SE7 A;  5LBM A;  4I4T E;  3VU7 H;  3WAJ A;  5HYA A;  4I55 E;  1WYB A;  3EUH A;  4HN9 A;  4JI1 T;  4OYK A;  2UXN B;  3UU3 A;  5CB4 E;  2FJD A;  3AXJ B;  3SH1 A;  2XQ4 A;  3ONX A;  1HNW T;  2OV9 A;  2LEH A;  2EHO C;  3K3O A;  2YU1 A;  3MXZ A;  2EHO A;  2ZJU A;  2V7M A;  1IJ5 A;  2CRB A;  5AQR B;  3ZMT B;  5KDM C;  4AI6 A;  3PMZ A;  3C98 B;  1D0Y A;  2ZM6 T;  4QAA A;  4NXN T;  3U8J A;  1HNZ T;  3O4X E;  4YSX A;  2W8F A;  4HFC A;  4GK0 E;  2DWG A;  5L2L A;  4JI4 T;  5FY1 A;  3ETU A;  3O1I A;  2CE7 A;  5AFJ A;  5JRC A;  4OFZ A;  1QLB A;  2V26 A;  4ZI7 E;  1M7K A;  3UUX B;  5TAO A;  4UF0 A;  2CXD A;  3HKE E;  2J47 A;  2JQH A;  2N2N A;  4U72 A;  5EK4 A;  3ZMV B;  3PUS A;  1ZOY A;  2AXD S;  3AB3 B;  5L4E A;  1HG5 A;  1M62 A;  2IW5 B;  4ANJ A;  1ZEE A;  2XJ7 A;  4L0R A;  4X5T A;  2EHO B;  2DI4 A;  1D0Z A;  3GWH A;  4OK0 A;  5J1G A;  2ZJV A;  3ZEF B;  5CA1 E;  1HCI A;  4DID B;  5JDN A;  4EYY R;  3RYF E;  5SYO A;  4JI8 T;  3R6N A;  3RQW A;  2WDV A;  4QXC B;  4K0K T;  5CO5 A;  5KX5 E;  4K0U A;  5LBQ B;  4DUY T;  5JRC B;  2FJA A;  2LKG A;  4TUY E;  4UF0 B;  1N32 T;  3N9Q A;  4ZI2 D;  1YQ3 A;  2FJB A;  2XAJ B;  3UT5 E;  2Z6E A;  4ERR A;  3BQL A;  2LRL A;  1QUU A;  3C4X A;  5FXW A;  4IHJ E;  3ANW A;  2C5I T;  2YOE A;  5EK3 A;  4DV7 T;  5HXR A;  1WFD A;  2XAF B;  2XYT A;  2DL1 A;  3PEO A;  1MIV A;  3CX6 B;  2VKO A;  2G0U A;  1OWA A;  2XAH B;  3FXE B;  4TZ4 C;  3RYI E;  4PJJ A;  3VR9 A;  4PNI A;  1ZKE A;  2MYS A;  3WTH A;  4HWC A;  2WZY A;  3C4Z A;  4TV8 E;  4I43 B;  3CIR A;  1US7 B;  5ADX L;  2LE8 A;  3KFW X;  4BFQ A;  2BVM A;  4DMV A;  5F5W A;  5IWA T;  3PUW F;  4I0U A;  3ZJ2 A;  1D1B A;  3RQU A;  2R6G F;  3NRX A;  1ZP0 A;  2X68 A;  3AE3 A;  3ZDG A;  4UV8 B;  4EEB A;  2A2F X;  3IA3 A;  4B3R T;  4YLH A;  3N9P A;  4ISS A;  3AE4 A;  5C8Y E;  5HEU A;  4LFA T;  2AE9 A;  2WB5 A;  3Q5E A;  2WM9 A;  3ANW B;  5AQT B;  2XQ3 A;  1V9D A;  2X67 A;  2KT9 A;  3CK6 A;  2PGZ A;  4OHF A;  2D0U A;  2BYQ A;  4JEH B;  1UW6 A;  2WDQ A;  2KMF A;  3Q9D A;  1VRB A;  2F4V T;  3VKG A;  2VUR A;  4COF A;  2NTY A;  3RRC A;  2Y56 A;  4PJN A;  4B3M T;  2XNU A;  4ZJS A;  3I1A A;  3ZDH A;  4DR3 T;  3M3Z B;  3WIP A;  1YQ4 A;  3I9W A;  4U7Y A;  5IYZ E;  5JVD E;  2XHE B;  2VB6 A;  3ZYK A;  3FXD B;  3CQX C;  2JPF A;  3NZQ A;  2PBI A;  4TWD A;  3RC3 A;  3IEE A;  4C91 A;  4CQI A;  5FMN A;  1HX1 B;  2LOP A;  2KWH A;  2UXB T;  2L3L A;  2YDQ A;  3AA6 B;  3AE8 A;  4LF7 T;  3EHZ A;  3HKC E;  4B3T T;  1UGO A;  2YK0 A;  3PDY A;  2V1D B;  2P9B A;  3TLV A;  2YEV C;  2NR4 A;  2DHR A;  4UXN B;  4IGU A;  2OA5 A;  5IHY A;  1W9R A;  4A97 A;  3LFM A;  3OJA A;  2M67 A;  3FHN A;  5CJ5 A;  3ZSS A;  4UY2 A;  4U2Z A;  5AQN B;  2V6Y A;  5FY0 A;  2BR7 A;  4NXM T;  3Q5W A;  5H6R B;  2X9X A;  4KHP T;  4O4L E;  3RYC E;  2VWA A;  2CWY A;  5HWY A;  3JCF A;  1XMQ T;  2ZLY A;  2LHR A;  4YFS A;  4UR9 A;  2KZ7 B;  2ACZ A;  2BYN A;  2LJL A;  4V1A v;  1BR0 A;  2IML A;  5C3J A;  1Y64 B;  5AFH A;  2W61 A;  3JAE A;  4ZXL A;  3T1H T;  2CHN A;  3ZMZ B;  1N33 T;  4JI7 T;  3TKL B;  3UUB A;  4KUM B;  2BG9 C;  4UIG A;  4PFP A;  4BJM A;  4CN4 A;  2XY8 B;  1XMO T;  3ESL A;  5J5I A;  3UU5 A;  1XDP A;  2BG9 A;  2XQY A;  4PIR A;  2NW7 A;  5AQG B;  1VOM A;  4JI0 T;  2V6Y B;  4ZHQ E;  4AKR B;  5LJM A;  3QOF A;  3BQK A;  1LRZ A;  3LK3 B;  4YSY A;  3P4W A;  4J2C A;  2FJE A;  2XSA A;  5FY7 A;  3RPU A;  2JQQ A;  4H9N C;  2Y8D A;  3FZL B;  3V5U A;  3UFG A;  4NUU A;  5JDL A;  4AKI A;  3ZJ1 A;  2ZM8 A;  3E08 A;  1W0A A;  2L9Q A;  2V7J A;  2MAW A;  5HEG A;  1MMN A;  4ZJT A;  2LM9 A;  2MBG A;  4UEM A;  3AED A;  1G73 A;  4DBM A;  3AEF A;  1QSD A;  2MOZ A;  4WNK A;  1VCS A;  3JAD A;  4UM1 A;  2DWK A;  3U8L A;  2X0H A;  1T8B A;  3BK9 A;  2YDS A;  2BG9 B;  3L8R A;  4YHJ A;  2Y57 A;  1VCT A;  5LJN A;  4TNW A;  2I0M A;  1JNZ A;  3SWH A;  2WNC A;  3PUZ F;  3B5M A; 
#chains in the Genus database with same CATH homology
 2XQ7 A;  4AFH A;  2WNL A;  4TWH A;  3UUB A;  5KZU A;  2BG9 C;  2XZ5 A;  4NZB A;  4ZZB A;  2XYS A;  3UU5 A;  4TWD A;  4QAC A;  5J5I A;  4Z91 A;  2BG9 A;  5AIN A;  1UV6 A;  4UM3 S;  5BW2 A;  3U8K A;  5L4E A;  3JAF A;  4HFD A;  5L4H A;  4PIR A;  3WTH A;  4AFG A;  2KSR A;  2WZY A;  5LXB A;  4LML A;  4IL4 A;  2M6I A;  3UQ4 A;  2QC1 B;  3EHZ A;  5HEH A;  3WTN A;  3UU4 A;  4HFE A;  2YMD A;  2XQA A;  5AFM A;  1OED E;  5CFB A;  4IL9 A;  4HFI A;  3TLV A;  2BYR A;  3UU8 A;  3TLT A;  4ZRU A;  3WTJ A;  4X5T A;  1UX2 A;  3T4M A;  2XNV A;  2XZ6 A;  3U8N A;  4LMK A;  1I9B A;  4UXU A;  3WTO A;  4BFQ A;  4ZK1 A;  4HFH A;  3P50 A;  3WTK A;  4LMJ A;  2XNT A;  4QH4 A;  2X00 A;  2ZJV A;  4Z90 A;  2Y58 A;  3P4W A;  3C79 A;  4B5D A;  2BYP A;  4A97 A;  5J5G A;  4HQP A;  3RQU A;  3RI5 A;  5HEJ A;  5FJV A;  2X00 D;  5BRX A;  4IRE A;  5IUX A;  3ZDG A;  4F8H A;  2XQ6 A;  4QH1 A;  3UU3 A;  3SQ6 A;  4EZ1 A;  2WN9 A;  3SH1 A;  5HCJ A;  3UQ7 A;  4ZK4 A;  2W8G A;  2XQ4 A;  5TVC A;  4XK9 A;  4NPP A;  5SYO A;  2WNJ A;  2LM2 A;  5HEU A;  4UY2 A;  4QH5 A;  3RIF A;  4HFB A;  1OED B;  2XQ5 A;  3RQW A;  3WTL A;  2BR7 A;  2YN6 A;  2MAW A;  2ZJU A;  2BG9 E;  2LKH A;  5HEO A;  3ZKR A;  5L47 A;  5CO5 A;  5HEG A;  4ALX A;  4ZJT A;  5J5H A;  2XQ3 A;  2M6B A;  5HCM A;  3IGQ A;  4TWF A;  2Y54 A;  4FRR A;  3SQ9 A;  4DBM A;  5JME A;  3WTM A;  4AFT A;  3PMZ A;  3UU6 A;  2UZ6 A;  2PGZ A;  4BQT A;  4ILB A;  2XQ9 A;  3EAM A;  2BYQ A;  3C84 A;  3LSV A;  2LKG A;  3JAD A;  3WTI A;  4TNV A;  1OED C;  2Y7Y A;  4UM3 A;  1UW6 A;  3TLU A;  4UM1 A;  2LLY A;  5AFN A;  4QAA A;  4QAB A;  1OED A;  3RIA A;  4WV9 A;  2BYN A;  3U8L A;  5KE4 A;  3U8J A;  5J5F A;  2BJ0 A;  4COF A;  2W8F A;  4D01 A;  3RHW A;  4HFC A;  4A98 A;  5BP0 A;  4XHE A;  2BG9 B;  3TLS A;  2Y56 A;  5J0Z A;  2XNU A;  4ZZC A;  4ZJS A;  2Y57 A;  3U8M A;  4ILC A;  3ZDH A;  4TNW A;  2XQ8 A;  3GUA A;  3WIP A;  5AFH A;  4ZR6 A;  2VL0 A;  5AFK A;  3JAE A;  2YOE A;  3EI0 A;  3TLW A;  4UM3 P;  3SIO A;  5AFL A;  2BR8 A;  5AFJ A;  2BYS A;  2PH9 A;  2XYT A;  3PEO A;  2C9T A;  2YKS A;  2WNC A;  2YME A;  5LG3 A;  4ILA A;  5AFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...