3UU6A

The glic pentameric ligand-gated ion channel loop2-22' mutant reduced in solution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu6A01
2C9TA 5AFMA 4QH1A 5JMEA 3IGQA 2X00D 2XQ7A 4HFDA 4ZZBA 5LXBA 5HCMA 5HCJA 5L4HA 2QC1B 5TVCA 5AFNA 4X5TA 5BW2A 4QH4A 2VL0A 4Z90A 4ZZCA 5L4EA 3UU5A 3WTLA 5AFHA 4EZ1A 3LSVA 3TLUA 2MAWA 2XQAA 4ILBA 3WTKA 3ZDGA 3WTNA 2XQ6A 5AFMB 2YMEA 4AFHA 3RQWA 2YN6A 4HFIA 5FJVA 4AFGA 3U8NA 2WN9A 2M6IA 2BJ0A 2PGZA 3EHZA 4LMLA 2ZJVA 4XHEA 5CFBA 3WTHA 2BG9C 3U8JA 5AFLA 2WZYA 4BFQA 3U8MA 2ZJUA 3ZDHA 2BYRA 1UV6A 3PMZA 3WIPA 2M6BA 3UUBA 4QACA 1OEDE 1UX2A 3C84A 3RQUA 3WTOA 1OEDA 4NPPA 3UU3A 2XNVA 2XQ5A 3TLVA 5J5IA 3UU8A 3JADA 3UU4A 3RIFA 4UM3S 2Y58A 5J5FA 3P4WA 2XNTA 2XNUA 4BQTA 2KSRA 4IL9A 3RHWA 4XK9A 3SQ9A 2YOEA 3P50A 1OEDB 3U8KA 2WNJA 4ZR6A 5AINA 2XQ8A 2BR8A 4QABA 4DBMA 2XQ9A 3EI0A 3RI5A 2XQ3A 3UQ7A 2W8GA 5BP0A 5J5HA 4TWHA 3RIAA 4TWDA 2X00A 4ILAA 2BYPA 4HQPA 4IREA 4ZRUA 4D01A 3ZKRA 5HEJA 4B5DA 2Y57A 2YKSA 3U8LA 4IL4A 4TNVA 2LLYA 4HFBA 2PH9A 1I9BA 2BYNA 5HEUA 4A97A 2XZ6A 2BR7A 5J0ZA 4ZK4A 4TNWA 5HEHA 2WNLA 3WTJA 2Y54A 4NZBA 3JAEA 2YMDA 2Y7YA 4UM1A 4HFHA 4HFEA 2BG9E 2W8FA 2UZ6A 1UW6A 3PEOA 2BG9A 4ZK1A 3GUAA 2WNCA 3JAFA 3SH1A 3C79A 4PIRA 4A98A 3WTMA 5BRXA 3TLWA 5LG3A 5L47A 4F8HA 4HFCA 5IUXA 3EAMA 2Y56A 4AFTA 2LM2A 5KZUA 4TWFA 4UM3A 1OEDC 3UU6A 4UXUA 3TLTA 4COFA 2XYSA 2LKHA 4QH5A 3SQ6A 4UM3P 3UQ4A 2BG9B 4ILCA 4LMKA 2BYSA 5AFKA 4ZJSA 2XZ5A 4Z91A 4UY2A 3WTIA 4ZJTA 2XYTA 5KE4A 5HEOA 4WV9A 3TLSA 5J5GA 4ALXA 2BYQA 4QAAA 5CO5A 3T4MA 2LKGA 5HEGA 3SIOA 5AFJA 2XQ4A 4LMJA 5SYOA 4FRRA
chains in the Genus database with same CATH superfamily
1LVFA 2IAKA 1DU2A 3FXEB 2WQYA 4K0KT 2VKOA 2VASA 5AFHA 2N9DA 5BR8T 1XDOA 4JI2T 3O4XE 4UELA 4DR6T 4G2AA 5C8YE 2CWOA 4JI8T 1KNPA 2JJ9A 2C0SA 1UV6A 4JI7T 3DTOA 2H7VC 2C5KT 3JADA 1D0YA 3KV4A 2NW9A 3NZPA 1W0AA 5JDQA 5HXEA 2XAGB 2NTYA 2YEVC 3IHRA 2NP9A 1XNQT 4X66T 4CXYA 2FJAA 4I4TE 1D1CA 5FVLA 4E7ZA 2WNLA 4CI1B 3OPCA 1T98A 3ABVA 5M4YA 1IJ5A 4F8HA 2Y56A 2UXXB 2N1GA 2BBHA 2CRBA 2WMOA 5AFKA 5CA1E 3EABA 2XYTA 4WV9A 4CI2B 5DJQC 4DV6T 2KWIB 5AFMA 4QH1A 4YJ2E 2XQ7A 3CWZB 3KVAA 5EK4A 3ANWB 3F57A 4AQYT 1U5PA 5F5WA 4ASKA 1WFDA 4ILBA 1Z8UA 2BKPA 4AI6A 4JV5T 5FXXA 1Y64B 2CA5A 5LGTB 4PJNA 4AKGA 2BS3A 3KBUA 2B76A 3PU3A 5L3FB 1E2AA 5JR9A 2JIWA 3UU8A 4OX9T 2YU2A 3P4WA 2BS2A 1ZHCA 4PNIA 1H7CA 1OEDB 4DR7T 2BR8A 1IBMT 3AE6A 4ILAA 2UXDT 5EK3A 5C2TA 3OVUA 4TNVA 2V7JA 5J0ZA 4ZK4A 1D0ZA 3CX8B 4ZI3D 5IWAT 5LJNA 2CXFA 2CHNA 4F6RC 2XM1A 4UXUA 5L2LA 4H9OC 5HXSA 3F31A 4ZOLE 4PJMA 3SWHA 4AKHA 1HG2A 5AQOB 3AA0B 3VKHA 5ABGA 2IMLA 4EYYR 2LKGA 4O2AE 3RIUA 2BKNA 3IGQA 3SRZA 2KNDA 3R84B 2QC1B 2K24A 4X5TA 3ZC0A 4ZZCA 4DVDA 4NXNT 3WTNA 3JC6D 2WM9A 3P4SA 4AKLA 2LT3A 3K1SA 3L3PA 2IW5B 1HX8A 1FMVA 2BDEA 5CJ5A 2ES0A 2WZHA 2XPKA 1X79A 2VKHA 1MMGA 5JRCB 3FZLB 4YTMA 4ZEYA 3NRXA 5FMNA 4UM3S 2Y58A 4IE6A 5FL0A 2HH7A 4GYRA 4PFOA 4O4LE 1YQ4A 2W66A 2Y48B 2NTXA 3CQXC 5CB4E 3ZN1B 4KBMB 2XQYA 4UF0A 2OA5A 1WCRA 2CBJA 2LSKA 2V26A 3PUQA 2MTQA 2LRKA 3H3AA 3AE8A 2UZ6A 2V6YB 1KFYA 3ZN0B 1FIOA 1HFAA 5JQGE 3R6NA 4UM3A 3TLTA 2C5JA 1X9BA 1IBLT 2BYSA 5AQGB 3ANWA 4Z91A 3TLSA 4LF6T 4WNKA 4EV6A 5CO5A 5AFJA 3K3OA 5LBMA 4EB6E 3HA4A 5JMEA 3L39A 3UT5E 4I50E 3VR9A 5AQRB 1BR2A 5LB7B 1MMNA 4YFSA 2CLYB 1I94T 1WYBA 5HXCA 2MAWA 3RKOA 4CN1A 5AQMB 5FJVA 2X51A 3AAAB 4TV9E 2CBIA 1UK5A 4Q25A 3ZMVB 5ABHA 2ZJVA 3K8PC 4JI5T 5E0OA 4YSXA 5LMUT 3A7MA 3ZMUB 3OKQA 4LFAT 1OEDA 4LF4T 2VB6A 4GKKT 3RIFA 4P0AA 3PUYF 2D0TA 2A72A 3ZC1A 4DMVA 3MXZA 4H9QC 4AQFA 3AEGA 3UTKA 4YT0A 3BQKA 3H37A 2W8GA 2XQ3A 4MLKA 5LJMA 4B3TT 4B5DA 4HFBA 4KMCA 1XMQT 2E9XB 1AJ3A 4GOUA 4QKNA 4LF8T 4IDNA 2IUBA 3I0QA 5HXRA 1MIWA 3AVRA 4HFCA 1U4QA 1N32T 3PUZF 4QX8B 2CXLA 3HKBE 4HEAA 4KUMB 4QXHB 3A5XA 3O1HA 4FI5A 5JR9C 4N78D 2UUBT 4UY2A 2JPFA 3RYIE 4C90A 2LSGA 2W0GA 3EVYA 5JDFA 4MHCA 3H3MA 4WBNE 3NBXX 4QH4A 4HE8A 4B3ST 5JDHA 2PG8A 5FXVA 2CM0A 3N9NA 2X67A 5JRCA 5JDMA 3NWIA 2W63A 4YTPA 2V5CA 5JTGA 3ZT6A 4AIUA 3WIPA 4QACA 3RQUA 4JYAT 4JI6T 2VKDA 2FUPA 2XASB 3Q5XA 3VKGA 3MA9A 1US7B 4DBQA 3RHWA 2N2NA 2W62A 3P50A 1HTJF 3RIUC 3U8KA 2WB5A 2XAHB 4QABA 2W2UA 4JEHB 5J5HA 3BK9A 4H9NC 2BYPA 2V6YA 2RP4A 1FMWA 2WCAA 2LEHA 2Y54A 1LRZA 3PEOA 2Y6XA 3QOFA 4IE4A 2LSIA 1W0BA 4JI1T 3WTMA 3RPUA 1IZNB 3CKDA 3VR8A 4PK5A 1OWAA 3N2GE 5JVDE 4X20E 2H3RA 1JNZA 1YKHB 4HKAA 2XAFB 5HWXA 2X00D 4NUVA 2QRXA 2DWGA 3LG7A 5EZYE 3PUWF 1Z0PA 2I0MA 3AECA 3ZJ1A 2XQ6A 3UUNA 3AE7A 2M6IA 4ISSA 3F2EA 3ZEFB 5IHYA 2BBJA 4HWDA 2WZYA 4X1IE 3KBTA 4YSYA 3PMZA 1UX2A 2XNVA 2JQ9A 4CN6A 3BQLA 4ZXLA 5J5IA 4IDOA 3AA1B 1UCUA 3P8CD 2SPCA 2Z6EA 2IC9A 4ZR6A 2E9XA 2MBGA 3CPZA 3KINB 2DNXA 3ZKRA 2X9XA 3N5LA 2UU9T 5F8PA 4PFPA 5H6QB 3LK3B 2BYNA 4A97A 3WTJA 3AEEA 2ODVA 1MMDA 3Q9DA 3AE9A 4ZI3C 4ZS3A 3SH1A 1YD8G 2Q9QB 5BRXA 3TLWA 5L47A 2K3WA 1NEKA 1O3XA 1OEDC 4ZHQE 3AEDA 3V5SA 2EHOB 3UQ4A 4TUYE 2ZMAA 2JQKA 2UXCT 5HEGA 4AQFC 4DUZT 3TKLB 2DHRA 2NOXA 3PUAA 3L8RA 3PUXF 1V9DA 4X65T 2AE9A 2Q9QD 4KX6A 5CA0E 2LRLA 1BR0A 4IHJE 4AXPA 2YMEA 2L3LA 5AQUB 4AFGA 2EHOD 3M65A 3AE5A 3JC6C 4XHEA 2L8KA 3CVRA 1KEYA 3PUSA 4G63A 3QB5K 3WAJA 3AAEB 5JREA 1OEDE 3EDVA 3MK7C 3OTOT 5FYMA 4I0UA 2FJBA 2QGSA 4YHJA 4JBWF 5LOVE 3CX6B 5AQNB 2NWBA 1D1BA 4O4HE 5AINA 3GN5B 1LKXA 2ACXA 4J2CA 3UQ7A 1ZEEA 4DV5T 3T1HT 2X00A 4HQPA 2J4GA 3AVSA 4MBQA 3C50A 1SE7A 3UUMA 4XZCA 1UW6A 4JI3T 3AXJB 2WDQA 5LMNT 3HI2A 4O4JE 4IE5A 3ETUA 4PW8A 3SOLA 1JNRA 4COFA 4KP3C 4QH5A 4PJJA 2D0UA 2YU1A 2D2SA 2X0HA 4LMKA 5JH7E 1M7KA 2X68A 4WW0A 1HNXT 4K0UA 5FNVE 3SIOA 1HNWT 4C91A 4ZI7E 2KINB 4AKRB 5TAOA 4DV2T 5TVCA 4U3CA 3PTRB 4I55E 1Y01A 2BVMA 4CXXA 4P1NA 4AFHA 4HFIA 1L0VA 4EOZB 1MNEA 2PGZA 2KMFA 2WAUA 4TZ4C 5JDGA 3RF1A 3C4XA 1T8BA 5LA6E 2KLQA 1SA0E 4OFZA 5J5FA 2CLYC 4EZ4A 4LF9T 4U7YA 3SQ9A 2CEAA 4LF5T 3UULA 5ABEA 3EI0A 3RI5A 3VHLA 4PAGA 5L3DB 4BAYB 2Q9QA 4DUYT 4TNWA 5JDNA 4DR4T 2CXDA 3I0OA 1E1HB 3RRCA 2LM9A 4ERRA 5LG4A 2EHOA 2W4XA 4HN9A 1MMAA 1WR6A 5LG3A 4AISA 3AEFA 2VQET 4U33A 2LM2A 4L0RA 4AFTA 3UU6A 3ZCJA 1UURA 3IA3A 3M3ZB 3CQGB 4JI4T 3MACA 4ZJTA 3JCFA 5AQKB 4ZI2D 5AQTB 2BZBA 2E9XC 4B3RT 2NW7A 4ZZBA 1WYCA 1G8XA 4BJMA 2V8SV 5AFNA 5BW2A 3N2KE 5AQJB 2LOSA 5HWYA 1XZYA 4NXMT 2BKOA 3EHZA 3RYHE 3OBVE 4GYSA 5LP6E 3U8MA 3P4RA 3KVBA 2YK0A 2UUAT 3MJXA 4QWNB 2XSBA 2ODUA 3GN5A 4U2YA 3I1AA 1E7PA 2CPTA 4U74A 3KFWX 2H89A 2V7KA 2FBWA 1EZ3A 2XZEA 3ZMZB 2XM2A 1G73A 2WBLA 2K9AA 5AQPB 5LBQB 1D1AA 2VL8A 4U31A 3I9YA 3PV0F 2WP9A 2PBIA 3AXJA 4DR1T 5HEUA 3NVOA 4DR5T 2J62A 4HFHA 3LK2B 3E22E 2ZM0A 2QVAA 2WS3A 3CK6A 5FXWA 4KHPT 2QA7A 3HKCE 2XAJB 3ZPOA 4DO0A 3P4PA 3QB5A 3PUVF 4QXCB 2I6HA 4ZJSA 5H6RB 1J1JA 4KHZF 2JMHA 2MOZA 3T4MA 2OLTA 2FJDA 3HKEE 2XUEA 1N34T 3L09A 3MZKB 2XTLA 5LXBA 5HCJA 5L4HA 4DMWA 2J1DG 4Z90A 2VQFT 3MKDA 3RC3A 4IE7A 2DLRA 2BJ0A 4CXWA 2E9XD 2WWVA 5CFBA 2D9DA 4DR2T 4EGWA 4UEMA 2ZJUA 5AQIB 1T72A 3C84A 5C3JA 1VCSA 3QUJA 5LGNB 2XQ5A 2E5VA 3AA7B 4YLHA 3KV9A 5J1GA 2WNJA 2CE7A 2DI4A 1J5ET 4UV9B 3NRYA 5AFUL 2RPAA 5AQFB 2Y57A 2LHRA 3VU7H 1HNZT 1UGOA 2UXNB 3RKGA 3N9QA 3RC8A 1BR4A 4LFBT 1MNDA 2HN1A 2P9BA 5CGMA 3EUHA 1HR0T 2VVSA 3LJCA 3GUAA 3RYCE 2IIUA 4DV0T 1ZOYA 4B3MT 2PFVA 4NUUA 2HN2A 4CZZB 3FHNA 1KNRA 2YDSA 3D0TA 2BG9B 4QHOA 4U2ZA 4UVBB 2IHR1 3KDSE 2XQ4A 2WDRA 2CMRA 4V1Av 5ETWA 2C9TA 2XJ7A 3ZT5A 3LFMA 4HFDA 5HCMA 5JDLA 3QC9A 2Q9QC 3TLUA 1YW0A 2XQAA 4E7SA 2X0YA 3AE1A 4NIQA 3RRWA 3U8NA 3QK6A 5LNKA 1FEWA 2M67A 2EHOC 2H7OA 5AFLA 3I9WA 2M6BA 3UUBA 3RGLA 5FVKA 5LHGB 2LSJA 5LGUB 3E0ZA 4X1YE 1UX4A 2H88A 5LHHB 4AQGA 4X1KE 1UUSA 4H9PC 3ZLIA 4X64T 5AQVB 2V1DB 1WR0A 4EYUA 4ZS2A 4TWDA 5HEJA 1SHZC 3HR0A 2X9YA 3O1IA 3LBXB 4YSZA 5FY7A 2WU5A 5HEHA 4IGUA 4PK6A 3ZT7A 4P09A 3V5UA 4HFEA 5L3EB 3O1JA 4DV4T 3C4WA 3N9OA 5ABFB 3FB2A 3FZKB 1HCIA 2WZIA 2WMNA 5FKYA 1XDPA 2B1EA 3AE2A 4UIGA 4OYKA 2LSYA 2I59A 3LDQB 4DIDB 4L9IA 2C5IT 5DQVA 3WTLA 2QYWA 3UU5A 3EDUA 1HF8A 4OK0A 1QLBA 3ZDGA 2YINA 2XHEB 1MIVA 3FZHB 4GKJT 2ACZA 5L3GB 5FY1A 2ZM6T 1T7SA 4IDQA 2RA1A 3DJBA 3IBPA 3TLVA 2HHHT 3PURA 5FL1A 5AQLB 1XNRT 4O2BE 2VURA 2YOEA 1M62A 4UF0B 2G0UA 4IIJE 3ZJ2A 2CCQA 3X1DA 4DNDA 3RYFE 3ZYLA 3ZMSB 3NZQA 2Y8DA 4GK0E 5LYJE 2XZ6A 1QUUA 2V7MA 3ONLC 3SS1A 3WAKA 4H9SE 2A3DA 2D5UA 1BR1A 1J5WA 3GWHA 2BG9A 3FBZA 2KZ7B 5FP3A 4EZHA 2VKJA 4UV8B 3FBLA 2XAQB 3FZFB 4IDZA 3Q5WA 5KZUA 4TX5A 2R6GF 4TWFA 2XYSA 1ZP0A 4UVCB 4U7IA 4BJNA 3J7Yq 2V7IA 2K5BB 1WLXA 3ZSSA 3U3IA 4QAAA 2KWHA 3VRBA 5SYOA 4ZI2C 5A1LA 3U78A 3AEBA 1NAFA 5DABA 2VL0A 4JEUB 2CHOA 4EZ1A 3LSVA 2E2AA 2V5DA 3PE0A 1VCTA 1ZV4X 2DWKA 2ZM8A 5ADXL 2WN9A 2JMKA 1S94A 3IEEA 3E08A 2YDRA 3U8JA 5F3JA 3ZDHA 4IDPA 2A9UA 2ZLYA 3ETVA 4U72A 5L3BB 2VWAA 4GK5E 1GQEA 4NPPA 4A5XA 3ESLA 4H63H 4AKIA 2XNUA 4XK9A 3UUXB 4HTEA 1YQ3A 3LBXA 3Q2MA 4YY3T 2XQ8A 3N9MA 5AQHB 4WYVA 2NW8A 5BP0A 4JI0T 2HPLA 1YKEB 4O8SA 3T8OA 3U8LA 2YDQA 2E5LT 2CWYA 1HX1B 3PU8A 4BA9A 4NZBA 5AQQB 2PJQA 4UM1A 4HGAA 5ABFA 3CIRA 3PJAA 4WZXA 4ZK1A 2DCFA 3JAFA 2DL1A 3C79A 4XBFB 1ZKEA 2E8IA 1HG5A 4EXTA 2BVLA 1N36T 5KXJA 5LHIB 4DV3T 3SQ6A 4ILCA 4EEDA 2V7LA 5FY0A 4I43B 4LMJA 4FRRA 5LXTE 4HFVA 4LFCT 5BMVE 3A8YC 3T1YT 2V6XA 2MYSA 3DP7A 2K48A 1IJ6A 5J2UE 5HAXA 2A2FX 3WTKA 2JQQA 3O9XA 3K3NA 4H9RC 3KV6A 2X9WA 4H63V 1XWMA 1IAPA 4KI0F 1UX5A 3N2OA 4BFQA 3KV5A 3N9LA 4B6XA 3AE3A 2BYRA 4TN7B 4GIWA 3RH3A 1KNZA 3WTOA 4CI3B 2OV9A 4ILUA 3FZMB 1W09A 4DBRA 3B13A 2WWUA 2PTFA 1KK7A 4MFRA 2XY8B 5KDMC 2XQ9A 2X66A 4ZRUA 2AXDS 2YKSA 4IL4A 1I9BA 3OJAA 2YMDA 5L3CB 4ISTA 2WNCA 2W61A 3AB3B 4A98A 3BQIA 4QX7B 4OYJA 2LHNA 5EK2A 1B7TA 4YTNA 3GMIA 3C4ZA 4UVAB 1I6ZA 3WTIA 3OYXA 1W9RA 5DQWA 4LF7T 3HL6A 4TV8E 2LJLA 2WU2A 5LCYA 4Z8XA 4IE0A 3ZSTA 4JLEA 5L4EA 4OHFA 2F4VT 4XAXB 2WY2A 2X9HA 4HWHA 3PJAJ 4PJLA 4UXNB 4LMLA 3WTHA 2BG9C 1HS7A 1OXZA 2XSAA 4CN4A 2UXBT 4CQIA 2J47A 2VVNA 4YXDA 3S4UA 2LOPA 3C98B 3UU4A 4FJOA 4MALA 3Q5EA 3ONXA 3OYZA 4P0BA 3RX6A 1QSDA 1S35A 4DBMA 4TWHA 3RIAA 2NR4A 4IREA 5GONE 2VK9A 4EEBA 2KXPB 3PUGA 1LVKA 2LLYA 3SFDA 2BR7A 3UFGA 2ZM2A 3HKDE 2BG9E 2W8FA 5FXZA 3J9X1 1YXRA 3ZYKA 4X62T 3LK42 1SUMB 2IC6A 3ZYMA 1NWMX 3AA6B 1VRBA 3QNUA 2LKHA 3ZMTB 3GA8A 4UM3P 2WDVA 3B5MA 3N9PA 5HXHA 3G06A 2GK9A 2KT9A 3CMLA 5J5GA 1VOMA 2L9QA 2WSSV 5J2TE 2JRKA 4UR9A 2BS4A 2HPJA 3Q5DA 4EAHA 3AE4A 5IYZE 4O4IE 5HYAA 2W00A 5AFMB 3WI3A 3RQWA 2W67A 2YN6A 1D0XA 2LE8A 3C51A 3CQCB 3SFEA 4EIWA 3ZCIA 4PK4A 1KF6A 3K3QC 3C64A 5KMGP 4A56A 4HWCA 4JUYA 3B57A 1MIYA 1CHUA 3FXDB 2IDOB 3UU3A 4WBOA 5AQSB 1NENA 1XMOT 2XNTA 4M1PA 2UUCT 4BQTA 2KSRA 4IL9A 4QXBB 3AAIA 3P7IA 1FJGT 5JR9B 4ADZA 1WRDA 1N33T 4D01A 1IBKT 4YHHT 3AEAA 2FJEA 3P4QA 2PH9A 3NKZA 4HWFA 5KX5E 4IT4A 3JAEA 2Y7YA 2MPKA 3W15B 4DV1T 3PDYA 4L5GA 3VRAA 3UFEA 4DR3T 3ONJA 2X0LB 4PIRA 3IF8B 5IUXA 3EAMA 4DV7T 3CX7B 4YJ3E 1CUNA 4HWIB 2XZ5A 1R8IA 5KE4A 5HEOA 2JQHA 4ANJA 4ALXA 2BYQA 3RLFF
chains in the Genus database with same CATH topology
2C9TA 5AFMA 4QH1A 5JMEA 3IGQA 2X00D 2XQ7A 4HFDA 4ZZBA 5LXBA 5HCMA 5HCJA 5L4HA 2QC1B 5TVCA 5AFNA 4X5TA 5BW2A 4QH4A 2VL0A 4Z90A 4ZZCA 5L4EA 3UU5A 3WTLA 5AFHA 4EZ1A 3LSVA 3TLUA 2MAWA 2XQAA 4ILBA 3WTKA 3ZDGA 3WTNA 2XQ6A 5AFMB 2YMEA 4AFHA 3RQWA 2YN6A 4HFIA 5FJVA 4AFGA 3U8NA 2WN9A 2M6IA 2BJ0A 2PGZA 3EHZA 4LMLA 2ZJVA 4XHEA 5CFBA 3WTHA 2BG9C 3U8JA 5AFLA 2WZYA 4BFQA 3U8MA 2ZJUA 3ZDHA 2BYRA 1UV6A 3PMZA 3WIPA 2M6BA 3UUBA 4QACA 1OEDE 1UX2A 3C84A 3RQUA 3WTOA 1OEDA 4NPPA 3UU3A 2XNVA 2XQ5A 3TLVA 5J5IA 3UU8A 3JADA 3UU4A 3RIFA 4UM3S 2Y58A 5J5FA 3P4WA 2XNTA 2XNUA 4BQTA 2KSRA 4IL9A 3RHWA 4XK9A 3SQ9A 2YOEA 3P50A 1OEDB 3U8KA 2WNJA 4ZR6A 5AINA 2XQ8A 2BR8A 4QABA 4DBMA 2XQ9A 3EI0A 3RI5A 2XQ3A 3UQ7A 2W8GA 5BP0A 5J5HA 4TWHA 3RIAA 4TWDA 2X00A 4ILAA 2BYPA 4HQPA 4IREA 4ZRUA 4D01A 3ZKRA 5HEJA 4B5DA 2Y57A 2YKSA 3U8LA 4IL4A 4TNVA 2LLYA 4HFBA 2PH9A 1I9BA 2BYNA 5HEUA 4A97A 2XZ6A 2BR7A 5J0ZA 4ZK4A 4TNWA 5HEHA 2WNLA 3WTJA 2Y54A 4NZBA 3JAEA 2YMDA 2Y7YA 4UM1A 4HFHA 4HFEA 2BG9E 2W8FA 2UZ6A 1UW6A 3PEOA 2BG9A 4ZK1A 3GUAA 2WNCA 3JAFA 3SH1A 3C79A 4PIRA 4A98A 3WTMA 5BRXA 3TLWA 5LG3A 5L47A 4F8HA 4HFCA 5IUXA 3EAMA 2Y56A 4AFTA 2LM2A 5KZUA 4TWFA 4UM3A 1OEDC 3UU6A 4UXUA 3TLTA 4COFA 2XYSA 2LKHA 4QH5A 3SQ6A 4UM3P 3UQ4A 2BG9B 4ILCA 4LMKA 2BYSA 5AFKA 4ZJSA 2XZ5A 4Z91A 4UY2A 3WTIA 4ZJTA 2XYTA 5KE4A 5HEOA 4WV9A 3TLSA 5J5GA 4ALXA 2BYQA 4QAAA 5CO5A 3T4MA 2LKGA 5HEGA 3SIOA 5AFJA 2XQ4A 4LMJA 5SYOA 4FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C9T A;  5AFM A;  4QH1 A;  5JME A;  3IGQ A;  2X00 D;  2XQ7 A;  4HFD A;  4ZZB A;  5LXB A;  5HCM A;  5HCJ A;  5L4H A;  2QC1 B;  5TVC A;  5AFN A;  4X5T A;  5BW2 A;  4QH4 A;  2VL0 A;  4Z90 A;  4ZZC A;  5L4E A;  3UU5 A;  3WTL A;  5AFH A;  4EZ1 A;  3LSV A;  3TLU A;  2MAW A;  2XQA A;  4ILB A;  3WTK A;  3ZDG A;  3WTN A;  2XQ6 A;  5AFM B;  2YME A;  4AFH A;  3RQW A;  2YN6 A;  4HFI A;  5FJV A;  4AFG A;  3U8N A;  2WN9 A;  2M6I A;  2BJ0 A;  2PGZ A;  3EHZ A;  4LML A;  2ZJV A;  4XHE A;  5CFB A;  3WTH A;  2BG9 C;  3U8J A;  5AFL A;  2WZY A;  4BFQ A;  3U8M A;  2ZJU A;  3ZDH A;  2BYR A;  1UV6 A;  3PMZ A;  3WIP A;  2M6B A;  3UUB A;  4QAC A;  1OED E;  1UX2 A;  3C84 A;  3RQU A;  3WTO A;  1OED A;  4NPP A;  3UU3 A;  2XNV A;  2XQ5 A;  3TLV A;  5J5I A;  3UU8 A;  3JAD A;  3UU4 A;  3RIF A;  4UM3 S;  2Y58 A;  5J5F A;  3P4W A;  2XNT A;  2XNU A;  4BQT A;  2KSR A;  4IL9 A;  3RHW A;  4XK9 A;  3SQ9 A;  2YOE A;  3P50 A;  1OED B;  3U8K A;  2WNJ A;  4ZR6 A;  5AIN A;  2XQ8 A;  2BR8 A;  4QAB A;  4DBM A;  2XQ9 A;  3EI0 A;  3RI5 A;  2XQ3 A;  3UQ7 A;  2W8G A;  5BP0 A;  5J5H A;  4TWH A;  3RIA A;  4TWD A;  2X00 A;  4ILA A;  2BYP A;  4HQP A;  4IRE A;  4ZRU A;  4D01 A;  3ZKR A;  5HEJ A;  4B5D A;  2Y57 A;  2YKS A;  3U8L A;  4IL4 A;  4TNV A;  2LLY A;  4HFB A;  2PH9 A;  1I9B A;  2BYN A;  5HEU A;  4A97 A;  2XZ6 A;  2BR7 A;  5J0Z A;  4ZK4 A;  4TNW A;  5HEH A;  2WNL A;  3WTJ A;  2Y54 A;  4NZB A;  3JAE A;  2YMD A;  2Y7Y A;  4UM1 A;  4HFH A;  4HFE A;  2BG9 E;  2W8F A;  2UZ6 A;  1UW6 A;  3PEO A;  2BG9 A;  4ZK1 A;  3GUA A;  2WNC A;  3JAF A;  3SH1 A;  3C79 A;  4PIR A;  4A98 A;  3WTM A;  5BRX A;  3TLW A;  5LG3 A;  5L47 A;  4F8H A;  4HFC A;  5IUX A;  3EAM A;  2Y56 A;  4AFT A;  2LM2 A;  5KZU A;  4TWF A;  4UM3 A;  1OED C;  3UU6 A;  4UXU A;  3TLT A;  4COF A;  2XYS A;  2LKH A;  4QH5 A;  3SQ6 A;  4UM3 P;  3UQ4 A;  2BG9 B;  4ILC A;  4LMK A;  2BYS A;  5AFK A;  4ZJS A;  2XZ5 A;  4Z91 A;  4UY2 A;  3WTI A;  4ZJT A;  2XYT A;  5KE4 A;  5HEO A;  4WV9 A;  3TLS A;  5J5G A;  4ALX A;  2BYQ A;  4QAA A;  5CO5 A;  3T4M A;  2LKG A;  5HEG A;  3SIO A;  5AFJ A;  2XQ4 A;  4LMJ A;  5SYO A;  4FRR A; 
#chains in the Genus database with same CATH topology
 1LVF A;  2IAK A;  1DU2 A;  3FXE B;  2WQY A;  4K0K T;  2VKO A;  2VAS A;  5AFH A;  2N9D A;  5BR8 T;  1XDO A;  4JI2 T;  3O4X E;  4UEL A;  4DR6 T;  4G2A A;  5C8Y E;  2CWO A;  4JI8 T;  1KNP A;  2JJ9 A;  2C0S A;  1UV6 A;  4JI7 T;  3DTO A;  2H7V C;  2C5K T;  3JAD A;  1D0Y A;  3KV4 A;  2NW9 A;  3NZP A;  1W0A A;  5JDQ A;  5HXE A;  2XAG B;  2NTY A;  2YEV C;  3IHR A;  2NP9 A;  1XNQ T;  4X66 T;  4CXY A;  2FJA A;  4I4T E;  1D1C A;  5FVL A;  4E7Z A;  2WNL A;  4CI1 B;  3OPC A;  1T98 A;  3ABV A;  5M4Y A;  1IJ5 A;  4F8H A;  2Y56 A;  2UXX B;  2N1G A;  2BBH A;  2CRB A;  2WMO A;  5AFK A;  5CA1 E;  3EAB A;  2XYT A;  4WV9 A;  4CI2 B;  5DJQ C;  4DV6 T;  2KWI B;  5AFM A;  4QH1 A;  4YJ2 E;  2XQ7 A;  3CWZ B;  3KVA A;  5EK4 A;  3ANW B;  3F57 A;  4AQY T;  1U5P A;  5F5W A;  4ASK A;  1WFD A;  4ILB A;  1Z8U A;  2BKP A;  4AI6 A;  4JV5 T;  5FXX A;  1Y64 B;  2CA5 A;  5LGT B;  4PJN A;  4AKG A;  2BS3 A;  3KBU A;  2B76 A;  3PU3 A;  5L3F B;  1E2A A;  5JR9 A;  2JIW A;  3UU8 A;  4OX9 T;  2YU2 A;  3P4W A;  2BS2 A;  1ZHC A;  4PNI A;  1H7C A;  1OED B;  4DR7 T;  2BR8 A;  1IBM T;  3AE6 A;  4ILA A;  2UXD T;  5EK3 A;  5C2T A;  3OVU A;  4TNV A;  2V7J A;  5J0Z A;  4ZK4 A;  1D0Z A;  3CX8 B;  4ZI3 D;  5IWA T;  5LJN A;  2CXF A;  2CHN A;  4F6R C;  2XM1 A;  4UXU A;  5L2L A;  4H9O C;  5HXS A;  3F31 A;  4ZOL E;  4PJM A;  3SWH A;  4AKH A;  1HG2 A;  5AQO B;  3AA0 B;  3VKH A;  5ABG A;  2IML A;  4EYY R;  2LKG A;  4O2A E;  3RIU A;  2BKN A;  3IGQ A;  3SRZ A;  2KND A;  3R84 B;  2QC1 B;  2K24 A;  4X5T A;  3ZC0 A;  4ZZC A;  4DVD A;  4NXN T;  3WTN A;  3JC6 D;  2WM9 A;  3P4S A;  4AKL A;  2LT3 A;  3K1S A;  3L3P A;  2IW5 B;  1HX8 A;  1FMV A;  2BDE A;  5CJ5 A;  2ES0 A;  2WZH A;  2XPK A;  1X79 A;  2VKH A;  1MMG A;  5JRC B;  3FZL B;  4YTM A;  4ZEY A;  3NRX A;  5FMN A;  4UM3 S;  2Y58 A;  4IE6 A;  5FL0 A;  2HH7 A;  4GYR A;  4PFO A;  4O4L E;  1YQ4 A;  2W66 A;  2Y48 B;  2NTX A;  3CQX C;  5CB4 E;  3ZN1 B;  4KBM B;  2XQY A;  4UF0 A;  2OA5 A;  1WCR A;  2CBJ A;  2LSK A;  2V26 A;  3PUQ A;  2MTQ A;  2LRK A;  3H3A A;  3AE8 A;  2UZ6 A;  2V6Y B;  1KFY A;  3ZN0 B;  1FIO A;  1HFA A;  5JQG E;  3R6N A;  4UM3 A;  3TLT A;  2C5J A;  1X9B A;  1IBL T;  2BYS A;  5AQG B;  3ANW A;  4Z91 A;  3TLS A;  4LF6 T;  4WNK A;  4EV6 A;  5CO5 A;  5AFJ A;  3K3O A;  5LBM A;  4EB6 E;  3HA4 A;  5JME A;  3L39 A;  3UT5 E;  4I50 E;  3VR9 A;  5AQR B;  1BR2 A;  5LB7 B;  1MMN A;  4YFS A;  2CLY B;  1I94 T;  1WYB A;  5HXC A;  2MAW A;  3RKO A;  4CN1 A;  5AQM B;  5FJV A;  2X51 A;  3AAA B;  4TV9 E;  2CBI A;  1UK5 A;  4Q25 A;  3ZMV B;  5ABH A;  2ZJV A;  3K8P C;  4JI5 T;  5E0O A;  4YSX A;  5LMU T;  3A7M A;  3ZMU B;  3OKQ A;  4LFA T;  1OED A;  4LF4 T;  2VB6 A;  4GKK T;  3RIF A;  4P0A A;  3PUY F;  2D0T A;  2A72 A;  3ZC1 A;  4DMV A;  3MXZ A;  4H9Q C;  4AQF A;  3AEG A;  3UTK A;  4YT0 A;  3BQK A;  3H37 A;  2W8G A;  2XQ3 A;  4MLK A;  5LJM A;  4B3T T;  4B5D A;  4HFB A;  4KMC A;  1XMQ T;  2E9X B;  1AJ3 A;  4GOU A;  4QKN A;  4LF8 T;  4IDN A;  2IUB A;  3I0Q A;  5HXR A;  1MIW A;  3AVR A;  4HFC A;  1U4Q A;  1N32 T;  3PUZ F;  4QX8 B;  2CXL A;  3HKB E;  4HEA A;  4KUM B;  4QXH B;  3A5X A;  3O1H A;  4FI5 A;  5JR9 C;  4N78 D;  2UUB T;  4UY2 A;  2JPF A;  3RYI E;  4C90 A;  2LSG A;  2W0G A;  3EVY A;  5JDF A;  4MHC A;  3H3M A;  4WBN E;  3NBX X;  4QH4 A;  4HE8 A;  4B3S T;  5JDH A;  2PG8 A;  5FXV A;  2CM0 A;  3N9N A;  2X67 A;  5JRC A;  5JDM A;  3NWI A;  2W63 A;  4YTP A;  2V5C A;  5JTG A;  3ZT6 A;  4AIU A;  3WIP A;  4QAC A;  3RQU A;  4JYA T;  4JI6 T;  2VKD A;  2FUP A;  2XAS B;  3Q5X A;  3VKG A;  3MA9 A;  1US7 B;  4DBQ A;  3RHW A;  2N2N A;  2W62 A;  3P50 A;  1HTJ F;  3RIU C;  3U8K A;  2WB5 A;  2XAH B;  4QAB A;  2W2U A;  4JEH B;  5J5H A;  3BK9 A;  4H9N C;  2BYP A;  2V6Y A;  2RP4 A;  1FMW A;  2WCA A;  2LEH A;  2Y54 A;  1LRZ A;  3PEO A;  2Y6X A;  3QOF A;  4IE4 A;  2LSI A;  1W0B A;  4JI1 T;  3WTM A;  3RPU A;  1IZN B;  3CKD A;  3VR8 A;  4PK5 A;  1OWA A;  3N2G E;  5JVD E;  4X20 E;  2H3R A;  1JNZ A;  1YKH B;  4HKA A;  2XAF B;  5HWX A;  2X00 D;  4NUV A;  2QRX A;  2DWG A;  3LG7 A;  5EZY E;  3PUW F;  1Z0P A;  2I0M A;  3AEC A;  3ZJ1 A;  2XQ6 A;  3UUN A;  3AE7 A;  2M6I A;  4ISS A;  3F2E A;  3ZEF B;  5IHY A;  2BBJ A;  4HWD A;  2WZY A;  4X1I E;  3KBT A;  4YSY A;  3PMZ A;  1UX2 A;  2XNV A;  2JQ9 A;  4CN6 A;  3BQL A;  4ZXL A;  5J5I A;  4IDO A;  3AA1 B;  1UCU A;  3P8C D;  2SPC A;  2Z6E A;  2IC9 A;  4ZR6 A;  2E9X A;  2MBG A;  3CPZ A;  3KIN B;  2DNX A;  3ZKR A;  2X9X A;  3N5L A;  2UU9 T;  5F8P A;  4PFP A;  5H6Q B;  3LK3 B;  2BYN A;  4A97 A;  3WTJ A;  3AEE A;  2ODV A;  1MMD A;  3Q9D A;  3AE9 A;  4ZI3 C;  4ZS3 A;  3SH1 A;  1YD8 G;  2Q9Q B;  5BRX A;  3TLW A;  5L47 A;  2K3W A;  1NEK A;  1O3X A;  1OED C;  4ZHQ E;  3AED A;  3V5S A;  2EHO B;  3UQ4 A;  4TUY E;  2ZMA A;  2JQK A;  2UXC T;  5HEG A;  4AQF C;  4DUZ T;  3TKL B;  2DHR A;  2NOX A;  3PUA A;  3L8R A;  3PUX F;  1V9D A;  4X65 T;  2AE9 A;  2Q9Q D;  4KX6 A;  5CA0 E;  2LRL A;  1BR0 A;  4IHJ E;  4AXP A;  2YME A;  2L3L A;  5AQU B;  4AFG A;  2EHO D;  3M65 A;  3AE5 A;  3JC6 C;  4XHE A;  2L8K A;  3CVR A;  1KEY A;  3PUS A;  4G63 A;  3QB5 K;  3WAJ A;  3AAE B;  5JRE A;  1OED E;  3EDV A;  3MK7 C;  3OTO T;  5FYM A;  4I0U A;  2FJB A;  2QGS A;  4YHJ A;  4JBW F;  5LOV E;  3CX6 B;  5AQN B;  2NWB A;  1D1B A;  4O4H E;  5AIN A;  3GN5 B;  1LKX A;  2ACX A;  4J2C A;  3UQ7 A;  1ZEE A;  4DV5 T;  3T1H T;  2X00 A;  4HQP A;  2J4G A;  3AVS A;  4MBQ A;  3C50 A;  1SE7 A;  3UUM A;  4XZC A;  1UW6 A;  4JI3 T;  3AXJ B;  2WDQ A;  5LMN T;  3HI2 A;  4O4J E;  4IE5 A;  3ETU A;  4PW8 A;  3SOL A;  1JNR A;  4COF A;  4KP3 C;  4QH5 A;  4PJJ A;  2D0U A;  2YU1 A;  2D2S A;  2X0H A;  4LMK A;  5JH7 E;  1M7K A;  2X68 A;  4WW0 A;  1HNX T;  4K0U A;  5FNV E;  3SIO A;  1HNW T;  4C91 A;  4ZI7 E;  2KIN B;  4AKR B;  5TAO A;  4DV2 T;  5TVC A;  4U3C A;  3PTR B;  4I55 E;  1Y01 A;  2BVM A;  4CXX A;  4P1N A;  4AFH A;  4HFI A;  1L0V A;  4EOZ B;  1MNE A;  2PGZ A;  2KMF A;  2WAU A;  4TZ4 C;  5JDG A;  3RF1 A;  3C4X A;  1T8B A;  5LA6 E;  2KLQ A;  1SA0 E;  4OFZ A;  5J5F A;  2CLY C;  4EZ4 A;  4LF9 T;  4U7Y A;  3SQ9 A;  2CEA A;  4LF5 T;  3UUL A;  5ABE A;  3EI0 A;  3RI5 A;  3VHL A;  4PAG A;  5L3D B;  4BAY B;  2Q9Q A;  4DUY T;  4TNW A;  5JDN A;  4DR4 T;  2CXD A;  3I0O A;  1E1H B;  3RRC A;  2LM9 A;  4ERR A;  5LG4 A;  2EHO A;  2W4X A;  4HN9 A;  1MMA A;  1WR6 A;  5LG3 A;  4AIS A;  3AEF A;  2VQE T;  4U33 A;  2LM2 A;  4L0R A;  4AFT A;  3UU6 A;  3ZCJ A;  1UUR A;  3IA3 A;  3M3Z B;  3CQG B;  4JI4 T;  3MAC A;  4ZJT A;  3JCF A;  5AQK B;  4ZI2 D;  5AQT B;  2BZB A;  2E9X C;  4B3R T;  2NW7 A;  4ZZB A;  1WYC A;  1G8X A;  4BJM A;  2V8S V;  5AFN A;  5BW2 A;  3N2K E;  5AQJ B;  2LOS A;  5HWY A;  1XZY A;  4NXM T;  2BKO A;  3EHZ A;  3RYH E;  3OBV E;  4GYS A;  5LP6 E;  3U8M A;  3P4R A;  3KVB A;  2YK0 A;  2UUA T;  3MJX A;  4QWN B;  2XSB A;  2ODU A;  3GN5 A;  4U2Y A;  3I1A A;  1E7P A;  2CPT A;  4U74 A;  3KFW X;  2H89 A;  2V7K A;  2FBW A;  1EZ3 A;  2XZE A;  3ZMZ B;  2XM2 A;  1G73 A;  2WBL A;  2K9A A;  5AQP B;  5LBQ B;  1D1A A;  2VL8 A;  4U31 A;  3I9Y A;  3PV0 F;  2WP9 A;  2PBI A;  3AXJ A;  4DR1 T;  5HEU A;  3NVO A;  4DR5 T;  2J62 A;  4HFH A;  3LK2 B;  3E22 E;  2ZM0 A;  2QVA A;  2WS3 A;  3CK6 A;  5FXW A;  4KHP T;  2QA7 A;  3HKC E;  2XAJ B;  3ZPO A;  4DO0 A;  3P4P A;  3QB5 A;  3PUV F;  4QXC B;  2I6H A;  4ZJS A;  5H6R B;  1J1J A;  4KHZ F;  2JMH A;  2MOZ A;  3T4M A;  2OLT A;  2FJD A;  3HKE E;  2XUE A;  1N34 T;  3L09 A;  3MZK B;  2XTL A;  5LXB A;  5HCJ A;  5L4H A;  4DMW A;  2J1D G;  4Z90 A;  2VQF T;  3MKD A;  3RC3 A;  4IE7 A;  2DLR A;  2BJ0 A;  4CXW A;  2E9X D;  2WWV A;  5CFB A;  2D9D A;  4DR2 T;  4EGW A;  4UEM A;  2ZJU A;  5AQI B;  1T72 A;  3C84 A;  5C3J A;  1VCS A;  3QUJ A;  5LGN B;  2XQ5 A;  2E5V A;  3AA7 B;  4YLH A;  3KV9 A;  5J1G A;  2WNJ A;  2CE7 A;  2DI4 A;  1J5E T;  4UV9 B;  3NRY A;  5AFU L;  2RPA A;  5AQF B;  2Y57 A;  2LHR A;  3VU7 H;  1HNZ T;  1UGO A;  2UXN B;  3RKG A;  3N9Q A;  3RC8 A;  1BR4 A;  4LFB T;  1MND A;  2HN1 A;  2P9B A;  5CGM A;  3EUH A;  1HR0 T;  2VVS A;  3LJC A;  3GUA A;  3RYC E;  2IIU A;  4DV0 T;  1ZOY A;  4B3M T;  2PFV A;  4NUU A;  2HN2 A;  4CZZ B;  3FHN A;  1KNR A;  2YDS A;  3D0T A;  2BG9 B;  4QHO A;  4U2Z A;  4UVB B;  2IHR 1;  3KDS E;  2XQ4 A;  2WDR A;  2CMR A;  4V1A v;  5ETW A;  2C9T A;  2XJ7 A;  3ZT5 A;  3LFM A;  4HFD A;  5HCM A;  5JDL A;  3QC9 A;  2Q9Q C;  3TLU A;  1YW0 A;  2XQA A;  4E7S A;  2X0Y A;  3AE1 A;  4NIQ A;  3RRW A;  3U8N A;  3QK6 A;  5LNK A;  1FEW A;  2M67 A;  2EHO C;  2H7O A;  5AFL A;  3I9W A;  2M6B A;  3UUB A;  3RGL A;  5FVK A;  5LHG B;  2LSJ A;  5LGU B;  3E0Z A;  4X1Y E;  1UX4 A;  2H88 A;  5LHH B;  4AQG A;  4X1K E;  1UUS A;  4H9P C;  3ZLI A;  4X64 T;  5AQV B;  2V1D B;  1WR0 A;  4EYU A;  4ZS2 A;  4TWD A;  5HEJ A;  1SHZ C;  3HR0 A;  2X9Y A;  3O1I A;  3LBX B;  4YSZ A;  5FY7 A;  2WU5 A;  5HEH A;  4IGU A;  4PK6 A;  3ZT7 A;  4P09 A;  3V5U A;  4HFE A;  5L3E B;  3O1J A;  4DV4 T;  3C4W A;  3N9O A;  5ABF B;  3FB2 A;  3FZK B;  1HCI A;  2WZI A;  2WMN A;  5FKY A;  1XDP A;  2B1E A;  3AE2 A;  4UIG A;  4OYK A;  2LSY A;  2I59 A;  3LDQ B;  4DID B;  4L9I A;  2C5I T;  5DQV A;  3WTL A;  2QYW A;  3UU5 A;  3EDU A;  1HF8 A;  4OK0 A;  1QLB A;  3ZDG A;  2YIN A;  2XHE B;  1MIV A;  3FZH B;  4GKJ T;  2ACZ A;  5L3G B;  5FY1 A;  2ZM6 T;  1T7S A;  4IDQ A;  2RA1 A;  3DJB A;  3IBP A;  3TLV A;  2HHH T;  3PUR A;  5FL1 A;  5AQL B;  1XNR T;  4O2B E;  2VUR A;  2YOE A;  1M62 A;  4UF0 B;  2G0U A;  4IIJ E;  3ZJ2 A;  2CCQ A;  3X1D A;  4DND A;  3RYF E;  3ZYL A;  3ZMS B;  3NZQ A;  2Y8D A;  4GK0 E;  5LYJ E;  2XZ6 A;  1QUU A;  2V7M A;  3ONL C;  3SS1 A;  3WAK A;  4H9S E;  2A3D A;  2D5U A;  1BR1 A;  1J5W A;  3GWH A;  2BG9 A;  3FBZ A;  2KZ7 B;  5FP3 A;  4EZH A;  2VKJ A;  4UV8 B;  3FBL A;  2XAQ B;  3FZF B;  4IDZ A;  3Q5W A;  5KZU A;  4TX5 A;  2R6G F;  4TWF A;  2XYS A;  1ZP0 A;  4UVC B;  4U7I A;  4BJN A;  3J7Y q;  2V7I A;  2K5B B;  1WLX A;  3ZSS A;  3U3I A;  4QAA A;  2KWH A;  3VRB A;  5SYO A;  4ZI2 C;  5A1L A;  3U78 A;  3AEB A;  1NAF A;  5DAB A;  2VL0 A;  4JEU B;  2CHO A;  4EZ1 A;  3LSV A;  2E2A A;  2V5D A;  3PE0 A;  1VCT A;  1ZV4 X;  2DWK A;  2ZM8 A;  5ADX L;  2WN9 A;  2JMK A;  1S94 A;  3IEE A;  3E08 A;  2YDR A;  3U8J A;  5F3J A;  3ZDH A;  4IDP A;  2A9U A;  2ZLY A;  3ETV A;  4U72 A;  5L3B B;  2VWA A;  4GK5 E;  1GQE A;  4NPP A;  4A5X A;  3ESL A;  4H63 H;  4AKI A;  2XNU A;  4XK9 A;  3UUX B;  4HTE A;  1YQ3 A;  3LBX A;  3Q2M A;  4YY3 T;  2XQ8 A;  3N9M A;  5AQH B;  4WYV A;  2NW8 A;  5BP0 A;  4JI0 T;  2HPL A;  1YKE B;  4O8S A;  3T8O A;  3U8L A;  2YDQ A;  2E5L T;  2CWY A;  1HX1 B;  3PU8 A;  4BA9 A;  4NZB A;  5AQQ B;  2PJQ A;  4UM1 A;  4HGA A;  5ABF A;  3CIR A;  3PJA A;  4WZX A;  4ZK1 A;  2DCF A;  3JAF A;  2DL1 A;  3C79 A;  4XBF B;  1ZKE A;  2E8I A;  1HG5 A;  4EXT A;  2BVL A;  1N36 T;  5KXJ A;  5LHI B;  4DV3 T;  3SQ6 A;  4ILC A;  4EED A;  2V7L A;  5FY0 A;  4I43 B;  4LMJ A;  4FRR A;  5LXT E;  4HFV A;  4LFC T;  5BMV E;  3A8Y C;  3T1Y T;  2V6X A;  2MYS A;  3DP7 A;  2K48 A;  1IJ6 A;  5J2U E;  5HAX A;  2A2F X;  3WTK A;  2JQQ A;  3O9X A;  3K3N A;  4H9R C;  3KV6 A;  2X9W A;  4H63 V;  1XWM A;  1IAP A;  4KI0 F;  1UX5 A;  3N2O A;  4BFQ A;  3KV5 A;  3N9L A;  4B6X A;  3AE3 A;  2BYR A;  4TN7 B;  4GIW A;  3RH3 A;  1KNZ A;  3WTO A;  4CI3 B;  2OV9 A;  4ILU A;  3FZM B;  1W09 A;  4DBR A;  3B13 A;  2WWU A;  2PTF A;  1KK7 A;  4MFR A;  2XY8 B;  5KDM C;  2XQ9 A;  2X66 A;  4ZRU A;  2AXD S;  2YKS A;  4IL4 A;  1I9B A;  3OJA A;  2YMD A;  5L3C B;  4IST A;  2WNC A;  2W61 A;  3AB3 B;  4A98 A;  3BQI A;  4QX7 B;  4OYJ A;  2LHN A;  5EK2 A;  1B7T A;  4YTN A;  3GMI A;  3C4Z A;  4UVA B;  1I6Z A;  3WTI A;  3OYX A;  1W9R A;  5DQW A;  4LF7 T;  3HL6 A;  4TV8 E;  2LJL A;  2WU2 A;  5LCY A;  4Z8X A;  4IE0 A;  3ZST A;  4JLE A;  5L4E A;  4OHF A;  2F4V T;  4XAX B;  2WY2 A;  2X9H A;  4HWH A;  3PJA J;  4PJL A;  4UXN B;  4LML A;  3WTH A;  2BG9 C;  1HS7 A;  1OXZ A;  2XSA A;  4CN4 A;  2UXB T;  4CQI A;  2J47 A;  2VVN A;  4YXD A;  3S4U A;  2LOP A;  3C98 B;  3UU4 A;  4FJO A;  4MAL A;  3Q5E A;  3ONX A;  3OYZ A;  4P0B A;  3RX6 A;  1QSD A;  1S35 A;  4DBM A;  4TWH A;  3RIA A;  2NR4 A;  4IRE A;  5GON E;  2VK9 A;  4EEB A;  2KXP B;  3PUG A;  1LVK A;  2LLY A;  3SFD A;  2BR7 A;  3UFG A;  2ZM2 A;  3HKD E;  2BG9 E;  2W8F A;  5FXZ A;  3J9X 1;  1YXR A;  3ZYK A;  4X62 T;  3LK4 2;  1SUM B;  2IC6 A;  3ZYM A;  1NWM X;  3AA6 B;  1VRB A;  3QNU A;  2LKH A;  3ZMT B;  3GA8 A;  4UM3 P;  2WDV A;  3B5M A;  3N9P A;  5HXH A;  3G06 A;  2GK9 A;  2KT9 A;  3CML A;  5J5G A;  1VOM A;  2L9Q A;  2WSS V;  5J2T E;  2JRK A;  4UR9 A;  2BS4 A;  2HPJ A;  3Q5D A;  4EAH A;  3AE4 A;  5IYZ E;  4O4I E;  5HYA A;  2W00 A;  5AFM B;  3WI3 A;  3RQW A;  2W67 A;  2YN6 A;  1D0X A;  2LE8 A;  3C51 A;  3CQC B;  3SFE A;  4EIW A;  3ZCI A;  4PK4 A;  1KF6 A;  3K3Q C;  3C64 A;  5KMG P;  4A56 A;  4HWC A;  4JUY A;  3B57 A;  1MIY A;  1CHU A;  3FXD B;  2IDO B;  3UU3 A;  4WBO A;  5AQS B;  1NEN A;  1XMO T;  2XNT A;  4M1P A;  2UUC T;  4BQT A;  2KSR A;  4IL9 A;  4QXB B;  3AAI A;  3P7I A;  1FJG T;  5JR9 B;  4ADZ A;  1WRD A;  1N33 T;  4D01 A;  1IBK T;  4YHH T;  3AEA A;  2FJE A;  3P4Q A;  2PH9 A;  3NKZ A;  4HWF A;  5KX5 E;  4IT4 A;  3JAE A;  2Y7Y A;  2MPK A;  3W15 B;  4DV1 T;  3PDY A;  4L5G A;  3VRA A;  3UFE A;  4DR3 T;  3ONJ A;  2X0L B;  4PIR A;  3IF8 B;  5IUX A;  3EAM A;  4DV7 T;  3CX7 B;  4YJ3 E;  1CUN A;  4HWI B;  2XZ5 A;  1R8I A;  5KE4 A;  5HEO A;  2JQH A;  4ANJ A;  4ALX A;  2BYQ A;  3RLF F; 
#chains in the Genus database with same CATH homology
 2C9T A;  5AFM A;  4QH1 A;  5JME A;  3IGQ A;  2X00 D;  2XQ7 A;  4HFD A;  4ZZB A;  5LXB A;  5HCM A;  5HCJ A;  5L4H A;  2QC1 B;  5TVC A;  5AFN A;  4X5T A;  5BW2 A;  4QH4 A;  2VL0 A;  4Z90 A;  4ZZC A;  5L4E A;  3UU5 A;  3WTL A;  5AFH A;  4EZ1 A;  3LSV A;  3TLU A;  2MAW A;  2XQA A;  4ILB A;  3WTK A;  3ZDG A;  3WTN A;  2XQ6 A;  5AFM B;  2YME A;  4AFH A;  3RQW A;  2YN6 A;  4HFI A;  5FJV A;  4AFG A;  3U8N A;  2WN9 A;  2M6I A;  2BJ0 A;  2PGZ A;  3EHZ A;  4LML A;  2ZJV A;  4XHE A;  5CFB A;  3WTH A;  2BG9 C;  3U8J A;  5AFL A;  2WZY A;  4BFQ A;  3U8M A;  2ZJU A;  3ZDH A;  2BYR A;  1UV6 A;  3PMZ A;  3WIP A;  2M6B A;  3UUB A;  4QAC A;  1OED E;  1UX2 A;  3C84 A;  3RQU A;  3WTO A;  1OED A;  4NPP A;  3UU3 A;  2XNV A;  2XQ5 A;  3TLV A;  5J5I A;  3UU8 A;  3JAD A;  3UU4 A;  3RIF A;  4UM3 S;  2Y58 A;  5J5F A;  3P4W A;  2XNT A;  2XNU A;  4BQT A;  2KSR A;  4IL9 A;  3RHW A;  4XK9 A;  3SQ9 A;  2YOE A;  3P50 A;  1OED B;  3U8K A;  2WNJ A;  4ZR6 A;  5AIN A;  2XQ8 A;  2BR8 A;  4QAB A;  4DBM A;  2XQ9 A;  3EI0 A;  3RI5 A;  2XQ3 A;  3UQ7 A;  2W8G A;  5BP0 A;  5J5H A;  4TWH A;  3RIA A;  4TWD A;  2X00 A;  4ILA A;  2BYP A;  4HQP A;  4IRE A;  4ZRU A;  4D01 A;  3ZKR A;  5HEJ A;  4B5D A;  2Y57 A;  2YKS A;  3U8L A;  4IL4 A;  4TNV A;  2LLY A;  4HFB A;  2PH9 A;  1I9B A;  2BYN A;  5HEU A;  4A97 A;  2XZ6 A;  2BR7 A;  5J0Z A;  4ZK4 A;  4TNW A;  5HEH A;  2WNL A;  3WTJ A;  2Y54 A;  4NZB A;  3JAE A;  2YMD A;  2Y7Y A;  4UM1 A;  4HFH A;  4HFE A;  2BG9 E;  2W8F A;  2UZ6 A;  1UW6 A;  3PEO A;  2BG9 A;  4ZK1 A;  3GUA A;  2WNC A;  3JAF A;  3SH1 A;  3C79 A;  4PIR A;  4A98 A;  3WTM A;  5BRX A;  3TLW A;  5LG3 A;  5L47 A;  4F8H A;  4HFC A;  5IUX A;  3EAM A;  2Y56 A;  4AFT A;  2LM2 A;  5KZU A;  4TWF A;  4UM3 A;  1OED C;  3UU6 A;  4UXU A;  3TLT A;  4COF A;  2XYS A;  2LKH A;  4QH5 A;  3SQ6 A;  4UM3 P;  3UQ4 A;  2BG9 B;  4ILC A;  4LMK A;  2BYS A;  5AFK A;  4ZJS A;  2XZ5 A;  4Z91 A;  4UY2 A;  3WTI A;  4ZJT A;  2XYT A;  5KE4 A;  5HEO A;  4WV9 A;  3TLS A;  5J5G A;  4ALX A;  2BYQ A;  4QAA A;  5CO5 A;  3T4M A;  2LKG A;  5HEG A;  3SIO A;  5AFJ A;  2XQ4 A;  4LMJ A;  5SYO A;  4FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...