3UU3A

The glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
311
structure length
305
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 83
structure length 305
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu3A01
3SIOA 4BQTA 1UV6A 2BYRA 3UUBA 3WTIA 1UW6A 5BW2A 4QH4A 5AFLA 2M6IA 4XK9A 3U8KA 4ZK1A 4LMJA 4QABA 5AFMB 5LXBA 2WNLA 2XQ6A 1OEDE 5AINA 4ZZBA 5HEJA 2BR7A 2BYNA 4ILAA 5L4HA 3U8NA 4ZK4A 3TLSA 2XZ5A 3RHWA 5TVCA 4ZZCA 3UU3A 1OEDC 2W8FA 2XQ8A 2BYQA 2BG9E 4TNWA 5SYOA 3EI0A 4DBMA 5BRXA 4HFDA 2YMEA 4TWHA 2Y7YA 5KZUA 2KSRA 4HQPA 3WTNA 5AFMA 4LMKA 5AFNA 4AFHA 5HEUA 4IREA 3WTOA 2BJ0A 3SH1A 2BG9C 4QACA 4UM3S 2LKHA 5FJVA 3UU6A 3WTJA 2Y56A 3RIAA 4LMLA 4QH1A 2PGZA 3SQ9A 3WTLA 5KE4A 4HFIA 2VL0A 4XHEA 4COFA 5J5GA 3WTMA 2YKSA 5HEGA 5HCJA 4WV9A 5CO5A 4PIRA 2MAWA 3UU4A 2WNCA 4B5DA 2C9TA 2XYTA 4NPPA 4TNVA 3UQ4A 2XZ6A 3WTHA 2YN6A 2X00D 4QAAA 4HFHA 4QH5A 4ZRUA 2X00A 4UY2A 5J0ZA 5L47A 3PEOA 2Y58A 5J5FA 5AFJA 2BYSA 3EHZA 3TLTA 3UU5A 2LM2A 2XQ9A 3JAFA 4UM1A 4HFCA 2XNTA 2QC1B 3JAEA 2ZJUA 4NZBA 5JMEA 4F8HA 3TLUA 5AFKA 4IL9A 2PH9A 4ZR6A 4UM3P 2LLYA 4X5TA 5J5HA 1UX2A 3ZDHA 4ZJSA 4ILCA 2XQAA 3RQUA 3U8MA 3RIFA 4FRRA 4HFEA 5HEHA 3C84A 3U8JA 4EZ1A 2LKGA 3P4WA 3RI5A 2Y57A 5IUXA 4AFTA 3P50A 5HEOA 3PMZA 4AFGA 2YMDA 3RQWA 4ZJTA 4A97A 1OEDA 5J5IA 5L4EA 4ILBA 5BP0A 2BYPA 2WNJA 2XNVA 4D01A 3IGQA 3LSVA 3C79A 4Z90A 2WN9A 4TWFA 2ZJVA 4UXUA 3WTKA 4BFQA 3UU8A 4ALXA 4A98A 1OEDB 3EAMA 4Z91A 3TLVA 3ZDGA 1I9BA 2UZ6A 2XQ7A 5CFBA 3GUAA 2BG9A 3UQ7A 2BR8A 3T4MA 2W8GA 4TWDA 2XNUA 3TLWA 3ZKRA 2Y54A 2WZYA 2XQ3A 4HFBA 5LG3A 2XQ5A 4IL4A 3U8LA 2XQ4A 2BG9B 3JADA 5AFHA 3SQ6A 5HCMA 2XYSA 4UM3A 2M6BA 2YOEA 3WIPA
chains in the Genus database with same CATH superfamily
3V5UA 3W15B 4JI2T 1W09A 3PDYA 4OYKA 2CRBA 3S4UA 4UV9B 2NW8A 3RYHE 4DBQA 2UUBT 4QXBB 4CN4A 5AFMB 5CA1E 2PBIA 4IDNA 3RC3A 1OEDC 3Q9DA 3QOFA 3B13A 2X9HA 4HTEA 4JI8T 5KZUA 4B3RT 2V7IA 2N2NA 5JRCA 3WTOA 3ZYKA 1FMVA 5L3DB 3WTJA 4TV8E 1MIWA 4G2AA 4U2ZA 4UXNB 4IE4A 4CZZB 3F57A 2MAWA 2WNCA 2XYTA 2YN6A 3NKZA 4GOUA 2DL1A 4UY2A 1CUNA 2WU5A 5LJNA 2VKDA 4DBRA 2JQ9A 5DJQC 1AJ3A 1YW0A 3ZC0A 1D0XA 4QXHB 4IHJE 3U8MA 2X68A 2W61A 5AQLB 4L0RA 3HKDE 3PUVF 2YMDA 4XZCA 4H63V 2BYPA 5LCYA 5JR9C 3ZDGA 2UZ6A 3MA9A 2F4VT 3WI3A 2JMHA 5KXJA 5HCMA 2BVLA 3WTIA 3ETVA 4EXTA 1WYCA 3KVAA 1KEYA 3PV0F 5ETWA 2XQ6A 3UUNA 2LSIA 4JUYA 2J1DG 2DWKA 4TUYE 2W8FA 5DABA 4PJNA 3TKLB 2KWHA 1I6ZA 5LHIB 4HWIB 2BJ0A 2C5KT 1GQEA 5FXXA 3ESLA 1QSDA 3RIAA 1DU2A 2WS3A 2YK0A 3WTMA 4CQIA 4DV5T 4JEHB 3ANWB 3BQKA 4AQFA 3AECA 3RYFE 4OYJA 2QA7A 2Q9QD 2G0UA 3MJXA 4OHFA 5EK2A 2LM2A 4AQYT 4QHOA 2NR4A 2W2UA 2ACZA 5CJ5A 3AXJA 3C51A 4ASKA 3CQGB 5FKYA 3NBXX 3DP7A 3RIFA 3RKGA 4PK6A 4HFVA 4MBQA 1ZP0A 3P50A 5HEOA 3KINB 1EZ3A 4ZJTA 2CLYB 4ADZA 4D01A 4PW8A 1D1BA 1HCIA 2CE7A 4TWFA 1HG2A 4GYSA 4YTNA 4P0AA 3T4MA 3FBLA 4TWDA 2CBIA 3IHRA 3PE0A 1ZOYA 4ZEYA 3N5LA 2JRKA 4U72A 5LBMA 3LK3B 3OJAA 1NEKA 4LF8T 2WZIA 3WIPA 2WY2A 5AQIB 1BR2A 3ETUA 3RIUA 3GWHA 4LMJA 2H88A 2WNLA 3P7IA 4O4HE 3FXDB 2CMRA 4YSZA 5FVLA 1ZKEA 2P9BA 3AA0B 3N9OA 4YSXA 3CWZB 4DUYT 5AFMA 4ZI3D 4H9NC 5JREA 4KHPT 2ZM2A 2LE8A 2BBHA 2W67A 3I9WA 4B5DA 2I0MA 3UQ4A 3O4XE 4ISTA 3AAEB 3E08A 3ZCIA 2Y58A 2UXNB 1XMOT 3TLTA 3AEBA 2WMOA 3BQLA 3ZYMA 2XUEA 5JMEA 2CHOA 2CM0A 3N9QA 3DJBA 2LKGA 4U31A 4JI4T 5LMNT 5IUXA 4X66T 2HN1A 1QLBA 4KHZF 3PU8A 2XAHB 4ALXA 3HI2A 2W63A 1IBKT 5LGUB 5FXZA 4IDPA 2XM2A 2A3DA 1D0YA 5ABFA 2V7JA 4UVBB 2XQ4A 2Q9QC 3SFEA 3UFGA 4AKRB 3OPCA 1W0BA 5AFLA 2M6IA 4H9SE 2V26A 3UFEA 2A9UA 2LSGA 2B76A 3K1SA 4DNDA 3AE4A 5LXTE 2X0LB 4DV6T 1JNZA 2JPFA 1JNRA 1HX1B 3M3ZB 1XNQT 4IDOA 4P1NA 4LF4T 3K3OA 3RC8A 3R6NA 2IAKA 4UF0B 1XZYA 5J5GA 3J7Yq 4WV9A 2YU1A 1FIOA 3ZCJA 4EEDA 3WTHA 4TNVA 2K9AA 1M62A 2X00D 3RYIE 4YTPA 1T72A 4O2BE 2E5LT 2NWBA 2Z6EA 5HXSA 2LJLA 5JH7E 3RQUA 2OV9A 4EV6A 3C98B 4AIUA 2LSKA 4YY3T 4AFGA 2VASA 1E7PA 1UK5A 4HGAA 4OFZA 4JI3T 3SS1A 3RRWA 3N9MA 2PTFA 4JI6T 4Q25A 1D1AA 4PK5A 2C5IT 3AE2A 5IYZE 3LK42 2FUPA 5LG3A 3OTOT 4IL4A 3OYXA 3KV9A 1XNRT 4UV8B 1V9DA 2YDQA 2LHRA 4WBOA 5BR8T 4I4TE 1BR4A 4JI5T 1IBLT 4K0KT 1R8IA 2VKJA 4GYRA 5ABEA 4X64T 5LP6E 4X20E 4GKJT 2ODUA 3MACA 4C90A 3E0ZA 4HFDA 1X79A 2Y7YA 3P4PA 3B5MA 5AFNA 3I1AA 4F6RC 3PJAJ 3I0QA 4NXMT 3PTRB 3VKGA 4IE7A 4PNIA 3UU4A 2XZ6A 5J0ZA 4NUVA 1VCTA 3P8CD 3NZPA 1WR0A 4YT0A 4J2CA 2XPKA 3KBUA 3UUMA 4H9QC 4UM1A 5C3JA 4Z8XA 4BJNA 4PJLA 2V6YA 2DI4A 3QK6A 3RF1A 2UXDT 5J5HA 2UXXB 2HPJA 2W4XA 2XQAA 3IF8B 3FHNA 3FZHB 3LG7A 4JI1T 3KFWX 2DWGA 3RQWA 5LA6E 1ZEEA 5J2TE 1UX5A 5HAXA 4AKLA 2LOSA 5AQPB 1I94T 3UU8A 5HXEA 5JDFA 2WDQA 1HNZT 3VHLA 3GUAA 4KP3C 4WZXA 1XDPA 2CWOA 3U8LA 4CI3B 2KT9A 4O2AE 1B7TA 3ZJ1A 3AVRA 2DLRA 2LT3A 4LFAT 3ZEFB 3SWHA 4GK0E 3OVUA 4QWNB 2WDVA 2XSBA 2LOPA 2SPCA 2XAFB 2ZLYA 2CLYC 4H9OC 4WNKA 2ODVA 5FXWA 3H37A 1M7KA 1LVKA 3K3NA 4CN6A 3L8RA 1LKXA 3VR9A 4LF5T 4HQPA 3EABA 3SH1A 4ZXLA 2QYWA 2KMFA 2X66A 2ZM0A 2KWIB 2LKHA 3RRCA 2VVNA 4CN1A 4EZHA 5AQGB 5FMNA 3ONLC 1YXRA 3ZT7A 3GA8A 5LGNB 3PJAA 1YD8G 5L47A 2ES0A 2IC6A 3AEEA 5AFJA 4L5GA 4UF0A 2I59A 3NVOA 2C5JA 4U3CA 3CKDA 3MKDA 4F8HA 1WCRA 1MMNA 4JBWF 5LGTB 5AQNB 3ZMVB 2E8IA 2WQYA 2LSJA 3P4WA 5BMVE 3CQXC 4A97A 5LNKA 4U7YA 2VQET 4Z90A 3WTKA 4A98A 3EDVA 3AE8A 2WAUA 1WLXA 3A5XA 2BKNA 4AKIA 5JDHA 3B57A 3P4RA 4DR6T 2IMLA 2IHR1 3A8YC 4TN7B 3U78A 5KMGP 3SQ6A 4ZR6A 3CVRA 3RGLA 4X1KE 2BYRA 3UUBA 5ABFB 2ZM8A 3GMIA 3AE9A 2D0UA 2W66A 2WWUA 3IEEA 5HEJA 3ZN1B 3LK2B 4C91A 4NUUA 3A7MA 3PU3A 3BQIA 4JI0T 3VKHA 4EGWA 5BRXA 3JC6D 1WRDA 2VKOA 5FYMA 4YLHA 2VURA 4KBMB 5AFUL 3AEFA 3C64A 4DV2T 3AEDA 4L9IA 1IJ6A 1MMGA 2HHHT 3OBVE 5HEGA 4YJ3E 4E7SA 5JDLA 3NRXA 2K24A 3ZN0B 4G63A 2XJ7A 4FI5A 1YQ4A 2FJBA 4N78D 2X0HA 2Y48B 4YSYA 3N2OA 5DQVA 2XNTA 2I6HA 4A5XA 5AFKA 3R84B 4DVDA 2PJQA 4X5TA 4PAGA 3C4WA 3P4SA 1ZV4X 1WYBA 3FXEB 4IDZA 3AE5A 3G06A 2Y57A 5LB7B 5L4EA 3CIRA 3M65A 2KXPB 3O1HA 2WM9A 3EAMA 4YFSA 4K0UA 2M67A 5CFBA 2BG9A 2BR8A 4IGUA 2N9DA 2WZYA 1MIYA 4NIQA 2XYSA 3EDUA 4LFCT 2NTYA 2X9XA 2QGSA 4EAHA 3NWIA 4GIWA 4EIWA 3U8KA 4O4LE 5AQMB 2E9XA 3TLSA 4KX6A 4PK4A 1T7SA 3PUAA 3X1DA 5TVCA 2V7LA 3DTOA 4ISSA 5EK3A 2BG9E 4B3MT 3IA3A 3KBTA 2V7MA 2XQYA 2K3WA 2K5BB 2KSRA 4LMKA 3AE1A 3UU6A 2WSSV 5FJVA 5HXRA 4DV4T 2W0GA 4HFIA 4COFA 4EEBA 3LBXA 5CO5A 4I55E 3O9XA 2EHOA 3KDSE 2NW7A 5HWYA 2WP9A 2JJ9A 2VL8A 1G8XA 2YINA 3QB5K 2BBJA 3CQCB 3VR8A 2XSAA 3NRYA 3FZMB 3Q5DA 1HG5A 2V6YB 2WZHA 2V5CA 3JC6C 4AI6A 4EZ1A 2BDEA 5L3BB 1MMAA 4A56A 3AA7B 4EZ4A 3PUYF 2XZEA 3F31A 4DUZT 3SOLA 2WN9A 4UXUA 1Y01A 5FNVE 2HPLA 4H63H 2A2FX 4AQFC 1E1HB 5EK4A 3ZMTB 4NXNT 2CA5A 2A72A 2WCAA 3I9YA 5LYJE 3T1HT 2NTXA 4UM3A 2HH7A 2UUCT 5J2UE 2LEHA 2MPKA 1G73A 2VWAA 5BW2A 4X1IE 2V1DB 4HE8A 1U5PA 4QKNA 5JDGA 2WU2A 5JVDE 4ZZCA 5FP3A 4B6XA 2FJEA 5AQFB 4DV3T 2BYQA 4DBMA 2V7KA 3EI0A 5JDQA 2BS4A 2GK9A 4IIJE 5CGMA 2AXDS 3SQ9A 2OLTA 4XHEA 4BAYB 5IWAT 4AQGA 4DR4T 4IE0A 4GKKT 3C4ZA 3PURA 2BKPA 3LJCA 3RYCE 2KZ7B 3QB5A 2CXDA 3RIUC 2BKOA 2Y8DA 2VK9A 4BJMA 1T8BA 3UT5E 4E7ZA 3MZKB 1J1JA 1BR0A 4ZJSA 3FBZA 5TAOA 1UUSA 3CMLA 2XM1A 3N2KE 3L09A 5LBQB 3RKOA 4DMVA 3T8OA 3C84A 4CXXA 2W62A 5J1GA 4ILUA 3VRBA 2VVSA 1YKEB 2UU9T 2JIWA 3FZFB 4OK0A 2YDRA 3HKBE 3Q5XA 2RPAA 4AXPA 2XASB 2JMKA 1N33T 3JADA 4PJJA 4JI7T 4ZI3C 3KV4A 3BK9A 3HA4A 5AQHB 4LF9T 4LF7T 4I0UA 2XQ8A 3H3MA 2J62A 5FVKA 4O4IE 2BVMA 4B3ST 4QACA 2H7OA 2LRKA 2VB6A 4TZ4C 2VQFT 5AQVB 3KV5A 4XBFB 2CBJA 2RA1A 4ZRUA 5JTGA 2L3LA 2NP9A 4ZHQE 5L2LA 3ZT5A 3FB2A 3JAFA 5HWXA 2VKHA 4KMCA 2LLYA 2X9WA 2YDSA 2WWVA 4HFEA 5H6RB 4I50E 1MNDA 1OEDA 2NOXA 1Y64B 2XQ7A 1IJ5A 1UX4A 2KNDA 2E2AA 2W8GA 4EOZB 3VRAA 1XWMA 4TX5A 5GONE 2BG9B 3MK7C 2JQQA 1XMQT 2YOEA 2H89A 5FY7A 4DMWA 5HYAA 5JDMA 1SA0E 2H7VC 3T1YT 2XAQB 1OEDE 2HN2A 3QC9A 5FY0A 2BR7A 5AINA 5L4HA 2X51A 2L8KA 3PUQA 3RHWA 1XDOA 2L9QA 4H9PC 5KDMC 1YKHB 3J9X1 4GK5E 2E9XB 3QNUA 4QX7B 2YMEA 4DR7T 5LMUT 4P0BA 2CCQA 2FBWA 1O3XA 3N2GE 4QH1A 3FZKB 4YJ2E 1KNZA 5KE4A 4IE5A 3PUGA 2RP4A 2YKSA 1HS7A 4PIRA 1MNEA 4NPPA 2B1EA 3K3QC 1W9RA 3LBXB 4X1YE 4JEUB 4QXCB 5FL1A 2Y6XA 3NZQA 2EHOB 1D1CA 4JLEA 3ZMZB 1Z8UA 4UELA 2PH9A 4UM3P 4ILCA 5F5WA 4CI1B 5ADXL 4DV1T 2FJAA 2QVAA 3IGQA 3UULA 2WMNA 4XAXB 2ZJVA 4BFQA 1NAFA 3TLVA 1I9BA 4AKHA 1FJGT 3JCFA 1OXZA 5AQTB 3HKCE 3P4QA 1LRZA 1VCSA 1UW6A 3EVYA 3GN5A 2LHNA 3CX8B 5AQJB 2V5DA 2BYNA 3K8PC 4ZI2D 5HXHA 4FJOA 3PUSA 4WBNE 1QUUA 4DO0A 4DR3T 5LOVE 4KUMB 1ZHCA 2IUBA 4U33A 5HXCA 1NWMX 4AFHA 5HEUA 3Q5EA 2J4GA 5L3CB 1HNWT 1SHZC 2Y56A 3WTLA 3UUXB 1N36T 3AA1B 3PUWF 5L3EB 1YQ3A 5AQSB 4HFHA 4QAAA 2NW9A 3PEOA 2LRLA 2ACXA 5JQGE 3MXZA 3D0TA 2BS2A 4EYUA 3PUZF 5LG4A 3U8JA 5EZYE 4HWCA 5F8PA 2OA5A 4AFTA 4DV0T 1IAPA 3ZC1A 4HWHA 4X65T 4ZS2A 4I43B 4MLKA 2Y54A 1MMDA 3F2EA 4U74A 3UTKA 4DR2T 4ZS3A 3SIOA 3WAJA 3RLFF 4QH4A 2UXCT 2UUAT 1L0VA 2E9XD 3CK6A 3ONXA 2ZM6T 4ZK4A 2W00A 4YXDA 2WDRA 4CXWA 3UU3A 2IC9A 2D5UA 2C0SA 5HCJA 4DV7T 2D2SA 1HX8A 1OWAA 2EHOD 2Q9QA 5KX5E 4HKAA 5FL0A 3JAEA 3HKEE 4ZI2C 3TLUA 4EYYR 3CX7B 4YTMA 1UX2A 2J47A 2FJDA 3L39A 3AE6A 2MBGA 3U3IA 1KFYA 3SRZA 2JQKA 3RI5A 1J5ET 2XAJB 4HEAA 5ABGA 4ILBA 3VU7H 3ZLIA 4U7IA 5C8YE 2XNVA 4JYAT 3C79A 3FZLB 3IBPA 1S94A 4DR5T 4ANJA 2WB5A 1OEDB 1HFAA 4KI0F 4Z91A 1E2AA 3V5SA 2YEVC 2XQ5A 5AFHA 5DQWA 4QX8B 2M6BA 2XAGB 2XTLA 1IZNB 4HWFA 4WYVA 5LXBA 1S35A 2H3RA 3U8NA 4PFPA 2XZ5A 4LF6T 3I0OA 1N34T 3Q2MA 3O1JA 4UR9A 4TNWA 5L3GB 3KV6A 4P09A 3OYZA 4TWHA 2MTQA 4ZOLE 5A1LA 4WW0A 2V8SV 1H7CA 2BG9C 4UM3S 5AQKB 3N9PA 4ERRA 3AAAB 1MIVA 2C9TA 5C2TA 2IIUA 2DNXA 4TV9E 4QH5A 5JR9B 4IE6A 1HTJF 5J5FA 3HR0A 2BYSA 1NENA 3EHZA 1U4QA 2E9XC 4O4JE 4B3TT 3H3AA 4YHJA 4NZBA 3RPUA 4IL9A 3CPZA 2BZBA 3ZDHA 4AISA 1KNRA 3AEAA 3ZMUB 1US7B 3ZSSA 3HL6A 2XY8B 3PMZA 5IHYA 1FMWA 3L3PA 1HR0T 2D9DA 3N9LA 2N1GA 3AB3B 2XNUA 2X67A 3AE3A 2EHOC 2X0YA 3ONJA 2CEAA 3EUHA 4OX9T 1X9BA 3ZT6A 1BR1A 3OKQA 2MYSA 2X9YA 4CI2B 4BQTA 5LJMA 1UV6A 4IDQA 5ABHA 4DR1T 2KLQA 4XK9A 4ZK1A 4YHHT 5CB4E 4ZZBA 4BA9A 5JRCB 2JQHA 1HNXT 3GN5B 2LM9A 3AAIA 4UVCB 2PFVA 1Z0PA 3WTNA 1KF6A 4JV5T 3KVBA 3QUJA 4IREA 4AKGA 1KK7A 3ANWA 1UCUA 4LMLA 4HN9A 2V6XA 4H9RC 1D0ZA 5E0OA 2PG8A 3O1IA 2X00A 5AQUB 4MHCA 2ZMAA 3AVSA 3LDQB 2ZJUA 2AE9A 1VRBA 1CHUA 4UIGA 2WBLA 1W0AA 2IDOB 4U2YA 1LVFA 5HEHA 2DHRA 4M1PA 1SE7A 3AEGA 5FXVA 5J5IA 4PJMA 2D0TA 5BP0A 3LSVA 4IT4A 4UEMA 3ZJ2A 1KNPA 1IBMT 2XQ3A 4HFBA 4X62T 1UURA 1WFDA 2CWYA 3CX6B 3RH3A 3AE7A 5AQRB 3Q5WA 2CPTA 5L3FB 4MALA 4O8SA 2CXFA 2CHNA 4QABA 2BS3A 1WR6A 4ILAA 1VOMA 1J5WA 3ABVA 4CXYA 2QRXA 3LFMA 3C4XA 5SYOA 4PFOA 2IW5B 5M4YA 2XHEB 4MFRA 1N32T 4DIDB 5FY1A 1T98A 2PGZA 2LSYA 2YU2A 5AQOB 2VL0A 4HWDA 4V1Av 3ZMSB 2CXLA 3AXJB 5CA0E 2UXBT 2E5VA 2K48A 3UU5A 2R6GF 3ZYLA 2XQ9A 3N9NA 4HFCA 2QC1B 5F3JA 1HF8A 4ZI7E 2Q9QB 5JR9A 3AA6B 4FRRA 3E22E 5LHGB 3SFDA 3C50A 3RX6A 3ZPOA 3PUXF 4EB6E 3ZSTA 5H6QB 2DCFA 2WNJA 5LHHB 2KINB 1FEWA 2MOZA 3WAKA 3UQ7A 4LFBT 3TLWA 3ZKRA 4UVAB 5JDNA 1SUMB 5AQQB 1UGOA
chains in the Genus database with same CATH topology
3SIOA 4BQTA 1UV6A 2BYRA 3UUBA 3WTIA 1UW6A 5BW2A 4QH4A 5AFLA 2M6IA 4XK9A 3U8KA 4ZK1A 4LMJA 4QABA 5AFMB 5LXBA 2WNLA 2XQ6A 1OEDE 5AINA 4ZZBA 5HEJA 2BR7A 2BYNA 4ILAA 5L4HA 3U8NA 4ZK4A 3TLSA 2XZ5A 3RHWA 5TVCA 4ZZCA 3UU3A 1OEDC 2W8FA 2XQ8A 2BYQA 2BG9E 4TNWA 5SYOA 3EI0A 4DBMA 5BRXA 4HFDA 2YMEA 4TWHA 2Y7YA 5KZUA 2KSRA 4HQPA 3WTNA 5AFMA 4LMKA 5AFNA 4AFHA 5HEUA 4IREA 3WTOA 2BJ0A 3SH1A 2BG9C 4QACA 4UM3S 2LKHA 5FJVA 3UU6A 3WTJA 2Y56A 3RIAA 4LMLA 4QH1A 2PGZA 3SQ9A 3WTLA 5KE4A 4HFIA 2VL0A 4XHEA 4COFA 5J5GA 3WTMA 2YKSA 5HEGA 5HCJA 4WV9A 5CO5A 4PIRA 2MAWA 3UU4A 2WNCA 4B5DA 2C9TA 2XYTA 4NPPA 4TNVA 3UQ4A 2XZ6A 3WTHA 2YN6A 2X00D 4QAAA 4HFHA 4QH5A 4ZRUA 2X00A 4UY2A 5J0ZA 5L47A 3PEOA 2Y58A 5J5FA 5AFJA 2BYSA 3EHZA 3TLTA 3UU5A 2LM2A 2XQ9A 3JAFA 4UM1A 4HFCA 2XNTA 2QC1B 3JAEA 2ZJUA 4NZBA 5JMEA 4F8HA 3TLUA 5AFKA 4IL9A 2PH9A 4ZR6A 4UM3P 2LLYA 4X5TA 5J5HA 1UX2A 3ZDHA 4ZJSA 4ILCA 2XQAA 3RQUA 3U8MA 3RIFA 4FRRA 4HFEA 5HEHA 3C84A 3U8JA 4EZ1A 2LKGA 3P4WA 3RI5A 2Y57A 5IUXA 4AFTA 3P50A 5HEOA 3PMZA 4AFGA 2YMDA 3RQWA 4ZJTA 4A97A 1OEDA 5J5IA 5L4EA 4ILBA 5BP0A 2BYPA 2WNJA 2XNVA 4D01A 3IGQA 3LSVA 3C79A 4Z90A 2WN9A 4TWFA 2ZJVA 4UXUA 3WTKA 4BFQA 3UU8A 4ALXA 4A98A 1OEDB 3EAMA 4Z91A 3TLVA 3ZDGA 1I9BA 2UZ6A 2XQ7A 5CFBA 3GUAA 2BG9A 3UQ7A 2BR8A 3T4MA 2W8GA 4TWDA 2XNUA 3TLWA 3ZKRA 2Y54A 2WZYA 2XQ3A 4HFBA 5LG3A 2XQ5A 4IL4A 3U8LA 2XQ4A 2BG9B 3JADA 5AFHA 3SQ6A 5HCMA 2XYSA 4UM3A 2M6BA 2YOEA 3WIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIO A;  4BQT A;  1UV6 A;  2BYR A;  3UUB A;  3WTI A;  1UW6 A;  5BW2 A;  4QH4 A;  5AFL A;  2M6I A;  4XK9 A;  3U8K A;  4ZK1 A;  4LMJ A;  4QAB A;  5AFM B;  5LXB A;  2WNL A;  2XQ6 A;  1OED E;  5AIN A;  4ZZB A;  5HEJ A;  2BR7 A;  2BYN A;  4ILA A;  5L4H A;  3U8N A;  4ZK4 A;  3TLS A;  2XZ5 A;  3RHW A;  5TVC A;  4ZZC A;  3UU3 A;  1OED C;  2W8F A;  2XQ8 A;  2BYQ A;  2BG9 E;  4TNW A;  5SYO A;  3EI0 A;  4DBM A;  5BRX A;  4HFD A;  2YME A;  4TWH A;  2Y7Y A;  5KZU A;  2KSR A;  4HQP A;  3WTN A;  5AFM A;  4LMK A;  5AFN A;  4AFH A;  5HEU A;  4IRE A;  3WTO A;  2BJ0 A;  3SH1 A;  2BG9 C;  4QAC A;  4UM3 S;  2LKH A;  5FJV A;  3UU6 A;  3WTJ A;  2Y56 A;  3RIA A;  4LML A;  4QH1 A;  2PGZ A;  3SQ9 A;  3WTL A;  5KE4 A;  4HFI A;  2VL0 A;  4XHE A;  4COF A;  5J5G A;  3WTM A;  2YKS A;  5HEG A;  5HCJ A;  4WV9 A;  5CO5 A;  4PIR A;  2MAW A;  3UU4 A;  2WNC A;  4B5D A;  2C9T A;  2XYT A;  4NPP A;  4TNV A;  3UQ4 A;  2XZ6 A;  3WTH A;  2YN6 A;  2X00 D;  4QAA A;  4HFH A;  4QH5 A;  4ZRU A;  2X00 A;  4UY2 A;  5J0Z A;  5L47 A;  3PEO A;  2Y58 A;  5J5F A;  5AFJ A;  2BYS A;  3EHZ A;  3TLT A;  3UU5 A;  2LM2 A;  2XQ9 A;  3JAF A;  4UM1 A;  4HFC A;  2XNT A;  2QC1 B;  3JAE A;  2ZJU A;  4NZB A;  5JME A;  4F8H A;  3TLU A;  5AFK A;  4IL9 A;  2PH9 A;  4ZR6 A;  4UM3 P;  2LLY A;  4X5T A;  5J5H A;  1UX2 A;  3ZDH A;  4ZJS A;  4ILC A;  2XQA A;  3RQU A;  3U8M A;  3RIF A;  4FRR A;  4HFE A;  5HEH A;  3C84 A;  3U8J A;  4EZ1 A;  2LKG A;  3P4W A;  3RI5 A;  2Y57 A;  5IUX A;  4AFT A;  3P50 A;  5HEO A;  3PMZ A;  4AFG A;  2YMD A;  3RQW A;  4ZJT A;  4A97 A;  1OED A;  5J5I A;  5L4E A;  4ILB A;  5BP0 A;  2BYP A;  2WNJ A;  2XNV A;  4D01 A;  3IGQ A;  3LSV A;  3C79 A;  4Z90 A;  2WN9 A;  4TWF A;  2ZJV A;  4UXU A;  3WTK A;  4BFQ A;  3UU8 A;  4ALX A;  4A98 A;  1OED B;  3EAM A;  4Z91 A;  3TLV A;  3ZDG A;  1I9B A;  2UZ6 A;  2XQ7 A;  5CFB A;  3GUA A;  2BG9 A;  3UQ7 A;  2BR8 A;  3T4M A;  2W8G A;  4TWD A;  2XNU A;  3TLW A;  3ZKR A;  2Y54 A;  2WZY A;  2XQ3 A;  4HFB A;  5LG3 A;  2XQ5 A;  4IL4 A;  3U8L A;  2XQ4 A;  2BG9 B;  3JAD A;  5AFH A;  3SQ6 A;  5HCM A;  2XYS A;  4UM3 A;  2M6B A;  2YOE A;  3WIP A; 
#chains in the Genus database with same CATH topology
 3V5U A;  3W15 B;  4JI2 T;  1W09 A;  3PDY A;  4OYK A;  2CRB A;  3S4U A;  4UV9 B;  2NW8 A;  3RYH E;  4DBQ A;  2UUB T;  4QXB B;  4CN4 A;  5AFM B;  5CA1 E;  2PBI A;  4IDN A;  3RC3 A;  1OED C;  3Q9D A;  3QOF A;  3B13 A;  2X9H A;  4HTE A;  4JI8 T;  5KZU A;  4B3R T;  2V7I A;  2N2N A;  5JRC A;  3WTO A;  3ZYK A;  1FMV A;  5L3D B;  3WTJ A;  4TV8 E;  1MIW A;  4G2A A;  4U2Z A;  4UXN B;  4IE4 A;  4CZZ B;  3F57 A;  2MAW A;  2WNC A;  2XYT A;  2YN6 A;  3NKZ A;  4GOU A;  2DL1 A;  4UY2 A;  1CUN A;  2WU5 A;  5LJN A;  2VKD A;  4DBR A;  2JQ9 A;  5DJQ C;  1AJ3 A;  1YW0 A;  3ZC0 A;  1D0X A;  4QXH B;  4IHJ E;  3U8M A;  2X68 A;  2W61 A;  5AQL B;  4L0R A;  3HKD E;  3PUV F;  2YMD A;  4XZC A;  4H63 V;  2BYP A;  5LCY A;  5JR9 C;  3ZDG A;  2UZ6 A;  3MA9 A;  2F4V T;  3WI3 A;  2JMH A;  5KXJ A;  5HCM A;  2BVL A;  3WTI A;  3ETV A;  4EXT A;  1WYC A;  3KVA A;  1KEY A;  3PV0 F;  5ETW A;  2XQ6 A;  3UUN A;  2LSI A;  4JUY A;  2J1D G;  2DWK A;  4TUY E;  2W8F A;  5DAB A;  4PJN A;  3TKL B;  2KWH A;  1I6Z A;  5LHI B;  4HWI B;  2BJ0 A;  2C5K T;  1GQE A;  5FXX A;  3ESL A;  1QSD A;  3RIA A;  1DU2 A;  2WS3 A;  2YK0 A;  3WTM A;  4CQI A;  4DV5 T;  4JEH B;  3ANW B;  3BQK A;  4AQF A;  3AEC A;  3RYF E;  4OYJ A;  2QA7 A;  2Q9Q D;  2G0U A;  3MJX A;  4OHF A;  5EK2 A;  2LM2 A;  4AQY T;  4QHO A;  2NR4 A;  2W2U A;  2ACZ A;  5CJ5 A;  3AXJ A;  3C51 A;  4ASK A;  3CQG B;  5FKY A;  3NBX X;  3DP7 A;  3RIF A;  3RKG A;  4PK6 A;  4HFV A;  4MBQ A;  1ZP0 A;  3P50 A;  5HEO A;  3KIN B;  1EZ3 A;  4ZJT A;  2CLY B;  4ADZ A;  4D01 A;  4PW8 A;  1D1B A;  1HCI A;  2CE7 A;  4TWF A;  1HG2 A;  4GYS A;  4YTN A;  4P0A A;  3T4M A;  3FBL A;  4TWD A;  2CBI A;  3IHR A;  3PE0 A;  1ZOY A;  4ZEY A;  3N5L A;  2JRK A;  4U72 A;  5LBM A;  3LK3 B;  3OJA A;  1NEK A;  4LF8 T;  2WZI A;  3WIP A;  2WY2 A;  5AQI B;  1BR2 A;  3ETU A;  3RIU A;  3GWH A;  4LMJ A;  2H88 A;  2WNL A;  3P7I A;  4O4H E;  3FXD B;  2CMR A;  4YSZ A;  5FVL A;  1ZKE A;  2P9B A;  3AA0 B;  3N9O A;  4YSX A;  3CWZ B;  4DUY T;  5AFM A;  4ZI3 D;  4H9N C;  5JRE A;  4KHP T;  2ZM2 A;  2LE8 A;  2BBH A;  2W67 A;  3I9W A;  4B5D A;  2I0M A;  3UQ4 A;  3O4X E;  4IST A;  3AAE B;  3E08 A;  3ZCI A;  2Y58 A;  2UXN B;  1XMO T;  3TLT A;  3AEB A;  2WMO A;  3BQL A;  3ZYM A;  2XUE A;  5JME A;  2CHO A;  2CM0 A;  3N9Q A;  3DJB A;  2LKG A;  4U31 A;  4JI4 T;  5LMN T;  5IUX A;  4X66 T;  2HN1 A;  1QLB A;  4KHZ F;  3PU8 A;  2XAH B;  4ALX A;  3HI2 A;  2W63 A;  1IBK T;  5LGU B;  5FXZ A;  4IDP A;  2XM2 A;  2A3D A;  1D0Y A;  5ABF A;  2V7J A;  4UVB B;  2XQ4 A;  2Q9Q C;  3SFE A;  3UFG A;  4AKR B;  3OPC A;  1W0B A;  5AFL A;  2M6I A;  4H9S E;  2V26 A;  3UFE A;  2A9U A;  2LSG A;  2B76 A;  3K1S A;  4DND A;  3AE4 A;  5LXT E;  2X0L B;  4DV6 T;  1JNZ A;  2JPF A;  1JNR A;  1HX1 B;  3M3Z B;  1XNQ T;  4IDO A;  4P1N A;  4LF4 T;  3K3O A;  3RC8 A;  3R6N A;  2IAK A;  4UF0 B;  1XZY A;  5J5G A;  3J7Y q;  4WV9 A;  2YU1 A;  1FIO A;  3ZCJ A;  4EED A;  3WTH A;  4TNV A;  2K9A A;  1M62 A;  2X00 D;  3RYI E;  4YTP A;  1T72 A;  4O2B E;  2E5L T;  2NWB A;  2Z6E A;  5HXS A;  2LJL A;  5JH7 E;  3RQU A;  2OV9 A;  4EV6 A;  3C98 B;  4AIU A;  2LSK A;  4YY3 T;  4AFG A;  2VAS A;  1E7P A;  1UK5 A;  4HGA A;  4OFZ A;  4JI3 T;  3SS1 A;  3RRW A;  3N9M A;  2PTF A;  4JI6 T;  4Q25 A;  1D1A A;  4PK5 A;  2C5I T;  3AE2 A;  5IYZ E;  3LK4 2;  2FUP A;  5LG3 A;  3OTO T;  4IL4 A;  3OYX A;  3KV9 A;  1XNR T;  4UV8 B;  1V9D A;  2YDQ A;  2LHR A;  4WBO A;  5BR8 T;  4I4T E;  1BR4 A;  4JI5 T;  1IBL T;  4K0K T;  1R8I A;  2VKJ A;  4GYR A;  5ABE A;  4X64 T;  5LP6 E;  4X20 E;  4GKJ T;  2ODU A;  3MAC A;  4C90 A;  3E0Z A;  4HFD A;  1X79 A;  2Y7Y A;  3P4P A;  3B5M A;  5AFN A;  3I1A A;  4F6R C;  3PJA J;  3I0Q A;  4NXM T;  3PTR B;  3VKG A;  4IE7 A;  4PNI A;  3UU4 A;  2XZ6 A;  5J0Z A;  4NUV A;  1VCT A;  3P8C D;  3NZP A;  1WR0 A;  4YT0 A;  4J2C A;  2XPK A;  3KBU A;  3UUM A;  4H9Q C;  4UM1 A;  5C3J A;  4Z8X A;  4BJN A;  4PJL A;  2V6Y A;  2DI4 A;  3QK6 A;  3RF1 A;  2UXD T;  5J5H A;  2UXX B;  2HPJ A;  2W4X A;  2XQA A;  3IF8 B;  3FHN A;  3FZH B;  3LG7 A;  4JI1 T;  3KFW X;  2DWG A;  3RQW A;  5LA6 E;  1ZEE A;  5J2T E;  1UX5 A;  5HAX A;  4AKL A;  2LOS A;  5AQP B;  1I94 T;  3UU8 A;  5HXE A;  5JDF A;  2WDQ A;  1HNZ T;  3VHL A;  3GUA A;  4KP3 C;  4WZX A;  1XDP A;  2CWO A;  3U8L A;  4CI3 B;  2KT9 A;  4O2A E;  1B7T A;  3ZJ1 A;  3AVR A;  2DLR A;  2LT3 A;  4LFA T;  3ZEF B;  3SWH A;  4GK0 E;  3OVU A;  4QWN B;  2WDV A;  2XSB A;  2LOP A;  2SPC A;  2XAF B;  2ZLY A;  2CLY C;  4H9O C;  4WNK A;  2ODV A;  5FXW A;  3H37 A;  1M7K A;  1LVK A;  3K3N A;  4CN6 A;  3L8R A;  1LKX A;  3VR9 A;  4LF5 T;  4HQP A;  3EAB A;  3SH1 A;  4ZXL A;  2QYW A;  2KMF A;  2X66 A;  2ZM0 A;  2KWI B;  2LKH A;  3RRC A;  2VVN A;  4CN1 A;  4EZH A;  5AQG B;  5FMN A;  3ONL C;  1YXR A;  3ZT7 A;  3GA8 A;  5LGN B;  3PJA A;  1YD8 G;  5L47 A;  2ES0 A;  2IC6 A;  3AEE A;  5AFJ A;  4L5G A;  4UF0 A;  2I59 A;  3NVO A;  2C5J A;  4U3C A;  3CKD A;  3MKD A;  4F8H A;  1WCR A;  1MMN A;  4JBW F;  5LGT B;  5AQN B;  3ZMV B;  2E8I A;  2WQY A;  2LSJ A;  3P4W A;  5BMV E;  3CQX C;  4A97 A;  5LNK A;  4U7Y A;  2VQE T;  4Z90 A;  3WTK A;  4A98 A;  3EDV A;  3AE8 A;  2WAU A;  1WLX A;  3A5X A;  2BKN A;  4AKI A;  5JDH A;  3B57 A;  3P4R A;  4DR6 T;  2IML A;  2IHR 1;  3A8Y C;  4TN7 B;  3U78 A;  5KMG P;  3SQ6 A;  4ZR6 A;  3CVR A;  3RGL A;  4X1K E;  2BYR A;  3UUB A;  5ABF B;  2ZM8 A;  3GMI A;  3AE9 A;  2D0U A;  2W66 A;  2WWU A;  3IEE A;  5HEJ A;  3ZN1 B;  3LK2 B;  4C91 A;  4NUU A;  3A7M A;  3PU3 A;  3BQI A;  4JI0 T;  3VKH A;  4EGW A;  5BRX A;  3JC6 D;  1WRD A;  2VKO A;  5FYM A;  4YLH A;  2VUR A;  4KBM B;  5AFU L;  3AEF A;  3C64 A;  4DV2 T;  3AED A;  4L9I A;  1IJ6 A;  1MMG A;  2HHH T;  3OBV E;  5HEG A;  4YJ3 E;  4E7S A;  5JDL A;  3NRX A;  2K24 A;  3ZN0 B;  4G63 A;  2XJ7 A;  4FI5 A;  1YQ4 A;  2FJB A;  4N78 D;  2X0H A;  2Y48 B;  4YSY A;  3N2O A;  5DQV A;  2XNT A;  2I6H A;  4A5X A;  5AFK A;  3R84 B;  4DVD A;  2PJQ A;  4X5T A;  4PAG A;  3C4W A;  3P4S A;  1ZV4 X;  1WYB A;  3FXE B;  4IDZ A;  3AE5 A;  3G06 A;  2Y57 A;  5LB7 B;  5L4E A;  3CIR A;  3M65 A;  2KXP B;  3O1H A;  2WM9 A;  3EAM A;  4YFS A;  4K0U A;  2M67 A;  5CFB A;  2BG9 A;  2BR8 A;  4IGU A;  2N9D A;  2WZY A;  1MIY A;  4NIQ A;  2XYS A;  3EDU A;  4LFC T;  2NTY A;  2X9X A;  2QGS A;  4EAH A;  3NWI A;  4GIW A;  4EIW A;  3U8K A;  4O4L E;  5AQM B;  2E9X A;  3TLS A;  4KX6 A;  4PK4 A;  1T7S A;  3PUA A;  3X1D A;  5TVC A;  2V7L A;  3DTO A;  4ISS A;  5EK3 A;  2BG9 E;  4B3M T;  3IA3 A;  3KBT A;  2V7M A;  2XQY A;  2K3W A;  2K5B B;  2KSR A;  4LMK A;  3AE1 A;  3UU6 A;  2WSS V;  5FJV A;  5HXR A;  4DV4 T;  2W0G A;  4HFI A;  4COF A;  4EEB A;  3LBX A;  5CO5 A;  4I55 E;  3O9X A;  2EHO A;  3KDS E;  2NW7 A;  5HWY A;  2WP9 A;  2JJ9 A;  2VL8 A;  1G8X A;  2YIN A;  3QB5 K;  2BBJ A;  3CQC B;  3VR8 A;  2XSA A;  3NRY A;  3FZM B;  3Q5D A;  1HG5 A;  2V6Y B;  2WZH A;  2V5C A;  3JC6 C;  4AI6 A;  4EZ1 A;  2BDE A;  5L3B B;  1MMA A;  4A56 A;  3AA7 B;  4EZ4 A;  3PUY F;  2XZE A;  3F31 A;  4DUZ T;  3SOL A;  2WN9 A;  4UXU A;  1Y01 A;  5FNV E;  2HPL A;  4H63 H;  2A2F X;  4AQF C;  1E1H B;  5EK4 A;  3ZMT B;  4NXN T;  2CA5 A;  2A72 A;  2WCA A;  3I9Y A;  5LYJ E;  3T1H T;  2NTX A;  4UM3 A;  2HH7 A;  2UUC T;  5J2U E;  2LEH A;  2MPK A;  1G73 A;  2VWA A;  5BW2 A;  4X1I E;  2V1D B;  4HE8 A;  1U5P A;  4QKN A;  5JDG A;  2WU2 A;  5JVD E;  4ZZC A;  5FP3 A;  4B6X A;  2FJE A;  5AQF B;  4DV3 T;  2BYQ A;  4DBM A;  2V7K A;  3EI0 A;  5JDQ A;  2BS4 A;  2GK9 A;  4IIJ E;  5CGM A;  2AXD S;  3SQ9 A;  2OLT A;  4XHE A;  4BAY B;  5IWA T;  4AQG A;  4DR4 T;  4IE0 A;  4GKK T;  3C4Z A;  3PUR A;  2BKP A;  3LJC A;  3RYC E;  2KZ7 B;  3QB5 A;  2CXD A;  3RIU C;  2BKO A;  2Y8D A;  2VK9 A;  4BJM A;  1T8B A;  3UT5 E;  4E7Z A;  3MZK B;  1J1J A;  1BR0 A;  4ZJS A;  3FBZ A;  5TAO A;  1UUS A;  3CML A;  2XM1 A;  3N2K E;  3L09 A;  5LBQ B;  3RKO A;  4DMV A;  3T8O A;  3C84 A;  4CXX A;  2W62 A;  5J1G A;  4ILU A;  3VRB A;  2VVS A;  1YKE B;  2UU9 T;  2JIW A;  3FZF B;  4OK0 A;  2YDR A;  3HKB E;  3Q5X A;  2RPA A;  4AXP A;  2XAS B;  2JMK A;  1N33 T;  3JAD A;  4PJJ A;  4JI7 T;  4ZI3 C;  3KV4 A;  3BK9 A;  3HA4 A;  5AQH B;  4LF9 T;  4LF7 T;  4I0U A;  2XQ8 A;  3H3M A;  2J62 A;  5FVK A;  4O4I E;  2BVM A;  4B3S T;  4QAC A;  2H7O A;  2LRK A;  2VB6 A;  4TZ4 C;  2VQF T;  5AQV B;  3KV5 A;  4XBF B;  2CBJ A;  2RA1 A;  4ZRU A;  5JTG A;  2L3L A;  2NP9 A;  4ZHQ E;  5L2L A;  3ZT5 A;  3FB2 A;  3JAF A;  5HWX A;  2VKH A;  4KMC A;  2LLY A;  2X9W A;  2YDS A;  2WWV A;  4HFE A;  5H6R B;  4I50 E;  1MND A;  1OED A;  2NOX A;  1Y64 B;  2XQ7 A;  1IJ5 A;  1UX4 A;  2KND A;  2E2A A;  2W8G A;  4EOZ B;  3VRA A;  1XWM A;  4TX5 A;  5GON E;  2BG9 B;  3MK7 C;  2JQQ A;  1XMQ T;  2YOE A;  2H89 A;  5FY7 A;  4DMW A;  5HYA A;  5JDM A;  1SA0 E;  2H7V C;  3T1Y T;  2XAQ B;  1OED E;  2HN2 A;  3QC9 A;  5FY0 A;  2BR7 A;  5AIN A;  5L4H A;  2X51 A;  2L8K A;  3PUQ A;  3RHW A;  1XDO A;  2L9Q A;  4H9P C;  5KDM C;  1YKH B;  3J9X 1;  4GK5 E;  2E9X B;  3QNU A;  4QX7 B;  2YME A;  4DR7 T;  5LMU T;  4P0B A;  2CCQ A;  2FBW A;  1O3X A;  3N2G E;  4QH1 A;  3FZK B;  4YJ2 E;  1KNZ A;  5KE4 A;  4IE5 A;  3PUG A;  2RP4 A;  2YKS A;  1HS7 A;  4PIR A;  1MNE A;  4NPP A;  2B1E A;  3K3Q C;  1W9R A;  3LBX B;  4X1Y E;  4JEU B;  4QXC B;  5FL1 A;  2Y6X A;  3NZQ A;  2EHO B;  1D1C A;  4JLE A;  3ZMZ B;  1Z8U A;  4UEL A;  2PH9 A;  4UM3 P;  4ILC A;  5F5W A;  4CI1 B;  5ADX L;  4DV1 T;  2FJA A;  2QVA A;  3IGQ A;  3UUL A;  2WMN A;  4XAX B;  2ZJV A;  4BFQ A;  1NAF A;  3TLV A;  1I9B A;  4AKH A;  1FJG T;  3JCF A;  1OXZ A;  5AQT B;  3HKC E;  3P4Q A;  1LRZ A;  1VCS A;  1UW6 A;  3EVY A;  3GN5 A;  2LHN A;  3CX8 B;  5AQJ B;  2V5D A;  2BYN A;  3K8P C;  4ZI2 D;  5HXH A;  4FJO A;  3PUS A;  4WBN E;  1QUU A;  4DO0 A;  4DR3 T;  5LOV E;  4KUM B;  1ZHC A;  2IUB A;  4U33 A;  5HXC A;  1NWM X;  4AFH A;  5HEU A;  3Q5E A;  2J4G A;  5L3C B;  1HNW T;  1SHZ C;  2Y56 A;  3WTL A;  3UUX B;  1N36 T;  3AA1 B;  3PUW F;  5L3E B;  1YQ3 A;  5AQS B;  4HFH A;  4QAA A;  2NW9 A;  3PEO A;  2LRL A;  2ACX A;  5JQG E;  3MXZ A;  3D0T A;  2BS2 A;  4EYU A;  3PUZ F;  5LG4 A;  3U8J A;  5EZY E;  4HWC A;  5F8P A;  2OA5 A;  4AFT A;  4DV0 T;  1IAP A;  3ZC1 A;  4HWH A;  4X65 T;  4ZS2 A;  4I43 B;  4MLK A;  2Y54 A;  1MMD A;  3F2E A;  4U74 A;  3UTK A;  4DR2 T;  4ZS3 A;  3SIO A;  3WAJ A;  3RLF F;  4QH4 A;  2UXC T;  2UUA T;  1L0V A;  2E9X D;  3CK6 A;  3ONX A;  2ZM6 T;  4ZK4 A;  2W00 A;  4YXD A;  2WDR A;  4CXW A;  3UU3 A;  2IC9 A;  2D5U A;  2C0S A;  5HCJ A;  4DV7 T;  2D2S A;  1HX8 A;  1OWA A;  2EHO D;  2Q9Q A;  5KX5 E;  4HKA A;  5FL0 A;  3JAE A;  3HKE E;  4ZI2 C;  3TLU A;  4EYY R;  3CX7 B;  4YTM A;  1UX2 A;  2J47 A;  2FJD A;  3L39 A;  3AE6 A;  2MBG A;  3U3I A;  1KFY A;  3SRZ A;  2JQK A;  3RI5 A;  1J5E T;  2XAJ B;  4HEA A;  5ABG A;  4ILB A;  3VU7 H;  3ZLI A;  4U7I A;  5C8Y E;  2XNV A;  4JYA T;  3C79 A;  3FZL B;  3IBP A;  1S94 A;  4DR5 T;  4ANJ A;  2WB5 A;  1OED B;  1HFA A;  4KI0 F;  4Z91 A;  1E2A A;  3V5S A;  2YEV C;  2XQ5 A;  5AFH A;  5DQW A;  4QX8 B;  2M6B A;  2XAG B;  2XTL A;  1IZN B;  4HWF A;  4WYV A;  5LXB A;  1S35 A;  2H3R A;  3U8N A;  4PFP A;  2XZ5 A;  4LF6 T;  3I0O A;  1N34 T;  3Q2M A;  3O1J A;  4UR9 A;  4TNW A;  5L3G B;  3KV6 A;  4P09 A;  3OYZ A;  4TWH A;  2MTQ A;  4ZOL E;  5A1L A;  4WW0 A;  2V8S V;  1H7C A;  2BG9 C;  4UM3 S;  5AQK B;  3N9P A;  4ERR A;  3AAA B;  1MIV A;  2C9T A;  5C2T A;  2IIU A;  2DNX A;  4TV9 E;  4QH5 A;  5JR9 B;  4IE6 A;  1HTJ F;  5J5F A;  3HR0 A;  2BYS A;  1NEN A;  3EHZ A;  1U4Q A;  2E9X C;  4O4J E;  4B3T T;  3H3A A;  4YHJ A;  4NZB A;  3RPU A;  4IL9 A;  3CPZ A;  2BZB A;  3ZDH A;  4AIS A;  1KNR A;  3AEA A;  3ZMU B;  1US7 B;  3ZSS A;  3HL6 A;  2XY8 B;  3PMZ A;  5IHY A;  1FMW A;  3L3P A;  1HR0 T;  2D9D A;  3N9L A;  2N1G A;  3AB3 B;  2XNU A;  2X67 A;  3AE3 A;  2EHO C;  2X0Y A;  3ONJ A;  2CEA A;  3EUH A;  4OX9 T;  1X9B A;  3ZT6 A;  1BR1 A;  3OKQ A;  2MYS A;  2X9Y A;  4CI2 B;  4BQT A;  5LJM A;  1UV6 A;  4IDQ A;  5ABH A;  4DR1 T;  2KLQ A;  4XK9 A;  4ZK1 A;  4YHH T;  5CB4 E;  4ZZB A;  4BA9 A;  5JRC B;  2JQH A;  1HNX T;  3GN5 B;  2LM9 A;  3AAI A;  4UVC B;  2PFV A;  1Z0P A;  3WTN A;  1KF6 A;  4JV5 T;  3KVB A;  3QUJ A;  4IRE A;  4AKG A;  1KK7 A;  3ANW A;  1UCU A;  4LML A;  4HN9 A;  2V6X A;  4H9R C;  1D0Z A;  5E0O A;  2PG8 A;  3O1I A;  2X00 A;  5AQU B;  4MHC A;  2ZMA A;  3AVS A;  3LDQ B;  2ZJU A;  2AE9 A;  1VRB A;  1CHU A;  4UIG A;  2WBL A;  1W0A A;  2IDO B;  4U2Y A;  1LVF A;  5HEH A;  2DHR A;  4M1P A;  1SE7 A;  3AEG A;  5FXV A;  5J5I A;  4PJM A;  2D0T A;  5BP0 A;  3LSV A;  4IT4 A;  4UEM A;  3ZJ2 A;  1KNP A;  1IBM T;  2XQ3 A;  4HFB A;  4X62 T;  1UUR A;  1WFD A;  2CWY A;  3CX6 B;  3RH3 A;  3AE7 A;  5AQR B;  3Q5W A;  2CPT A;  5L3F B;  4MAL A;  4O8S A;  2CXF A;  2CHN A;  4QAB A;  2BS3 A;  1WR6 A;  4ILA A;  1VOM A;  1J5W A;  3ABV A;  4CXY A;  2QRX A;  3LFM A;  3C4X A;  5SYO A;  4PFO A;  2IW5 B;  5M4Y A;  2XHE B;  4MFR A;  1N32 T;  4DID B;  5FY1 A;  1T98 A;  2PGZ A;  2LSY A;  2YU2 A;  5AQO B;  2VL0 A;  4HWD A;  4V1A v;  3ZMS B;  2CXL A;  3AXJ B;  5CA0 E;  2UXB T;  2E5V A;  2K48 A;  3UU5 A;  2R6G F;  3ZYL A;  2XQ9 A;  3N9N A;  4HFC A;  2QC1 B;  5F3J A;  1HF8 A;  4ZI7 E;  2Q9Q B;  5JR9 A;  3AA6 B;  4FRR A;  3E22 E;  5LHG B;  3SFD A;  3C50 A;  3RX6 A;  3ZPO A;  3PUX F;  4EB6 E;  3ZST A;  5H6Q B;  2DCF A;  2WNJ A;  5LHH B;  2KIN B;  1FEW A;  2MOZ A;  3WAK A;  3UQ7 A;  4LFB T;  3TLW A;  3ZKR A;  4UVA B;  5JDN A;  1SUM B;  5AQQ B;  1UGO A; 
#chains in the Genus database with same CATH homology
 3SIO A;  4BQT A;  1UV6 A;  2BYR A;  3UUB A;  3WTI A;  1UW6 A;  5BW2 A;  4QH4 A;  5AFL A;  2M6I A;  4XK9 A;  3U8K A;  4ZK1 A;  4LMJ A;  4QAB A;  5AFM B;  5LXB A;  2WNL A;  2XQ6 A;  1OED E;  5AIN A;  4ZZB A;  5HEJ A;  2BR7 A;  2BYN A;  4ILA A;  5L4H A;  3U8N A;  4ZK4 A;  3TLS A;  2XZ5 A;  3RHW A;  5TVC A;  4ZZC A;  3UU3 A;  1OED C;  2W8F A;  2XQ8 A;  2BYQ A;  2BG9 E;  4TNW A;  5SYO A;  3EI0 A;  4DBM A;  5BRX A;  4HFD A;  2YME A;  4TWH A;  2Y7Y A;  5KZU A;  2KSR A;  4HQP A;  3WTN A;  5AFM A;  4LMK A;  5AFN A;  4AFH A;  5HEU A;  4IRE A;  3WTO A;  2BJ0 A;  3SH1 A;  2BG9 C;  4QAC A;  4UM3 S;  2LKH A;  5FJV A;  3UU6 A;  3WTJ A;  2Y56 A;  3RIA A;  4LML A;  4QH1 A;  2PGZ A;  3SQ9 A;  3WTL A;  5KE4 A;  4HFI A;  2VL0 A;  4XHE A;  4COF A;  5J5G A;  3WTM A;  2YKS A;  5HEG A;  5HCJ A;  4WV9 A;  5CO5 A;  4PIR A;  2MAW A;  3UU4 A;  2WNC A;  4B5D A;  2C9T A;  2XYT A;  4NPP A;  4TNV A;  3UQ4 A;  2XZ6 A;  3WTH A;  2YN6 A;  2X00 D;  4QAA A;  4HFH A;  4QH5 A;  4ZRU A;  2X00 A;  4UY2 A;  5J0Z A;  5L47 A;  3PEO A;  2Y58 A;  5J5F A;  5AFJ A;  2BYS A;  3EHZ A;  3TLT A;  3UU5 A;  2LM2 A;  2XQ9 A;  3JAF A;  4UM1 A;  4HFC A;  2XNT A;  2QC1 B;  3JAE A;  2ZJU A;  4NZB A;  5JME A;  4F8H A;  3TLU A;  5AFK A;  4IL9 A;  2PH9 A;  4ZR6 A;  4UM3 P;  2LLY A;  4X5T A;  5J5H A;  1UX2 A;  3ZDH A;  4ZJS A;  4ILC A;  2XQA A;  3RQU A;  3U8M A;  3RIF A;  4FRR A;  4HFE A;  5HEH A;  3C84 A;  3U8J A;  4EZ1 A;  2LKG A;  3P4W A;  3RI5 A;  2Y57 A;  5IUX A;  4AFT A;  3P50 A;  5HEO A;  3PMZ A;  4AFG A;  2YMD A;  3RQW A;  4ZJT A;  4A97 A;  1OED A;  5J5I A;  5L4E A;  4ILB A;  5BP0 A;  2BYP A;  2WNJ A;  2XNV A;  4D01 A;  3IGQ A;  3LSV A;  3C79 A;  4Z90 A;  2WN9 A;  4TWF A;  2ZJV A;  4UXU A;  3WTK A;  4BFQ A;  3UU8 A;  4ALX A;  4A98 A;  1OED B;  3EAM A;  4Z91 A;  3TLV A;  3ZDG A;  1I9B A;  2UZ6 A;  2XQ7 A;  5CFB A;  3GUA A;  2BG9 A;  3UQ7 A;  2BR8 A;  3T4M A;  2W8G A;  4TWD A;  2XNU A;  3TLW A;  3ZKR A;  2Y54 A;  2WZY A;  2XQ3 A;  4HFB A;  5LG3 A;  2XQ5 A;  4IL4 A;  3U8L A;  2XQ4 A;  2BG9 B;  3JAD A;  5AFH A;  3SQ6 A;  5HCM A;  2XYS A;  4UM3 A;  2M6B A;  2YOE A;  3WIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...