3UU3A

The glic pentameric ligand-gated ion channel loop2-20' oxidized mutant in a locally-closed conformation (lc1 subtype)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
311
structure length
305
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVECNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 83
structure length 305
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu3A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu3A01
1UX2A 4IL4A 5HEJA 5AINA 3WTOA 2BG9B 2XQ9A 4F8HA 5BP0A 4X5TA 3GUAA 2Y7YA 4ZJSA 3RIFA 2W8FA 3UQ4A 5BW2A 3JAFA 3WTJA 3JAEA 2XQ5A 3U8KA 2Y56A 4TNWA 4QH4A 2LLYA 5J5FA 5KE4A 4UXUA 5KZUA 3U8MA 3P4WA 5JMEA 2XQ6A 2XNTA 2BYQA 4TWHA 3WTKA 4NZBA 3TLVA 5AFKA 3WTMA 4HFEA 5TVCA 3P50A 3SQ6A 2ZJVA 4BQTA 2BG9A 4ZZCA 3WTHA 2WN9A 4HFDA 4HFIA 3UU4A 4COFA 2Y58A 2YMEA 3UQ7A 3RQWA 4UM1A 3SQ9A 4AFHA 4ILBA 4FRRA 3EAMA 2XQ4A 4PIRA 5AFJA 3UU8A 5CFBA 3JADA 2W8GA 4QACA 2XQ7A 2BR7A 2LKHA 3WTLA 2X00A 4IL9A 2YKSA 3RI5A 5AFNA 1OEDA 3TLWA 5HCMA 5AFLA 5HEHA 3TLSA 2BYPA 4A98A 2XQ3A 5J0ZA 2X00D 3ZDGA 5AFHA 2XQAA 4UM3S 3RQUA 2XYTA 2BYRA 2WNCA 5FJVA 4XHEA 3U8NA 3U8JA 4Z91A 3C84A 4B5DA 5J5IA 4ZJTA 4UM3P 3SIOA 3UU5A 4AFGA 5AFMA 3WTIA 3PMZA 2Y54A 3EHZA 3C79A 3T4MA 5HEUA 3IGQA 2KSRA 5LG3A 4QAAA 2VL0A 2XYSA 4LMLA 4LMKA 2XZ6A 3ZDHA 4Z90A 3U8LA 4AFTA 4ALXA 5J5GA 4TWDA 4ZR6A 4TNVA 5CO5A 3WTNA 5J5HA 4BFQA 5IUXA 4A97A 4TWFA 2M6IA 4HFCA 3ZKRA 3TLUA 3UU6A 5L4HA 2WNLA 4UM3A 2XNVA 3TLTA 5BRXA 4ZRUA 2Y57A 3RHWA 5L4EA 2C9TA 2QC1B 4QH1A 4HFHA 3EI0A 3SH1A 3PEOA 3UUBA 2XZ5A 4NPPA 4QABA 4HFBA 2LM2A 4HQPA 4LMJA 2PH9A 2YMDA 4ZK4A 3WIPA 2WZYA 2XQ8A 2BG9C 2BG9E 5HEOA 2BJ0A 4WV9A 4ZZBA 2M6BA 3LSVA 4XK9A 3UU3A 5SYOA 2YN6A 4IREA 4ILCA 2YOEA 5L47A 2BR8A 2UZ6A 1UW6A 4UY2A 1OEDB 3RIAA 4DBMA 2MAWA 2BYNA 4D01A 1OEDC 1OEDE 5HEGA 2PGZA 2ZJUA 4ILAA 4QH5A 1I9BA 4EZ1A 2WNJA 2XNUA 2BYSA 2LKGA 5LXBA 1UV6A 4ZK1A 5AFMB 5HCJA
chains in the Genus database with same CATH superfamily
2MPKA 2N1GA 3IEEA 2LT3A 4I4TE 4UVCB 5BW2A 1Z8UA 3JC6D 4EEBA 3M3ZB 2NWBA 3ZT7A 3RYHE 4NZBA 2C5JA 1MMAA 2W66A 3A5XA 3P50A 5FY1A 3LBXB 2EHOA 2H7OA 2D2SA 4I0UA 2P9BA 3ZC0A 5AQIB 5LJMA 4O4HE 4AISA 4QHOA 2RA1A 1HG2A 3P4SA 1IZNB 1YKEB 4JEHB 5FXXA 3UU5A 4DR7T 4AFGA 2E5LT 4XBFB 4IDQA 2W63A 3PU3A 4UR9A 1IJ6A 3I9YA 2VQFT 5JQGE 5JRCA 1WFDA 5BRXA 5FY7A 3UUNA 4DV4T 2IC9A 4HFBA 2VK9A 4P0BA 3RX6A 3AA1B 2UXBT 3KV6A 4UF0B 2UXXB 2DHRA 3GN5A 4WYVA 2OV9A 3UT5E 4DR5T 5JTGA 2WNJA 3O1HA 1UV6A 2KWHA 4ZK1A 5AFMB 3EVYA 2JJ9A 1US7B 3CX7B 1KNZA 4WW0A 3I9WA 3P4WA 4TWHA 2H89A 2E2AA 2V7KA 4ZZCA 4YT0A 2BVLA 4UM1A 2AXDS 2VKHA 2YDQA 3JADA 3ZJ2A 2X00D 3I1AA 5EK4A 2OLTA 3OVUA 5AQLB 5HAXA 3K3NA 1T98A 3UFGA 3EHZA 5JDHA 5LB7B 3SWHA 2VL0A 2FBWA 4NUUA 2V7JA 4IE4A 3AA0B 4ZEYA 3P8CD 3T1HT 3B13A 4A97A 4KBMB 2HN2A 2VQET 4EEDA 2MTQA 4EAHA 2XTLA 1X9BA 2X0YA 2UXNB 3AE2A 5J1GA 1QUUA 5HYAA 5LHHB 3ANWA 3G06A 3H3AA 3ETVA 5AQPB 3BK9A 3K1SA 4A56A 5DJQC 3RIAA 4DBMA 3FZLB 2XNUA 4X20E 1AJ3A 4CN6A 5AINA 3PUYF 1J1JA 3U8MA 2V26A 1E2AA 2I59A 5ABFA 2BG9A 3OTOT 4PJNA 3SFDA 2CE7A 4ILBA 2XQ7A 2XAQB 2BZBA 2X00A 4YTMA 2WWVA 3AVRA 4DV2T 2WDVA 5IHYA 3SOLA 4WBNE 3LK2B 4DMVA 4ZI2C 4LFCT 4E7SA 2L9QA 4ZXLA 2HHHT 2VKJA 3Q5XA 3J9X1 3NRXA 4U33A 1V9DA 4U31A 4NIQA 2Y48B 2W67A 2LJLA 2R6GF 2QYWA 3F31A 3VR8A 2H7VC 2DL1A 2X9YA 2I6HA 2XQ8A 2JQ9A 1EZ3A 1FMWA 3RLFF 1BR1A 2WB5A 3KV5A 5LGUB 5J2UE 3RYIE 5CA0E 3DP7A 1VCTA 5KMGP 4ILAA 4QH5A 3K8PC 3N9PA 3RRWA 4PFOA 2X9WA 4ISTA 2V6XA 5HXRA 1WLXA 3PUAA 3CQGB 2E5VA 2LSIA 3UQ4A 1S35A 4IE7A 1LVFA 1T72A 3ZSSA 3NZPA 4DR2T 3B57A 1KF6A 5EK3A 3WTKA 1W09A 5BR8T 3D0TA 3FXDB 5L3GB 2VWAA 2VVNA 4X62T 3PU8A 3MKDA 5M4YA 4K0UA 4O2BE 4HFDA 3R6NA 4COFA 2WN9A 5JREA 3EAMA 4O2AE 5JDGA 2Y6XA 2J1DG 3ZDGA 4HGAA 3RQUA 5FJVA 3C51A 1VRBA 4KI0F 4UM3P 3SIOA 4YLHA 4TZ4C 5LJNA 1N36T 2RPAA 4BJNA 2KT9A 5L3EB 3OPCA 5JR9B 3U8LA 2XJ7A 2FJEA 2AE9A 3NVOA 5IUXA 4C91A 3AE3A 3SFEA 2E8IA 4V1Av 4UM3A 4B6XA 1SE7A 3OYXA 4KHPT 4LFAT 2A9UA 4BAYB 4NPPA 2XAGB 4JLEA 2QA7A 2PH9A 4ZK4A 4UEMA 4JI2T 2BG9C 2BG9E 4JI1T 3LK3B 3ABVA 4H9SE 1BR4A 5A1LA 5LMNT 1SUMB 4F6RC 3N9OA 3ZT5A 4DV7T 1MMNA 4WZXA 2XSBA 2JPFA 3I0OA 3HL6A 2VKDA 2LSYA 4ILUA 3VRBA 2Y7YA 4PAGA 1IJ5A 3ZN0B 3AECA 5C2TA 5KZUA 3NWIA 4AQFC 3FBLA 3ZN1B 5TAOA 2CXFA 4IIJE 3E08A 2K5BB 5AQQB 2YKSA 1MMGA 4ZHQE 5HXCA 2CEAA 4I55E 4UM3S 3U8JA 4EOZB 4JI7T 3IGQA 5AQGB 3A7MA 1UK5A 3LDQB 3UULA 2YU1A 1XDPA 2WAUA 3N9LA 1WR0A 2JQHA 2D9DA 2C9TA 4MALA 1D0YA 2XASB 2D0TA 2FJAA 2J62A 2V8SV 3L8RA 3PE0A 1LRZA 3M65A 3RYFE 3IA3A 1UW6A 5JDQA 2V6YB 4WBOA 2ODVA 4CQIA 3ZSTA 5E0OA 5FXZA 4U7IA 2ZM0A 3ZMVB 2NP9A 5AQUB 4ANJA 3CMLA 3HR0A 2HPJA 2W8FA 4NXMT 4CXWA 3V5SA 3KV9A 3N9QA 2J4GA 3ZMUB 4ZI2D 4DIDB 2W61A 2BYQA 1HNXT 5KXJA 3N5LA 2BKPA 2FJBA 3EDVA 4IDZA 2VL8A 5H6RB 4ZS3A 4U72A 3ETUA 4QACA 2WCAA 3RI5A 3GMIA 1W0BA 4X1IE 5DQWA 4YSZA 5AFHA 2SPCA 2XQAA 3ZEFB 3PUGA 3VR9A 4HWCA 4DR6T 3AXJB 2PFVA 5JDFA 2Y54A 5LOVE 2FUPA 2JIWA 4H9NC 3CPZA 3AAAB 4Z90A 4JBWF 2V5CA 4AXPA 3ZMTB 5CGMA 2VB6A 4EYUA 2BKOA 2X67A 1MNDA 4LF6T 2E9XB 4GKJT 2LSJA 5JDLA 1R8IA 2HN1A 3C64A 3CWZB 4N78D 1NEKA 4PJMA 5EK2A 1W9RA 4CI1B 4JV5T 4WV9A 2W62A 3PUZF 4ZZBA 4O4LE 3WAKA 4AI6A 1XDOA 5F8PA 3ZPOA 1LVKA 4P0AA 5HEGA 2ZLYA 5AQFB 2CXDA 4YSXA 3AE6A 5IYZE 3ZCJA 3FZKB 4DNDA 3Q5WA 3WTOA 1ZEEA 3C98B 4OK0A 4J2CA 4EYYR 3JAEA 1HG5A 1MIVA 3PDYA 1E7PA 3WAJA 2XQ6A 1QLBA 2LRLA 5AFKA 4AKHA 2NOXA 3T1YT 2DI4A 4GK0E 3HKDE 2CLYB 4PIRA 4GYRA 1ZOYA 4GK5E 3FHNA 3KVAA 3HI2A 4HWIB 2Q9QB 4X66T 3N2OA 5FVKA 2YINA 1UURA 2NW7A 1UCUA 2IUBA 4DUYT 3N2KE 1G73A 4HWFA 3MK7C 3FZMB 4LF7T 4ZI3C 3Q2MA 4GOUA 5LMUT 5CJ5A 3RKGA 4DR4T 2JMHA 3KBUA 5JDMA 4KHZF 3LK42 4HQPA 1NAFA 5SYOA 4ERRA 3P4RA 3ESLA 3RRCA 2K3WA 3CX6B 2X68A 2L3LA 2LHRA 4NUVA 4YJ2E 4EZHA 2ZM8A 2H3RA 4U2YA 3GUAA 3P4QA 2QRXA 4CXYA 5HXSA 1SA0E 2V5DA 5FXWA 3QNUA 1KFYA 4EGWA 3AEFA 2WWUA 1D1CA 2IDOB 2W8GA 5IWAT 4TV9E 2DWKA 1OEDA 4BJMA 1LKXA 3KBTA 2XM2A 4B3MT 1I94T 4LF8T 4CN1A 3CQCB 1YW0A 3WTIA 1ZHCA 2YU2A 3KDSE 3ZYMA 2XZEA 2IMLA 4LF4T 4AFTA 4ALXA 3KINB 3CQXC 3S4UA 5HXHA 4ZI7E 4ZR6A 1J5WA 1IBMT 2NTYA 3AEEA 5L4HA 3EUHA 2Y57A 1J5ET 5HWYA 2ES0A 2K9AA 3RH3A 1KK7A 4L5GA 3AEDA 2EHOB 3T8OA 5J2TE 4QX8B 4MBQA 4PK4A 3ZLIA 4AQFA 1N34T 2BYNA 2KWIB 2B1EA 3AAEB 3MZKB 2ODUA 1Y01A 4A5XA 2H88A 3QUJA 4OYJA 3VRAA 4ZJSA 4O8SA 4G63A 2XQ5A 3I0QA 4H63V 4PK5A 5L3CB 3HA4A 2V7LA 1CUNA 4P09A 3HKEE 2LEHA 5ABEA 4JI6T 5JRCB 3SQ6A 4DR1T 3VU7H 3N9MA 4PNIA 3AEBA 4PW8A 2F4VT 5CFBA 2W4XA 2D0UA 4I43B 4IL9A 4HEAA 5HEHA 4DV5T 2BKNA 3U8NA 4ZJTA 4Z8XA 3NZQA 2G0UA 3GN5B 2MYSA 5JDNA 1XMOT 2ACZA 3K3OA 2BDEA 5ETWA 2LHNA 3KVBA 5L3BB 3L09A 2QVAA 3IHRA 3LBXA 4ZRUA 4ZS2A 3H3MA 2XUEA 5KX5E 4QABA 4XAXB 3LG7A 1HF8A 4XZCA 5LGTB 4YTNA 1O3XA 3PJAA 4HKAA 4UY2A 2MAWA 1OEDC 1OEDE 3P7IA 2ACXA 2WU2A 3DJBA 4UXNB 3F2EA 5EZYE 3BQLA 1ZP0A 4QWNB 2YEVC 2WM9A 1FIOA 4U7YA 1IAPA 5J5FA 4DR3T 2L8KA 4DO0A 2VKOA 3LFMA 5ADXL 3OJAA 4BQTA 5F5WA 5LHIB 4HFIA 4FRRA 3GWHA 4PJJA 2XQ4A 4UF0A 2C5IT 4ZI3D 5AFLA 4NXNT 1D0ZA 1NENA 2XYTA 1ZV4X 2XM1A 1HNWT 2KINB 2CHOA 5AFMA 2N9DA 4TUYE 2KSRA 2X9HA 4X1YE 4LMLA 2IC6A 3IF8B 4CXXA 2FJDA 4HN9A 2CA5A 2Q9QA 3CKDA 2V7IA 5J5HA 3AE1A 3QC9A 2XAHB 2XNVA 3TLTA 3L39A 5L4EA 2YK0A 4QH1A 3EI0A 3C4WA 3SH1A 3RF1A 2CRBA 1WYBA 4QXCB 3Q5EA 4K0KT 4LMJA 2YMDA 4UVBB 3HKCE 3KFWX 2C0SA 2X0LB 5AQHB 1JNZA 2XSAA 2HPLA 2CWOA 4CZZB 3QB5K 4KP3C 1VOMA 3AE7A 3V5UA 3FZFB 4IE0A 3ZJ1A 2LKGA 4DBRA 3AE8A 5HCJA 2CHNA 2LSKA 1WCRA 4F8HA 5BP0A 5LA6E 1M62A 3U3IA 3LJCA 2Y56A 5AQKB 3K3QC 1UUSA 3C50A 1G8XA 3TLVA 2WDQA 2CCQA 2VASA 2JMKA 3AEAA 4IDPA 4YHHT 4DMWA 3WTHA 2XY8B 2W0GA 3RQWA 3PV0F 1IBKT 2BS2A 2A72A 2N2NA 3W15B 5HWXA 3O9XA 5AFNA 2NW8A 5HCMA 3TLSA 2NW9A 5F3JA 3IBPA 2WDRA 3QOFA 2BYRA 2UUCT 3RIUA 4LF5T 4TV8E 1NWMX 4LFBT 3N2GE 4X65T 1SHZC 4MLKA 4YY3T 5LG4A 2E9XC 4EV6A 2IW5B 4QAAA 4O4JE 1GQEA 2X66A 2HH7A 4PK6A 4TWDA 5AQRB 4TN7B 4AQGA 4B3TT 3RHWA 4CN4A 5GONE 1WYCA 3C4ZA 1W0AA 5LNKA 4LF9T 1MIYA 1YKHB 1KNPA 2BS4A 4YSYA 4DV6T 5AQVB 4YJ3E 2YN6A 4G2AA 1JNRA 4IREA 2PTFA 4IDNA 3AAIA 4OFZA 3ONJA 3VHLA 2IAKA 2W00A 2PBIA 4ZOLE 2CLYC 1KNRA 3DTOA 3FXEB 4AKRB 2ZM2A 4X5TA 2IIUA 3JAFA 4QH4A 4GKKT 3CX8B 5KE4A 5AQMB 2XNTA 3AA6B 2Q9QC 3OYZA 2DNXA 2DCFA 2UUBT 5FL1A 2LRKA 3UU4A 4AFHA 3UQ7A 3UU8A 4UV8B 3ZCIA 3JCFA 4P1NA 4JYAT 3RGLA 2PG8A 2XAJB 1XNRT 4ADZA 3C84A 4UV9B 2VURA 1OXZA 4DV3T 2V1DB 2CM0A 1FMVA 2NTXA 2I0MA 3ZYLA 1BR0A 1VCSA 5LXTE 3AE5A 2YDRA 3MA9A 3OBVE 4L0RA 5C8YE 3EABA 4DV0T 1BR2A 4HWDA 3QB5A 2BJ0A 5CB4E 5FKYA 5FL0A 5H6QB 2YOEA 5L47A 2UU9T 3CIRA 3PUSA 2ZJUA 5AQJB 4EZ1A 3E0ZA 4PFPA 5JR9A 4BA9A 4HTEA 3RIUC 3BQKA 4DBQA 3O1IA 4ASKA 4IL4A 5LBMA 3U78A 4IHJE 5CA1E 3U8KA 4DUZT 2WQYA 2LLYA 3O1JA 2WBLA 4DVDA 4UIGA 2LE8A 2Y8DA 3ZMZB 4UVAB 5LCYA 3QK6A 3ZYKA 2Y58A 3SQ9A 2CPTA 4EIWA 2CMRA 2LKHA 3ZMSB 4KX6A 2J47A 4CI2B 3TLWA 3UUMA 5FNVE 4AKIA 4H9OC 2WNCA 1D1AA 4Z91A 4AKLA 3ONLC 3PMZA 2B76A 2JRKA 5LG3A 4IT4A 3AA7B 2XYSA 3WI3A 2XZ6A 4WNKA 4JI5T 2XAFB 4OHFA 2EHOC 5KDMC 4X1KE 1UX5A 4YTPA 1N32T 4B3ST 1XWMA 3TLUA 3UU6A 1MIWA 2WMNA 4HFHA 3AB3B 1HCIA 5FVLA 5FP3A 2WU5A 5C3JA 4YXDA 4ILCA 2BR8A 3H37A 1HTJF 4U3CA 3NKZA 5AQSB 4EB6E 1UGOA 2BYSA 5LXBA 2XPKA 3MXZA 5ABHA 3ZT6A 5HEJA 2LOPA 5LBQB 2MBGA 2VVSA 3AEGA 2X51A 3RIFA 3FZHB 1MMDA 4IDOA 4QXBB 2E9XD 3WTMA 4HFEA 5FY0A 3PJAJ 4H9RC 1IBLT 2DLRA 4YHJA 3PURA 5AFJA 2CBJA 2BS3A 2UXDT 1D1BA 2Z6EA 4FI5A 4HWHA 2BYPA 2V6YA 2XQ3A 4O4IE 3UFEA 3JC6C 3X1DA 4B5DA 1YQ3A 4ISSA 3TKLB 3C79A 3T4MA 5AQNB 4H9QC 2W2UA 1XZYA 4LMKA 2KMFA 2OA5A 3R84B 3VKHA 5JR9C 5JH7E 1M7KA 2DWGA 4TWFA 2M6IA 4HFCA 2CWYA 4JEUB 2WNLA 5JVDE 4MFRA 2QC1B 2IHR1 1T7SA 2LSGA 4EXTA 4UELA 2LM2A 3HKBE 1XNQT 2WZYA 4XK9A 4B3RT 3EDUA 3LSVA 2PJQA 1XMQT 1N33T 2WS3A 3AXJA 2Q9QD 4U74A 1YXRA 1FJGT 2PGZA 1UX4A 1T8BA 2A3DA 3PTRB 3BQIA 1KEYA 2RP4A 4GYSA 4QXHB 5DQVA 2D5UA 5L2LA 1H7CA 2WMOA 4UXUA 2E9XA 2KXPB 2XHEB 1L0VA 2JQQA 1WRDA 4Q25A 3NRYA 5TVCA 1HNZT 4C90A 2UXCT 2YDSA 1D0XA 4MHCA 5L3DB 5FMNA 2BVMA 2X9XA 2ZMAA 4A98A 5J0ZA 3P4PA 4M1PA 2WP9A 4XHEA 5J5IA 4U2ZA 4I50E 5L3FB 4QX7B 1OWAA 3RC3A 2JQKA 4JI0T 4HE8A 3ZC1A 4FJOA 2C5KT 3E22E 3J7Yq 3AVSA 3ANWB 4TNVA 5CO5A 3WTNA 3OKQA 2WSSV 1U5PA 3F57A 4KMCA 1E1HB 5LP6E 3VKGA 3AE9A 1FEWA 3PEOA 3UUBA 3L3PA 4X64T 2XZ5A 5LYJE 4YFSA 5LHGB 5LGNB 1QSDA 4PJLA 2XQYA 3NBXX 2GK9A 1X79A 1B7TA 2UZ6A 1OEDB 1YQ4A 3PUQA 4GIWA 1YD8G 3PUXF 1S94A 3Q5DA 2QGSA 5FXVA 2K24A 5ABFB 1UX2A 3FB2A 1MNEA 2BG9B 2XQ9A 3PUWF 3WTJA 3AE4A 4TNWA 2K48A 5AQTB 3CK6A 3SRZA 4DV1T 3RC8A 5ABGA 5JMEA 2MOZA 3SS1A 2WZHA 3RYCE 4QKNA 2ZJVA 4AQYT 4JI8T 2YMEA 3O4XE 5AQOB 1HS7A 2EHOD 2A2FX 4JI4T 1DU2A 2BR7A 3WTLA 1I6ZA 4L9IA 1HX8A 3MJXA 1WR6A 1CHUA 4AKGA 2LM9A 2M67A 1U4QA 4JUYA 3N9NA 5DABA 4TX5A 3Q9DA 5HEUA 5HXEA 3PUVF 5BMVE 2X0HA 3KV4A 3RPUA 2V7MA 3ZDHA 2CXLA 2KNDA 5J5GA 2BBHA 2NR4A 2BBJA 3MACA 4OYKA 3FBZA 4BFQA 1HR0T 3ZKRA 1HFAA 4CI3B 2WY2A 1Y64B 2KZ7B 2CBIA 3B5MA 4IGUA 5AFUL 4JI3T 2KLQA 4E7ZA 3UUXB 5FYMA 3WIPA 5HEOA 2M6BA 4KUMB 3UU3A 4IE6A 1ZKEA 2UUAT 1Z0PA 3A8YC 4AIUA 2ZM6T 3UTKA 3C4XA 2LOSA 4IE5A 4HFVA 4H63H 4OX9T 4D01A 3GA8A 4H9PC 3RKOA 1I9BA 2WZIA 3CVRA 3ONXA 1HX1B 4EZ4A
chains in the Genus database with same CATH topology
1UX2A 4IL4A 5HEJA 5AINA 3WTOA 2BG9B 2XQ9A 4F8HA 5BP0A 4X5TA 3GUAA 2Y7YA 4ZJSA 3RIFA 2W8FA 3UQ4A 5BW2A 3JAFA 3WTJA 3JAEA 2XQ5A 3U8KA 2Y56A 4TNWA 4QH4A 2LLYA 5J5FA 5KE4A 4UXUA 5KZUA 3U8MA 3P4WA 5JMEA 2XQ6A 2XNTA 2BYQA 4TWHA 3WTKA 4NZBA 3TLVA 5AFKA 3WTMA 4HFEA 5TVCA 3P50A 3SQ6A 2ZJVA 4BQTA 2BG9A 4ZZCA 3WTHA 2WN9A 4HFDA 4HFIA 3UU4A 4COFA 2Y58A 2YMEA 3UQ7A 3RQWA 4UM1A 3SQ9A 4AFHA 4ILBA 4FRRA 3EAMA 2XQ4A 4PIRA 5AFJA 3UU8A 5CFBA 3JADA 2W8GA 4QACA 2XQ7A 2BR7A 2LKHA 3WTLA 2X00A 4IL9A 2YKSA 3RI5A 5AFNA 1OEDA 3TLWA 5HCMA 5AFLA 5HEHA 3TLSA 2BYPA 4A98A 2XQ3A 5J0ZA 2X00D 3ZDGA 5AFHA 2XQAA 4UM3S 3RQUA 2XYTA 2BYRA 2WNCA 5FJVA 4XHEA 3U8NA 3U8JA 4Z91A 3C84A 4B5DA 5J5IA 4ZJTA 4UM3P 3SIOA 3UU5A 4AFGA 5AFMA 3WTIA 3PMZA 2Y54A 3EHZA 3C79A 3T4MA 5HEUA 3IGQA 2KSRA 5LG3A 4QAAA 2VL0A 2XYSA 4LMLA 4LMKA 2XZ6A 3ZDHA 4Z90A 3U8LA 4AFTA 4ALXA 5J5GA 4TWDA 4ZR6A 4TNVA 5CO5A 3WTNA 5J5HA 4BFQA 5IUXA 4A97A 4TWFA 2M6IA 4HFCA 3ZKRA 3TLUA 3UU6A 5L4HA 2WNLA 4UM3A 2XNVA 3TLTA 5BRXA 4ZRUA 2Y57A 3RHWA 5L4EA 2C9TA 2QC1B 4QH1A 4HFHA 3EI0A 3SH1A 3PEOA 3UUBA 2XZ5A 4NPPA 4QABA 4HFBA 2LM2A 4HQPA 4LMJA 2PH9A 2YMDA 4ZK4A 3WIPA 2WZYA 2XQ8A 2BG9C 2BG9E 5HEOA 2BJ0A 4WV9A 4ZZBA 2M6BA 3LSVA 4XK9A 3UU3A 5SYOA 2YN6A 4IREA 4ILCA 2YOEA 5L47A 2BR8A 2UZ6A 1UW6A 4UY2A 1OEDB 3RIAA 4DBMA 2MAWA 2BYNA 4D01A 1OEDC 1OEDE 5HEGA 2PGZA 2ZJUA 4ILAA 4QH5A 1I9BA 4EZ1A 2WNJA 2XNUA 2BYSA 2LKGA 5LXBA 1UV6A 4ZK1A 5AFMB 5HCJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX2 A;  4IL4 A;  5HEJ A;  5AIN A;  3WTO A;  2BG9 B;  2XQ9 A;  4F8H A;  5BP0 A;  4X5T A;  3GUA A;  2Y7Y A;  4ZJS A;  3RIF A;  2W8F A;  3UQ4 A;  5BW2 A;  3JAF A;  3WTJ A;  3JAE A;  2XQ5 A;  3U8K A;  2Y56 A;  4TNW A;  4QH4 A;  2LLY A;  5J5F A;  5KE4 A;  4UXU A;  5KZU A;  3U8M A;  3P4W A;  5JME A;  2XQ6 A;  2XNT A;  2BYQ A;  4TWH A;  3WTK A;  4NZB A;  3TLV A;  5AFK A;  3WTM A;  4HFE A;  5TVC A;  3P50 A;  3SQ6 A;  2ZJV A;  4BQT A;  2BG9 A;  4ZZC A;  3WTH A;  2WN9 A;  4HFD A;  4HFI A;  3UU4 A;  4COF A;  2Y58 A;  2YME A;  3UQ7 A;  3RQW A;  4UM1 A;  3SQ9 A;  4AFH A;  4ILB A;  4FRR A;  3EAM A;  2XQ4 A;  4PIR A;  5AFJ A;  3UU8 A;  5CFB A;  3JAD A;  2W8G A;  4QAC A;  2XQ7 A;  2BR7 A;  2LKH A;  3WTL A;  2X00 A;  4IL9 A;  2YKS A;  3RI5 A;  5AFN A;  1OED A;  3TLW A;  5HCM A;  5AFL A;  5HEH A;  3TLS A;  2BYP A;  4A98 A;  2XQ3 A;  5J0Z A;  2X00 D;  3ZDG A;  5AFH A;  2XQA A;  4UM3 S;  3RQU A;  2XYT A;  2BYR A;  2WNC A;  5FJV A;  4XHE A;  3U8N A;  3U8J A;  4Z91 A;  3C84 A;  4B5D A;  5J5I A;  4ZJT A;  4UM3 P;  3SIO A;  3UU5 A;  4AFG A;  5AFM A;  3WTI A;  3PMZ A;  2Y54 A;  3EHZ A;  3C79 A;  3T4M A;  5HEU A;  3IGQ A;  2KSR A;  5LG3 A;  4QAA A;  2VL0 A;  2XYS A;  4LML A;  4LMK A;  2XZ6 A;  3ZDH A;  4Z90 A;  3U8L A;  4AFT A;  4ALX A;  5J5G A;  4TWD A;  4ZR6 A;  4TNV A;  5CO5 A;  3WTN A;  5J5H A;  4BFQ A;  5IUX A;  4A97 A;  4TWF A;  2M6I A;  4HFC A;  3ZKR A;  3TLU A;  3UU6 A;  5L4H A;  2WNL A;  4UM3 A;  2XNV A;  3TLT A;  5BRX A;  4ZRU A;  2Y57 A;  3RHW A;  5L4E A;  2C9T A;  2QC1 B;  4QH1 A;  4HFH A;  3EI0 A;  3SH1 A;  3PEO A;  3UUB A;  2XZ5 A;  4NPP A;  4QAB A;  4HFB A;  2LM2 A;  4HQP A;  4LMJ A;  2PH9 A;  2YMD A;  4ZK4 A;  3WIP A;  2WZY A;  2XQ8 A;  2BG9 C;  2BG9 E;  5HEO A;  2BJ0 A;  4WV9 A;  4ZZB A;  2M6B A;  3LSV A;  4XK9 A;  3UU3 A;  5SYO A;  2YN6 A;  4IRE A;  4ILC A;  2YOE A;  5L47 A;  2BR8 A;  2UZ6 A;  1UW6 A;  4UY2 A;  1OED B;  3RIA A;  4DBM A;  2MAW A;  2BYN A;  4D01 A;  1OED C;  1OED E;  5HEG A;  2PGZ A;  2ZJU A;  4ILA A;  4QH5 A;  1I9B A;  4EZ1 A;  2WNJ A;  2XNU A;  2BYS A;  2LKG A;  5LXB A;  1UV6 A;  4ZK1 A;  5AFM B;  5HCJ A; 
#chains in the Genus database with same CATH topology
 2MPK A;  2N1G A;  3IEE A;  2LT3 A;  4I4T E;  4UVC B;  5BW2 A;  1Z8U A;  3JC6 D;  4EEB A;  3M3Z B;  2NWB A;  3ZT7 A;  3RYH E;  4NZB A;  2C5J A;  1MMA A;  2W66 A;  3A5X A;  3P50 A;  5FY1 A;  3LBX B;  2EHO A;  2H7O A;  2D2S A;  4I0U A;  2P9B A;  3ZC0 A;  5AQI B;  5LJM A;  4O4H E;  4AIS A;  4QHO A;  2RA1 A;  1HG2 A;  3P4S A;  1IZN B;  1YKE B;  4JEH B;  5FXX A;  3UU5 A;  4DR7 T;  4AFG A;  2E5L T;  4XBF B;  4IDQ A;  2W63 A;  3PU3 A;  4UR9 A;  1IJ6 A;  3I9Y A;  2VQF T;  5JQG E;  5JRC A;  1WFD A;  5BRX A;  5FY7 A;  3UUN A;  4DV4 T;  2IC9 A;  4HFB A;  2VK9 A;  4P0B A;  3RX6 A;  3AA1 B;  2UXB T;  3KV6 A;  4UF0 B;  2UXX B;  2DHR A;  3GN5 A;  4WYV A;  2OV9 A;  3UT5 E;  4DR5 T;  5JTG A;  2WNJ A;  3O1H A;  1UV6 A;  2KWH A;  4ZK1 A;  5AFM B;  3EVY A;  2JJ9 A;  1US7 B;  3CX7 B;  1KNZ A;  4WW0 A;  3I9W A;  3P4W A;  4TWH A;  2H89 A;  2E2A A;  2V7K A;  4ZZC A;  4YT0 A;  2BVL A;  4UM1 A;  2AXD S;  2VKH A;  2YDQ A;  3JAD A;  3ZJ2 A;  2X00 D;  3I1A A;  5EK4 A;  2OLT A;  3OVU A;  5AQL B;  5HAX A;  3K3N A;  1T98 A;  3UFG A;  3EHZ A;  5JDH A;  5LB7 B;  3SWH A;  2VL0 A;  2FBW A;  4NUU A;  2V7J A;  4IE4 A;  3AA0 B;  4ZEY A;  3P8C D;  3T1H T;  3B13 A;  4A97 A;  4KBM B;  2HN2 A;  2VQE T;  4EED A;  2MTQ A;  4EAH A;  2XTL A;  1X9B A;  2X0Y A;  2UXN B;  3AE2 A;  5J1G A;  1QUU A;  5HYA A;  5LHH B;  3ANW A;  3G06 A;  3H3A A;  3ETV A;  5AQP B;  3BK9 A;  3K1S A;  4A56 A;  5DJQ C;  3RIA A;  4DBM A;  3FZL B;  2XNU A;  4X20 E;  1AJ3 A;  4CN6 A;  5AIN A;  3PUY F;  1J1J A;  3U8M A;  2V26 A;  1E2A A;  2I59 A;  5ABF A;  2BG9 A;  3OTO T;  4PJN A;  3SFD A;  2CE7 A;  4ILB A;  2XQ7 A;  2XAQ B;  2BZB A;  2X00 A;  4YTM A;  2WWV A;  3AVR A;  4DV2 T;  2WDV A;  5IHY A;  3SOL A;  4WBN E;  3LK2 B;  4DMV A;  4ZI2 C;  4LFC T;  4E7S A;  2L9Q A;  4ZXL A;  2HHH T;  2VKJ A;  3Q5X A;  3J9X 1;  3NRX A;  4U33 A;  1V9D A;  4U31 A;  4NIQ A;  2Y48 B;  2W67 A;  2LJL A;  2R6G F;  2QYW A;  3F31 A;  3VR8 A;  2H7V C;  2DL1 A;  2X9Y A;  2I6H A;  2XQ8 A;  2JQ9 A;  1EZ3 A;  1FMW A;  3RLF F;  1BR1 A;  2WB5 A;  3KV5 A;  5LGU B;  5J2U E;  3RYI E;  5CA0 E;  3DP7 A;  1VCT A;  5KMG P;  4ILA A;  4QH5 A;  3K8P C;  3N9P A;  3RRW A;  4PFO A;  2X9W A;  4IST A;  2V6X A;  5HXR A;  1WLX A;  3PUA A;  3CQG B;  2E5V A;  2LSI A;  3UQ4 A;  1S35 A;  4IE7 A;  1LVF A;  1T72 A;  3ZSS A;  3NZP A;  4DR2 T;  3B57 A;  1KF6 A;  5EK3 A;  3WTK A;  1W09 A;  5BR8 T;  3D0T A;  3FXD B;  5L3G B;  2VWA A;  2VVN A;  4X62 T;  3PU8 A;  3MKD A;  5M4Y A;  4K0U A;  4O2B E;  4HFD A;  3R6N A;  4COF A;  2WN9 A;  5JRE A;  3EAM A;  4O2A E;  5JDG A;  2Y6X A;  2J1D G;  3ZDG A;  4HGA A;  3RQU A;  5FJV A;  3C51 A;  1VRB A;  4KI0 F;  4UM3 P;  3SIO A;  4YLH A;  4TZ4 C;  5LJN A;  1N36 T;  2RPA A;  4BJN A;  2KT9 A;  5L3E B;  3OPC A;  5JR9 B;  3U8L A;  2XJ7 A;  2FJE A;  2AE9 A;  3NVO A;  5IUX A;  4C91 A;  3AE3 A;  3SFE A;  2E8I A;  4V1A v;  4UM3 A;  4B6X A;  1SE7 A;  3OYX A;  4KHP T;  4LFA T;  2A9U A;  4BAY B;  4NPP A;  2XAG B;  4JLE A;  2QA7 A;  2PH9 A;  4ZK4 A;  4UEM A;  4JI2 T;  2BG9 C;  2BG9 E;  4JI1 T;  3LK3 B;  3ABV A;  4H9S E;  1BR4 A;  5A1L A;  5LMN T;  1SUM B;  4F6R C;  3N9O A;  3ZT5 A;  4DV7 T;  1MMN A;  4WZX A;  2XSB A;  2JPF A;  3I0O A;  3HL6 A;  2VKD A;  2LSY A;  4ILU A;  3VRB A;  2Y7Y A;  4PAG A;  1IJ5 A;  3ZN0 B;  3AEC A;  5C2T A;  5KZU A;  3NWI A;  4AQF C;  3FBL A;  3ZN1 B;  5TAO A;  2CXF A;  4IIJ E;  3E08 A;  2K5B B;  5AQQ B;  2YKS A;  1MMG A;  4ZHQ E;  5HXC A;  2CEA A;  4I55 E;  4UM3 S;  3U8J A;  4EOZ B;  4JI7 T;  3IGQ A;  5AQG B;  3A7M A;  1UK5 A;  3LDQ B;  3UUL A;  2YU1 A;  1XDP A;  2WAU A;  3N9L A;  1WR0 A;  2JQH A;  2D9D A;  2C9T A;  4MAL A;  1D0Y A;  2XAS B;  2D0T A;  2FJA A;  2J62 A;  2V8S V;  3L8R A;  3PE0 A;  1LRZ A;  3M65 A;  3RYF E;  3IA3 A;  1UW6 A;  5JDQ A;  2V6Y B;  4WBO A;  2ODV A;  4CQI A;  3ZST A;  5E0O A;  5FXZ A;  4U7I A;  2ZM0 A;  3ZMV B;  2NP9 A;  5AQU B;  4ANJ A;  3CML A;  3HR0 A;  2HPJ A;  2W8F A;  4NXM T;  4CXW A;  3V5S A;  3KV9 A;  3N9Q A;  2J4G A;  3ZMU B;  4ZI2 D;  4DID B;  2W61 A;  2BYQ A;  1HNX T;  5KXJ A;  3N5L A;  2BKP A;  2FJB A;  3EDV A;  4IDZ A;  2VL8 A;  5H6R B;  4ZS3 A;  4U72 A;  3ETU A;  4QAC A;  2WCA A;  3RI5 A;  3GMI A;  1W0B A;  4X1I E;  5DQW A;  4YSZ A;  5AFH A;  2SPC A;  2XQA A;  3ZEF B;  3PUG A;  3VR9 A;  4HWC A;  4DR6 T;  3AXJ B;  2PFV A;  5JDF A;  2Y54 A;  5LOV E;  2FUP A;  2JIW A;  4H9N C;  3CPZ A;  3AAA B;  4Z90 A;  4JBW F;  2V5C A;  4AXP A;  3ZMT B;  5CGM A;  2VB6 A;  4EYU A;  2BKO A;  2X67 A;  1MND A;  4LF6 T;  2E9X B;  4GKJ T;  2LSJ A;  5JDL A;  1R8I A;  2HN1 A;  3C64 A;  3CWZ B;  4N78 D;  1NEK A;  4PJM A;  5EK2 A;  1W9R A;  4CI1 B;  4JV5 T;  4WV9 A;  2W62 A;  3PUZ F;  4ZZB A;  4O4L E;  3WAK A;  4AI6 A;  1XDO A;  5F8P A;  3ZPO A;  1LVK A;  4P0A A;  5HEG A;  2ZLY A;  5AQF B;  2CXD A;  4YSX A;  3AE6 A;  5IYZ E;  3ZCJ A;  3FZK B;  4DND A;  3Q5W A;  3WTO A;  1ZEE A;  3C98 B;  4OK0 A;  4J2C A;  4EYY R;  3JAE A;  1HG5 A;  1MIV A;  3PDY A;  1E7P A;  3WAJ A;  2XQ6 A;  1QLB A;  2LRL A;  5AFK A;  4AKH A;  2NOX A;  3T1Y T;  2DI4 A;  4GK0 E;  3HKD E;  2CLY B;  4PIR A;  4GYR A;  1ZOY A;  4GK5 E;  3FHN A;  3KVA A;  3HI2 A;  4HWI B;  2Q9Q B;  4X66 T;  3N2O A;  5FVK A;  2YIN A;  1UUR A;  2NW7 A;  1UCU A;  2IUB A;  4DUY T;  3N2K E;  1G73 A;  4HWF A;  3MK7 C;  3FZM B;  4LF7 T;  4ZI3 C;  3Q2M A;  4GOU A;  5LMU T;  5CJ5 A;  3RKG A;  4DR4 T;  2JMH A;  3KBU A;  5JDM A;  4KHZ F;  3LK4 2;  4HQP A;  1NAF A;  5SYO A;  4ERR A;  3P4R A;  3ESL A;  3RRC A;  2K3W A;  3CX6 B;  2X68 A;  2L3L A;  2LHR A;  4NUV A;  4YJ2 E;  4EZH A;  2ZM8 A;  2H3R A;  4U2Y A;  3GUA A;  3P4Q A;  2QRX A;  4CXY A;  5HXS A;  1SA0 E;  2V5D A;  5FXW A;  3QNU A;  1KFY A;  4EGW A;  3AEF A;  2WWU A;  1D1C A;  2IDO B;  2W8G A;  5IWA T;  4TV9 E;  2DWK A;  1OED A;  4BJM A;  1LKX A;  3KBT A;  2XM2 A;  4B3M T;  1I94 T;  4LF8 T;  4CN1 A;  3CQC B;  1YW0 A;  3WTI A;  1ZHC A;  2YU2 A;  3KDS E;  3ZYM A;  2XZE A;  2IML A;  4LF4 T;  4AFT A;  4ALX A;  3KIN B;  3CQX C;  3S4U A;  5HXH A;  4ZI7 E;  4ZR6 A;  1J5W A;  1IBM T;  2NTY A;  3AEE A;  5L4H A;  3EUH A;  2Y57 A;  1J5E T;  5HWY A;  2ES0 A;  2K9A A;  3RH3 A;  1KK7 A;  4L5G A;  3AED A;  2EHO B;  3T8O A;  5J2T E;  4QX8 B;  4MBQ A;  4PK4 A;  3ZLI A;  4AQF A;  1N34 T;  2BYN A;  2KWI B;  2B1E A;  3AAE B;  3MZK B;  2ODU A;  1Y01 A;  4A5X A;  2H88 A;  3QUJ A;  4OYJ A;  3VRA A;  4ZJS A;  4O8S A;  4G63 A;  2XQ5 A;  3I0Q A;  4H63 V;  4PK5 A;  5L3C B;  3HA4 A;  2V7L A;  1CUN A;  4P09 A;  3HKE E;  2LEH A;  5ABE A;  4JI6 T;  5JRC B;  3SQ6 A;  4DR1 T;  3VU7 H;  3N9M A;  4PNI A;  3AEB A;  4PW8 A;  2F4V T;  5CFB A;  2W4X A;  2D0U A;  4I43 B;  4IL9 A;  4HEA A;  5HEH A;  4DV5 T;  2BKN A;  3U8N A;  4ZJT A;  4Z8X A;  3NZQ A;  2G0U A;  3GN5 B;  2MYS A;  5JDN A;  1XMO T;  2ACZ A;  3K3O A;  2BDE A;  5ETW A;  2LHN A;  3KVB A;  5L3B B;  3L09 A;  2QVA A;  3IHR A;  3LBX A;  4ZRU A;  4ZS2 A;  3H3M A;  2XUE A;  5KX5 E;  4QAB A;  4XAX B;  3LG7 A;  1HF8 A;  4XZC A;  5LGT B;  4YTN A;  1O3X A;  3PJA A;  4HKA A;  4UY2 A;  2MAW A;  1OED C;  1OED E;  3P7I A;  2ACX A;  2WU2 A;  3DJB A;  4UXN B;  3F2E A;  5EZY E;  3BQL A;  1ZP0 A;  4QWN B;  2YEV C;  2WM9 A;  1FIO A;  4U7Y A;  1IAP A;  5J5F A;  4DR3 T;  2L8K A;  4DO0 A;  2VKO A;  3LFM A;  5ADX L;  3OJA A;  4BQT A;  5F5W A;  5LHI B;  4HFI A;  4FRR A;  3GWH A;  4PJJ A;  2XQ4 A;  4UF0 A;  2C5I T;  4ZI3 D;  5AFL A;  4NXN T;  1D0Z A;  1NEN A;  2XYT A;  1ZV4 X;  2XM1 A;  1HNW T;  2KIN B;  2CHO A;  5AFM A;  2N9D A;  4TUY E;  2KSR A;  2X9H A;  4X1Y E;  4LML A;  2IC6 A;  3IF8 B;  4CXX A;  2FJD A;  4HN9 A;  2CA5 A;  2Q9Q A;  3CKD A;  2V7I A;  5J5H A;  3AE1 A;  3QC9 A;  2XAH B;  2XNV A;  3TLT A;  3L39 A;  5L4E A;  2YK0 A;  4QH1 A;  3EI0 A;  3C4W A;  3SH1 A;  3RF1 A;  2CRB A;  1WYB A;  4QXC B;  3Q5E A;  4K0K T;  4LMJ A;  2YMD A;  4UVB B;  3HKC E;  3KFW X;  2C0S A;  2X0L B;  5AQH B;  1JNZ A;  2XSA A;  2HPL A;  2CWO A;  4CZZ B;  3QB5 K;  4KP3 C;  1VOM A;  3AE7 A;  3V5U A;  3FZF B;  4IE0 A;  3ZJ1 A;  2LKG A;  4DBR A;  3AE8 A;  5HCJ A;  2CHN A;  2LSK A;  1WCR A;  4F8H A;  5BP0 A;  5LA6 E;  1M62 A;  3U3I A;  3LJC A;  2Y56 A;  5AQK B;  3K3Q C;  1UUS A;  3C50 A;  1G8X A;  3TLV A;  2WDQ A;  2CCQ A;  2VAS A;  2JMK A;  3AEA A;  4IDP A;  4YHH T;  4DMW A;  3WTH A;  2XY8 B;  2W0G A;  3RQW A;  3PV0 F;  1IBK T;  2BS2 A;  2A72 A;  2N2N A;  3W15 B;  5HWX A;  3O9X A;  5AFN A;  2NW8 A;  5HCM A;  3TLS A;  2NW9 A;  5F3J A;  3IBP A;  2WDR A;  3QOF A;  2BYR A;  2UUC T;  3RIU A;  4LF5 T;  4TV8 E;  1NWM X;  4LFB T;  3N2G E;  4X65 T;  1SHZ C;  4MLK A;  4YY3 T;  5LG4 A;  2E9X C;  4EV6 A;  2IW5 B;  4QAA A;  4O4J E;  1GQE A;  2X66 A;  2HH7 A;  4PK6 A;  4TWD A;  5AQR B;  4TN7 B;  4AQG A;  4B3T T;  3RHW A;  4CN4 A;  5GON E;  1WYC A;  3C4Z A;  1W0A A;  5LNK A;  4LF9 T;  1MIY A;  1YKH B;  1KNP A;  2BS4 A;  4YSY A;  4DV6 T;  5AQV B;  4YJ3 E;  2YN6 A;  4G2A A;  1JNR A;  4IRE A;  2PTF A;  4IDN A;  3AAI A;  4OFZ A;  3ONJ A;  3VHL A;  2IAK A;  2W00 A;  2PBI A;  4ZOL E;  2CLY C;  1KNR A;  3DTO A;  3FXE B;  4AKR B;  2ZM2 A;  4X5T A;  2IIU A;  3JAF A;  4QH4 A;  4GKK T;  3CX8 B;  5KE4 A;  5AQM B;  2XNT A;  3AA6 B;  2Q9Q C;  3OYZ A;  2DNX A;  2DCF A;  2UUB T;  5FL1 A;  2LRK A;  3UU4 A;  4AFH A;  3UQ7 A;  3UU8 A;  4UV8 B;  3ZCI A;  3JCF A;  4P1N A;  4JYA T;  3RGL A;  2PG8 A;  2XAJ B;  1XNR T;  4ADZ A;  3C84 A;  4UV9 B;  2VUR A;  1OXZ A;  4DV3 T;  2V1D B;  2CM0 A;  1FMV A;  2NTX A;  2I0M A;  3ZYL A;  1BR0 A;  1VCS A;  5LXT E;  3AE5 A;  2YDR A;  3MA9 A;  3OBV E;  4L0R A;  5C8Y E;  3EAB A;  4DV0 T;  1BR2 A;  4HWD A;  3QB5 A;  2BJ0 A;  5CB4 E;  5FKY A;  5FL0 A;  5H6Q B;  2YOE A;  5L47 A;  2UU9 T;  3CIR A;  3PUS A;  2ZJU A;  5AQJ B;  4EZ1 A;  3E0Z A;  4PFP A;  5JR9 A;  4BA9 A;  4HTE A;  3RIU C;  3BQK A;  4DBQ A;  3O1I A;  4ASK A;  4IL4 A;  5LBM A;  3U78 A;  4IHJ E;  5CA1 E;  3U8K A;  4DUZ T;  2WQY A;  2LLY A;  3O1J A;  2WBL A;  4DVD A;  4UIG A;  2LE8 A;  2Y8D A;  3ZMZ B;  4UVA B;  5LCY A;  3QK6 A;  3ZYK A;  2Y58 A;  3SQ9 A;  2CPT A;  4EIW A;  2CMR A;  2LKH A;  3ZMS B;  4KX6 A;  2J47 A;  4CI2 B;  3TLW A;  3UUM A;  5FNV E;  4AKI A;  4H9O C;  2WNC A;  1D1A A;  4Z91 A;  4AKL A;  3ONL C;  3PMZ A;  2B76 A;  2JRK A;  5LG3 A;  4IT4 A;  3AA7 B;  2XYS A;  3WI3 A;  2XZ6 A;  4WNK A;  4JI5 T;  2XAF B;  4OHF A;  2EHO C;  5KDM C;  4X1K E;  1UX5 A;  4YTP A;  1N32 T;  4B3S T;  1XWM A;  3TLU A;  3UU6 A;  1MIW A;  2WMN A;  4HFH A;  3AB3 B;  1HCI A;  5FVL A;  5FP3 A;  2WU5 A;  5C3J A;  4YXD A;  4ILC A;  2BR8 A;  3H37 A;  1HTJ F;  4U3C A;  3NKZ A;  5AQS B;  4EB6 E;  1UGO A;  2BYS A;  5LXB A;  2XPK A;  3MXZ A;  5ABH A;  3ZT6 A;  5HEJ A;  2LOP A;  5LBQ B;  2MBG A;  2VVS A;  3AEG A;  2X51 A;  3RIF A;  3FZH B;  1MMD A;  4IDO A;  4QXB B;  2E9X D;  3WTM A;  4HFE A;  5FY0 A;  3PJA J;  4H9R C;  1IBL T;  2DLR A;  4YHJ A;  3PUR A;  5AFJ A;  2CBJ A;  2BS3 A;  2UXD T;  1D1B A;  2Z6E A;  4FI5 A;  4HWH A;  2BYP A;  2V6Y A;  2XQ3 A;  4O4I E;  3UFE A;  3JC6 C;  3X1D A;  4B5D A;  1YQ3 A;  4ISS A;  3TKL B;  3C79 A;  3T4M A;  5AQN B;  4H9Q C;  2W2U A;  1XZY A;  4LMK A;  2KMF A;  2OA5 A;  3R84 B;  3VKH A;  5JR9 C;  5JH7 E;  1M7K A;  2DWG A;  4TWF A;  2M6I A;  4HFC A;  2CWY A;  4JEU B;  2WNL A;  5JVD E;  4MFR A;  2QC1 B;  2IHR 1;  1T7S A;  2LSG A;  4EXT A;  4UEL A;  2LM2 A;  3HKB E;  1XNQ T;  2WZY A;  4XK9 A;  4B3R T;  3EDU A;  3LSV A;  2PJQ A;  1XMQ T;  1N33 T;  2WS3 A;  3AXJ A;  2Q9Q D;  4U74 A;  1YXR A;  1FJG T;  2PGZ A;  1UX4 A;  1T8B A;  2A3D A;  3PTR B;  3BQI A;  1KEY A;  2RP4 A;  4GYS A;  4QXH B;  5DQV A;  2D5U A;  5L2L A;  1H7C A;  2WMO A;  4UXU A;  2E9X A;  2KXP B;  2XHE B;  1L0V A;  2JQQ A;  1WRD A;  4Q25 A;  3NRY A;  5TVC A;  1HNZ T;  4C90 A;  2UXC T;  2YDS A;  1D0X A;  4MHC A;  5L3D B;  5FMN A;  2BVM A;  2X9X A;  2ZMA A;  4A98 A;  5J0Z A;  3P4P A;  4M1P A;  2WP9 A;  4XHE A;  5J5I A;  4U2Z A;  4I50 E;  5L3F B;  4QX7 B;  1OWA A;  3RC3 A;  2JQK A;  4JI0 T;  4HE8 A;  3ZC1 A;  4FJO A;  2C5K T;  3E22 E;  3J7Y q;  3AVS A;  3ANW B;  4TNV A;  5CO5 A;  3WTN A;  3OKQ A;  2WSS V;  1U5P A;  3F57 A;  4KMC A;  1E1H B;  5LP6 E;  3VKG A;  3AE9 A;  1FEW A;  3PEO A;  3UUB A;  3L3P A;  4X64 T;  2XZ5 A;  5LYJ E;  4YFS A;  5LHG B;  5LGN B;  1QSD A;  4PJL A;  2XQY A;  3NBX X;  2GK9 A;  1X79 A;  1B7T A;  2UZ6 A;  1OED B;  1YQ4 A;  3PUQ A;  4GIW A;  1YD8 G;  3PUX F;  1S94 A;  3Q5D A;  2QGS A;  5FXV A;  2K24 A;  5ABF B;  1UX2 A;  3FB2 A;  1MNE A;  2BG9 B;  2XQ9 A;  3PUW F;  3WTJ A;  3AE4 A;  4TNW A;  2K48 A;  5AQT B;  3CK6 A;  3SRZ A;  4DV1 T;  3RC8 A;  5ABG A;  5JME A;  2MOZ A;  3SS1 A;  2WZH A;  3RYC E;  4QKN A;  2ZJV A;  4AQY T;  4JI8 T;  2YME A;  3O4X E;  5AQO B;  1HS7 A;  2EHO D;  2A2F X;  4JI4 T;  1DU2 A;  2BR7 A;  3WTL A;  1I6Z A;  4L9I A;  1HX8 A;  3MJX A;  1WR6 A;  1CHU A;  4AKG A;  2LM9 A;  2M67 A;  1U4Q A;  4JUY A;  3N9N A;  5DAB A;  4TX5 A;  3Q9D A;  5HEU A;  5HXE A;  3PUV F;  5BMV E;  2X0H A;  3KV4 A;  3RPU A;  2V7M A;  3ZDH A;  2CXL A;  2KND A;  5J5G A;  2BBH A;  2NR4 A;  2BBJ A;  3MAC A;  4OYK A;  3FBZ A;  4BFQ A;  1HR0 T;  3ZKR A;  1HFA A;  4CI3 B;  2WY2 A;  1Y64 B;  2KZ7 B;  2CBI A;  3B5M A;  4IGU A;  5AFU L;  4JI3 T;  2KLQ A;  4E7Z A;  3UUX B;  5FYM A;  3WIP A;  5HEO A;  2M6B A;  4KUM B;  3UU3 A;  4IE6 A;  1ZKE A;  2UUA T;  1Z0P A;  3A8Y C;  4AIU A;  2ZM6 T;  3UTK A;  3C4X A;  2LOS A;  4IE5 A;  4HFV A;  4H63 H;  4OX9 T;  4D01 A;  3GA8 A;  4H9P C;  3RKO A;  1I9B A;  2WZI A;  3CVR A;  3ONX A;  1HX1 B;  4EZ4 A; 
#chains in the Genus database with same CATH homology
 1UX2 A;  4IL4 A;  5HEJ A;  5AIN A;  3WTO A;  2BG9 B;  2XQ9 A;  4F8H A;  5BP0 A;  4X5T A;  3GUA A;  2Y7Y A;  4ZJS A;  3RIF A;  2W8F A;  3UQ4 A;  5BW2 A;  3JAF A;  3WTJ A;  3JAE A;  2XQ5 A;  3U8K A;  2Y56 A;  4TNW A;  4QH4 A;  2LLY A;  5J5F A;  5KE4 A;  4UXU A;  5KZU A;  3U8M A;  3P4W A;  5JME A;  2XQ6 A;  2XNT A;  2BYQ A;  4TWH A;  3WTK A;  4NZB A;  3TLV A;  5AFK A;  3WTM A;  4HFE A;  5TVC A;  3P50 A;  3SQ6 A;  2ZJV A;  4BQT A;  2BG9 A;  4ZZC A;  3WTH A;  2WN9 A;  4HFD A;  4HFI A;  3UU4 A;  4COF A;  2Y58 A;  2YME A;  3UQ7 A;  3RQW A;  4UM1 A;  3SQ9 A;  4AFH A;  4ILB A;  4FRR A;  3EAM A;  2XQ4 A;  4PIR A;  5AFJ A;  3UU8 A;  5CFB A;  3JAD A;  2W8G A;  4QAC A;  2XQ7 A;  2BR7 A;  2LKH A;  3WTL A;  2X00 A;  4IL9 A;  2YKS A;  3RI5 A;  5AFN A;  1OED A;  3TLW A;  5HCM A;  5AFL A;  5HEH A;  3TLS A;  2BYP A;  4A98 A;  2XQ3 A;  5J0Z A;  2X00 D;  3ZDG A;  5AFH A;  2XQA A;  4UM3 S;  3RQU A;  2XYT A;  2BYR A;  2WNC A;  5FJV A;  4XHE A;  3U8N A;  3U8J A;  4Z91 A;  3C84 A;  4B5D A;  5J5I A;  4ZJT A;  4UM3 P;  3SIO A;  3UU5 A;  4AFG A;  5AFM A;  3WTI A;  3PMZ A;  2Y54 A;  3EHZ A;  3C79 A;  3T4M A;  5HEU A;  3IGQ A;  2KSR A;  5LG3 A;  4QAA A;  2VL0 A;  2XYS A;  4LML A;  4LMK A;  2XZ6 A;  3ZDH A;  4Z90 A;  3U8L A;  4AFT A;  4ALX A;  5J5G A;  4TWD A;  4ZR6 A;  4TNV A;  5CO5 A;  3WTN A;  5J5H A;  4BFQ A;  5IUX A;  4A97 A;  4TWF A;  2M6I A;  4HFC A;  3ZKR A;  3TLU A;  3UU6 A;  5L4H A;  2WNL A;  4UM3 A;  2XNV A;  3TLT A;  5BRX A;  4ZRU A;  2Y57 A;  3RHW A;  5L4E A;  2C9T A;  2QC1 B;  4QH1 A;  4HFH A;  3EI0 A;  3SH1 A;  3PEO A;  3UUB A;  2XZ5 A;  4NPP A;  4QAB A;  4HFB A;  2LM2 A;  4HQP A;  4LMJ A;  2PH9 A;  2YMD A;  4ZK4 A;  3WIP A;  2WZY A;  2XQ8 A;  2BG9 C;  2BG9 E;  5HEO A;  2BJ0 A;  4WV9 A;  4ZZB A;  2M6B A;  3LSV A;  4XK9 A;  3UU3 A;  5SYO A;  2YN6 A;  4IRE A;  4ILC A;  2YOE A;  5L47 A;  2BR8 A;  2UZ6 A;  1UW6 A;  4UY2 A;  1OED B;  3RIA A;  4DBM A;  2MAW A;  2BYN A;  4D01 A;  1OED C;  1OED E;  5HEG A;  2PGZ A;  2ZJU A;  4ILA A;  4QH5 A;  1I9B A;  4EZ1 A;  2WNJ A;  2XNU A;  2BYS A;  2LKG A;  5LXB A;  1UV6 A;  4ZK1 A;  5AFM B;  5HCJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...