3UU3A

The glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
311
structure length
305
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 83
structure length 305
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu3A01
2W8GA 2BG9A 5HEUA 3UQ4A 2XZ5A 3JAFA 2Y57A 4ZZBA 5J0ZA 4ZK1A 4ZJSA 5AFMA 3SH1A 3PEOA 2YMEA 2W8FA 3U8KA 2WNCA 4UM1A 4TNWA 4HFEA 4IL9A 4QAAA 2XQAA 4UM3A 2Y54A 3UU6A 5HEGA 5HCMA 4QH5A 3TLVA 3WTOA 4FRRA 5BRXA 4WV9A 2Y7YA 2BR8A 3WTHA 3RQWA 2LKHA 2QC1B 3EI0A 3C84A 2LKGA 5JMEA 3RIFA 2WZYA 2BYRA 2M6IA 5HEJA 3GUAA 2ZJVA 4ZZCA 1OEDA 3T4MA 2WNLA 5AFLA 5CFBA 4UM3S 2BYNA 3EAMA 3C79A 2UZ6A 5BP0A 4AFGA 3P4WA 4ILAA 5TVCA 2Y58A 5HCJA 2WN9A 3WTLA 5KE4A 3TLUA 2XYSA 5J5GA 3PMZA 4ILCA 4HFIA 1UV6A 4EZ1A 2XNTA 2BYQA 3UU8A 2BJ0A 4ZRUA 2PH9A 3WIPA 2XNUA 3JADA 4LMLA 2VL0A 4TNVA 2XNVA 2X00A 3RQUA 3UU3A 4A98A 1UX2A 4ILBA 5HEOA 4ZR6A 4TWDA 3SIOA 4ALXA 3WTMA 5AFNA 5HEHA 5AINA 3WTIA 3UU5A 2XYTA 2BYSA 2XQ7A 2YN6A 2XQ9A 3LSVA 5IUXA 4TWHA 4QH4A 2PGZA 2WNJA 4UM3P 2BR7A 2XQ8A 3U8LA 3U8MA 5CO5A 2X00D 3RIAA 4NZBA 2BG9C 3U8NA 1I9BA 4BFQA 5J5IA 1UW6A 1OEDC 3WTKA 4XK9A 5AFHA 4Z91A 5FJVA 5L47A 2XQ5A 4B5DA 5AFKA 2XQ3A 3U8JA 2KSRA 4XHEA 2M6BA 4HFBA 4NPPA 4UY2A 3ZKRA 3WTNA 2C9TA 3SQ6A 2MAWA 4HFDA 2ZJUA 4DBMA 2XQ6A 3UUBA 4QACA 3TLSA 4X5TA 4PIRA 3UU4A 1OEDE 5LXBA 4LMKA 4COFA 5L4EA 2LLYA 4HQPA 2YKSA 4ZK4A 4UXUA 3EHZA 3ZDHA 4AFHA 4TWFA 2XZ6A 4A97A 4HFHA 2YOEA 3WTJA 4AFTA 3SQ9A 5AFJA 2Y56A 3TLWA 5KZUA 3RI5A 5J5HA 1OEDB 2LM2A 4QABA 2XQ4A 3RHWA 4ZJTA 4BQTA 5AFMB 5LG3A 4LMJA 3TLTA 3JAEA 2YMDA 2BG9B 4IREA 5SYOA 5L4HA 4D01A 4HFCA 2BYPA 2BG9E 3P50A 3UQ7A 3ZDGA 4IL4A 4QH1A 4Z90A 3IGQA 5BW2A 4F8HA 5J5FA
chains in the Genus database with same CATH superfamily
2LSKA 1WYBA 5AQIB 2X0LB 4JLEA 3PUQA 2V7JA 5HEGA 5BMVE 2Y48B 3PU8A 5FXWA 4KUMB 3WTHA 5EZYE 2LKHA 3E0ZA 4PFPA 2VWAA 2WZYA 4DUYT 3SRZA 2HPLA 4UM3S 3C79A 2FUPA 4HFIA 4JYAT 4UV8B 5KDMC 4B3TT 4X66T 4LMLA 2ODVA 3EVYA 5HWXA 1T72A 3WTIA 4YY3T 4DV5T 4F6RC 2UU9T 3UU5A 3H3AA 4DR3T 4CXWA 3ABVA 1W0AA 5E0OA 4LF6T 1MNDA 2WBLA 4YJ3E 4E7SA 4CN6A 2XQYA 1W9RA 2QA7A 3AEDA 3TKLB 5AQLB 4BA9A 4XHEA 4BJNA 4ZOLE 2RA1A 2YDRA 3FZLB 1X79A 3AECA 3G06A 1IBLT 1YQ4A 3RC8A 2NR4A 2DL1A 2YOEA 1MMDA 5AFJA 4ANJA 4NUVA 1EZ3A 2I59A 4IE7A 5L4HA 4P09A 2NOXA 3RGLA 3JC6D 2BYPA 4EB6E 4YHHT 3IGQA 2HN1A 2W8GA 2E9XB 3ZMSB 3Q9DA 4JI1T 1X9BA 3UUXB 4AI6A 1LVKA 5FL0A 3ZYMA 1FMVA 4JEUB 3P7IA 5LMUT 1SUMB 4H63V 4IDZA 2LJLA 2K9AA 1T8BA 3PUYF 3WAKA 3AA6B 3N2GE 3ZN1B 4HTEA 3UUNA 2W67A 4AQYT 4AFGA 3Q5XA 3GN5B 2JRKA 2XYSA 1YW0A 5FY7A 2A72A 5JH7E 2E9XA 4DV1T 1U4QA 2CWYA 1KNPA 5HEOA 2DI4A 4TWDA 5DQVA 3WTMA 1HG5A 5JRCB 1V9DA 3M65A 1GQEA 4ZS3A 4TUYE 1MIVA 2V5DA 2XQ8A 3ZC1A 5EK2A 4Z8XA 2HN2A 4HWDA 4HWHA 1JNRA 3Q2MA 2R6GF 3AAEB 3KINB 3F57A 4FJOA 1UURA 4KP3C 3TLSA 2CXFA 2BVLA 1OEDE 5LXBA 4HQPA 4XBFB 2W66A 2OLTA 3T8OA 4LFBT 2QVAA 2XQ4A 2BKNA 3RHWA 2YU2A 4ZJTA 1UCUA 2YMDA 3AVSA 3F2EA 2ES0A 3EDUA 2BG9E 3RPUA 4JI7T 3I0OA 4EXTA 3I0QA 3AAIA 3AE3A 1BR1A 1D0ZA 2V7LA 2WNCA 5EK3A 4IL9A 4YLHA 3UTKA 3ONLC 2KT9A 4FRRA 4DV7T 5KXJA 4PAGA 4AIUA 5JMEA 5LHHB 1IZNB 2NW8A 3P8CD 5L3BB 2E5VA 2KXPB 3MA9A 4ILAA 4LF7T 2WN9A 2D5UA 2H88A 3UU8A 2Y6XA 5ABGA 5AQOB 2IHR1 3LK2B 3JCFA 5AFNA 3OYXA 3K1SA 2XYTA 4DVDA 4BJMA 3FXDB 3RYHE 3RYIE 3ONJA 1OEDC 3ZYKA 4XK9A 1VCSA 4X1KE 3NRYA 4UVAB 4NPPA 5BR8T 3OPCA 4X1YE 2V26A 4NIQA 5HWYA 3HI2A 3SFDA 1XMQT 4P0AA 2J62A 4U2ZA 4PW8A 3ZPOA 1J5ET 4ZXLA 5DJQC 2X9YA 1OEDB 2VVSA 1XDOA 1O3XA 4LMJA 5LB7B 4D01A 4OK0A 1JNZA 4QH1A 1D0YA 4UELA 2AXDS 3QC9A 4BAYB 4HEAA 5J5FA 4ZI3C 5CA1E 2CXLA 5AFMA 5AQTB 1H7CA 1LRZA 5LGNB 4UM1A 1KFYA 1WLXA 2CLYC 2XM1A 1WR6A 2JMHA 5AQKB 3RF1A 1YKEB 2IMLA 2XHEB 3PURA 5J2UE 2IC6A 2JQ9A 2MBGA 3HL6A 4MALA 3FZKB 4HWFA 3EI0A 2VKOA 2CE7A 2B1EA 2M6IA 3ANWB 2W0GA 4ZZCA 2DLRA 2IUBA 5JDGA 3EAMA 3T1HT 3N9MA 5ABEA 3UU3A 2DWGA 4A98A 1I94T 2EHOA 5FVLA 5L3EB 3A8YC 3C4ZA 2PGZA 4UVCB 2ZM0A 3AA0B 3ZJ2A 3RC3A 4EIWA 3JC6C 4P1NA 3AEGA 4O2AE 3FZHB 2XQ5A 4B5DA 1N32T 1E2AA 3O4XE 1Y01A 2ZJUA 3FHNA 3VR8A 1S94A 3MJXA 2D9DA 2RPAA 2FBWA 4QX8B 3CWZB 3FXEB 2YDSA 3TLWA 2ZM2A 1MNEA 5AFMB 5IHYA 3VRAA 3JAEA 4X64T 4UF0B 5FVKA 4YTPA 3SFEA 4B3ST 1QUUA 4GKKT 2YINA 3OVUA 3AEFA 1J1JA 4TNWA 3B5MA 5IYZE 5LHIB 2BZBA 3K8PC 3AA1B 4AISA 3CKDA 4WV9A 5AQNB 2JMKA 2V6YB 2QRXA 3C50A 1XNRT 2CWOA 1Y64B 2JQQA 4GIWA 5TVCA 4AQGA 1FMWA 4IDPA 3KVBA 4TNVA 2NW7A 3RQUA 5LMNT 3L3PA 2N1GA 5AQRB 3C4WA 2XAGB 5LBMA 3U8MA 5CO5A 2BKPA 4IE4A 3UFEA 2IC9A 4EZ4A 2LRKA 3WTNA 3PDYA 1BR2A 2C9TA 4HE8A 2E2AA 4KBMB 3AXJA 4COFA 1CUNA 2I0MA 2XSAA 5JR9A 4U33A 3VHLA 3GA8A 5JTGA 1HFAA 4BQTA 4PJJA 2K5BB 3RRWA 1SA0E 2BVMA 2C5KT 2G0UA 2RP4A 1NENA 4HFCA 1T7SA 3OBVE 2Z6EA 3ZLIA 4CN4A 2QYWA 4QKNA 4I50E 2WM9A 1VRBA 5LOVE 1FEWA 3PU3A 4ZJSA 4NXNT 3QB5K 4UM3A 1QSDA 2X9HA 2XAFB 3SWHA 5H6QB 2K3WA 4DV2T 1I6ZA 4ILUA 5EK4A 4DR6T 2X9WA 3K3OA 2VKDA 4DR4T 4EZHA 4KX6A 5AFLA 4IGUA 5FKYA 3MACA 3P4PA 5ABFB 5KMGP 2ODUA 2Q9QA 3PUGA 2XSBA 3NRXA 5LNKA 2X00A 2VB6A 5AQVB 2H7VC 3RKGA 1J5WA 1LVFA 2EHOD 1XMOT 5J2TE 4PFOA 4QH4A 4UM3P 2XAHB 2VL8A 2X00D 3LFMA 3NBXX 3WTKA 5AFHA 3ZCJA 3L39A 3IHRA 3AE7A 2CM0A 2KINB 3P4SA 4UY2A 3HKDE 3CX7B 3KBTA 3HKBE 2BDEA 4HKAA 5L3GB 3IA3A 1IJ5A 3ZDHA 2PTFA 2WZIA 2KZ7B 4G2AA 2X9XA 4C90A 2C5JA 3GMIA 4IE0A 2XZEA 3RLFF 3RYCE 1VCTA 4PK4A 2PJQA 5AQFB 4DR7T 3CPZA 1WCRA 4IL4A 2CBJA 2BBJA 3RIUA 2DCFA 5ABHA 4QHOA 3UQ4A 4NUUA 3ZMZB 4ZHQE 4YSZA 4KI0F 4JI3T 4EYUA 2K48A 1L0VA 2YEVC 5AQJB 2IAKA 2HH7A 3U3IA 5C8YE 2PBIA 2LSJA 2M67A 4DIDB 2D2SA 4KMCA 5ETWA 5FY0A 2OA5A 4MHCA 4TV8E 4EGWA 2ZJVA 2W61A 5JDMA 5FNVE 5FY1A 3U78A 2AE9A 3X1DA 3C64A 4EZ1A 3E22E 4U31A 3ZYLA 4A5XA 4TV9E 2BJ0A 4HN9A 3R84B 1UUSA 5FXZA 3F31A 3EABA 1HS7A 3QNUA 1ZKEA 4OYKA 4C91A 3LK42 3ZN0B 2PG8A 5TAOA 2LSYA 3AE4A 4YSXA 5F8PA 5L2LA 1XZYA 4ZS2A 5HXHA 2MAWA 1QLBA 3RKOA 5JDLA 2JPFA 1M62A 3VRBA 2IDOB 4PJLA 3EHZA 3AVRA 4TWFA 3J9X1 4DV4T 4V1Av 3KVAA 3FBZA 4O2BE 2LM2A 3ZEFB 4G63A 1HNXT 3FZFB 2FJEA 2P9BA 4DO0A 3OKQA 3CIRA 5JR9C 2V7IA 3ONXA 3UULA 5BW2A 3CVRA 3CMLA 4JI4T 4K0UA 1AJ3A 3JAFA 1ZEEA 3ZC0A 2YMEA 2W8FA 3U8KA 1MMNA 4WW0A 4E7ZA 4B3MT 2XPKA 1FJGT 4EEDA 4CZZB 2LOPA 2ZM6T 4FI5A 1WR0A 3DP7A 4IE6A 2X67A 4ZRUA 1ZP0A 4ASKA 1KNZA 2UUAT 2L9QA 2V8SV 5L3FB 3AA7B 3BQIA 3RX6A 1HG2A 4DNDA 2JJ9A 4H9QC 5AQMB 2XQ9A 3OJAA 1W0BA 3U8LA 2VKHA 4WZXA 1KF6A 3I9WA 3U8NA 1I9BA 5J5IA 3AE9A 3UUMA 3LK3B 2CA5A 1BR4A 1U5PA 2NTYA 5LJMA 4HFDA 4DBMA 2VK9A 5F3JA 5CA0E 5LA6E 2LLYA 4UXUA 3PUWF 3WTJA 2WSSV 5LBQB 2CHNA 3O1HA 3N2KE 3M3ZB 4QABA 1G73A 4DR2T 2NTXA 5SYOA 3PUZF 3KV9A 3GWHA 4PJMA 4PK6A 2BG9A 2NP9A 4ZI3D 3NZQA 4UF0A 1YQ3A 2Y54A 3UU6A 3ZSTA 3TLVA 2ZLYA 5HXEA 2Y7YA 2BR8A 1MIWA 2CBIA 3RQWA 3W15B 3AE8A 2BYRA 4GOUA 4Q25A 2WAUA 5LYJE 4GYRA 3PMZA 1NEKA 3JADA 4DV0T 3O9XA 1KK7A 4HFVA 4ZR6A 4YHJA 4O4HE 4CQIA 4AXPA 1IBMT 2WNJA 4GYSA 3DJBA 4AKHA 5HYAA 4TX5A 4HFBA 4U3CA 2BS3A 3UUBA 1HCIA 3MXZA 2SPCA 4U72A 3AXJB 2DNXA 3P4RA 3ZSSA 4UIGA 2ZM8A 2WDQA 2XM2A 2LE8A 2UXDT 2CXDA 5LP6E 5JDQA 2Q9QB 2L8KA 1B7TA 4PK5A 2MTQA 2V5CA 3V5UA 2VQFT 4QAAA 4UR9A 2WP9A 3OYZA 5HCMA 2X68A 4EOZB 5ABFA 3KBUA 2JQHA 3PUAA 4U74A 2LEHA 4DV6T 5AQUB 5LGTB 1UK5A 3CQXC 2HPJA 3CQCB 3BQKA 2HHHT 3FB2A 4QXBB 4EEBA 3P4WA 2YDQA 2Y58A 1XWMA 3TLUA 3D0TA 2XAQB 5LCYA 4ISTA 4AKRB 4AQFA 4LF4T 4LF8T 3KFWX 4TWHA 4UXNB 3RIUC 2X0HA 5AQPB 3S4UA 3HA4A 5JR9B 3ZT5A 3O1JA 2FJBA 5FMNA 1DU2A 1R8IA 5AQQB 4QACA 3AAAB 3VR9A 5LXTE 3UU4A 2J47A 3MZKB 5L4EA 1Z8UA 4ERRA 4EAHA 4UVBB 4YT0A 4A97A 3PJAA 4GKJT 2H3RA 1G8XA 2W2UA 4ADZA 2NWBA 2EHOC 4M1PA 3KDSE 1S35A 4JBWF 5HEUA 2DWKA 3IEEA 5J0ZA 2CMRA 2VASA 4OX9T 5DABA 4AKIA 4MBQA 3N9LA 1XDPA 4QH5A 2QGSA 2UUBT 1UX5A 4JI2T 4JV5T 3LJCA 4YFSA 2KLQA 3C84A 1WRDA 2D0TA 3A7MA 2WNLA 5BP0A 3PJAJ 3KV6A 4ILCA 2XNUA 2DHRA 4H9PC 3VU7H 1OWAA 3BK9A 4ILBA 1YXRA 2CLYB 3AE2A 4HWIB 3LSVA 1WFDA 2UXNB 2V7KA 5JREA 3IF8B 1UW6A 3L09A 1SHZC 5AQSB 1N33T 3EDVA 4Z91A 2V6YA 3U8JA 2M6BA 4DBQA 3PUVF 1M7KA 4GK0E 2KNDA 4O4LE 4LMKA 5HXSA 2F4VT 4IE5A 4OFZA 2Y8DA 2VKJA 5FP3A 1MMAA 2BKOA 3SQ9A 2WS3A 2E9XC 2WDVA 3P4QA 4UV9B 4HWCA 1IBKT 2XZ5A 1BR0A 3ETVA 2E9XD 3SH1A 4H9RC 1XNQT 3UT5E 4IT4A 3KV5A 4L9IA 3AEEA 3N9PA 5J1GA 2UXBT 2QC1B 2WDRA 2VURA 3RIFA 2WB5A 2A2FX 3WI3A 2UZ6A 4HGAA 2LHNA 5HCJA 2XNTA 4ZI2C 1IJ6A 4MLKA 1UX2A 4JEHB 4JI0T 3MKDA 3SIOA 2D0UA 3OTOT 3QUJA 3WAJA 5L3CB 3AE6A 3ZT6A 1HX8A 3E08A 1Z0PA 4NZBA 2BG9C 4YJ2E 2XUEA 2Q9QD 1E7PA 3LG7A 4NXMT 1N36T 3SOLA 3GN5A 2V6XA 3CK6A 3N2OA 4AFHA 1MMGA 3ETUA 3PUSA 4HFHA 4DUZT 3AE1A 2MPKA 2ZMAA 4DMWA 5LHGB 5LG3A 4JI8T 3LDQB 4JUYA 3DTOA 4L5GA 3V5SA 2CHOA 3QK6A 4I43B 4CI2B 2A9UA 2L3LA 3I1AA 4DBRA 4ZI7E 5JVDE 2WU2A 5CJ5A 5JRCA 5FYMA 4JI6T 4EV6A 2JIWA 3HKCE 1LKXA 4X1IE 1US7B 2X66A 4H63H 2C5IT 4DMVA 2W63A 2LKGA 2N2NA 2WWVA 3GUAA 4CXYA 2WY2A 3L8RA 5FXXA 2IW5B 5CGMA 4X65T 2WCAA 1UV6A 2CPTA 4CI1B 2VL0A 1N34T 4ALXA 3N9OA 3MK7C 3ZT7A 3AEBA 4LF5T 3C98B 1HNWT 5JDNA 2LSIA 2C0SA 2V7MA 2W4XA 3NKZA 1SE7A 3FZMB 2BR7A 2Q9QC 4BFQA 2CEAA 5L47A 5LG4A 2LT3A 1NAFA 3ANWA 3H3MA 5H6RB 2VVNA 4JI5T 4UEMA 4XAXB 3N9NA 4CI3B 2OV9A 3ZCIA 1HF8A 4PJNA 5LGUB 2XZ6A 4IDQA 5IWAT 3CX8B 4AFTA 2MYSA 4DR5T 1D0XA 4WYVA 3PV0F 2X0YA 3HR0A 3RYFE 3C4XA 3K3QC 2VQET 4DV3T 4DR1T 2X51A 2N9DA 2BS2A 3CX6B 5AQGB 3AE5A 3BQLA 2XQAA 5DQWA 4AKGA 3ZMTB 1KNRA 3FBLA 4O8SA 5A1LA 3H37A 1HX1B 1HR0T 3CQGB 3ZJ1A 4MFRA 4KHPT 4QWNB 2UUCT 1NWMX 5JDHA 4H9SE 3WIPA 3ESLA 5F5WA 2LHRA 2XASB 2XJ7A 1CHUA 4TZ4C 3B13A 3NWIA 5AINA 2LSGA 5LJNA 4YSYA 2BYSA 3Q5EA 2XQ7A 3AB3B 3RIAA 2FJAA 3LBXA 2I6HA 2KSRA 3ZKRA 2CCQA 2W62A 3PE0A 5AQHB 4O4IE 2A3DA 5L3DB 4IDNA 3ZMUB 4K0KT 4AKLA 3VKHA 4OYJA 4QX7B 2WZHA 1YKHB 2LRLA 3AEAA 3TLTA 4I4TE 2KWHA 1WYCA 3LBXB 4A56A 5GONE 2XTLA 2WU5A 4F8HA 2FJDA 4QXHB 2GK9A 5FL1A 3PEOA 4LF9T 4CXXA 2V1DB 3WTOA 2J1DG 2NW9A 4X62T 5BRXA 4ISSA 2KMFA 4WNKA 4GK5E 2YK0A 4H9NC 3N9QA 3NZPA 4WBNE 3RH3A 3T4MA 2K24A 1VOMA 3I9YA 3EUHA 4KHZF 5CFBA 2BYNA 1D1AA 3PTRB 3WTLA 5J5GA 2BYQA 5AFUL 1HNZT 3N5LA 4I0UA 3O1IA 4B3RT 1OXZA 2XNVA 4X20E 5HEHA 3SS1A 2YU1A 5JQGE 3RRCA 2YN6A 5IUXA 4YTNA 4U7YA 3UFGA 5KX5E 2WQYA 4IDOA 1YD8G 1MIYA 4L0RA 4N78D 3SQ6A 4LFCT 2IIUA 2XAJB 4YTMA 4PIRA 1ZOYA 3C51A 3PUXF 3QOFA 5C2TA 4WBOA 5ADXL 1E1HB 2MOZA 2W00A 3K3NA 1UGOA 2E8IA 3RI5A 5J5HA 5JDFA 2BG9B 2LOSA 2H89A 2LM9A 2JQKA 2H7OA 3P50A 2ACZA 2UXCT 1ZHCA 2Y57A 4ZZBA 4ZK1A 1W09A 4HFEA 3ZMVB 1KEYA 1T98A 2WMNA 2E5LT 3IBPA 4U7IA 2BS4A 4IIJE 3QB5A 3B57A 5C3JA 5HEJA 1OEDA 2B76A 4EYYR 3T1YT 2J4GA 3HKEE 3Q5WA 5KE4A 4ZEYA 1D1CA 2PH9A 2CRBA 4CN1A 5FXVA 4TN7B 3Q5DA 3VKGA 4IHJE 4O4JE 4LFAT 5FJVA 1UX4A 5AFKA 2WMOA 1FIOA 2XQ3A 4U2YA 2UXXB 3KV4A 1ZV4X 3A5XA 2ACXA 2XQ6A 4H9OC 4X5TA 5HXCA 4ZI2D 2WWUA 4J2CA 4YXDA 3R6NA 2YKSA 4ZK4A 2KWIB 4PNIA 5M4YA 1D1BA 3NVOA 4OHFA 2BBHA 1IAPA 2Y56A 5CB4E 5HXRA 4P0BA 2EHOB 4I55E 4B6XA 5KZUA 5HAXA 4IREA 2PFVA 4AQFC 3UQ7A 4QXCB 3ZDGA 4Z90A 2XY8B 4XZCA 3J7Yq 1HTJF
chains in the Genus database with same CATH topology
2W8GA 2BG9A 5HEUA 3UQ4A 2XZ5A 3JAFA 2Y57A 4ZZBA 5J0ZA 4ZK1A 4ZJSA 5AFMA 3SH1A 3PEOA 2YMEA 2W8FA 3U8KA 2WNCA 4UM1A 4TNWA 4HFEA 4IL9A 4QAAA 2XQAA 4UM3A 2Y54A 3UU6A 5HEGA 5HCMA 4QH5A 3TLVA 3WTOA 4FRRA 5BRXA 4WV9A 2Y7YA 2BR8A 3WTHA 3RQWA 2LKHA 2QC1B 3EI0A 3C84A 2LKGA 5JMEA 3RIFA 2WZYA 2BYRA 2M6IA 5HEJA 3GUAA 2ZJVA 4ZZCA 1OEDA 3T4MA 2WNLA 5AFLA 5CFBA 4UM3S 2BYNA 3EAMA 3C79A 2UZ6A 5BP0A 4AFGA 3P4WA 4ILAA 5TVCA 2Y58A 5HCJA 2WN9A 3WTLA 5KE4A 3TLUA 2XYSA 5J5GA 3PMZA 4ILCA 4HFIA 1UV6A 4EZ1A 2XNTA 2BYQA 3UU8A 2BJ0A 4ZRUA 2PH9A 3WIPA 2XNUA 3JADA 4LMLA 2VL0A 4TNVA 2XNVA 2X00A 3RQUA 3UU3A 4A98A 1UX2A 4ILBA 5HEOA 4ZR6A 4TWDA 3SIOA 4ALXA 3WTMA 5AFNA 5HEHA 5AINA 3WTIA 3UU5A 2XYTA 2BYSA 2XQ7A 2YN6A 2XQ9A 3LSVA 5IUXA 4TWHA 4QH4A 2PGZA 2WNJA 4UM3P 2BR7A 2XQ8A 3U8LA 3U8MA 5CO5A 2X00D 3RIAA 4NZBA 2BG9C 3U8NA 1I9BA 4BFQA 5J5IA 1UW6A 1OEDC 3WTKA 4XK9A 5AFHA 4Z91A 5FJVA 5L47A 2XQ5A 4B5DA 5AFKA 2XQ3A 3U8JA 2KSRA 4XHEA 2M6BA 4HFBA 4NPPA 4UY2A 3ZKRA 3WTNA 2C9TA 3SQ6A 2MAWA 4HFDA 2ZJUA 4DBMA 2XQ6A 3UUBA 4QACA 3TLSA 4X5TA 4PIRA 3UU4A 1OEDE 5LXBA 4LMKA 4COFA 5L4EA 2LLYA 4HQPA 2YKSA 4ZK4A 4UXUA 3EHZA 3ZDHA 4AFHA 4TWFA 2XZ6A 4A97A 4HFHA 2YOEA 3WTJA 4AFTA 3SQ9A 5AFJA 2Y56A 3TLWA 5KZUA 3RI5A 5J5HA 1OEDB 2LM2A 4QABA 2XQ4A 3RHWA 4ZJTA 4BQTA 5AFMB 5LG3A 4LMJA 3TLTA 3JAEA 2YMDA 2BG9B 4IREA 5SYOA 5L4HA 4D01A 4HFCA 2BYPA 2BG9E 3P50A 3UQ7A 3ZDGA 4IL4A 4QH1A 4Z90A 3IGQA 5BW2A 4F8HA 5J5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W8G A;  2BG9 A;  5HEU A;  3UQ4 A;  2XZ5 A;  3JAF A;  2Y57 A;  4ZZB A;  5J0Z A;  4ZK1 A;  4ZJS A;  5AFM A;  3SH1 A;  3PEO A;  2YME A;  2W8F A;  3U8K A;  2WNC A;  4UM1 A;  4TNW A;  4HFE A;  4IL9 A;  4QAA A;  2XQA A;  4UM3 A;  2Y54 A;  3UU6 A;  5HEG A;  5HCM A;  4QH5 A;  3TLV A;  3WTO A;  4FRR A;  5BRX A;  4WV9 A;  2Y7Y A;  2BR8 A;  3WTH A;  3RQW A;  2LKH A;  2QC1 B;  3EI0 A;  3C84 A;  2LKG A;  5JME A;  3RIF A;  2WZY A;  2BYR A;  2M6I A;  5HEJ A;  3GUA A;  2ZJV A;  4ZZC A;  1OED A;  3T4M A;  2WNL A;  5AFL A;  5CFB A;  4UM3 S;  2BYN A;  3EAM A;  3C79 A;  2UZ6 A;  5BP0 A;  4AFG A;  3P4W A;  4ILA A;  5TVC A;  2Y58 A;  5HCJ A;  2WN9 A;  3WTL A;  5KE4 A;  3TLU A;  2XYS A;  5J5G A;  3PMZ A;  4ILC A;  4HFI A;  1UV6 A;  4EZ1 A;  2XNT A;  2BYQ A;  3UU8 A;  2BJ0 A;  4ZRU A;  2PH9 A;  3WIP A;  2XNU A;  3JAD A;  4LML A;  2VL0 A;  4TNV A;  2XNV A;  2X00 A;  3RQU A;  3UU3 A;  4A98 A;  1UX2 A;  4ILB A;  5HEO A;  4ZR6 A;  4TWD A;  3SIO A;  4ALX A;  3WTM A;  5AFN A;  5HEH A;  5AIN A;  3WTI A;  3UU5 A;  2XYT A;  2BYS A;  2XQ7 A;  2YN6 A;  2XQ9 A;  3LSV A;  5IUX A;  4TWH A;  4QH4 A;  2PGZ A;  2WNJ A;  4UM3 P;  2BR7 A;  2XQ8 A;  3U8L A;  3U8M A;  5CO5 A;  2X00 D;  3RIA A;  4NZB A;  2BG9 C;  3U8N A;  1I9B A;  4BFQ A;  5J5I A;  1UW6 A;  1OED C;  3WTK A;  4XK9 A;  5AFH A;  4Z91 A;  5FJV A;  5L47 A;  2XQ5 A;  4B5D A;  5AFK A;  2XQ3 A;  3U8J A;  2KSR A;  4XHE A;  2M6B A;  4HFB A;  4NPP A;  4UY2 A;  3ZKR A;  3WTN A;  2C9T A;  3SQ6 A;  2MAW A;  4HFD A;  2ZJU A;  4DBM A;  2XQ6 A;  3UUB A;  4QAC A;  3TLS A;  4X5T A;  4PIR A;  3UU4 A;  1OED E;  5LXB A;  4LMK A;  4COF A;  5L4E A;  2LLY A;  4HQP A;  2YKS A;  4ZK4 A;  4UXU A;  3EHZ A;  3ZDH A;  4AFH A;  4TWF A;  2XZ6 A;  4A97 A;  4HFH A;  2YOE A;  3WTJ A;  4AFT A;  3SQ9 A;  5AFJ A;  2Y56 A;  3TLW A;  5KZU A;  3RI5 A;  5J5H A;  1OED B;  2LM2 A;  4QAB A;  2XQ4 A;  3RHW A;  4ZJT A;  4BQT A;  5AFM B;  5LG3 A;  4LMJ A;  3TLT A;  3JAE A;  2YMD A;  2BG9 B;  4IRE A;  5SYO A;  5L4H A;  4D01 A;  4HFC A;  2BYP A;  2BG9 E;  3P50 A;  3UQ7 A;  3ZDG A;  4IL4 A;  4QH1 A;  4Z90 A;  3IGQ A;  5BW2 A;  4F8H A;  5J5F A; 
#chains in the Genus database with same CATH topology
 2LSK A;  1WYB A;  5AQI B;  2X0L B;  4JLE A;  3PUQ A;  2V7J A;  5HEG A;  5BMV E;  2Y48 B;  3PU8 A;  5FXW A;  4KUM B;  3WTH A;  5EZY E;  2LKH A;  3E0Z A;  4PFP A;  2VWA A;  2WZY A;  4DUY T;  3SRZ A;  2HPL A;  4UM3 S;  3C79 A;  2FUP A;  4HFI A;  4JYA T;  4UV8 B;  5KDM C;  4B3T T;  4X66 T;  4LML A;  2ODV A;  3EVY A;  5HWX A;  1T72 A;  3WTI A;  4YY3 T;  4DV5 T;  4F6R C;  2UU9 T;  3UU5 A;  3H3A A;  4DR3 T;  4CXW A;  3ABV A;  1W0A A;  5E0O A;  4LF6 T;  1MND A;  2WBL A;  4YJ3 E;  4E7S A;  4CN6 A;  2XQY A;  1W9R A;  2QA7 A;  3AED A;  3TKL B;  5AQL B;  4BA9 A;  4XHE A;  4BJN A;  4ZOL E;  2RA1 A;  2YDR A;  3FZL B;  1X79 A;  3AEC A;  3G06 A;  1IBL T;  1YQ4 A;  3RC8 A;  2NR4 A;  2DL1 A;  2YOE A;  1MMD A;  5AFJ A;  4ANJ A;  4NUV A;  1EZ3 A;  2I59 A;  4IE7 A;  5L4H A;  4P09 A;  2NOX A;  3RGL A;  3JC6 D;  2BYP A;  4EB6 E;  4YHH T;  3IGQ A;  2HN1 A;  2W8G A;  2E9X B;  3ZMS B;  3Q9D A;  4JI1 T;  1X9B A;  3UUX B;  4AI6 A;  1LVK A;  5FL0 A;  3ZYM A;  1FMV A;  4JEU B;  3P7I A;  5LMU T;  1SUM B;  4H63 V;  4IDZ A;  2LJL A;  2K9A A;  1T8B A;  3PUY F;  3WAK A;  3AA6 B;  3N2G E;  3ZN1 B;  4HTE A;  3UUN A;  2W67 A;  4AQY T;  4AFG A;  3Q5X A;  3GN5 B;  2JRK A;  2XYS A;  1YW0 A;  5FY7 A;  2A72 A;  5JH7 E;  2E9X A;  4DV1 T;  1U4Q A;  2CWY A;  1KNP A;  5HEO A;  2DI4 A;  4TWD A;  5DQV A;  3WTM A;  1HG5 A;  5JRC B;  1V9D A;  3M65 A;  1GQE A;  4ZS3 A;  4TUY E;  1MIV A;  2V5D A;  2XQ8 A;  3ZC1 A;  5EK2 A;  4Z8X A;  2HN2 A;  4HWD A;  4HWH A;  1JNR A;  3Q2M A;  2R6G F;  3AAE B;  3KIN B;  3F57 A;  4FJO A;  1UUR A;  4KP3 C;  3TLS A;  2CXF A;  2BVL A;  1OED E;  5LXB A;  4HQP A;  4XBF B;  2W66 A;  2OLT A;  3T8O A;  4LFB T;  2QVA A;  2XQ4 A;  2BKN A;  3RHW A;  2YU2 A;  4ZJT A;  1UCU A;  2YMD A;  3AVS A;  3F2E A;  2ES0 A;  3EDU A;  2BG9 E;  3RPU A;  4JI7 T;  3I0O A;  4EXT A;  3I0Q A;  3AAI A;  3AE3 A;  1BR1 A;  1D0Z A;  2V7L A;  2WNC A;  5EK3 A;  4IL9 A;  4YLH A;  3UTK A;  3ONL C;  2KT9 A;  4FRR A;  4DV7 T;  5KXJ A;  4PAG A;  4AIU A;  5JME A;  5LHH B;  1IZN B;  2NW8 A;  3P8C D;  5L3B B;  2E5V A;  2KXP B;  3MA9 A;  4ILA A;  4LF7 T;  2WN9 A;  2D5U A;  2H88 A;  3UU8 A;  2Y6X A;  5ABG A;  5AQO B;  2IHR 1;  3LK2 B;  3JCF A;  5AFN A;  3OYX A;  3K1S A;  2XYT A;  4DVD A;  4BJM A;  3FXD B;  3RYH E;  3RYI E;  3ONJ A;  1OED C;  3ZYK A;  4XK9 A;  1VCS A;  4X1K E;  3NRY A;  4UVA B;  4NPP A;  5BR8 T;  3OPC A;  4X1Y E;  2V26 A;  4NIQ A;  5HWY A;  3HI2 A;  3SFD A;  1XMQ T;  4P0A A;  2J62 A;  4U2Z A;  4PW8 A;  3ZPO A;  1J5E T;  4ZXL A;  5DJQ C;  2X9Y A;  1OED B;  2VVS A;  1XDO A;  1O3X A;  4LMJ A;  5LB7 B;  4D01 A;  4OK0 A;  1JNZ A;  4QH1 A;  1D0Y A;  4UEL A;  2AXD S;  3QC9 A;  4BAY B;  4HEA A;  5J5F A;  4ZI3 C;  5CA1 E;  2CXL A;  5AFM A;  5AQT B;  1H7C A;  1LRZ A;  5LGN B;  4UM1 A;  1KFY A;  1WLX A;  2CLY C;  2XM1 A;  1WR6 A;  2JMH A;  5AQK B;  3RF1 A;  1YKE B;  2IML A;  2XHE B;  3PUR A;  5J2U E;  2IC6 A;  2JQ9 A;  2MBG A;  3HL6 A;  4MAL A;  3FZK B;  4HWF A;  3EI0 A;  2VKO A;  2CE7 A;  2B1E A;  2M6I A;  3ANW B;  2W0G A;  4ZZC A;  2DLR A;  2IUB A;  5JDG A;  3EAM A;  3T1H T;  3N9M A;  5ABE A;  3UU3 A;  2DWG A;  4A98 A;  1I94 T;  2EHO A;  5FVL A;  5L3E B;  3A8Y C;  3C4Z A;  2PGZ A;  4UVC B;  2ZM0 A;  3AA0 B;  3ZJ2 A;  3RC3 A;  4EIW A;  3JC6 C;  4P1N A;  3AEG A;  4O2A E;  3FZH B;  2XQ5 A;  4B5D A;  1N32 T;  1E2A A;  3O4X E;  1Y01 A;  2ZJU A;  3FHN A;  3VR8 A;  1S94 A;  3MJX A;  2D9D A;  2RPA A;  2FBW A;  4QX8 B;  3CWZ B;  3FXE B;  2YDS A;  3TLW A;  2ZM2 A;  1MNE A;  5AFM B;  5IHY A;  3VRA A;  3JAE A;  4X64 T;  4UF0 B;  5FVK A;  4YTP A;  3SFE A;  4B3S T;  1QUU A;  4GKK T;  2YIN A;  3OVU A;  3AEF A;  1J1J A;  4TNW A;  3B5M A;  5IYZ E;  5LHI B;  2BZB A;  3K8P C;  3AA1 B;  4AIS A;  3CKD A;  4WV9 A;  5AQN B;  2JMK A;  2V6Y B;  2QRX A;  3C50 A;  1XNR T;  2CWO A;  1Y64 B;  2JQQ A;  4GIW A;  5TVC A;  4AQG A;  1FMW A;  4IDP A;  3KVB A;  4TNV A;  2NW7 A;  3RQU A;  5LMN T;  3L3P A;  2N1G A;  5AQR B;  3C4W A;  2XAG B;  5LBM A;  3U8M A;  5CO5 A;  2BKP A;  4IE4 A;  3UFE A;  2IC9 A;  4EZ4 A;  2LRK A;  3WTN A;  3PDY A;  1BR2 A;  2C9T A;  4HE8 A;  2E2A A;  4KBM B;  3AXJ A;  4COF A;  1CUN A;  2I0M A;  2XSA A;  5JR9 A;  4U33 A;  3VHL A;  3GA8 A;  5JTG A;  1HFA A;  4BQT A;  4PJJ A;  2K5B B;  3RRW A;  1SA0 E;  2BVM A;  2C5K T;  2G0U A;  2RP4 A;  1NEN A;  4HFC A;  1T7S A;  3OBV E;  2Z6E A;  3ZLI A;  4CN4 A;  2QYW A;  4QKN A;  4I50 E;  2WM9 A;  1VRB A;  5LOV E;  1FEW A;  3PU3 A;  4ZJS A;  4NXN T;  3QB5 K;  4UM3 A;  1QSD A;  2X9H A;  2XAF B;  3SWH A;  5H6Q B;  2K3W A;  4DV2 T;  1I6Z A;  4ILU A;  5EK4 A;  4DR6 T;  2X9W A;  3K3O A;  2VKD A;  4DR4 T;  4EZH A;  4KX6 A;  5AFL A;  4IGU A;  5FKY A;  3MAC A;  3P4P A;  5ABF B;  5KMG P;  2ODU A;  2Q9Q A;  3PUG A;  2XSB A;  3NRX A;  5LNK A;  2X00 A;  2VB6 A;  5AQV B;  2H7V C;  3RKG A;  1J5W A;  1LVF A;  2EHO D;  1XMO T;  5J2T E;  4PFO A;  4QH4 A;  4UM3 P;  2XAH B;  2VL8 A;  2X00 D;  3LFM A;  3NBX X;  3WTK A;  5AFH A;  3ZCJ A;  3L39 A;  3IHR A;  3AE7 A;  2CM0 A;  2KIN B;  3P4S A;  4UY2 A;  3HKD E;  3CX7 B;  3KBT A;  3HKB E;  2BDE A;  4HKA A;  5L3G B;  3IA3 A;  1IJ5 A;  3ZDH A;  2PTF A;  2WZI A;  2KZ7 B;  4G2A A;  2X9X A;  4C90 A;  2C5J A;  3GMI A;  4IE0 A;  2XZE A;  3RLF F;  3RYC E;  1VCT A;  4PK4 A;  2PJQ A;  5AQF B;  4DR7 T;  3CPZ A;  1WCR A;  4IL4 A;  2CBJ A;  2BBJ A;  3RIU A;  2DCF A;  5ABH A;  4QHO A;  3UQ4 A;  4NUU A;  3ZMZ B;  4ZHQ E;  4YSZ A;  4KI0 F;  4JI3 T;  4EYU A;  2K48 A;  1L0V A;  2YEV C;  5AQJ B;  2IAK A;  2HH7 A;  3U3I A;  5C8Y E;  2PBI A;  2LSJ A;  2M67 A;  4DID B;  2D2S A;  4KMC A;  5ETW A;  5FY0 A;  2OA5 A;  4MHC A;  4TV8 E;  4EGW A;  2ZJV A;  2W61 A;  5JDM A;  5FNV E;  5FY1 A;  3U78 A;  2AE9 A;  3X1D A;  3C64 A;  4EZ1 A;  3E22 E;  4U31 A;  3ZYL A;  4A5X A;  4TV9 E;  2BJ0 A;  4HN9 A;  3R84 B;  1UUS A;  5FXZ A;  3F31 A;  3EAB A;  1HS7 A;  3QNU A;  1ZKE A;  4OYK A;  4C91 A;  3LK4 2;  3ZN0 B;  2PG8 A;  5TAO A;  2LSY A;  3AE4 A;  4YSX A;  5F8P A;  5L2L A;  1XZY A;  4ZS2 A;  5HXH A;  2MAW A;  1QLB A;  3RKO A;  5JDL A;  2JPF A;  1M62 A;  3VRB A;  2IDO B;  4PJL A;  3EHZ A;  3AVR A;  4TWF A;  3J9X 1;  4DV4 T;  4V1A v;  3KVA A;  3FBZ A;  4O2B E;  2LM2 A;  3ZEF B;  4G63 A;  1HNX T;  3FZF B;  2FJE A;  2P9B A;  4DO0 A;  3OKQ A;  3CIR A;  5JR9 C;  2V7I A;  3ONX A;  3UUL A;  5BW2 A;  3CVR A;  3CML A;  4JI4 T;  4K0U A;  1AJ3 A;  3JAF A;  1ZEE A;  3ZC0 A;  2YME A;  2W8F A;  3U8K A;  1MMN A;  4WW0 A;  4E7Z A;  4B3M T;  2XPK A;  1FJG T;  4EED A;  4CZZ B;  2LOP A;  2ZM6 T;  4FI5 A;  1WR0 A;  3DP7 A;  4IE6 A;  2X67 A;  4ZRU A;  1ZP0 A;  4ASK A;  1KNZ A;  2UUA T;  2L9Q A;  2V8S V;  5L3F B;  3AA7 B;  3BQI A;  3RX6 A;  1HG2 A;  4DND A;  2JJ9 A;  4H9Q C;  5AQM B;  2XQ9 A;  3OJA A;  1W0B A;  3U8L A;  2VKH A;  4WZX A;  1KF6 A;  3I9W A;  3U8N A;  1I9B A;  5J5I A;  3AE9 A;  3UUM A;  3LK3 B;  2CA5 A;  1BR4 A;  1U5P A;  2NTY A;  5LJM A;  4HFD A;  4DBM A;  2VK9 A;  5F3J A;  5CA0 E;  5LA6 E;  2LLY A;  4UXU A;  3PUW F;  3WTJ A;  2WSS V;  5LBQ B;  2CHN A;  3O1H A;  3N2K E;  3M3Z B;  4QAB A;  1G73 A;  4DR2 T;  2NTX A;  5SYO A;  3PUZ F;  3KV9 A;  3GWH A;  4PJM A;  4PK6 A;  2BG9 A;  2NP9 A;  4ZI3 D;  3NZQ A;  4UF0 A;  1YQ3 A;  2Y54 A;  3UU6 A;  3ZST A;  3TLV A;  2ZLY A;  5HXE A;  2Y7Y A;  2BR8 A;  1MIW A;  2CBI A;  3RQW A;  3W15 B;  3AE8 A;  2BYR A;  4GOU A;  4Q25 A;  2WAU A;  5LYJ E;  4GYR A;  3PMZ A;  1NEK A;  3JAD A;  4DV0 T;  3O9X A;  1KK7 A;  4HFV A;  4ZR6 A;  4YHJ A;  4O4H E;  4CQI A;  4AXP A;  1IBM T;  2WNJ A;  4GYS A;  3DJB A;  4AKH A;  5HYA A;  4TX5 A;  4HFB A;  4U3C A;  2BS3 A;  3UUB A;  1HCI A;  3MXZ A;  2SPC A;  4U72 A;  3AXJ B;  2DNX A;  3P4R A;  3ZSS A;  4UIG A;  2ZM8 A;  2WDQ A;  2XM2 A;  2LE8 A;  2UXD T;  2CXD A;  5LP6 E;  5JDQ A;  2Q9Q B;  2L8K A;  1B7T A;  4PK5 A;  2MTQ A;  2V5C A;  3V5U A;  2VQF T;  4QAA A;  4UR9 A;  2WP9 A;  3OYZ A;  5HCM A;  2X68 A;  4EOZ B;  5ABF A;  3KBU A;  2JQH A;  3PUA A;  4U74 A;  2LEH A;  4DV6 T;  5AQU B;  5LGT B;  1UK5 A;  3CQX C;  2HPJ A;  3CQC B;  3BQK A;  2HHH T;  3FB2 A;  4QXB B;  4EEB A;  3P4W A;  2YDQ A;  2Y58 A;  1XWM A;  3TLU A;  3D0T A;  2XAQ B;  5LCY A;  4IST A;  4AKR B;  4AQF A;  4LF4 T;  4LF8 T;  3KFW X;  4TWH A;  4UXN B;  3RIU C;  2X0H A;  5AQP B;  3S4U A;  3HA4 A;  5JR9 B;  3ZT5 A;  3O1J A;  2FJB A;  5FMN A;  1DU2 A;  1R8I A;  5AQQ B;  4QAC A;  3AAA B;  3VR9 A;  5LXT E;  3UU4 A;  2J47 A;  3MZK B;  5L4E A;  1Z8U A;  4ERR A;  4EAH A;  4UVB B;  4YT0 A;  4A97 A;  3PJA A;  4GKJ T;  2H3R A;  1G8X A;  2W2U A;  4ADZ A;  2NWB A;  2EHO C;  4M1P A;  3KDS E;  1S35 A;  4JBW F;  5HEU A;  2DWK A;  3IEE A;  5J0Z A;  2CMR A;  2VAS A;  4OX9 T;  5DAB A;  4AKI A;  4MBQ A;  3N9L A;  1XDP A;  4QH5 A;  2QGS A;  2UUB T;  1UX5 A;  4JI2 T;  4JV5 T;  3LJC A;  4YFS A;  2KLQ A;  3C84 A;  1WRD A;  2D0T A;  3A7M A;  2WNL A;  5BP0 A;  3PJA J;  3KV6 A;  4ILC A;  2XNU A;  2DHR A;  4H9P C;  3VU7 H;  1OWA A;  3BK9 A;  4ILB A;  1YXR A;  2CLY B;  3AE2 A;  4HWI B;  3LSV A;  1WFD A;  2UXN B;  2V7K A;  5JRE A;  3IF8 B;  1UW6 A;  3L09 A;  1SHZ C;  5AQS B;  1N33 T;  3EDV A;  4Z91 A;  2V6Y A;  3U8J A;  2M6B A;  4DBQ A;  3PUV F;  1M7K A;  4GK0 E;  2KND A;  4O4L E;  4LMK A;  5HXS A;  2F4V T;  4IE5 A;  4OFZ A;  2Y8D A;  2VKJ A;  5FP3 A;  1MMA A;  2BKO A;  3SQ9 A;  2WS3 A;  2E9X C;  2WDV A;  3P4Q A;  4UV9 B;  4HWC A;  1IBK T;  2XZ5 A;  1BR0 A;  3ETV A;  2E9X D;  3SH1 A;  4H9R C;  1XNQ T;  3UT5 E;  4IT4 A;  3KV5 A;  4L9I A;  3AEE A;  3N9P A;  5J1G A;  2UXB T;  2QC1 B;  2WDR A;  2VUR A;  3RIF A;  2WB5 A;  2A2F X;  3WI3 A;  2UZ6 A;  4HGA A;  2LHN A;  5HCJ A;  2XNT A;  4ZI2 C;  1IJ6 A;  4MLK A;  1UX2 A;  4JEH B;  4JI0 T;  3MKD A;  3SIO A;  2D0U A;  3OTO T;  3QUJ A;  3WAJ A;  5L3C B;  3AE6 A;  3ZT6 A;  1HX8 A;  3E08 A;  1Z0P A;  4NZB A;  2BG9 C;  4YJ2 E;  2XUE A;  2Q9Q D;  1E7P A;  3LG7 A;  4NXM T;  1N36 T;  3SOL A;  3GN5 A;  2V6X A;  3CK6 A;  3N2O A;  4AFH A;  1MMG A;  3ETU A;  3PUS A;  4HFH A;  4DUZ T;  3AE1 A;  2MPK A;  2ZMA A;  4DMW A;  5LHG B;  5LG3 A;  4JI8 T;  3LDQ B;  4JUY A;  3DTO A;  4L5G A;  3V5S A;  2CHO A;  3QK6 A;  4I43 B;  4CI2 B;  2A9U A;  2L3L A;  3I1A A;  4DBR A;  4ZI7 E;  5JVD E;  2WU2 A;  5CJ5 A;  5JRC A;  5FYM A;  4JI6 T;  4EV6 A;  2JIW A;  3HKC E;  1LKX A;  4X1I E;  1US7 B;  2X66 A;  4H63 H;  2C5I T;  4DMV A;  2W63 A;  2LKG A;  2N2N A;  2WWV A;  3GUA A;  4CXY A;  2WY2 A;  3L8R A;  5FXX A;  2IW5 B;  5CGM A;  4X65 T;  2WCA A;  1UV6 A;  2CPT A;  4CI1 B;  2VL0 A;  1N34 T;  4ALX A;  3N9O A;  3MK7 C;  3ZT7 A;  3AEB A;  4LF5 T;  3C98 B;  1HNW T;  5JDN A;  2LSI A;  2C0S A;  2V7M A;  2W4X A;  3NKZ A;  1SE7 A;  3FZM B;  2BR7 A;  2Q9Q C;  4BFQ A;  2CEA A;  5L47 A;  5LG4 A;  2LT3 A;  1NAF A;  3ANW A;  3H3M A;  5H6R B;  2VVN A;  4JI5 T;  4UEM A;  4XAX B;  3N9N A;  4CI3 B;  2OV9 A;  3ZCI A;  1HF8 A;  4PJN A;  5LGU B;  2XZ6 A;  4IDQ A;  5IWA T;  3CX8 B;  4AFT A;  2MYS A;  4DR5 T;  1D0X A;  4WYV A;  3PV0 F;  2X0Y A;  3HR0 A;  3RYF E;  3C4X A;  3K3Q C;  2VQE T;  4DV3 T;  4DR1 T;  2X51 A;  2N9D A;  2BS2 A;  3CX6 B;  5AQG B;  3AE5 A;  3BQL A;  2XQA A;  5DQW A;  4AKG A;  3ZMT B;  1KNR A;  3FBL A;  4O8S A;  5A1L A;  3H37 A;  1HX1 B;  1HR0 T;  3CQG B;  3ZJ1 A;  4MFR A;  4KHP T;  4QWN B;  2UUC T;  1NWM X;  5JDH A;  4H9S E;  3WIP A;  3ESL A;  5F5W A;  2LHR A;  2XAS B;  2XJ7 A;  1CHU A;  4TZ4 C;  3B13 A;  3NWI A;  5AIN A;  2LSG A;  5LJN A;  4YSY A;  2BYS A;  3Q5E A;  2XQ7 A;  3AB3 B;  3RIA A;  2FJA A;  3LBX A;  2I6H A;  2KSR A;  3ZKR A;  2CCQ A;  2W62 A;  3PE0 A;  5AQH B;  4O4I E;  2A3D A;  5L3D B;  4IDN A;  3ZMU B;  4K0K T;  4AKL A;  3VKH A;  4OYJ A;  4QX7 B;  2WZH A;  1YKH B;  2LRL A;  3AEA A;  3TLT A;  4I4T E;  2KWH A;  1WYC A;  3LBX B;  4A56 A;  5GON E;  2XTL A;  2WU5 A;  4F8H A;  2FJD A;  4QXH B;  2GK9 A;  5FL1 A;  3PEO A;  4LF9 T;  4CXX A;  2V1D B;  3WTO A;  2J1D G;  2NW9 A;  4X62 T;  5BRX A;  4ISS A;  2KMF A;  4WNK A;  4GK5 E;  2YK0 A;  4H9N C;  3N9Q A;  3NZP A;  4WBN E;  3RH3 A;  3T4M A;  2K24 A;  1VOM A;  3I9Y A;  3EUH A;  4KHZ F;  5CFB A;  2BYN A;  1D1A A;  3PTR B;  3WTL A;  5J5G A;  2BYQ A;  5AFU L;  1HNZ T;  3N5L A;  4I0U A;  3O1I A;  4B3R T;  1OXZ A;  2XNV A;  4X20 E;  5HEH A;  3SS1 A;  2YU1 A;  5JQG E;  3RRC A;  2YN6 A;  5IUX A;  4YTN A;  4U7Y A;  3UFG A;  5KX5 E;  2WQY A;  4IDO A;  1YD8 G;  1MIY A;  4L0R A;  4N78 D;  3SQ6 A;  4LFC T;  2IIU A;  2XAJ B;  4YTM A;  4PIR A;  1ZOY A;  3C51 A;  3PUX F;  3QOF A;  5C2T A;  4WBO A;  5ADX L;  1E1H B;  2MOZ A;  2W00 A;  3K3N A;  1UGO A;  2E8I A;  3RI5 A;  5J5H A;  5JDF A;  2BG9 B;  2LOS A;  2H89 A;  2LM9 A;  2JQK A;  2H7O A;  3P50 A;  2ACZ A;  2UXC T;  1ZHC A;  2Y57 A;  4ZZB A;  4ZK1 A;  1W09 A;  4HFE A;  3ZMV B;  1KEY A;  1T98 A;  2WMN A;  2E5L T;  3IBP A;  4U7I A;  2BS4 A;  4IIJ E;  3QB5 A;  3B57 A;  5C3J A;  5HEJ A;  1OED A;  2B76 A;  4EYY R;  3T1Y T;  2J4G A;  3HKE E;  3Q5W A;  5KE4 A;  4ZEY A;  1D1C A;  2PH9 A;  2CRB A;  4CN1 A;  5FXV A;  4TN7 B;  3Q5D A;  3VKG A;  4IHJ E;  4O4J E;  4LFA T;  5FJV A;  1UX4 A;  5AFK A;  2WMO A;  1FIO A;  2XQ3 A;  4U2Y A;  2UXX B;  3KV4 A;  1ZV4 X;  3A5X A;  2ACX A;  2XQ6 A;  4H9O C;  4X5T A;  5HXC A;  4ZI2 D;  2WWU A;  4J2C A;  4YXD A;  3R6N A;  2YKS A;  4ZK4 A;  2KWI B;  4PNI A;  5M4Y A;  1D1B A;  3NVO A;  4OHF A;  2BBH A;  1IAP A;  2Y56 A;  5CB4 E;  5HXR A;  4P0B A;  2EHO B;  4I55 E;  4B6X A;  5KZU A;  5HAX A;  4IRE A;  2PFV A;  4AQF C;  3UQ7 A;  4QXC B;  3ZDG A;  4Z90 A;  2XY8 B;  4XZC A;  3J7Y q;  1HTJ F; 
#chains in the Genus database with same CATH homology
 2W8G A;  2BG9 A;  5HEU A;  3UQ4 A;  2XZ5 A;  3JAF A;  2Y57 A;  4ZZB A;  5J0Z A;  4ZK1 A;  4ZJS A;  5AFM A;  3SH1 A;  3PEO A;  2YME A;  2W8F A;  3U8K A;  2WNC A;  4UM1 A;  4TNW A;  4HFE A;  4IL9 A;  4QAA A;  2XQA A;  4UM3 A;  2Y54 A;  3UU6 A;  5HEG A;  5HCM A;  4QH5 A;  3TLV A;  3WTO A;  4FRR A;  5BRX A;  4WV9 A;  2Y7Y A;  2BR8 A;  3WTH A;  3RQW A;  2LKH A;  2QC1 B;  3EI0 A;  3C84 A;  2LKG A;  5JME A;  3RIF A;  2WZY A;  2BYR A;  2M6I A;  5HEJ A;  3GUA A;  2ZJV A;  4ZZC A;  1OED A;  3T4M A;  2WNL A;  5AFL A;  5CFB A;  4UM3 S;  2BYN A;  3EAM A;  3C79 A;  2UZ6 A;  5BP0 A;  4AFG A;  3P4W A;  4ILA A;  5TVC A;  2Y58 A;  5HCJ A;  2WN9 A;  3WTL A;  5KE4 A;  3TLU A;  2XYS A;  5J5G A;  3PMZ A;  4ILC A;  4HFI A;  1UV6 A;  4EZ1 A;  2XNT A;  2BYQ A;  3UU8 A;  2BJ0 A;  4ZRU A;  2PH9 A;  3WIP A;  2XNU A;  3JAD A;  4LML A;  2VL0 A;  4TNV A;  2XNV A;  2X00 A;  3RQU A;  3UU3 A;  4A98 A;  1UX2 A;  4ILB A;  5HEO A;  4ZR6 A;  4TWD A;  3SIO A;  4ALX A;  3WTM A;  5AFN A;  5HEH A;  5AIN A;  3WTI A;  3UU5 A;  2XYT A;  2BYS A;  2XQ7 A;  2YN6 A;  2XQ9 A;  3LSV A;  5IUX A;  4TWH A;  4QH4 A;  2PGZ A;  2WNJ A;  4UM3 P;  2BR7 A;  2XQ8 A;  3U8L A;  3U8M A;  5CO5 A;  2X00 D;  3RIA A;  4NZB A;  2BG9 C;  3U8N A;  1I9B A;  4BFQ A;  5J5I A;  1UW6 A;  1OED C;  3WTK A;  4XK9 A;  5AFH A;  4Z91 A;  5FJV A;  5L47 A;  2XQ5 A;  4B5D A;  5AFK A;  2XQ3 A;  3U8J A;  2KSR A;  4XHE A;  2M6B A;  4HFB A;  4NPP A;  4UY2 A;  3ZKR A;  3WTN A;  2C9T A;  3SQ6 A;  2MAW A;  4HFD A;  2ZJU A;  4DBM A;  2XQ6 A;  3UUB A;  4QAC A;  3TLS A;  4X5T A;  4PIR A;  3UU4 A;  1OED E;  5LXB A;  4LMK A;  4COF A;  5L4E A;  2LLY A;  4HQP A;  2YKS A;  4ZK4 A;  4UXU A;  3EHZ A;  3ZDH A;  4AFH A;  4TWF A;  2XZ6 A;  4A97 A;  4HFH A;  2YOE A;  3WTJ A;  4AFT A;  3SQ9 A;  5AFJ A;  2Y56 A;  3TLW A;  5KZU A;  3RI5 A;  5J5H A;  1OED B;  2LM2 A;  4QAB A;  2XQ4 A;  3RHW A;  4ZJT A;  4BQT A;  5AFM B;  5LG3 A;  4LMJ A;  3TLT A;  3JAE A;  2YMD A;  2BG9 B;  4IRE A;  5SYO A;  5L4H A;  4D01 A;  4HFC A;  2BYP A;  2BG9 E;  3P50 A;  3UQ7 A;  3ZDG A;  4IL4 A;  4QH1 A;  4Z90 A;  3IGQ A;  5BW2 A;  4F8H A;  5J5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...