3UU6A

The glic pentameric ligand-gated ion channel loop2-22' mutant reduced in solution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu6A01
4XK9A 4EZ1A 3RI5A 2PH9A 4ZR6A 4HFDA 5L4EA 5BRXA 3PMZA 3UU8A 3SQ6A 4AFTA 4DBMA 4LMJA 2BYRA 4ILBA 1UX2A 4ZRUA 4HFEA 2Y7YA 2X00A 4AFGA 5KZUA 5HEJA 4UM3S 4NPPA 4Z90A 2XQAA 4IL9A 5CFBA 5LXBA 2ZJVA 3UUBA 3WTJA 4A97A 4TNWA 1I9BA 2XZ5A 2XYSA 4HQPA 3T4MA 5AFMB 4QH4A 5J5FA 3RQWA 4QH5A 4F8HA 2LKGA 3TLSA 5AFLA 4ALXA 2BG9E 4TWHA 2WNLA 4QAAA 3RIFA 5HEGA 3U8LA 3WTMA 4BQTA 3UU6A 5BW2A 5HCJA 3JAEA 2Y56A 3RHWA 4COFA 2ZJUA 5AFHA 3SQ9A 3SIOA 1OEDA 2MAWA 4UM1A 2XQ6A 2XNTA 4ILCA 4UXUA 3TLUA 2PGZA 2WNCA 4UM3P 4ZJTA 3WTIA 2BYQA 4HFBA 3TLVA 4ZJSA 3TLWA 4BFQA 4ZK1A 2QC1B 5L47A 5J5HA 5J5GA 4ILAA 2BR7A 3RIAA 2BYPA 1UV6A 3LSVA 5CO5A 3U8JA 2XQ4A 2YMEA 4ZZBA 5FJVA 4HFCA 4QH1A 4UY2A 4QABA 3WTNA 5BP0A 2YKSA 2XYTA 5AFMA 4IL4A 2W8GA 3UU4A 2M6IA 2XQ8A 4HFHA 3UU3A 5AFNA 4NZBA 4FRRA 4LMKA 5HEOA 2BG9C 2LM2A 3ZDGA 3TLTA 3UQ4A 3EI0A 3P50A 3UQ7A 3WTLA 1OEDE 5AFKA 2WNJA 3WTOA 4ZZCA 3C79A 2KSRA 1UW6A 5JMEA 2Y54A 2X00D 1OEDC 4HFIA 2BG9A 2BYNA 3WTKA 2XQ3A 5TVCA 4X5TA 3UU5A 4TNVA 5J5IA 4IREA 3C84A 5HCMA 4A98A 4XHEA 2YN6A 3RQUA 2Y58A 5HEHA 2WZYA 4WV9A 4LMLA 4TWDA 4TWFA 3ZKRA 2BYSA 3WTHA 5HEUA 4B5DA 3WIPA 2C9TA 2BR8A 2Y57A 3ZDHA 4Z91A 4ZK4A 4QACA 5AFJA 2YMDA 3SH1A 4UM3A 2LLYA 3JAFA 3PEOA 3JADA 2WN9A 4AFHA 5AINA 5KE4A 2BG9B 4D01A 2BJ0A 5J0ZA 2YOEA 5SYOA 2UZ6A 2XQ9A 3U8KA 5IUXA 2XNVA 2VL0A 3IGQA 3EHZA 5LG3A 4PIRA 3U8MA 2LKHA 1OEDB 2XQ7A 3EAMA 2XNUA 5L4HA 2W8FA 3U8NA 3GUAA 2XQ5A 3P4WA 2M6BA 2XZ6A
chains in the Genus database with same CATH superfamily
4GK5E 5DJQC 4MBQA 4HFDA 4PNIA 2LJLA 4ISSA 4HFVA 1VRBA 3LBXB 5KZUA 3CMLA 5FY1A 4YLHA 3WTJA 3RYHE 1XDOA 2FUPA 4DV7T 2JIWA 2XJ7A 4KBMB 3CX6B 3ONXA 5JDFA 4V1Av 2FJBA 5FY0A 4OYJA 3AE7A 4A56A 2CM0A 2MOZA 4PJNA 3D0TA 3KVAA 3H3AA 5L47A 5J5GA 3RIAA 2XAHB 2XTLA 3T1HT 3VRAA 1YQ4A 5F5WA 3RRCA 4JBWF 1ZP0A 5LGUB 3DJBA 3AE4A 2XAQB 1I6ZA 1IJ5A 4YY3T 3QK6A 5AFNA 2N1GA 5HEOA 1D0YA 3Q5EA 4JI3T 4K0KT 3KV4A 2W61A 3UQ7A 2VKHA 3WTLA 2E9XA 3GN5A 2X00D 3AVRA 4X5TA 4HEAA 5H6QB 2ZLYA 2J4GA 1AJ3A 3RIUC 2QA7A 4X1KE 2WU5A 4ASKA 2HN1A 2VQFT 1IJ6A 1XMOT 3JADA 4B3MT 5IHYA 4J2CA 1Y01A 4TX5A 3AAIA 5IWAT 2ODUA 2W8FA 2E5VA 5E0OA 1N34T 5J2TE 2ZM6T 3CX7B 1HNXT 4AKHA 2EHOD 3A5XA 4EYYR 4IE5A 4ILBA 1QUUA 5LXTE 3A8YC 5LGNB 2KT9A 3PUSA 3T4MA 3N9LA 5L2LA 3AE1A 1HFAA 3ZEFB 2E9XC 3U8LA 2V7MA 4O4LE 3E0ZA 3Q9DA 3RC3A 2CRBA 3SIOA 2XQ6A 2H3RA 4I4TE 5CGMA 2VQET 3B13A 5EZYE 4ZJSA 3RIUA 1NWMX 3AE3A 1MIVA 1W0BA 2BYPA 3GA8A 3QOFA 4IE6A 2D0UA 3QNUA 5LOVE 3MK7C 2YDQA 5LB7B 3HL6A 3ANWB 4LMKA 2LM2A 4BAYB 4DR4T 4L0RA 2BS4A 3RKOA 4LFBT 4AQYT 4F6RC 4CN1A 5BMVE 2D0TA 2MBGA 5L3BB 3C84A 3PU8A 3F57A 3RQUA 4KI0F 2BKPA 2WDQA 4YJ2E 4GYSA 1MMNA 3AA1B 3CQGB 2X51A 2CLYB 4IDNA 4EEBA 4AFHA 2XQ9A 3PUAA 4LF6T 5L4HA 2C5JA 2KXPB 4DV5T 3FHNA 4H63H 1XDPA 4DBMA 4EOZB 2JQ9A 4YSZA 4ZRUA 2CE7A 2W62A 2VB6A 4HQPA 5AQKB 3B57A 3O4XE 1YKEB 3LFMA 4QXHB 3EDVA 1NAFA 2DL1A 2ES0A 5HWYA 5HYAA 5FXZA 4CXXA 3UUNA 2E8IA 4WBNE 4B3TT 2WM9A 1WYBA 3KV9A 3G06A 3WTIA 2V7LA 2VURA 2Y6XA 1FMWA 3PJAJ 3NRYA 2LHRA 3K1SA 2IAKA 2PFVA 5LJMA 5H6RB 4CN6A 4CXWA 2BG9C 5FMNA 4H9SE 4CI3B 4ZZCA 4JLEA 2EHOB 1IBMT 3BQIA 2JQHA 1HG5A 3K8PC 4WBOA 5LMUT 3WTKA 5J5IA 2XQ3A 5TVCA 4TNVA 3EUHA 4FI5A 4GK0E 4XHEA 4G2AA 5FKYA 5C8YE 4YT0A 2E5LT 3GWHA 3KVBA 2BYSA 4X64T 5FXXA 4EEDA 2XUEA 3QUJA 4IDQA 4GKKT 2X9WA 4UM3A 3NBXX 1E2AA 2UU9T 2J47A 4DR7T 4UVBB 1H7CA 3IHRA 2A3DA 2DLRA 2JMKA 3WI3A 4DMWA 4DV2T 2QYWA 1Z0PA 5JDNA 1OXZA 2V5DA 3PUQA 1YD8G 2BS3A 3AE8A 1KNZA 4IL9A 2E2AA 4HN9A 1YQ3A 2H88A 4AKIA 4DR3T 2CMRA 4GIWA 3FZMB 5EK3A 4DV3T 1MMDA 2BG9E 5C2TA 3VU7H 5AQOB 3UU6A 3NVOA 2DCFA 2OV9A 5JQGE 5HXCA 1YKHB 4UM1A 2OA5A 1UK5A 1V9DA 1ZKEA 3N5LA 1MIWA 2YMEA 4E7SA 4I43B 4YTPA 2IW5B 3Q2MA 4ISTA 3QB5K 2YEVC 2Y48B 5LP6E 5AQUB 3C4XA 3ZSTA 1XNRT 3PUYF 3EI0A 4BA9A 3MACA 2NP9A 5ETWA 5HCMA 4B3ST 3ZC0A 3J7Yq 2WSSV 5LGTB 2XSAA 3SS1A 4AKLA 2LM9A 2Q9QD 3AB3B 2WN9A 4ZXLA 4CXYA 1OEDB 3Q5WA 2CHOA 4IGUA 2Q9QA 3RYIE 2BBJA 3UU8A 3LBXA 3AA7B 5HWXA 2BVLA 2ZM0A 4YHJA 4HGAA 1HX8A 4DR2T 3AE6A 1KEYA 2WWUA 4CQIA 2WY2A 3EVYA 2LKGA 2Y8DA 5AQFB 4UV8B 4P09A 1HNZT 5LHHB 3PUVF 3C98B 2ACXA 3I0OA 3TLUA 4IDPA 3AAAB 1CHUA 4JUYA 4AKRB 4DMVA 2JPFA 2GK9A 4BJNA 3AA0B 2M6IA 5KXJA 4QXCB 3Q5XA 3ABVA 2VK9A 4IE4A 2A9UA 2NW7A 1XNQT 1IBLT 2QGSA 3C51A 3CK6A 2KSRA 1UW6A 3CWZB 5EK4A 3ZN0B 1OWAA 3KV6A 2JJ9A 3BK9A 5JR9C 4KUMB 1KNPA 4YTNA 1UX5A 2ZMAA 5FL1A 1HR0T 4QACA 2YMDA 1W9RA 2LLYA 4JEHB 1SA0E 3HKDE 2IHR1 4DV6T 2BG9B 1ZV4X 4DBQA 4O4JE 3AVSA 2UUAT 5KX5E 2LSJA 3ETUA 2WDVA 3IA3A 4TV9E 4Z90A 4FJOA 4JI7T 3ONLC 4X1IE 1I9BA 5JREA 2RA1A 4PAGA 4LF7T 2XM1A 3CKDA 2K24A 3S4UA 2LE8A 5ADXL 4COFA 2YK0A 3AEFA 2UXCT 4XAXB 2NWBA 4ZK1A 2QC1B 1BR2A 4JI6T 1S35A 3UFEA 2LSKA 4HFCA 1US7B 2M67A 3VKHA 2W8GA 2KMFA 3N9OA 1HG2A 3ANWA 5JDGA 1IZNB 2ODVA 3ESLA 4C90A 4WZXA 3F31A 4KP3C 3ZDGA 1FMVA 4PK6A 3VHLA 4U33A 1XZYA 4DR5T 4C91A 5LHIB 2X0LB 4MLKA 3PE0A 4Z91A 1BR4A 3FZHB 4OYKA 4OX9T 1LKXA 2XSBA 3KDSE 4PJJA 2BJ0A 5J0ZA 3UT5E 4JYAT 2Q9QC 2FJAA 4O4IE 3JC6C 2I59A 4ERRA 2LOPA 3U8NA 3AE9A 1UGOA 3NZQA 5FY7A 3K3OA 1GQEA 5FXVA 2XQAA 3FBZA 5FYMA 3A7MA 5LNKA 3OKQA 5J1GA 2CWYA 4EXTA 3WTMA 3RHWA 1OEDA 2WNCA 2CCQA 4ILAA 1UX4A 1T8BA 1BR0A 4QH1A 3AXJA 4NXMT 5KMGP 2WZIA 4HFHA 2K48A 4NZBA 4DR1T 3KFWX 5AQLB 1WLXA 3C50A 3UQ4A 3E22E 4LF5T 5AFKA 4QWNB 3WTOA 2WS3A 4LF9T 3GMIA 2BG9A 4NUVA 2IC6A 4UEMA 1WR0A 1JNRA 3ZKRA 1MMGA 3WIPA 1FEWA 2JRKA 2Y57A 1VOMA 5AFJA 3SH1A 2ZM8A 4JI8T 2W0GA 3C64A 3LK2B 5IYZE 2L9QA 1HTJF 4H9OC 2BZBA 2LHNA 2LKHA 5JDQA 2D2SA 4IE7A 4ZOLE 4UR9A 1WYCA 3GN5B 2WMOA 2LEHA 5CA0E 1O3XA 3AXJB 5HEJA 4UM3S 3ZCIA 2K9AA 2VKJA 3BQLA 2YDSA 1UCUA 5AQSB 5AFMB 4QH5A 4TWHA 3RIFA 1MNDA 3JAEA 2Y56A 2ZJUA 4WW0A 2JQQA 3ZMZB 4L5GA 1YXRA 3TLWA 5EK2A 2VKDA 3FBLA 4K0UA 2OLTA 3U8JA 4ZZBA 4AQGA 4HWDA 3RYFE 3OVUA 3CQCB 2QRXA 4GOUA 1LVFA 3ZJ1A 4JI1T 4U2ZA 5DABA 5CA1E 1D0ZA 5AQIB 1ZOYA 3BQKA 4PK4A 3PUWF 4IDOA 2X66A 2CBJA 3P4PA 4ZI3D 2BBHA 3HR0A 5LJNA 2J62A 5DQVA 2X9XA 4TWDA 3KV5A 5LA6E 3CX8B 2C9TA 3O1JA 2QVAA 3RYCE 3AE5A 2LRLA 4TV8E 5KE4A 3OYXA 3NZPA 4EZHA 2V7JA 3C4ZA 1LRZA 2XNVA 5L3EB 4DNDA 5HXHA 5ABHA 2M6BA 1E1HB 4EAHA 3P8CD 5L4EA 2HH7A 3RPUA 2J1DG 4AFTA 2FJEA 2X00A 4E7ZA 4AFGA 2ZJVA 4CI1B 1N36T 2W63A 1ZHCA 4UV9B 3X1DA 4NUUA 5AFLA 1EZ3A 5BW2A 1D0XA 3MKDA 2WP9A 4TUYE 5JVDE 5FVLA 3AE2A 2BYQA 4HFBA 3TLVA 3R84B 3VR8A 4P0BA 2KWHA 3LSVA 5ABFA 3UTKA 4EYUA 5FJVA 2XYTA 1XMQT 2BDEA 4ILUA 3UU4A 4YJ3E 2X67A 3ZYLA 1IBKT 1HNWT 4GKJT 5LMNT 4EZ4A 4NXNT 4Q25A 3UFGA 3UUMA 2MPKA 1T7SA 4HWFA 1J1JA 1DU2A 4JI0T 3IEEA 4L9IA 3B5MA 2V26A 5ABGA 3PV0F 2XM2A 3ZC1A 2XZEA 5BR8T 4ANJA 5L3GB 3PEOA 2PBIA 3FB2A 3VR9A 4IIJE 3AA6B 3PTRB 5AFUL 4PIRA 1HX1B 4DVDA 2XQ5A 2UXXB 4EZ1A 4TZ4C 2Q9QB 5LBQB 5BRXA 5HAXA 3N9NA 3MXZA 3L39A 2DNXA 2IIUA 2WAUA 4JEUB 2I6HA 1CUNA 2CEAA 5FP3A 5LHGB 2G0UA 5LXBA 2XHEB 3JCFA 3NKZA 3RLFF 5CJ5A 4TN7B 3AEGA 4ZHQE 4H9NC 3RX6A 5HEGA 5AQMB 4DBRA 3L8RA 1U5PA 1HF8A 3SQ9A 3EDUA 1D1BA 1U4QA 4UXUA 3ZT5A 4QHOA 2V1DB 4P0AA 2WBLA 4UXNB 3V5SA 3I9WA 5M4YA 4UY2A 4QABA 1BR1A 5AFMA 1T98A 4Z8XA 3K3QC 3OJAA 3ZN1B 4CI2B 2XQ8A 5JDHA 2LSIA 3M3ZB 3N2KE 3SRZA 2JQKA 1FIOA 2CA5A 3M65A 3P50A 2EHOA 3C79A 3I0QA 3ONJA 5JMEA 1OEDC 2KWIB 4AKGA 4H9PC 4U2YA 2CXDA 2VWAA 4YSYA 4QX8B 4EIWA 2WWVA 2WZYA 2KZ7B 1I94T 2XY8B 4B3RT 2X9YA 2V8SV 4I50E 3JAFA 4AQFA 2N9DA 4ZI7E 2F4VT 4XZCA 4IHJE 3IGQA 1L0VA 3AEBA 1X9BA 4XK9A 4ZR6A 4DV1T 5L3CB 3ZMTB 3PMZA 2X0HA 2E9XB 3SQ6A 4LMJA 2DHRA 3CVRA 5CB4E 5JH7E 5JR9B 4AI6A 2WMNA 3L09A 2UXBT 4ALXA 5JRCA 4H9QC 4LFAT 2XNTA 2V5CA 2AXDS 2BVMA 4U7IA 4UF0B 4N78D 5CO5A 1KK7A 5HXRA 5AQVB 4AISA 4O4HE 3KINB 3LDQB 4CN4A 2KLQA 3SWHA 4EV6A 4UELA 3PU3A 2RP4A 2XAGB 4H63V 2BS2A 1Z8UA 2BKOA 5A1LA 3MJXA 3N9QA 3SOLA 2H7VC 4U31A 4KHZF 4JI5T 2PTFA 4HFIA 2L3LA 4IREA 4IDZA 4DUZT 3CQXC 3H37A 4A98A 2V6YB 2HPLA 2R6GF 4WV9A 4U7YA 4KX6A 4TWFA 2A72A 2NR4A 2PJQA 3ZDHA 5TAOA 3ZPOA 3QC9A 2CXFA 3ZCJA 2XPKA 5AINA 5JDMA 5F3JA 3EHZA 5L3DB 2NTXA 2XNUA 1M7KA 3RGLA 2EHOC 2YINA 3P4RA 2MTQA 2ACZA 5FXWA 4NPPA 3P7IA 3O9XA 3HA4A 4A97A 2VKOA 2L8KA 2XZ5A 2RPAA 3LK42 2N2NA 2NTYA 3RQWA 3W15B 3TLSA 5KDMC 3ZMVB 4WYVA 4QAAA 3N9PA 4OFZA 1ZEEA 2I0MA 1S94A 4U72A 4HTEA 4BFQA 4YXDA 5FL0A 2BR7A 1UURA 4ZEYA 1UV6A 3IBPA 3ETVA 4QX7B 3N2GE 5BP0A 3TKLB 5FNVE 4U74A 2VL8A 2NW9A 3LG7A 2VASA 3FXEB 1R8IA 4CZZB 1SE7A 2WNJA 3ZMSB 5JDLA 2XAJB 5AQTB 3QB5A 2XASB 4KHPT 3AAEB 5HXSA 2YN6A 4LMLA 3SFEA 2CLYC 1WRDA 3VRBA 5L3FB 3AEAA 3CIRA 1Y64B 4ZS3A 2VVSA 5J2UE 2C5IT 5DQWA 3RC8A 3MZKB 5JTGA 3RKGA 4EGWA 5LG3A 2BR8A 2LSYA 4O2AE 3ZMUB 4AQFC 2A2FX 3RH3A 3KBUA 4DIDB 2FBWA 2JMHA 4HFEA 3P4SA 5AQQB 3E08A 5AQPB 4X62T 1WCRA 1J5ET 1JNZA 4LF4T 4QH4A 4XBFB 3HKCE 4PK5A 4ZI2D 4BQTA 1B7TA 2CBIA 4A5XA 3HI2A 5ABEA 1YW0A 4ILCA 3FZKB 4JV5T 2PGZA 2DWGA 4UM3P 2YU2A 4ZJTA 5J5HA 1MMAA 4O2BE 4WNKA 2H89A 1NENA 3JC6D 1VCSA 5LCYA 3I9YA 4UVCB 2CPTA 5AQRB 4FRRA 3ZLIA 4AIUA 3HKBE 1SHZC 2XAFB 4UVAB 2YDRA 3F2EA 3ZYKA 4KMCA 3UU5A 3ZT6A 3KBTA 3FZLB 3NWIA 5HEUA 2W66A 4HWHA 5C3JA 2WQYA 1KNRA 1E7PA 2LT3A 5SYOA 1LVKA 1XWMA 2PG8A 3U8KA 2DI4A 3AEEA 3L3PA 1MNEA 3Q5DA 3EAMA 2P9BA 3P4WA 2XZ6A 2UXNB 2V6XA 4H9RC 1D1CA 5FVKA 4B6XA 3FZFB 1UX2A 2LRKA 4X20E 2HN2A 5CFBA 3N2OA 4ZI3C 1FJGT 4TNWA 1G8XA 4F8HA 1N33T 1M62A 3O1IA 2WNLA 2H7OA 2V7IA 4M1PA 5AQJB 5AFHA 3ZYMA 3ZJ2A 4BJMA 5F8PA 2DWKA 3PUXF 2XQ4A 1W0AA 1QSDA 4IL4A 5LYJE 2K3WA 2UXDT 5LBMA 4G63A 4PFPA 2MYSA 2YU1A 4PFOA 4IE0A 3TLTA 4YHHT 3OPCA 1X79A 5AQNB 1OEDE 2X0YA 3UUXB 3MA9A 4GYRA 4MHCA 2AE9A 2Y58A 4HKAA 2IMLA 2C0SA 4YTMA 4B5DA 3NRXA 2KNDA 2B1EA 3T8OA 1HCIA 4U3CA 2IUBA 3R6NA 2B76A 2YOEA 1T72A 3J9X1 3GUAA 1VCTA 4DV0T 3CPZA 3U78A 3FXDB 2WZHA 3LJCA 2WCAA 3PUZF 2BYRA 4IT4A 4JI4T 3UUBA 1NEKA 1IAPA 2UUCT 2XYSA 4LFCT 4ZI2C 4MFRA 2VVNA 2X68A 3P4QA 4OK0A 5HCJA 3UULA 4O8SA 2MAWA 2CXLA 4PJMA 2IDOB 3ZT7A 2W2UA 2ZM2A 1MIYA 1SUMB 2YKSA 2SPCA 3OYZA 2FJDA 1WR6A 2LSGA 4I0UA 4HWCA 4DUYT 3O1HA 3PURA 3ZSSA 4DO0A 3AEDA 3VKGA 1HS7A 2NW8A 1UUSA 2Y54A 5AQHB 3LK3B 2BYNA 4EB6E 4DV4T 3OTOT 2K5BB 4PJLA 4UIGA 3WTHA 1N32T 2WU2A 4YSXA 4ZK4A 4ADZA 2HHHT 3WAJA 3PUGA 2NOXA 4QXBB 2LOSA 2IC9A 5JR9A 2UZ6A 2VL0A 4MALA 3U8MA 4D01A 3PJAA 3I1AA 3RI5A 2PH9A 2HPJA 3PDYA 3RRWA 3DTOA 4I55E 3N9MA 2Y7YA 3C4WA 2C5KT 5J5FA 2E9XD 4HE8A 1W09A 2CWOA 4AXPA 2KINB 5JRCB 3EABA 4X65T 4X66T 1WFDA 2BKNA 2D5UA 3V5UA 3HKEE 2W67A 2V7KA 4UF0A 4NIQA 4JI2T 1KF6A 3WTNA 4ZS2A 4P1NA 5HXEA 2UUBT 3K3NA 5AQGB 2XQYA 3UU3A 2V6YA 4X1YE 1J5WA 4LF8T 3AECA 2W4XA 2X9HA 4YFSA 5GONE 2WB5A 4OHFA 2W00A 2WDRA 2Z6EA 3IF8B 4HWIB 1G73A 1KFYA 3H3MA 5LG4A 3SFDA 5HEHA 3RF1A 2D9DA 4QKNA 2CHNA 3DP7A 1D1AA 5ABFB 3WAKA 3T1YT 4DR6T 3U3IA 5IUXA 1QLBA 3OBVE 2XQ7A 4PW8A
chains in the Genus database with same CATH topology
4XK9A 4EZ1A 3RI5A 2PH9A 4ZR6A 4HFDA 5L4EA 5BRXA 3PMZA 3UU8A 3SQ6A 4AFTA 4DBMA 4LMJA 2BYRA 4ILBA 1UX2A 4ZRUA 4HFEA 2Y7YA 2X00A 4AFGA 5KZUA 5HEJA 4UM3S 4NPPA 4Z90A 2XQAA 4IL9A 5CFBA 5LXBA 2ZJVA 3UUBA 3WTJA 4A97A 4TNWA 1I9BA 2XZ5A 2XYSA 4HQPA 3T4MA 5AFMB 4QH4A 5J5FA 3RQWA 4QH5A 4F8HA 2LKGA 3TLSA 5AFLA 4ALXA 2BG9E 4TWHA 2WNLA 4QAAA 3RIFA 5HEGA 3U8LA 3WTMA 4BQTA 3UU6A 5BW2A 5HCJA 3JAEA 2Y56A 3RHWA 4COFA 2ZJUA 5AFHA 3SQ9A 3SIOA 1OEDA 2MAWA 4UM1A 2XQ6A 2XNTA 4ILCA 4UXUA 3TLUA 2PGZA 2WNCA 4UM3P 4ZJTA 3WTIA 2BYQA 4HFBA 3TLVA 4ZJSA 3TLWA 4BFQA 4ZK1A 2QC1B 5L47A 5J5HA 5J5GA 4ILAA 2BR7A 3RIAA 2BYPA 1UV6A 3LSVA 5CO5A 3U8JA 2XQ4A 2YMEA 4ZZBA 5FJVA 4HFCA 4QH1A 4UY2A 4QABA 3WTNA 5BP0A 2YKSA 2XYTA 5AFMA 4IL4A 2W8GA 3UU4A 2M6IA 2XQ8A 4HFHA 3UU3A 5AFNA 4NZBA 4FRRA 4LMKA 5HEOA 2BG9C 2LM2A 3ZDGA 3TLTA 3UQ4A 3EI0A 3P50A 3UQ7A 3WTLA 1OEDE 5AFKA 2WNJA 3WTOA 4ZZCA 3C79A 2KSRA 1UW6A 5JMEA 2Y54A 2X00D 1OEDC 4HFIA 2BG9A 2BYNA 3WTKA 2XQ3A 5TVCA 4X5TA 3UU5A 4TNVA 5J5IA 4IREA 3C84A 5HCMA 4A98A 4XHEA 2YN6A 3RQUA 2Y58A 5HEHA 2WZYA 4WV9A 4LMLA 4TWDA 4TWFA 3ZKRA 2BYSA 3WTHA 5HEUA 4B5DA 3WIPA 2C9TA 2BR8A 2Y57A 3ZDHA 4Z91A 4ZK4A 4QACA 5AFJA 2YMDA 3SH1A 4UM3A 2LLYA 3JAFA 3PEOA 3JADA 2WN9A 4AFHA 5AINA 5KE4A 2BG9B 4D01A 2BJ0A 5J0ZA 2YOEA 5SYOA 2UZ6A 2XQ9A 3U8KA 5IUXA 2XNVA 2VL0A 3IGQA 3EHZA 5LG3A 4PIRA 3U8MA 2LKHA 1OEDB 2XQ7A 3EAMA 2XNUA 5L4HA 2W8FA 3U8NA 3GUAA 2XQ5A 3P4WA 2M6BA 2XZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XK9 A;  4EZ1 A;  3RI5 A;  2PH9 A;  4ZR6 A;  4HFD A;  5L4E A;  5BRX A;  3PMZ A;  3UU8 A;  3SQ6 A;  4AFT A;  4DBM A;  4LMJ A;  2BYR A;  4ILB A;  1UX2 A;  4ZRU A;  4HFE A;  2Y7Y A;  2X00 A;  4AFG A;  5KZU A;  5HEJ A;  4UM3 S;  4NPP A;  4Z90 A;  2XQA A;  4IL9 A;  5CFB A;  5LXB A;  2ZJV A;  3UUB A;  3WTJ A;  4A97 A;  4TNW A;  1I9B A;  2XZ5 A;  2XYS A;  4HQP A;  3T4M A;  5AFM B;  4QH4 A;  5J5F A;  3RQW A;  4QH5 A;  4F8H A;  2LKG A;  3TLS A;  5AFL A;  4ALX A;  2BG9 E;  4TWH A;  2WNL A;  4QAA A;  3RIF A;  5HEG A;  3U8L A;  3WTM A;  4BQT A;  3UU6 A;  5BW2 A;  5HCJ A;  3JAE A;  2Y56 A;  3RHW A;  4COF A;  2ZJU A;  5AFH A;  3SQ9 A;  3SIO A;  1OED A;  2MAW A;  4UM1 A;  2XQ6 A;  2XNT A;  4ILC A;  4UXU A;  3TLU A;  2PGZ A;  2WNC A;  4UM3 P;  4ZJT A;  3WTI A;  2BYQ A;  4HFB A;  3TLV A;  4ZJS A;  3TLW A;  4BFQ A;  4ZK1 A;  2QC1 B;  5L47 A;  5J5H A;  5J5G A;  4ILA A;  2BR7 A;  3RIA A;  2BYP A;  1UV6 A;  3LSV A;  5CO5 A;  3U8J A;  2XQ4 A;  2YME A;  4ZZB A;  5FJV A;  4HFC A;  4QH1 A;  4UY2 A;  4QAB A;  3WTN A;  5BP0 A;  2YKS A;  2XYT A;  5AFM A;  4IL4 A;  2W8G A;  3UU4 A;  2M6I A;  2XQ8 A;  4HFH A;  3UU3 A;  5AFN A;  4NZB A;  4FRR A;  4LMK A;  5HEO A;  2BG9 C;  2LM2 A;  3ZDG A;  3TLT A;  3UQ4 A;  3EI0 A;  3P50 A;  3UQ7 A;  3WTL A;  1OED E;  5AFK A;  2WNJ A;  3WTO A;  4ZZC A;  3C79 A;  2KSR A;  1UW6 A;  5JME A;  2Y54 A;  2X00 D;  1OED C;  4HFI A;  2BG9 A;  2BYN A;  3WTK A;  2XQ3 A;  5TVC A;  4X5T A;  3UU5 A;  4TNV A;  5J5I A;  4IRE A;  3C84 A;  5HCM A;  4A98 A;  4XHE A;  2YN6 A;  3RQU A;  2Y58 A;  5HEH A;  2WZY A;  4WV9 A;  4LML A;  4TWD A;  4TWF A;  3ZKR A;  2BYS A;  3WTH A;  5HEU A;  4B5D A;  3WIP A;  2C9T A;  2BR8 A;  2Y57 A;  3ZDH A;  4Z91 A;  4ZK4 A;  4QAC A;  5AFJ A;  2YMD A;  3SH1 A;  4UM3 A;  2LLY A;  3JAF A;  3PEO A;  3JAD A;  2WN9 A;  4AFH A;  5AIN A;  5KE4 A;  2BG9 B;  4D01 A;  2BJ0 A;  5J0Z A;  2YOE A;  5SYO A;  2UZ6 A;  2XQ9 A;  3U8K A;  5IUX A;  2XNV A;  2VL0 A;  3IGQ A;  3EHZ A;  5LG3 A;  4PIR A;  3U8M A;  2LKH A;  1OED B;  2XQ7 A;  3EAM A;  2XNU A;  5L4H A;  2W8F A;  3U8N A;  3GUA A;  2XQ5 A;  3P4W A;  2M6B A;  2XZ6 A; 
#chains in the Genus database with same CATH topology
 4GK5 E;  5DJQ C;  4MBQ A;  4HFD A;  4PNI A;  2LJL A;  4ISS A;  4HFV A;  1VRB A;  3LBX B;  5KZU A;  3CML A;  5FY1 A;  4YLH A;  3WTJ A;  3RYH E;  1XDO A;  2FUP A;  4DV7 T;  2JIW A;  2XJ7 A;  4KBM B;  3CX6 B;  3ONX A;  5JDF A;  4V1A v;  2FJB A;  5FY0 A;  4OYJ A;  3AE7 A;  4A56 A;  2CM0 A;  2MOZ A;  4PJN A;  3D0T A;  3KVA A;  3H3A A;  5L47 A;  5J5G A;  3RIA A;  2XAH B;  2XTL A;  3T1H T;  3VRA A;  1YQ4 A;  5F5W A;  3RRC A;  4JBW F;  1ZP0 A;  5LGU B;  3DJB A;  3AE4 A;  2XAQ B;  1I6Z A;  1IJ5 A;  4YY3 T;  3QK6 A;  5AFN A;  2N1G A;  5HEO A;  1D0Y A;  3Q5E A;  4JI3 T;  4K0K T;  3KV4 A;  2W61 A;  3UQ7 A;  2VKH A;  3WTL A;  2E9X A;  3GN5 A;  2X00 D;  3AVR A;  4X5T A;  4HEA A;  5H6Q B;  2ZLY A;  2J4G A;  1AJ3 A;  3RIU C;  2QA7 A;  4X1K E;  2WU5 A;  4ASK A;  2HN1 A;  2VQF T;  1IJ6 A;  1XMO T;  3JAD A;  4B3M T;  5IHY A;  4J2C A;  1Y01 A;  4TX5 A;  3AAI A;  5IWA T;  2ODU A;  2W8F A;  2E5V A;  5E0O A;  1N34 T;  5J2T E;  2ZM6 T;  3CX7 B;  1HNX T;  4AKH A;  2EHO D;  3A5X A;  4EYY R;  4IE5 A;  4ILB A;  1QUU A;  5LXT E;  3A8Y C;  5LGN B;  2KT9 A;  3PUS A;  3T4M A;  3N9L A;  5L2L A;  3AE1 A;  1HFA A;  3ZEF B;  2E9X C;  3U8L A;  2V7M A;  4O4L E;  3E0Z A;  3Q9D A;  3RC3 A;  2CRB A;  3SIO A;  2XQ6 A;  2H3R A;  4I4T E;  5CGM A;  2VQE T;  3B13 A;  5EZY E;  4ZJS A;  3RIU A;  1NWM X;  3AE3 A;  1MIV A;  1W0B A;  2BYP A;  3GA8 A;  3QOF A;  4IE6 A;  2D0U A;  3QNU A;  5LOV E;  3MK7 C;  2YDQ A;  5LB7 B;  3HL6 A;  3ANW B;  4LMK A;  2LM2 A;  4BAY B;  4DR4 T;  4L0R A;  2BS4 A;  3RKO A;  4LFB T;  4AQY T;  4F6R C;  4CN1 A;  5BMV E;  2D0T A;  2MBG A;  5L3B B;  3C84 A;  3PU8 A;  3F57 A;  3RQU A;  4KI0 F;  2BKP A;  2WDQ A;  4YJ2 E;  4GYS A;  1MMN A;  3AA1 B;  3CQG B;  2X51 A;  2CLY B;  4IDN A;  4EEB A;  4AFH A;  2XQ9 A;  3PUA A;  4LF6 T;  5L4H A;  2C5J A;  2KXP B;  4DV5 T;  3FHN A;  4H63 H;  1XDP A;  4DBM A;  4EOZ B;  2JQ9 A;  4YSZ A;  4ZRU A;  2CE7 A;  2W62 A;  2VB6 A;  4HQP A;  5AQK B;  3B57 A;  3O4X E;  1YKE B;  3LFM A;  4QXH B;  3EDV A;  1NAF A;  2DL1 A;  2ES0 A;  5HWY A;  5HYA A;  5FXZ A;  4CXX A;  3UUN A;  2E8I A;  4WBN E;  4B3T T;  2WM9 A;  1WYB A;  3KV9 A;  3G06 A;  3WTI A;  2V7L A;  2VUR A;  2Y6X A;  1FMW A;  3PJA J;  3NRY A;  2LHR A;  3K1S A;  2IAK A;  2PFV A;  5LJM A;  5H6R B;  4CN6 A;  4CXW A;  2BG9 C;  5FMN A;  4H9S E;  4CI3 B;  4ZZC A;  4JLE A;  2EHO B;  1IBM T;  3BQI A;  2JQH A;  1HG5 A;  3K8P C;  4WBO A;  5LMU T;  3WTK A;  5J5I A;  2XQ3 A;  5TVC A;  4TNV A;  3EUH A;  4FI5 A;  4GK0 E;  4XHE A;  4G2A A;  5FKY A;  5C8Y E;  4YT0 A;  2E5L T;  3GWH A;  3KVB A;  2BYS A;  4X64 T;  5FXX A;  4EED A;  2XUE A;  3QUJ A;  4IDQ A;  4GKK T;  2X9W A;  4UM3 A;  3NBX X;  1E2A A;  2UU9 T;  2J47 A;  4DR7 T;  4UVB B;  1H7C A;  3IHR A;  2A3D A;  2DLR A;  2JMK A;  3WI3 A;  4DMW A;  4DV2 T;  2QYW A;  1Z0P A;  5JDN A;  1OXZ A;  2V5D A;  3PUQ A;  1YD8 G;  2BS3 A;  3AE8 A;  1KNZ A;  4IL9 A;  2E2A A;  4HN9 A;  1YQ3 A;  2H88 A;  4AKI A;  4DR3 T;  2CMR A;  4GIW A;  3FZM B;  5EK3 A;  4DV3 T;  1MMD A;  2BG9 E;  5C2T A;  3VU7 H;  5AQO B;  3UU6 A;  3NVO A;  2DCF A;  2OV9 A;  5JQG E;  5HXC A;  1YKH B;  4UM1 A;  2OA5 A;  1UK5 A;  1V9D A;  1ZKE A;  3N5L A;  1MIW A;  2YME A;  4E7S A;  4I43 B;  4YTP A;  2IW5 B;  3Q2M A;  4IST A;  3QB5 K;  2YEV C;  2Y48 B;  5LP6 E;  5AQU B;  3C4X A;  3ZST A;  1XNR T;  3PUY F;  3EI0 A;  4BA9 A;  3MAC A;  2NP9 A;  5ETW A;  5HCM A;  4B3S T;  3ZC0 A;  3J7Y q;  2WSS V;  5LGT B;  2XSA A;  3SS1 A;  4AKL A;  2LM9 A;  2Q9Q D;  3AB3 B;  2WN9 A;  4ZXL A;  4CXY A;  1OED B;  3Q5W A;  2CHO A;  4IGU A;  2Q9Q A;  3RYI E;  2BBJ A;  3UU8 A;  3LBX A;  3AA7 B;  5HWX A;  2BVL A;  2ZM0 A;  4YHJ A;  4HGA A;  1HX8 A;  4DR2 T;  3AE6 A;  1KEY A;  2WWU A;  4CQI A;  2WY2 A;  3EVY A;  2LKG A;  2Y8D A;  5AQF B;  4UV8 B;  4P09 A;  1HNZ T;  5LHH B;  3PUV F;  3C98 B;  2ACX A;  3I0O A;  3TLU A;  4IDP A;  3AAA B;  1CHU A;  4JUY A;  4AKR B;  4DMV A;  2JPF A;  2GK9 A;  4BJN A;  3AA0 B;  2M6I A;  5KXJ A;  4QXC B;  3Q5X A;  3ABV A;  2VK9 A;  4IE4 A;  2A9U A;  2NW7 A;  1XNQ T;  1IBL T;  2QGS A;  3C51 A;  3CK6 A;  2KSR A;  1UW6 A;  3CWZ B;  5EK4 A;  3ZN0 B;  1OWA A;  3KV6 A;  2JJ9 A;  3BK9 A;  5JR9 C;  4KUM B;  1KNP A;  4YTN A;  1UX5 A;  2ZMA A;  5FL1 A;  1HR0 T;  4QAC A;  2YMD A;  1W9R A;  2LLY A;  4JEH B;  1SA0 E;  3HKD E;  2IHR 1;  4DV6 T;  2BG9 B;  1ZV4 X;  4DBQ A;  4O4J E;  3AVS A;  2UUA T;  5KX5 E;  2LSJ A;  3ETU A;  2WDV A;  3IA3 A;  4TV9 E;  4Z90 A;  4FJO A;  4JI7 T;  3ONL C;  4X1I E;  1I9B A;  5JRE A;  2RA1 A;  4PAG A;  4LF7 T;  2XM1 A;  3CKD A;  2K24 A;  3S4U A;  2LE8 A;  5ADX L;  4COF A;  2YK0 A;  3AEF A;  2UXC T;  4XAX B;  2NWB A;  4ZK1 A;  2QC1 B;  1BR2 A;  4JI6 T;  1S35 A;  3UFE A;  2LSK A;  4HFC A;  1US7 B;  2M67 A;  3VKH A;  2W8G A;  2KMF A;  3N9O A;  1HG2 A;  3ANW A;  5JDG A;  1IZN B;  2ODV A;  3ESL A;  4C90 A;  4WZX A;  3F31 A;  4KP3 C;  3ZDG A;  1FMV A;  4PK6 A;  3VHL A;  4U33 A;  1XZY A;  4DR5 T;  4C91 A;  5LHI B;  2X0L B;  4MLK A;  3PE0 A;  4Z91 A;  1BR4 A;  3FZH B;  4OYK A;  4OX9 T;  1LKX A;  2XSB A;  3KDS E;  4PJJ A;  2BJ0 A;  5J0Z A;  3UT5 E;  4JYA T;  2Q9Q C;  2FJA A;  4O4I E;  3JC6 C;  2I59 A;  4ERR A;  2LOP A;  3U8N A;  3AE9 A;  1UGO A;  3NZQ A;  5FY7 A;  3K3O A;  1GQE A;  5FXV A;  2XQA A;  3FBZ A;  5FYM A;  3A7M A;  5LNK A;  3OKQ A;  5J1G A;  2CWY A;  4EXT A;  3WTM A;  3RHW A;  1OED A;  2WNC A;  2CCQ A;  4ILA A;  1UX4 A;  1T8B A;  1BR0 A;  4QH1 A;  3AXJ A;  4NXM T;  5KMG P;  2WZI A;  4HFH A;  2K48 A;  4NZB A;  4DR1 T;  3KFW X;  5AQL B;  1WLX A;  3C50 A;  3UQ4 A;  3E22 E;  4LF5 T;  5AFK A;  4QWN B;  3WTO A;  2WS3 A;  4LF9 T;  3GMI A;  2BG9 A;  4NUV A;  2IC6 A;  4UEM A;  1WR0 A;  1JNR A;  3ZKR A;  1MMG A;  3WIP A;  1FEW A;  2JRK A;  2Y57 A;  1VOM A;  5AFJ A;  3SH1 A;  2ZM8 A;  4JI8 T;  2W0G A;  3C64 A;  3LK2 B;  5IYZ E;  2L9Q A;  1HTJ F;  4H9O C;  2BZB A;  2LHN A;  2LKH A;  5JDQ A;  2D2S A;  4IE7 A;  4ZOL E;  4UR9 A;  1WYC A;  3GN5 B;  2WMO A;  2LEH A;  5CA0 E;  1O3X A;  3AXJ B;  5HEJ A;  4UM3 S;  3ZCI A;  2K9A A;  2VKJ A;  3BQL A;  2YDS A;  1UCU A;  5AQS B;  5AFM B;  4QH5 A;  4TWH A;  3RIF A;  1MND A;  3JAE A;  2Y56 A;  2ZJU A;  4WW0 A;  2JQQ A;  3ZMZ B;  4L5G A;  1YXR A;  3TLW A;  5EK2 A;  2VKD A;  3FBL A;  4K0U A;  2OLT A;  3U8J A;  4ZZB A;  4AQG A;  4HWD A;  3RYF E;  3OVU A;  3CQC B;  2QRX A;  4GOU A;  1LVF A;  3ZJ1 A;  4JI1 T;  4U2Z A;  5DAB A;  5CA1 E;  1D0Z A;  5AQI B;  1ZOY A;  3BQK A;  4PK4 A;  3PUW F;  4IDO A;  2X66 A;  2CBJ A;  3P4P A;  4ZI3 D;  2BBH A;  3HR0 A;  5LJN A;  2J62 A;  5DQV A;  2X9X A;  4TWD A;  3KV5 A;  5LA6 E;  3CX8 B;  2C9T A;  3O1J A;  2QVA A;  3RYC E;  3AE5 A;  2LRL A;  4TV8 E;  5KE4 A;  3OYX A;  3NZP A;  4EZH A;  2V7J A;  3C4Z A;  1LRZ A;  2XNV A;  5L3E B;  4DND A;  5HXH A;  5ABH A;  2M6B A;  1E1H B;  4EAH A;  3P8C D;  5L4E A;  2HH7 A;  3RPU A;  2J1D G;  4AFT A;  2FJE A;  2X00 A;  4E7Z A;  4AFG A;  2ZJV A;  4CI1 B;  1N36 T;  2W63 A;  1ZHC A;  4UV9 B;  3X1D A;  4NUU A;  5AFL A;  1EZ3 A;  5BW2 A;  1D0X A;  3MKD A;  2WP9 A;  4TUY E;  5JVD E;  5FVL A;  3AE2 A;  2BYQ A;  4HFB A;  3TLV A;  3R84 B;  3VR8 A;  4P0B A;  2KWH A;  3LSV A;  5ABF A;  3UTK A;  4EYU A;  5FJV A;  2XYT A;  1XMQ T;  2BDE A;  4ILU A;  3UU4 A;  4YJ3 E;  2X67 A;  3ZYL A;  1IBK T;  1HNW T;  4GKJ T;  5LMN T;  4EZ4 A;  4NXN T;  4Q25 A;  3UFG A;  3UUM A;  2MPK A;  1T7S A;  4HWF A;  1J1J A;  1DU2 A;  4JI0 T;  3IEE A;  4L9I A;  3B5M A;  2V26 A;  5ABG A;  3PV0 F;  2XM2 A;  3ZC1 A;  2XZE A;  5BR8 T;  4ANJ A;  5L3G B;  3PEO A;  2PBI A;  3FB2 A;  3VR9 A;  4IIJ E;  3AA6 B;  3PTR B;  5AFU L;  4PIR A;  1HX1 B;  4DVD A;  2XQ5 A;  2UXX B;  4EZ1 A;  4TZ4 C;  2Q9Q B;  5LBQ B;  5BRX A;  5HAX A;  3N9N A;  3MXZ A;  3L39 A;  2DNX A;  2IIU A;  2WAU A;  4JEU B;  2I6H A;  1CUN A;  2CEA A;  5FP3 A;  5LHG B;  2G0U A;  5LXB A;  2XHE B;  3JCF A;  3NKZ A;  3RLF F;  5CJ5 A;  4TN7 B;  3AEG A;  4ZHQ E;  4H9N C;  3RX6 A;  5HEG A;  5AQM B;  4DBR A;  3L8R A;  1U5P A;  1HF8 A;  3SQ9 A;  3EDU A;  1D1B A;  1U4Q A;  4UXU A;  3ZT5 A;  4QHO A;  2V1D B;  4P0A A;  2WBL A;  4UXN B;  3V5S A;  3I9W A;  5M4Y A;  4UY2 A;  4QAB A;  1BR1 A;  5AFM A;  1T98 A;  4Z8X A;  3K3Q C;  3OJA A;  3ZN1 B;  4CI2 B;  2XQ8 A;  5JDH A;  2LSI A;  3M3Z B;  3N2K E;  3SRZ A;  2JQK A;  1FIO A;  2CA5 A;  3M65 A;  3P50 A;  2EHO A;  3C79 A;  3I0Q A;  3ONJ A;  5JME A;  1OED C;  2KWI B;  4AKG A;  4H9P C;  4U2Y A;  2CXD A;  2VWA A;  4YSY A;  4QX8 B;  4EIW A;  2WWV A;  2WZY A;  2KZ7 B;  1I94 T;  2XY8 B;  4B3R T;  2X9Y A;  2V8S V;  4I50 E;  3JAF A;  4AQF A;  2N9D A;  4ZI7 E;  2F4V T;  4XZC A;  4IHJ E;  3IGQ A;  1L0V A;  3AEB A;  1X9B A;  4XK9 A;  4ZR6 A;  4DV1 T;  5L3C B;  3ZMT B;  3PMZ A;  2X0H A;  2E9X B;  3SQ6 A;  4LMJ A;  2DHR A;  3CVR A;  5CB4 E;  5JH7 E;  5JR9 B;  4AI6 A;  2WMN A;  3L09 A;  2UXB T;  4ALX A;  5JRC A;  4H9Q C;  4LFA T;  2XNT A;  2V5C A;  2AXD S;  2BVM A;  4U7I A;  4UF0 B;  4N78 D;  5CO5 A;  1KK7 A;  5HXR A;  5AQV B;  4AIS A;  4O4H E;  3KIN B;  3LDQ B;  4CN4 A;  2KLQ A;  3SWH A;  4EV6 A;  4UEL A;  3PU3 A;  2RP4 A;  2XAG B;  4H63 V;  2BS2 A;  1Z8U A;  2BKO A;  5A1L A;  3MJX A;  3N9Q A;  3SOL A;  2H7V C;  4U31 A;  4KHZ F;  4JI5 T;  2PTF A;  4HFI A;  2L3L A;  4IRE A;  4IDZ A;  4DUZ T;  3CQX C;  3H37 A;  4A98 A;  2V6Y B;  2HPL A;  2R6G F;  4WV9 A;  4U7Y A;  4KX6 A;  4TWF A;  2A72 A;  2NR4 A;  2PJQ A;  3ZDH A;  5TAO A;  3ZPO A;  3QC9 A;  2CXF A;  3ZCJ A;  2XPK A;  5AIN A;  5JDM A;  5F3J A;  3EHZ A;  5L3D B;  2NTX A;  2XNU A;  1M7K A;  3RGL A;  2EHO C;  2YIN A;  3P4R A;  2MTQ A;  2ACZ A;  5FXW A;  4NPP A;  3P7I A;  3O9X A;  3HA4 A;  4A97 A;  2VKO A;  2L8K A;  2XZ5 A;  2RPA A;  3LK4 2;  2N2N A;  2NTY A;  3RQW A;  3W15 B;  3TLS A;  5KDM C;  3ZMV B;  4WYV A;  4QAA A;  3N9P A;  4OFZ A;  1ZEE A;  2I0M A;  1S94 A;  4U72 A;  4HTE A;  4BFQ A;  4YXD A;  5FL0 A;  2BR7 A;  1UUR A;  4ZEY A;  1UV6 A;  3IBP A;  3ETV A;  4QX7 B;  3N2G E;  5BP0 A;  3TKL B;  5FNV E;  4U74 A;  2VL8 A;  2NW9 A;  3LG7 A;  2VAS A;  3FXE B;  1R8I A;  4CZZ B;  1SE7 A;  2WNJ A;  3ZMS B;  5JDL A;  2XAJ B;  5AQT B;  3QB5 A;  2XAS B;  4KHP T;  3AAE B;  5HXS A;  2YN6 A;  4LML A;  3SFE A;  2CLY C;  1WRD A;  3VRB A;  5L3F B;  3AEA A;  3CIR A;  1Y64 B;  4ZS3 A;  2VVS A;  5J2U E;  2C5I T;  5DQW A;  3RC8 A;  3MZK B;  5JTG A;  3RKG A;  4EGW A;  5LG3 A;  2BR8 A;  2LSY A;  4O2A E;  3ZMU B;  4AQF C;  2A2F X;  3RH3 A;  3KBU A;  4DID B;  2FBW A;  2JMH A;  4HFE A;  3P4S A;  5AQQ B;  3E08 A;  5AQP B;  4X62 T;  1WCR A;  1J5E T;  1JNZ A;  4LF4 T;  4QH4 A;  4XBF B;  3HKC E;  4PK5 A;  4ZI2 D;  4BQT A;  1B7T A;  2CBI A;  4A5X A;  3HI2 A;  5ABE A;  1YW0 A;  4ILC A;  3FZK B;  4JV5 T;  2PGZ A;  2DWG A;  4UM3 P;  2YU2 A;  4ZJT A;  5J5H A;  1MMA A;  4O2B E;  4WNK A;  2H89 A;  1NEN A;  3JC6 D;  1VCS A;  5LCY A;  3I9Y A;  4UVC B;  2CPT A;  5AQR B;  4FRR A;  3ZLI A;  4AIU A;  3HKB E;  1SHZ C;  2XAF B;  4UVA B;  2YDR A;  3F2E A;  3ZYK A;  4KMC A;  3UU5 A;  3ZT6 A;  3KBT A;  3FZL B;  3NWI A;  5HEU A;  2W66 A;  4HWH A;  5C3J A;  2WQY A;  1KNR A;  1E7P A;  2LT3 A;  5SYO A;  1LVK A;  1XWM A;  2PG8 A;  3U8K A;  2DI4 A;  3AEE A;  3L3P A;  1MNE A;  3Q5D A;  3EAM A;  2P9B A;  3P4W A;  2XZ6 A;  2UXN B;  2V6X A;  4H9R C;  1D1C A;  5FVK A;  4B6X A;  3FZF B;  1UX2 A;  2LRK A;  4X20 E;  2HN2 A;  5CFB A;  3N2O A;  4ZI3 C;  1FJG T;  4TNW A;  1G8X A;  4F8H A;  1N33 T;  1M62 A;  3O1I A;  2WNL A;  2H7O A;  2V7I A;  4M1P A;  5AQJ B;  5AFH A;  3ZYM A;  3ZJ2 A;  4BJM A;  5F8P A;  2DWK A;  3PUX F;  2XQ4 A;  1W0A A;  1QSD A;  4IL4 A;  5LYJ E;  2K3W A;  2UXD T;  5LBM A;  4G63 A;  4PFP A;  2MYS A;  2YU1 A;  4PFO A;  4IE0 A;  3TLT A;  4YHH T;  3OPC A;  1X79 A;  5AQN B;  1OED E;  2X0Y A;  3UUX B;  3MA9 A;  4GYR A;  4MHC A;  2AE9 A;  2Y58 A;  4HKA A;  2IML A;  2C0S A;  4YTM A;  4B5D A;  3NRX A;  2KND A;  2B1E A;  3T8O A;  1HCI A;  4U3C A;  2IUB A;  3R6N A;  2B76 A;  2YOE A;  1T72 A;  3J9X 1;  3GUA A;  1VCT A;  4DV0 T;  3CPZ A;  3U78 A;  3FXD B;  2WZH A;  3LJC A;  2WCA A;  3PUZ F;  2BYR A;  4IT4 A;  4JI4 T;  3UUB A;  1NEK A;  1IAP A;  2UUC T;  2XYS A;  4LFC T;  4ZI2 C;  4MFR A;  2VVN A;  2X68 A;  3P4Q A;  4OK0 A;  5HCJ A;  3UUL A;  4O8S A;  2MAW A;  2CXL A;  4PJM A;  2IDO B;  3ZT7 A;  2W2U A;  2ZM2 A;  1MIY A;  1SUM B;  2YKS A;  2SPC A;  3OYZ A;  2FJD A;  1WR6 A;  2LSG A;  4I0U A;  4HWC A;  4DUY T;  3O1H A;  3PUR A;  3ZSS A;  4DO0 A;  3AED A;  3VKG A;  1HS7 A;  2NW8 A;  1UUS A;  2Y54 A;  5AQH B;  3LK3 B;  2BYN A;  4EB6 E;  4DV4 T;  3OTO T;  2K5B B;  4PJL A;  4UIG A;  3WTH A;  1N32 T;  2WU2 A;  4YSX A;  4ZK4 A;  4ADZ A;  2HHH T;  3WAJ A;  3PUG A;  2NOX A;  4QXB B;  2LOS A;  2IC9 A;  5JR9 A;  2UZ6 A;  2VL0 A;  4MAL A;  3U8M A;  4D01 A;  3PJA A;  3I1A A;  3RI5 A;  2PH9 A;  2HPJ A;  3PDY A;  3RRW A;  3DTO A;  4I55 E;  3N9M A;  2Y7Y A;  3C4W A;  2C5K T;  5J5F A;  2E9X D;  4HE8 A;  1W09 A;  2CWO A;  4AXP A;  2KIN B;  5JRC B;  3EAB A;  4X65 T;  4X66 T;  1WFD A;  2BKN A;  2D5U A;  3V5U A;  3HKE E;  2W67 A;  2V7K A;  4UF0 A;  4NIQ A;  4JI2 T;  1KF6 A;  3WTN A;  4ZS2 A;  4P1N A;  5HXE A;  2UUB T;  3K3N A;  5AQG B;  2XQY A;  3UU3 A;  2V6Y A;  4X1Y E;  1J5W A;  4LF8 T;  3AEC A;  2W4X A;  2X9H A;  4YFS A;  5GON E;  2WB5 A;  4OHF A;  2W00 A;  2WDR A;  2Z6E A;  3IF8 B;  4HWI B;  1G73 A;  1KFY A;  3H3M A;  5LG4 A;  3SFD A;  5HEH A;  3RF1 A;  2D9D A;  4QKN A;  2CHN A;  3DP7 A;  1D1A A;  5ABF B;  3WAK A;  3T1Y T;  4DR6 T;  3U3I A;  5IUX A;  1QLB A;  3OBV E;  2XQ7 A;  4PW8 A; 
#chains in the Genus database with same CATH homology
 4XK9 A;  4EZ1 A;  3RI5 A;  2PH9 A;  4ZR6 A;  4HFD A;  5L4E A;  5BRX A;  3PMZ A;  3UU8 A;  3SQ6 A;  4AFT A;  4DBM A;  4LMJ A;  2BYR A;  4ILB A;  1UX2 A;  4ZRU A;  4HFE A;  2Y7Y A;  2X00 A;  4AFG A;  5KZU A;  5HEJ A;  4UM3 S;  4NPP A;  4Z90 A;  2XQA A;  4IL9 A;  5CFB A;  5LXB A;  2ZJV A;  3UUB A;  3WTJ A;  4A97 A;  4TNW A;  1I9B A;  2XZ5 A;  2XYS A;  4HQP A;  3T4M A;  5AFM B;  4QH4 A;  5J5F A;  3RQW A;  4QH5 A;  4F8H A;  2LKG A;  3TLS A;  5AFL A;  4ALX A;  2BG9 E;  4TWH A;  2WNL A;  4QAA A;  3RIF A;  5HEG A;  3U8L A;  3WTM A;  4BQT A;  3UU6 A;  5BW2 A;  5HCJ A;  3JAE A;  2Y56 A;  3RHW A;  4COF A;  2ZJU A;  5AFH A;  3SQ9 A;  3SIO A;  1OED A;  2MAW A;  4UM1 A;  2XQ6 A;  2XNT A;  4ILC A;  4UXU A;  3TLU A;  2PGZ A;  2WNC A;  4UM3 P;  4ZJT A;  3WTI A;  2BYQ A;  4HFB A;  3TLV A;  4ZJS A;  3TLW A;  4BFQ A;  4ZK1 A;  2QC1 B;  5L47 A;  5J5H A;  5J5G A;  4ILA A;  2BR7 A;  3RIA A;  2BYP A;  1UV6 A;  3LSV A;  5CO5 A;  3U8J A;  2XQ4 A;  2YME A;  4ZZB A;  5FJV A;  4HFC A;  4QH1 A;  4UY2 A;  4QAB A;  3WTN A;  5BP0 A;  2YKS A;  2XYT A;  5AFM A;  4IL4 A;  2W8G A;  3UU4 A;  2M6I A;  2XQ8 A;  4HFH A;  3UU3 A;  5AFN A;  4NZB A;  4FRR A;  4LMK A;  5HEO A;  2BG9 C;  2LM2 A;  3ZDG A;  3TLT A;  3UQ4 A;  3EI0 A;  3P50 A;  3UQ7 A;  3WTL A;  1OED E;  5AFK A;  2WNJ A;  3WTO A;  4ZZC A;  3C79 A;  2KSR A;  1UW6 A;  5JME A;  2Y54 A;  2X00 D;  1OED C;  4HFI A;  2BG9 A;  2BYN A;  3WTK A;  2XQ3 A;  5TVC A;  4X5T A;  3UU5 A;  4TNV A;  5J5I A;  4IRE A;  3C84 A;  5HCM A;  4A98 A;  4XHE A;  2YN6 A;  3RQU A;  2Y58 A;  5HEH A;  2WZY A;  4WV9 A;  4LML A;  4TWD A;  4TWF A;  3ZKR A;  2BYS A;  3WTH A;  5HEU A;  4B5D A;  3WIP A;  2C9T A;  2BR8 A;  2Y57 A;  3ZDH A;  4Z91 A;  4ZK4 A;  4QAC A;  5AFJ A;  2YMD A;  3SH1 A;  4UM3 A;  2LLY A;  3JAF A;  3PEO A;  3JAD A;  2WN9 A;  4AFH A;  5AIN A;  5KE4 A;  2BG9 B;  4D01 A;  2BJ0 A;  5J0Z A;  2YOE A;  5SYO A;  2UZ6 A;  2XQ9 A;  3U8K A;  5IUX A;  2XNV A;  2VL0 A;  3IGQ A;  3EHZ A;  5LG3 A;  4PIR A;  3U8M A;  2LKH A;  1OED B;  2XQ7 A;  3EAM A;  2XNU A;  5L4H A;  2W8F A;  3U8N A;  3GUA A;  2XQ5 A;  3P4W A;  2M6B A;  2XZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...