3UU6A

The glic pentameric ligand-gated ion channel loop2-22' mutant reduced in solution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu6A01
3EI0A 3TLUA 2PH9A 3P4WA 5AFMB 5BP0A 2XQ3A 2XQ4A 4QH5A 3TLSA 2C9TA 3WTNA 4Z90A 2UZ6A 2ZJVA 3C79A 2WZYA 5L4EA 2XQAA 3UQ4A 2XZ5A 2BG9B 2BYPA 3SIOA 5LXBA 5HEJA 3U8NA 2VL0A 5J5GA 4QH4A 5J5IA 4HQPA 3SQ9A 3C84A 2LLYA 3RQWA 3WTIA 2YKSA 4HFIA 3RQUA 3ZDGA 3JAEA 4HFEA 1OEDE 4ZK1A 3JAFA 4BQTA 4TNVA 2M6BA 4UXUA 4LMJA 4TWDA 3WIPA 4ZJSA 3SQ6A 5AFJA 5AFNA 2XYSA 3UU4A 4ZJTA 2XQ9A 4ALXA 4ILCA 3UU8A 5L4HA 5HCMA 4TNWA 2YMEA 3U8LA 2W8GA 5IUXA 2Y58A 5HEUA 3PEOA 2BYQA 4UM3P 5HCJA 4QABA 3EHZA 3RIFA 5J0ZA 4QH1A 5HEOA 2QC1B 5CO5A 3U8JA 3WTMA 3JADA 3P50A 2LKHA 2BYNA 5KE4A 3U8MA 4AFGA 5CFBA 5AINA 5HEGA 2PGZA 4HFDA 4UM1A 3WTHA 4B5DA 3UUBA 5JMEA 3WTJA 3SH1A 4Z91A 3RHWA 4TWHA 2BR8A 1OEDC 2XNTA 5BW2A 1OEDA 5AFLA 1UV6A 2M6IA 5KZUA 4WV9A 4LMLA 4TWFA 5HEHA 4QAAA 1UW6A 4UM3A 4PIRA 2BG9E 3RIAA 4ZZBA 3T4MA 4UM3S 2WNJA 3TLVA 2XQ7A 3TLWA 2BJ0A 4ZRUA 4A97A 2LM2A 5AFKA 2XQ6A 3UU6A 4XK9A 4A98A 4ZR6A 5FJVA 5AFHA 2YMDA 2YOEA 2ZJUA 4ZK4A 2MAWA 1UX2A 3PMZA 4COFA 3UQ7A 2YN6A 4HFBA 2Y54A 2WNCA 3WTLA 4EZ1A 5BRXA 4LMKA 2BYRA 2Y7YA 4AFHA 4NPPA 5SYOA 4ILAA 3ZDHA 2XNUA 2XNVA 2Y57A 2WN9A 4F8HA 2LKGA 3EAMA 3ZKRA 4ZZCA 3LSVA 2XQ5A 5L47A 2X00A 2XQ8A 4HFCA 3U8KA 1I9BA 3TLTA 4HFHA 4X5TA 2Y56A 4IL9A 3UU5A 3RI5A 2XYTA 3IGQA 5J5FA 2BYSA 2KSRA 4UY2A 4IL4A 5AFMA 5J5HA 4FRRA 2XZ6A 4QACA 5LG3A 4D01A 4DBMA 1OEDB 3WTOA 2WNLA 2W8FA 3WTKA 2BG9C 4XHEA 2BG9A 2X00D 3UU3A 4AFTA 3GUAA 4NZBA 2BR7A 4BFQA 4IREA 4ILBA 5TVCA
chains in the Genus database with same CATH superfamily
3GA8A 3TLUA 2PH9A 3RPUA 5DJQC 2BYPA 4PAGA 2IC9A 3C84A 5ETWA 5HWYA 1S94A 4DR3T 3CPZA 4CI3B 3LG7A 3S4UA 1UK5A 4ZHQE 2W66A 2VVSA 5LMNT 4LF5T 3KVAA 4QH1A 5DABA 5GONE 4EAHA 3AEEA 5KE4A 5FL0A 1MIWA 1IBKT 2W2UA 1G8XA 1VRBA 5EK2A 3AVRA 2V7JA 3ZEFB 4G2AA 4HFVA 4AKIA 4X66T 4HWCA 4WYVA 2IAKA 5F8PA 4DBRA 3AE6A 4HWDA 2MAWA 1IZNB 5JVDE 3DP7A 2YN6A 3Q5EA 2NWBA 3KBUA 4CQIA 4DMVA 1XDPA 2R6GF 1M62A 4UY2A 4L9IA 3LDQB 4CN6A 5FXWA 4P09A 4P1NA 3AEBA 4AQGA 2DL1A 4EV6A 1ZV4X 1G73A 1JNZA 2NW9A 4PK5A 3WTNA 3ANWA 3AAEB 4CN4A 2LLYA 3WTIA 1IJ6A 1US7B 3JAFA 4IDPA 4QKNA 4ZI7E 4C90A 2M67A 4YTNA 5LYJE 5JDLA 3HKDE 5HCMA 4YSYA 2WMNA 3I1AA 4NIQA 4CI1B 4DR4T 1ZKEA 5AQJB 3AXJB 4GOUA 3FZKB 5C8YE 2LKHA 4QXHB 5AINA 2PFVA 3O1JA 4KHPT 4ANJA 3EDUA 4PJNA 3GN5A 3KV6A 4EEBA 5LMUT 2BKNA 3BK9A 3NBXX 2WNJA 3DTOA 2LM2A 2V7MA 3FBZA 4AI6A 1MMGA 3ZJ1A 3ZC0A 2WQYA 4JEUB 2FJAA 3A8YC 5IHYA 3LSVA 1W0AA 4QHOA 3VKHA 3ZT7A 4X5TA 3ZMVB 4EZHA 4XZCA 3H3MA 3RKOA 3ZMTB 2KSRA 4YJ3E 2UXNB 3H37A 3P4QA 4HN9A 2WU2A 1BR2A 3X1DA 3FZMB 4AQFC 3PUWF 4AQFA 2BR7A 3OYXA 2LEHA 4EB6E 5FMNA 4E7ZA 2UZ6A 3UFEA 3KFWX 4DV7T 2MTQA 2VL0A 5J5GA 2ZMAA 5L3CB 2YKSA 5JR9C 4PJLA 1E7PA 2W0GA 3KDSE 1J5WA 1YD8G 1OXZA 4JI0T 3SQ6A 4QXBB 2CM0A 3PDYA 4O4JE 2YMEA 2CE7A 2W8GA 1LRZA 3NKZA 2JQQA 1J1JA 5HCJA 2JIWA 3I0QA 1NEKA 2L3LA 3CVRA 5JDHA 1D0YA 1VOMA 1WRDA 4JV5T 4B3ST 3E0ZA 5L3GB 2XPKA 4GYSA 1X79A 1XDOA 3AE2A 5HXCA 4LF4T 2A9UA 4ADZA 4C91A 2N2NA 2H7OA 2ZM2A 4UM3A 3T4MA 5AFKA 3HI2A 4AKGA 1HS7A 4NUVA 4IT4A 4ILUA 5HYAA 3WTLA 4H9PC 3ZDHA 2XNUA 2UXBT 2Y57A 5JDQA 2FUPA 3UU5A 4AKRB 2VWAA 3GN5B 3AEGA 3PJAJ 1SHZC 3C98B 3FBLA 5L2LA 3B57A 4BFQA 4YXDA 4WZXA 5AQOB 3P4RA 4QH4A 3UULA 3CK6A 4IDOA 5LGTB 2V7KA 3RRCA 3ZCJA 2OA5A 4ZXLA 3C4WA 4UVCB 3P4SA 3AA0B 2V5DA 1BR4A 3PUSA 2NTYA 2LSKA 3RIFA 2QC1B 2LSIA 3WTMA 3JADA 2LOPA 5CFBA 1AJ3A 5AQVB 4HWHA 2CA5A 2BBJA 3PUVF 4KUMB 1W9RA 3MKDA 5LCYA 1UV6A 4CXWA 4E7SA 5JR9B 4LMLA 4O4HE 4H63H 2OV9A 2CXFA 1T8BA 1V9DA 4UXNB 2NTXA 1D1BA 1NENA 1ZEEA 3K3OA 2A3DA 4A97A 5AQLB 1HFAA 2WWUA 3C4ZA 4A98A 2JPFA 3RYIE 3SOLA 4QX8B 2WSSV 3QOFA 4LFBT 4LF6T 2CHNA 1KFYA 4DR5T 1FMVA 3N9NA 3VR8A 2QYWA 2FJDA 4YHJA 1WYBA 2BYSA 1KNRA 4OYJA 4DBMA 5HWXA 3LK2B 3N9LA 3ONXA 4LFAT 3AVSA 3V5UA 4NZBA 4ZZBA 2C5KT 2X9HA 4X1IE 4PNIA 2D0TA 2K3WA 4DMWA 4MLKA 3UQ4A 3VU7H 4HWFA 3U8NA 4MFRA 2FJEA 5C2TA 3SQ9A 2IDOB 2J62A 2UXDT 2V6XA 1NAFA 1WR0A 2WDVA 2C5IT 4JI1T 1LVKA 1MIVA 5J2UE 2X9XA 1YW0A 3LJCA 2XAGB 3PEOA 4DV4T 5HEOA 5JH7E 3C50A 5LB7B 4B5DA 5JMEA 2XHEB 3SH1A 3RHWA 3ZJ2A 1KF6A 2BKOA 2E5LT 4DBQA 4XBFB 1OWAA 4AKLA 4CXXA 2DI4A 2RP4A 2B1EA 1X9BA 5IWAT 4PFOA 4K0UA 2FBWA 2YOEA 4JI6T 1UX2A 1D0XA 2XZEA 4ZEYA 4QWNB 3EAMA 4O4LE 4H9RC 5L47A 2LSGA 2LRKA 2KINB 2YEVC 4H63V 3QB5K 4U31A 4ZOLE 5LG4A 5JRCB 4H9OC 4D01A 3J7Yq 3WTOA 2L8KA 2D9DA 2X66A 1CUNA 4DV5T 2HHHT 1KK7A 1BR0A 4CZZB 1YXRA 5FY7A 2J1DG 2J47A 2A2FX 3VRBA 1HNXT 2HPLA 2J4GA 5M4YA 2MPKA 2E8IA 4B3RT 5LGNB 4U7YA 2L9QA 3AXJA 4DR6T 4HKAA 5L4HA 1UX5A 1XNRT 5LHHB 4YSZA 4JI3T 4H9QC 5KMGP 2GK9A 3P50A 1HR0T 3QK6A 1Z8UA 4UM1A 1SUMB 3WTJA 2BR8A 5LBQB 2XY8B 2YINA 2DLRA 3RF1A 4ZS3A 3RH3A 2UUCT 4OX9T 3H3AA 3HKBE 3AA6B 5FXVA 5AQKB 1VCTA 1KNPA 4BAYB 2ZJUA 3AE9A 4COFA 3BQIA 4JI2T 2E9XD 4WBOA 5AFLA 2LKGA 3RX6A 3Q5DA 2Z6EA 2XQ5A 1W0BA 3UUNA 4BJMA 3HR0A 3P8CD 2YDQA 2VL8A 4AQYT 3I9WA 5EK3A 4QACA 2CBIA 2CCQA 5AQUB 4XHEA 4H9NC 1HTJF 3KBTA 4EGWA 1IJ5A 4IHJE 3TLSA 3ZC1A 3IF8B 4LF9T 5LHIB 2PBIA 4IDZA 4YY3T 2LE8A 4U74A 5L3DB 3FZLB 3RYCE 4L5GA 4AIUA 3AE8A 3UU8A 2JQ9A 2E9XC 2PJQA 1L0VA 2UXXB 4H9SE 2BYQA 3NVOA 5AQTB 2JMHA 5J0ZA 1WYCA 2VKJA 2BYNA 3QUJA 1I94T 3R84B 3Q5WA 3AE4A 4I0UA 2ES0A 2IW5B 2CLYB 3O1IA 5ABFB 2BS3A 3T1HT 4UR9A 2K9AA 5JQGE 2WBLA 4TWFA 3Q2MA 4DIDB 4KHZF 3M65A 3T1YT 2WMOA 3PU8A 2KXPB 2XQ7A 5BR8T 2I59A 3MXZA 2BVMA 4OHFA 2Q9QD 2F4VT 2BBHA 4M1PA 1UCUA 4HWIB 3K3QC 5KDMC 2X68A 4JUYA 1I9BA 3MA9A 3Q9DA 3L39A 3PJAA 1J5ET 3N9OA 3VKGA 2B76A 3ZLIA 4OK0A 4JI8T 3BQLA 2JMKA 4AFTA 2YU2A 4P0BA 2NR4A 5TVCA 3J9X1 3AA7B 2W62A 2VB6A 4Z90A 3C79A 2KMFA 4DVDA 5LXBA 5J5IA 3A5XA 3JAEA 3RC8A 4GYRA 4UXUA 1ZOYA 3EVYA 2P9BA 2Q9QC 5AFNA 2Q9QA 4F6RC 2IHR1 4UELA 2WM9A 2ACXA 1H7CA 4YFSA 5L3BB 4ZI2D 3EHZA 3LBXA 3GWHA 4WNKA 2LM9A 5JR9A 3E22E 4Z91A 5LA6E 2DHRA 4YJ2E 5FXXA 5AFUL 2G0UA 3PUAA 3WI3A 5EZYE 3TLVA 3G06A 2NW8A 2YK0A 1MNEA 2XQ6A 1HNZT 2XAQB 4XK9A 5LP6E 3N2GE 5HXSA 2E9XB 3BQKA 4UVAB 2Y7YA 4O2AE 2UU9T 3NZPA 1N36T 3U8KA 4HFHA 4BJNA 3M3ZB 2MBGA 5CA1E 3IGQA 3GMIA 3PURA 2EHOD 2WY2A 4ZI2C 3PUQA 4DV1T 2PG8A 4X62T 2NW7A 4NXNT 4ILBA 4QXCB 3EI0A 2CBJA 1DU2A 4JI4T 4XAXB 4PJMA 2XAFB 2X0HA 5L4EA 5LNKA 3C64A 3RQWA 3KVBA 4MALA 3WIPA 3K1SA 4JBWF 2CPTA 2XQ9A 2V7IA 2VASA 3U8LA 2WDRA 2Y58A 2CEAA 2CXDA 4UM3P 4HGAA 1FJGT 1T72A 4CI2B 4B3MT 3U8JA 2QVAA 5F5WA 5AQSB 3C4XA 2EHOC 3AAAB 2EHOA 2V26A 5J1GA 3PE0A 4UV8B 2WB5A 1XWMA 4ISSA 2M6IA 5KZUA 3ZPOA 5CJ5A 2OLTA 3AAIA 5CGMA 3FB2A 3SRZA 1QLBA 2DWKA 4A5XA 2Q9QB 4DUYT 2K24A 2UUBT 4DNDA 2Y6XA 5FVKA 4V1Av 2YMDA 3FZFB 3PMZA 4UVBB 3I0OA 2WNCA 3LBXB 4TN7B 3R6NA 4WBNE 5JRCA 3CQXC 3HKEE 1YKHB 3L09A 3ZMZB 3UT5E 2ZM6T 3B5MA 5FL1A 2A72A 4KBMB 3HKCE 5LBMA 2BDEA 3GUAA 2K48A 5AQHB 3RLFF 4FJOA 2XSAA 4IGUA 1MMNA 2XQAA 4BA9A 2BG9B 5JTGA 4L0RA 4X64T 4U7IA 2WS3A 3IHRA 4J2CA 3AB3B 3EABA 2WDQA 1UUSA 2KT9A 3F57A 2XYSA 2PTFA 2XUEA 2MOZA 5LJNA 2CRBA 1KEYA 5LGUB 1WFDA 1UURA 3N9MA 4B6XA 1XZYA 2VVNA 4IIJE 2HPJA 4IDQA 4AFGA 2PGZA 2KWHA 3ZCIA 3HA4A 3UUBA 3ONLC 1KNZA 2XNTA 4TUYE 4YTPA 1QSDA 2KLQA 4QAAA 2LHRA 2WWVA 2XM1A 5ABHA 4Q25A 2VQET 3UU6A 2C5JA 3E08A 4YLHA 4O8SA 4GKKT 4LF7T 2X67A 1Z0PA 4HFBA 4LMKA 4KX6A 1M7KA 3AEDA 1WR6A 3U78A 3V5SA 4KP3C 2EHOB 2WZIA 2D2SA 4O2BE 4ISTA 1FIOA 3AE1A 4UF0B 1ZHCA 2WNLA 2X9WA 2X00D 1MIYA 3Q5XA 2DWGA 5KXJA 3SWHA 3KINB 3P4WA 4QH5A 2D0UA 2LRLA 2WCAA 2ZJVA 3C51A 4PW8A 2VKDA 4IDNA 1WLXA 4DV6T 4OYKA 4UEMA 4X65T 4TNVA 5E0OA 2QGSA 4LMJA 4TWDA 5AQRB 4QX7B 5C3JA 5ABEA 2W00A 4ALXA 4ILCA 2BZBA 3RC3A 2E5VA 3P7IA 3UUXB 4Z8XA 2I6HA 5IUXA 2UXCT 3ZMUB 4GK5E 2CLYC 4OFZA 5ABFA 4I4TE 1XNQT 4MBQA 5HXRA 1I6ZA 4TV9E 5ADXL 4YTMA 1N32T 4TWHA 4GIWA 4O4IE 5BW2A 5HEHA 4KI0F 3N2OA 3RYFE 2HH7A 1LVFA 4IE0A 3MZKB 3JCFA 2KWIB 3K3NA 1ZP0A 3UQ7A 4ZS2A 1FMWA 3DJBA 5FVLA 3KV5A 2XNVA 1XMOT 3ZKRA 5FKYA 1D1AA 1HX1B 5AQGB 4TX5A 2NOXA 4N78D 4TZ4C 4X1YE 2C0SA 1R8IA 4AXPA 3CQGB 1U5PA 3MK7C 5HXEA 1N33T 5CB4E 3ZYLA 2XJ7A 3CWZB 3EDVA 1YQ4A 3CX7B 4ZK1A 4JEHB 2D5UA 1E2AA 1VCSA 5FY0A 1HF8A 2V6YB 4I43B 5AQFB 1HG5A 4U2ZA 3KV4A 3A7MA 5LXTE 2AE9A 5H6RB 5JREA 4CN1A 2JQKA 1B7TA 3IA3A 2LHNA 2ZM0A 1SE7A 5KX5E 2XAJB 3WTHA 2VK9A 4TV8E 2X0YA 3NWIA 5JDMA 4YT0A 4B3TT 1IAPA 3D0TA 1U4QA 3QNUA 4WV9A 2E9XA 4UM3S 4JI7T 3TLWA 2BJ0A 2LSYA 4GKJT 4DO0A 1YKEB 4EXTA 5AFHA 2SPCA 4AKHA 4NUUA 4CXYA 1HX8A 5DQWA 3F2EA 5JDGA 4EZ4A 1IBMT 2XQ8A 5TAOA 4EEDA 1S35A 1HNWT 2XYTA 2HN2A 2H3RA 2FJBA 4IL4A 3NRYA 2LSJA 2ZLYA 2W63A 2W8FA 4YHHT 1IBLT 1BR1A 3PUGA 3MJXA 3CIRA 3LK3B 5AFMB 3CX6B 3AE3A 1UGOA 1D1CA 2XZ5A 1FEWA 2VQFT 3PUZF 3SIOA 5HEJA 4NXMT 3L3PA 2VURA 2RPAA 2CWYA 2LT3A 3NZQA 4JI5T 2N9DA 4X1KE 4ZJTA 3CKDA 2IC6A 4EOZB 5IYZE 3JC6D 2IUBA 2WAUA 3ZYKA 3VRAA 3TKLB 2XTLA 3U8MA 4DR7T 4HFDA 3PU3A 3FXEB 2BS4A 3ZSSA 4DV0T 5JDFA 2MYSA 2YU1A 4IE5A 5FJVA 5BMVE 3T8OA 3SFEA 3UFGA 1MMAA 3AA1B 2BYRA 4ILAA 3QC9A 5A1LA 1E1HB 4KMCA 2V5CA 3CX8B 2Y56A 5AQQB 3ETVA 4EYUA 4DV3T 3ZN1B 3RYHE 2X51A 3JC6C 4FRRA 3MACA 3K8PC 2BVLA 2BG9C 3AECA 2BG9A 4LF8T 1XMQT 3PV0F 1GQEA 3U3IA 1T7SA 2WZYA 1CHUA 4HQPA 3AEAA 1D0ZA 5ABGA 3B13A 2JQHA 4X20E 4EIWA 3ANWB 3VR9A 4PJJA 3UU4A 5JDNA 3VHLA 4TNWA 2H88A 4EYYR 2K5BB 2W61A 3OKQA 4DR2T 5DQVA 1SA0E 4DUZT 1WCRA 3ZMSB 3SFDA 5HEGA 2N1GA 2HN1A 2YDRA 5LJMA 4JYAT 1OEDC 2CWOA 1OEDA 3CMLA 2WP9A 2X0LB 1Y64B 2NP9A 2QA7A 2V1DB 3UUMA 1T98A 3QB5A 5LOVE 3FXDB 2XAHB 4IE6A 4EZ1A 2ODVA 4AFHA 5SYOA 3RRWA 4UF0A 4PK4A 3TLTA 5J2TE 2ODUA 2JJ9A 2Y48B 2DNXA 5J5HA 2V7LA 3I9YA 5FY1A 5L3FB 1O3XA 5BP0A 4ZI3D 2JRKA 2XASB 3FZHB 2XSBA 3OTOT 3RQUA 3ZDGA 4HFEA 3ZT6A 2E2AA 2AXDS 4ZJSA 4IE4A 5HAXA 1HCIA 4LFCT 3P4PA 4YSXA 2RA1A 3FHNA 3ETUA 3ZYMA 4ASKA 4MHCA 3W15B 5H6QB 5CO5A 1HG2A 4DV2T 5FNVE 4P0AA 3ONJA 2LJLA 4UIGA 1UX4A 2LOSA 1QUUA 3O4XE 5FYMA 3HL6A 5EK4A 2V8SV 1NWMX 4PIRA 2BG9E 3RIAA 4ZI3C 4I50E 3ABVA 2I0MA 4U72A 3LK42 2BS2A 3OYZA 2X9YA 3ZN0B 4PFPA 3IEEA 3N9QA 4ZR6A 3NRXA 2Y54A 2VKHA 2CHOA 2CXLA 1MMDA 4AISA 3UTKA 4F8HA 2WN9A 3ZSTA 1N34T 4HE8A 4I55E 5LHGB 2WZHA 3PUXF 5F3JA 3OPCA 1Y01A 4IL9A 5L3EB 2W67A 2XM2A 1YQ3A 1OEDB 2KZ7B 5HXHA 2H7VC 3PTRB 4FI5A 2XQ3A 2XQ4A 2C9TA 3AEFA 4HEAA 3EUHA 4K0KT 3PUYF 2QRXA 3AE5A 1LKXA 3O1HA 4GK0E 2V6YA 3WAJA 4U2YA 4HFIA 2DCFA 4UV9B 1OEDE 2ACZA 4BQTA 1W09A 2CMRA 4ERRA 2M6BA 1MNDA 5CA0E 5AFJA 5AQNB 2H89A 4PK6A 2WU5A 3SS1A 1JNRA 3N2KE 5HEUA 4HTEA 4QABA 3ESLA 1EZ3A 3N9PA 4JLEA 5FP3A 3OVUA 3O9XA 4U33A 2ZM8A 3F31A 2W4XA 1UW6A 5AQIB 2IIUA 3RKGA 5AQPB 4ZRUA 3RIUC 3RIUA 4WW0A 2KNDA 3ZT5A 3IBPA 3KV9A 4ZK4A 2VKOA 3N5LA 4DR1T 2BKPA 3OJAA 5BRXA 3WAKA 4A56A 4NPPA 3AE7A 4ZZCA 3OBVE 2X00A 4HFCA 3LFMA 3CQCB 3L8RA 2YDSA 4IE7A 4G63A 5AQMB 2XQYA 3RI5A 2UUAT 5J5FA 5AFMA 2XZ6A 5LG3A 2Y8DA 5FXZA 3RGLA 3WTKA 3UU3A 2IMLA 4U3CA 4IREA
chains in the Genus database with same CATH topology
3EI0A 3TLUA 2PH9A 3P4WA 5AFMB 5BP0A 2XQ3A 2XQ4A 4QH5A 3TLSA 2C9TA 3WTNA 4Z90A 2UZ6A 2ZJVA 3C79A 2WZYA 5L4EA 2XQAA 3UQ4A 2XZ5A 2BG9B 2BYPA 3SIOA 5LXBA 5HEJA 3U8NA 2VL0A 5J5GA 4QH4A 5J5IA 4HQPA 3SQ9A 3C84A 2LLYA 3RQWA 3WTIA 2YKSA 4HFIA 3RQUA 3ZDGA 3JAEA 4HFEA 1OEDE 4ZK1A 3JAFA 4BQTA 4TNVA 2M6BA 4UXUA 4LMJA 4TWDA 3WIPA 4ZJSA 3SQ6A 5AFJA 5AFNA 2XYSA 3UU4A 4ZJTA 2XQ9A 4ALXA 4ILCA 3UU8A 5L4HA 5HCMA 4TNWA 2YMEA 3U8LA 2W8GA 5IUXA 2Y58A 5HEUA 3PEOA 2BYQA 4UM3P 5HCJA 4QABA 3EHZA 3RIFA 5J0ZA 4QH1A 5HEOA 2QC1B 5CO5A 3U8JA 3WTMA 3JADA 3P50A 2LKHA 2BYNA 5KE4A 3U8MA 4AFGA 5CFBA 5AINA 5HEGA 2PGZA 4HFDA 4UM1A 3WTHA 4B5DA 3UUBA 5JMEA 3WTJA 3SH1A 4Z91A 3RHWA 4TWHA 2BR8A 1OEDC 2XNTA 5BW2A 1OEDA 5AFLA 1UV6A 2M6IA 5KZUA 4WV9A 4LMLA 4TWFA 5HEHA 4QAAA 1UW6A 4UM3A 4PIRA 2BG9E 3RIAA 4ZZBA 3T4MA 4UM3S 2WNJA 3TLVA 2XQ7A 3TLWA 2BJ0A 4ZRUA 4A97A 2LM2A 5AFKA 2XQ6A 3UU6A 4XK9A 4A98A 4ZR6A 5FJVA 5AFHA 2YMDA 2YOEA 2ZJUA 4ZK4A 2MAWA 1UX2A 3PMZA 4COFA 3UQ7A 2YN6A 4HFBA 2Y54A 2WNCA 3WTLA 4EZ1A 5BRXA 4LMKA 2BYRA 2Y7YA 4AFHA 4NPPA 5SYOA 4ILAA 3ZDHA 2XNUA 2XNVA 2Y57A 2WN9A 4F8HA 2LKGA 3EAMA 3ZKRA 4ZZCA 3LSVA 2XQ5A 5L47A 2X00A 2XQ8A 4HFCA 3U8KA 1I9BA 3TLTA 4HFHA 4X5TA 2Y56A 4IL9A 3UU5A 3RI5A 2XYTA 3IGQA 5J5FA 2BYSA 2KSRA 4UY2A 4IL4A 5AFMA 5J5HA 4FRRA 2XZ6A 4QACA 5LG3A 4D01A 4DBMA 1OEDB 3WTOA 2WNLA 2W8FA 3WTKA 2BG9C 4XHEA 2BG9A 2X00D 3UU3A 4AFTA 3GUAA 4NZBA 2BR7A 4BFQA 4IREA 4ILBA 5TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI0 A;  3TLU A;  2PH9 A;  3P4W A;  5AFM B;  5BP0 A;  2XQ3 A;  2XQ4 A;  4QH5 A;  3TLS A;  2C9T A;  3WTN A;  4Z90 A;  2UZ6 A;  2ZJV A;  3C79 A;  2WZY A;  5L4E A;  2XQA A;  3UQ4 A;  2XZ5 A;  2BG9 B;  2BYP A;  3SIO A;  5LXB A;  5HEJ A;  3U8N A;  2VL0 A;  5J5G A;  4QH4 A;  5J5I A;  4HQP A;  3SQ9 A;  3C84 A;  2LLY A;  3RQW A;  3WTI A;  2YKS A;  4HFI A;  3RQU A;  3ZDG A;  3JAE A;  4HFE A;  1OED E;  4ZK1 A;  3JAF A;  4BQT A;  4TNV A;  2M6B A;  4UXU A;  4LMJ A;  4TWD A;  3WIP A;  4ZJS A;  3SQ6 A;  5AFJ A;  5AFN A;  2XYS A;  3UU4 A;  4ZJT A;  2XQ9 A;  4ALX A;  4ILC A;  3UU8 A;  5L4H A;  5HCM A;  4TNW A;  2YME A;  3U8L A;  2W8G A;  5IUX A;  2Y58 A;  5HEU A;  3PEO A;  2BYQ A;  4UM3 P;  5HCJ A;  4QAB A;  3EHZ A;  3RIF A;  5J0Z A;  4QH1 A;  5HEO A;  2QC1 B;  5CO5 A;  3U8J A;  3WTM A;  3JAD A;  3P50 A;  2LKH A;  2BYN A;  5KE4 A;  3U8M A;  4AFG A;  5CFB A;  5AIN A;  5HEG A;  2PGZ A;  4HFD A;  4UM1 A;  3WTH A;  4B5D A;  3UUB A;  5JME A;  3WTJ A;  3SH1 A;  4Z91 A;  3RHW A;  4TWH A;  2BR8 A;  1OED C;  2XNT A;  5BW2 A;  1OED A;  5AFL A;  1UV6 A;  2M6I A;  5KZU A;  4WV9 A;  4LML A;  4TWF A;  5HEH A;  4QAA A;  1UW6 A;  4UM3 A;  4PIR A;  2BG9 E;  3RIA A;  4ZZB A;  3T4M A;  4UM3 S;  2WNJ A;  3TLV A;  2XQ7 A;  3TLW A;  2BJ0 A;  4ZRU A;  4A97 A;  2LM2 A;  5AFK A;  2XQ6 A;  3UU6 A;  4XK9 A;  4A98 A;  4ZR6 A;  5FJV A;  5AFH A;  2YMD A;  2YOE A;  2ZJU A;  4ZK4 A;  2MAW A;  1UX2 A;  3PMZ A;  4COF A;  3UQ7 A;  2YN6 A;  4HFB A;  2Y54 A;  2WNC A;  3WTL A;  4EZ1 A;  5BRX A;  4LMK A;  2BYR A;  2Y7Y A;  4AFH A;  4NPP A;  5SYO A;  4ILA A;  3ZDH A;  2XNU A;  2XNV A;  2Y57 A;  2WN9 A;  4F8H A;  2LKG A;  3EAM A;  3ZKR A;  4ZZC A;  3LSV A;  2XQ5 A;  5L47 A;  2X00 A;  2XQ8 A;  4HFC A;  3U8K A;  1I9B A;  3TLT A;  4HFH A;  4X5T A;  2Y56 A;  4IL9 A;  3UU5 A;  3RI5 A;  2XYT A;  3IGQ A;  5J5F A;  2BYS A;  2KSR A;  4UY2 A;  4IL4 A;  5AFM A;  5J5H A;  4FRR A;  2XZ6 A;  4QAC A;  5LG3 A;  4D01 A;  4DBM A;  1OED B;  3WTO A;  2WNL A;  2W8F A;  3WTK A;  2BG9 C;  4XHE A;  2BG9 A;  2X00 D;  3UU3 A;  4AFT A;  3GUA A;  4NZB A;  2BR7 A;  4BFQ A;  4IRE A;  4ILB A;  5TVC A; 
#chains in the Genus database with same CATH topology
 3GA8 A;  3TLU A;  2PH9 A;  3RPU A;  5DJQ C;  2BYP A;  4PAG A;  2IC9 A;  3C84 A;  5ETW A;  5HWY A;  1S94 A;  4DR3 T;  3CPZ A;  4CI3 B;  3LG7 A;  3S4U A;  1UK5 A;  4ZHQ E;  2W66 A;  2VVS A;  5LMN T;  4LF5 T;  3KVA A;  4QH1 A;  5DAB A;  5GON E;  4EAH A;  3AEE A;  5KE4 A;  5FL0 A;  1MIW A;  1IBK T;  2W2U A;  1G8X A;  1VRB A;  5EK2 A;  3AVR A;  2V7J A;  3ZEF B;  4G2A A;  4HFV A;  4AKI A;  4X66 T;  4HWC A;  4WYV A;  2IAK A;  5F8P A;  4DBR A;  3AE6 A;  4HWD A;  2MAW A;  1IZN B;  5JVD E;  3DP7 A;  2YN6 A;  3Q5E A;  2NWB A;  3KBU A;  4CQI A;  4DMV A;  1XDP A;  2R6G F;  1M62 A;  4UY2 A;  4L9I A;  3LDQ B;  4CN6 A;  5FXW A;  4P09 A;  4P1N A;  3AEB A;  4AQG A;  2DL1 A;  4EV6 A;  1ZV4 X;  1G73 A;  1JNZ A;  2NW9 A;  4PK5 A;  3WTN A;  3ANW A;  3AAE B;  4CN4 A;  2LLY A;  3WTI A;  1IJ6 A;  1US7 B;  3JAF A;  4IDP A;  4QKN A;  4ZI7 E;  4C90 A;  2M67 A;  4YTN A;  5LYJ E;  5JDL A;  3HKD E;  5HCM A;  4YSY A;  2WMN A;  3I1A A;  4NIQ A;  4CI1 B;  4DR4 T;  1ZKE A;  5AQJ B;  3AXJ B;  4GOU A;  3FZK B;  5C8Y E;  2LKH A;  4QXH B;  5AIN A;  2PFV A;  3O1J A;  4KHP T;  4ANJ A;  3EDU A;  4PJN A;  3GN5 A;  3KV6 A;  4EEB A;  5LMU T;  2BKN A;  3BK9 A;  3NBX X;  2WNJ A;  3DTO A;  2LM2 A;  2V7M A;  3FBZ A;  4AI6 A;  1MMG A;  3ZJ1 A;  3ZC0 A;  2WQY A;  4JEU B;  2FJA A;  3A8Y C;  5IHY A;  3LSV A;  1W0A A;  4QHO A;  3VKH A;  3ZT7 A;  4X5T A;  3ZMV B;  4EZH A;  4XZC A;  3H3M A;  3RKO A;  3ZMT B;  2KSR A;  4YJ3 E;  2UXN B;  3H37 A;  3P4Q A;  4HN9 A;  2WU2 A;  1BR2 A;  3X1D A;  3FZM B;  4AQF C;  3PUW F;  4AQF A;  2BR7 A;  3OYX A;  2LEH A;  4EB6 E;  5FMN A;  4E7Z A;  2UZ6 A;  3UFE A;  3KFW X;  4DV7 T;  2MTQ A;  2VL0 A;  5J5G A;  2ZMA A;  5L3C B;  2YKS A;  5JR9 C;  4PJL A;  1E7P A;  2W0G A;  3KDS E;  1J5W A;  1YD8 G;  1OXZ A;  4JI0 T;  3SQ6 A;  4QXB B;  2CM0 A;  3PDY A;  4O4J E;  2YME A;  2CE7 A;  2W8G A;  1LRZ A;  3NKZ A;  2JQQ A;  1J1J A;  5HCJ A;  2JIW A;  3I0Q A;  1NEK A;  2L3L A;  3CVR A;  5JDH A;  1D0Y A;  1VOM A;  1WRD A;  4JV5 T;  4B3S T;  3E0Z A;  5L3G B;  2XPK A;  4GYS A;  1X79 A;  1XDO A;  3AE2 A;  5HXC A;  4LF4 T;  2A9U A;  4ADZ A;  4C91 A;  2N2N A;  2H7O A;  2ZM2 A;  4UM3 A;  3T4M A;  5AFK A;  3HI2 A;  4AKG A;  1HS7 A;  4NUV A;  4IT4 A;  4ILU A;  5HYA A;  3WTL A;  4H9P C;  3ZDH A;  2XNU A;  2UXB T;  2Y57 A;  5JDQ A;  2FUP A;  3UU5 A;  4AKR B;  2VWA A;  3GN5 B;  3AEG A;  3PJA J;  1SHZ C;  3C98 B;  3FBL A;  5L2L A;  3B57 A;  4BFQ A;  4YXD A;  4WZX A;  5AQO B;  3P4R A;  4QH4 A;  3UUL A;  3CK6 A;  4IDO A;  5LGT B;  2V7K A;  3RRC A;  3ZCJ A;  2OA5 A;  4ZXL A;  3C4W A;  4UVC B;  3P4S A;  3AA0 B;  2V5D A;  1BR4 A;  3PUS A;  2NTY A;  2LSK A;  3RIF A;  2QC1 B;  2LSI A;  3WTM A;  3JAD A;  2LOP A;  5CFB A;  1AJ3 A;  5AQV B;  4HWH A;  2CA5 A;  2BBJ A;  3PUV F;  4KUM B;  1W9R A;  3MKD A;  5LCY A;  1UV6 A;  4CXW A;  4E7S A;  5JR9 B;  4LML A;  4O4H E;  4H63 H;  2OV9 A;  2CXF A;  1T8B A;  1V9D A;  4UXN B;  2NTX A;  1D1B A;  1NEN A;  1ZEE A;  3K3O A;  2A3D A;  4A97 A;  5AQL B;  1HFA A;  2WWU A;  3C4Z A;  4A98 A;  2JPF A;  3RYI E;  3SOL A;  4QX8 B;  2WSS V;  3QOF A;  4LFB T;  4LF6 T;  2CHN A;  1KFY A;  4DR5 T;  1FMV A;  3N9N A;  3VR8 A;  2QYW A;  2FJD A;  4YHJ A;  1WYB A;  2BYS A;  1KNR A;  4OYJ A;  4DBM A;  5HWX A;  3LK2 B;  3N9L A;  3ONX A;  4LFA T;  3AVS A;  3V5U A;  4NZB A;  4ZZB A;  2C5K T;  2X9H A;  4X1I E;  4PNI A;  2D0T A;  2K3W A;  4DMW A;  4MLK A;  3UQ4 A;  3VU7 H;  4HWF A;  3U8N A;  4MFR A;  2FJE A;  5C2T A;  3SQ9 A;  2IDO B;  2J62 A;  2UXD T;  2V6X A;  1NAF A;  1WR0 A;  2WDV A;  2C5I T;  4JI1 T;  1LVK A;  1MIV A;  5J2U E;  2X9X A;  1YW0 A;  3LJC A;  2XAG B;  3PEO A;  4DV4 T;  5HEO A;  5JH7 E;  3C50 A;  5LB7 B;  4B5D A;  5JME A;  2XHE B;  3SH1 A;  3RHW A;  3ZJ2 A;  1KF6 A;  2BKO A;  2E5L T;  4DBQ A;  4XBF B;  1OWA A;  4AKL A;  4CXX A;  2DI4 A;  2RP4 A;  2B1E A;  1X9B A;  5IWA T;  4PFO A;  4K0U A;  2FBW A;  2YOE A;  4JI6 T;  1UX2 A;  1D0X A;  2XZE A;  4ZEY A;  4QWN B;  3EAM A;  4O4L E;  4H9R C;  5L47 A;  2LSG A;  2LRK A;  2KIN B;  2YEV C;  4H63 V;  3QB5 K;  4U31 A;  4ZOL E;  5LG4 A;  5JRC B;  4H9O C;  4D01 A;  3J7Y q;  3WTO A;  2L8K A;  2D9D A;  2X66 A;  1CUN A;  4DV5 T;  2HHH T;  1KK7 A;  1BR0 A;  4CZZ B;  1YXR A;  5FY7 A;  2J1D G;  2J47 A;  2A2F X;  3VRB A;  1HNX T;  2HPL A;  2J4G A;  5M4Y A;  2MPK A;  2E8I A;  4B3R T;  5LGN B;  4U7Y A;  2L9Q A;  3AXJ A;  4DR6 T;  4HKA A;  5L4H A;  1UX5 A;  1XNR T;  5LHH B;  4YSZ A;  4JI3 T;  4H9Q C;  5KMG P;  2GK9 A;  3P50 A;  1HR0 T;  3QK6 A;  1Z8U A;  4UM1 A;  1SUM B;  3WTJ A;  2BR8 A;  5LBQ B;  2XY8 B;  2YIN A;  2DLR A;  3RF1 A;  4ZS3 A;  3RH3 A;  2UUC T;  4OX9 T;  3H3A A;  3HKB E;  3AA6 B;  5FXV A;  5AQK B;  1VCT A;  1KNP A;  4BAY B;  2ZJU A;  3AE9 A;  4COF A;  3BQI A;  4JI2 T;  2E9X D;  4WBO A;  5AFL A;  2LKG A;  3RX6 A;  3Q5D A;  2Z6E A;  2XQ5 A;  1W0B A;  3UUN A;  4BJM A;  3HR0 A;  3P8C D;  2YDQ A;  2VL8 A;  4AQY T;  3I9W A;  5EK3 A;  4QAC A;  2CBI A;  2CCQ A;  5AQU B;  4XHE A;  4H9N C;  1HTJ F;  3KBT A;  4EGW A;  1IJ5 A;  4IHJ E;  3TLS A;  3ZC1 A;  3IF8 B;  4LF9 T;  5LHI B;  2PBI A;  4IDZ A;  4YY3 T;  2LE8 A;  4U74 A;  5L3D B;  3FZL B;  3RYC E;  4L5G A;  4AIU A;  3AE8 A;  3UU8 A;  2JQ9 A;  2E9X C;  2PJQ A;  1L0V A;  2UXX B;  4H9S E;  2BYQ A;  3NVO A;  5AQT B;  2JMH A;  5J0Z A;  1WYC A;  2VKJ A;  2BYN A;  3QUJ A;  1I94 T;  3R84 B;  3Q5W A;  3AE4 A;  4I0U A;  2ES0 A;  2IW5 B;  2CLY B;  3O1I A;  5ABF B;  2BS3 A;  3T1H T;  4UR9 A;  2K9A A;  5JQG E;  2WBL A;  4TWF A;  3Q2M A;  4DID B;  4KHZ F;  3M65 A;  3T1Y T;  2WMO A;  3PU8 A;  2KXP B;  2XQ7 A;  5BR8 T;  2I59 A;  3MXZ A;  2BVM A;  4OHF A;  2Q9Q D;  2F4V T;  2BBH A;  4M1P A;  1UCU A;  4HWI B;  3K3Q C;  5KDM C;  2X68 A;  4JUY A;  1I9B A;  3MA9 A;  3Q9D A;  3L39 A;  3PJA A;  1J5E T;  3N9O A;  3VKG A;  2B76 A;  3ZLI A;  4OK0 A;  4JI8 T;  3BQL A;  2JMK A;  4AFT A;  2YU2 A;  4P0B A;  2NR4 A;  5TVC A;  3J9X 1;  3AA7 B;  2W62 A;  2VB6 A;  4Z90 A;  3C79 A;  2KMF A;  4DVD A;  5LXB A;  5J5I A;  3A5X A;  3JAE A;  3RC8 A;  4GYR A;  4UXU A;  1ZOY A;  3EVY A;  2P9B A;  2Q9Q C;  5AFN A;  2Q9Q A;  4F6R C;  2IHR 1;  4UEL A;  2WM9 A;  2ACX A;  1H7C A;  4YFS A;  5L3B B;  4ZI2 D;  3EHZ A;  3LBX A;  3GWH A;  4WNK A;  2LM9 A;  5JR9 A;  3E22 E;  4Z91 A;  5LA6 E;  2DHR A;  4YJ2 E;  5FXX A;  5AFU L;  2G0U A;  3PUA A;  3WI3 A;  5EZY E;  3TLV A;  3G06 A;  2NW8 A;  2YK0 A;  1MNE A;  2XQ6 A;  1HNZ T;  2XAQ B;  4XK9 A;  5LP6 E;  3N2G E;  5HXS A;  2E9X B;  3BQK A;  4UVA B;  2Y7Y A;  4O2A E;  2UU9 T;  3NZP A;  1N36 T;  3U8K A;  4HFH A;  4BJN A;  3M3Z B;  2MBG A;  5CA1 E;  3IGQ A;  3GMI A;  3PUR A;  2EHO D;  2WY2 A;  4ZI2 C;  3PUQ A;  4DV1 T;  2PG8 A;  4X62 T;  2NW7 A;  4NXN T;  4ILB A;  4QXC B;  3EI0 A;  2CBJ A;  1DU2 A;  4JI4 T;  4XAX B;  4PJM A;  2XAF B;  2X0H A;  5L4E A;  5LNK A;  3C64 A;  3RQW A;  3KVB A;  4MAL A;  3WIP A;  3K1S A;  4JBW F;  2CPT A;  2XQ9 A;  2V7I A;  2VAS A;  3U8L A;  2WDR A;  2Y58 A;  2CEA A;  2CXD A;  4UM3 P;  4HGA A;  1FJG T;  1T72 A;  4CI2 B;  4B3M T;  3U8J A;  2QVA A;  5F5W A;  5AQS B;  3C4X A;  2EHO C;  3AAA B;  2EHO A;  2V26 A;  5J1G A;  3PE0 A;  4UV8 B;  2WB5 A;  1XWM A;  4ISS A;  2M6I A;  5KZU A;  3ZPO A;  5CJ5 A;  2OLT A;  3AAI A;  5CGM A;  3FB2 A;  3SRZ A;  1QLB A;  2DWK A;  4A5X A;  2Q9Q B;  4DUY T;  2K24 A;  2UUB T;  4DND A;  2Y6X A;  5FVK A;  4V1A v;  2YMD A;  3FZF B;  3PMZ A;  4UVB B;  3I0O A;  2WNC A;  3LBX B;  4TN7 B;  3R6N A;  4WBN E;  5JRC A;  3CQX C;  3HKE E;  1YKH B;  3L09 A;  3ZMZ B;  3UT5 E;  2ZM6 T;  3B5M A;  5FL1 A;  2A72 A;  4KBM B;  3HKC E;  5LBM A;  2BDE A;  3GUA A;  2K48 A;  5AQH B;  3RLF F;  4FJO A;  2XSA A;  4IGU A;  1MMN A;  2XQA A;  4BA9 A;  2BG9 B;  5JTG A;  4L0R A;  4X64 T;  4U7I A;  2WS3 A;  3IHR A;  4J2C A;  3AB3 B;  3EAB A;  2WDQ A;  1UUS A;  2KT9 A;  3F57 A;  2XYS A;  2PTF A;  2XUE A;  2MOZ A;  5LJN A;  2CRB A;  1KEY A;  5LGU B;  1WFD A;  1UUR A;  3N9M A;  4B6X A;  1XZY A;  2VVN A;  4IIJ E;  2HPJ A;  4IDQ A;  4AFG A;  2PGZ A;  2KWH A;  3ZCI A;  3HA4 A;  3UUB A;  3ONL C;  1KNZ A;  2XNT A;  4TUY E;  4YTP A;  1QSD A;  2KLQ A;  4QAA A;  2LHR A;  2WWV A;  2XM1 A;  5ABH A;  4Q25 A;  2VQE T;  3UU6 A;  2C5J A;  3E08 A;  4YLH A;  4O8S A;  4GKK T;  4LF7 T;  2X67 A;  1Z0P A;  4HFB A;  4LMK A;  4KX6 A;  1M7K A;  3AED A;  1WR6 A;  3U78 A;  3V5S A;  4KP3 C;  2EHO B;  2WZI A;  2D2S A;  4O2B E;  4IST A;  1FIO A;  3AE1 A;  4UF0 B;  1ZHC A;  2WNL A;  2X9W A;  2X00 D;  1MIY A;  3Q5X A;  2DWG A;  5KXJ A;  3SWH A;  3KIN B;  3P4W A;  4QH5 A;  2D0U A;  2LRL A;  2WCA A;  2ZJV A;  3C51 A;  4PW8 A;  2VKD A;  4IDN A;  1WLX A;  4DV6 T;  4OYK A;  4UEM A;  4X65 T;  4TNV A;  5E0O A;  2QGS A;  4LMJ A;  4TWD A;  5AQR B;  4QX7 B;  5C3J A;  5ABE A;  2W00 A;  4ALX A;  4ILC A;  2BZB A;  3RC3 A;  2E5V A;  3P7I A;  3UUX B;  4Z8X A;  2I6H A;  5IUX A;  2UXC T;  3ZMU B;  4GK5 E;  2CLY C;  4OFZ A;  5ABF A;  4I4T E;  1XNQ T;  4MBQ A;  5HXR A;  1I6Z A;  4TV9 E;  5ADX L;  4YTM A;  1N32 T;  4TWH A;  4GIW A;  4O4I E;  5BW2 A;  5HEH A;  4KI0 F;  3N2O A;  3RYF E;  2HH7 A;  1LVF A;  4IE0 A;  3MZK B;  3JCF A;  2KWI B;  3K3N A;  1ZP0 A;  3UQ7 A;  4ZS2 A;  1FMW A;  3DJB A;  5FVL A;  3KV5 A;  2XNV A;  1XMO T;  3ZKR A;  5FKY A;  1D1A A;  1HX1 B;  5AQG B;  4TX5 A;  2NOX A;  4N78 D;  4TZ4 C;  4X1Y E;  2C0S A;  1R8I A;  4AXP A;  3CQG B;  1U5P A;  3MK7 C;  5HXE A;  1N33 T;  5CB4 E;  3ZYL A;  2XJ7 A;  3CWZ B;  3EDV A;  1YQ4 A;  3CX7 B;  4ZK1 A;  4JEH B;  2D5U A;  1E2A A;  1VCS A;  5FY0 A;  1HF8 A;  2V6Y B;  4I43 B;  5AQF B;  1HG5 A;  4U2Z A;  3KV4 A;  3A7M A;  5LXT E;  2AE9 A;  5H6R B;  5JRE A;  4CN1 A;  2JQK A;  1B7T A;  3IA3 A;  2LHN A;  2ZM0 A;  1SE7 A;  5KX5 E;  2XAJ B;  3WTH A;  2VK9 A;  4TV8 E;  2X0Y A;  3NWI A;  5JDM A;  4YT0 A;  4B3T T;  1IAP A;  3D0T A;  1U4Q A;  3QNU A;  4WV9 A;  2E9X A;  4UM3 S;  4JI7 T;  3TLW A;  2BJ0 A;  2LSY A;  4GKJ T;  4DO0 A;  1YKE B;  4EXT A;  5AFH A;  2SPC A;  4AKH A;  4NUU A;  4CXY A;  1HX8 A;  5DQW A;  3F2E A;  5JDG A;  4EZ4 A;  1IBM T;  2XQ8 A;  5TAO A;  4EED A;  1S35 A;  1HNW T;  2XYT A;  2HN2 A;  2H3R A;  2FJB A;  4IL4 A;  3NRY A;  2LSJ A;  2ZLY A;  2W63 A;  2W8F A;  4YHH T;  1IBL T;  1BR1 A;  3PUG A;  3MJX A;  3CIR A;  3LK3 B;  5AFM B;  3CX6 B;  3AE3 A;  1UGO A;  1D1C A;  2XZ5 A;  1FEW A;  2VQF T;  3PUZ F;  3SIO A;  5HEJ A;  4NXM T;  3L3P A;  2VUR A;  2RPA A;  2CWY A;  2LT3 A;  3NZQ A;  4JI5 T;  2N9D A;  4X1K E;  4ZJT A;  3CKD A;  2IC6 A;  4EOZ B;  5IYZ E;  3JC6 D;  2IUB A;  2WAU A;  3ZYK A;  3VRA A;  3TKL B;  2XTL A;  3U8M A;  4DR7 T;  4HFD A;  3PU3 A;  3FXE B;  2BS4 A;  3ZSS A;  4DV0 T;  5JDF A;  2MYS A;  2YU1 A;  4IE5 A;  5FJV A;  5BMV E;  3T8O A;  3SFE A;  3UFG A;  1MMA A;  3AA1 B;  2BYR A;  4ILA A;  3QC9 A;  5A1L A;  1E1H B;  4KMC A;  2V5C A;  3CX8 B;  2Y56 A;  5AQQ B;  3ETV A;  4EYU A;  4DV3 T;  3ZN1 B;  3RYH E;  2X51 A;  3JC6 C;  4FRR A;  3MAC A;  3K8P C;  2BVL A;  2BG9 C;  3AEC A;  2BG9 A;  4LF8 T;  1XMQ T;  3PV0 F;  1GQE A;  3U3I A;  1T7S A;  2WZY A;  1CHU A;  4HQP A;  3AEA A;  1D0Z A;  5ABG A;  3B13 A;  2JQH A;  4X20 E;  4EIW A;  3ANW B;  3VR9 A;  4PJJ A;  3UU4 A;  5JDN A;  3VHL A;  4TNW A;  2H88 A;  4EYY R;  2K5B B;  2W61 A;  3OKQ A;  4DR2 T;  5DQV A;  1SA0 E;  4DUZ T;  1WCR A;  3ZMS B;  3SFD A;  5HEG A;  2N1G A;  2HN1 A;  2YDR A;  5LJM A;  4JYA T;  1OED C;  2CWO A;  1OED A;  3CML A;  2WP9 A;  2X0L B;  1Y64 B;  2NP9 A;  2QA7 A;  2V1D B;  3UUM A;  1T98 A;  3QB5 A;  5LOV E;  3FXD B;  2XAH B;  4IE6 A;  4EZ1 A;  2ODV A;  4AFH A;  5SYO A;  3RRW A;  4UF0 A;  4PK4 A;  3TLT A;  5J2T E;  2ODU A;  2JJ9 A;  2Y48 B;  2DNX A;  5J5H A;  2V7L A;  3I9Y A;  5FY1 A;  5L3F B;  1O3X A;  5BP0 A;  4ZI3 D;  2JRK A;  2XAS B;  3FZH B;  2XSB A;  3OTO T;  3RQU A;  3ZDG A;  4HFE A;  3ZT6 A;  2E2A A;  2AXD S;  4ZJS A;  4IE4 A;  5HAX A;  1HCI A;  4LFC T;  3P4P A;  4YSX A;  2RA1 A;  3FHN A;  3ETU A;  3ZYM A;  4ASK A;  4MHC A;  3W15 B;  5H6Q B;  5CO5 A;  1HG2 A;  4DV2 T;  5FNV E;  4P0A A;  3ONJ A;  2LJL A;  4UIG A;  1UX4 A;  2LOS A;  1QUU A;  3O4X E;  5FYM A;  3HL6 A;  5EK4 A;  2V8S V;  1NWM X;  4PIR A;  2BG9 E;  3RIA A;  4ZI3 C;  4I50 E;  3ABV A;  2I0M A;  4U72 A;  3LK4 2;  2BS2 A;  3OYZ A;  2X9Y A;  3ZN0 B;  4PFP A;  3IEE A;  3N9Q A;  4ZR6 A;  3NRX A;  2Y54 A;  2VKH A;  2CHO A;  2CXL A;  1MMD A;  4AIS A;  3UTK A;  4F8H A;  2WN9 A;  3ZST A;  1N34 T;  4HE8 A;  4I55 E;  5LHG B;  2WZH A;  3PUX F;  5F3J A;  3OPC A;  1Y01 A;  4IL9 A;  5L3E B;  2W67 A;  2XM2 A;  1YQ3 A;  1OED B;  2KZ7 B;  5HXH A;  2H7V C;  3PTR B;  4FI5 A;  2XQ3 A;  2XQ4 A;  2C9T A;  3AEF A;  4HEA A;  3EUH A;  4K0K T;  3PUY F;  2QRX A;  3AE5 A;  1LKX A;  3O1H A;  4GK0 E;  2V6Y A;  3WAJ A;  4U2Y A;  4HFI A;  2DCF A;  4UV9 B;  1OED E;  2ACZ A;  4BQT A;  1W09 A;  2CMR A;  4ERR A;  2M6B A;  1MND A;  5CA0 E;  5AFJ A;  5AQN B;  2H89 A;  4PK6 A;  2WU5 A;  3SS1 A;  1JNR A;  3N2K E;  5HEU A;  4HTE A;  4QAB A;  3ESL A;  1EZ3 A;  3N9P A;  4JLE A;  5FP3 A;  3OVU A;  3O9X A;  4U33 A;  2ZM8 A;  3F31 A;  2W4X A;  1UW6 A;  5AQI B;  2IIU A;  3RKG A;  5AQP B;  4ZRU A;  3RIU C;  3RIU A;  4WW0 A;  2KND A;  3ZT5 A;  3IBP A;  3KV9 A;  4ZK4 A;  2VKO A;  3N5L A;  4DR1 T;  2BKP A;  3OJA A;  5BRX A;  3WAK A;  4A56 A;  4NPP A;  3AE7 A;  4ZZC A;  3OBV E;  2X00 A;  4HFC A;  3LFM A;  3CQC B;  3L8R A;  2YDS A;  4IE7 A;  4G63 A;  5AQM B;  2XQY A;  3RI5 A;  2UUA T;  5J5F A;  5AFM A;  2XZ6 A;  5LG3 A;  2Y8D A;  5FXZ A;  3RGL A;  3WTK A;  3UU3 A;  2IML A;  4U3C A;  4IRE A; 
#chains in the Genus database with same CATH homology
 3EI0 A;  3TLU A;  2PH9 A;  3P4W A;  5AFM B;  5BP0 A;  2XQ3 A;  2XQ4 A;  4QH5 A;  3TLS A;  2C9T A;  3WTN A;  4Z90 A;  2UZ6 A;  2ZJV A;  3C79 A;  2WZY A;  5L4E A;  2XQA A;  3UQ4 A;  2XZ5 A;  2BG9 B;  2BYP A;  3SIO A;  5LXB A;  5HEJ A;  3U8N A;  2VL0 A;  5J5G A;  4QH4 A;  5J5I A;  4HQP A;  3SQ9 A;  3C84 A;  2LLY A;  3RQW A;  3WTI A;  2YKS A;  4HFI A;  3RQU A;  3ZDG A;  3JAE A;  4HFE A;  1OED E;  4ZK1 A;  3JAF A;  4BQT A;  4TNV A;  2M6B A;  4UXU A;  4LMJ A;  4TWD A;  3WIP A;  4ZJS A;  3SQ6 A;  5AFJ A;  5AFN A;  2XYS A;  3UU4 A;  4ZJT A;  2XQ9 A;  4ALX A;  4ILC A;  3UU8 A;  5L4H A;  5HCM A;  4TNW A;  2YME A;  3U8L A;  2W8G A;  5IUX A;  2Y58 A;  5HEU A;  3PEO A;  2BYQ A;  4UM3 P;  5HCJ A;  4QAB A;  3EHZ A;  3RIF A;  5J0Z A;  4QH1 A;  5HEO A;  2QC1 B;  5CO5 A;  3U8J A;  3WTM A;  3JAD A;  3P50 A;  2LKH A;  2BYN A;  5KE4 A;  3U8M A;  4AFG A;  5CFB A;  5AIN A;  5HEG A;  2PGZ A;  4HFD A;  4UM1 A;  3WTH A;  4B5D A;  3UUB A;  5JME A;  3WTJ A;  3SH1 A;  4Z91 A;  3RHW A;  4TWH A;  2BR8 A;  1OED C;  2XNT A;  5BW2 A;  1OED A;  5AFL A;  1UV6 A;  2M6I A;  5KZU A;  4WV9 A;  4LML A;  4TWF A;  5HEH A;  4QAA A;  1UW6 A;  4UM3 A;  4PIR A;  2BG9 E;  3RIA A;  4ZZB A;  3T4M A;  4UM3 S;  2WNJ A;  3TLV A;  2XQ7 A;  3TLW A;  2BJ0 A;  4ZRU A;  4A97 A;  2LM2 A;  5AFK A;  2XQ6 A;  3UU6 A;  4XK9 A;  4A98 A;  4ZR6 A;  5FJV A;  5AFH A;  2YMD A;  2YOE A;  2ZJU A;  4ZK4 A;  2MAW A;  1UX2 A;  3PMZ A;  4COF A;  3UQ7 A;  2YN6 A;  4HFB A;  2Y54 A;  2WNC A;  3WTL A;  4EZ1 A;  5BRX A;  4LMK A;  2BYR A;  2Y7Y A;  4AFH A;  4NPP A;  5SYO A;  4ILA A;  3ZDH A;  2XNU A;  2XNV A;  2Y57 A;  2WN9 A;  4F8H A;  2LKG A;  3EAM A;  3ZKR A;  4ZZC A;  3LSV A;  2XQ5 A;  5L47 A;  2X00 A;  2XQ8 A;  4HFC A;  3U8K A;  1I9B A;  3TLT A;  4HFH A;  4X5T A;  2Y56 A;  4IL9 A;  3UU5 A;  3RI5 A;  2XYT A;  3IGQ A;  5J5F A;  2BYS A;  2KSR A;  4UY2 A;  4IL4 A;  5AFM A;  5J5H A;  4FRR A;  2XZ6 A;  4QAC A;  5LG3 A;  4D01 A;  4DBM A;  1OED B;  3WTO A;  2WNL A;  2W8F A;  3WTK A;  2BG9 C;  4XHE A;  2BG9 A;  2X00 D;  3UU3 A;  4AFT A;  3GUA A;  4NZB A;  2BR7 A;  4BFQ A;  4IRE A;  4ILB A;  5TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...