3UU6A

The glic pentameric ligand-gated ion channel loop2-22' mutant reduced in solution
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
311
structure length
311
Chain Sequence
b'VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNCPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 91
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu6A01
1OEDE 4TNVA 1UV6A 2Y58A 2Y7YA 4UM3P 3ZDGA 5HEJA 3UU5A 5AFNA 5J5HA 3TLUA 5HCJA 5AFJA 5CO5A 3ZKRA 3UQ4A 4A97A 4ILAA 5IUXA 3GUAA 1OEDA 4HQPA 4WV9A 3SIOA 2BYRA 4X5TA 2W8FA 4Z91A 1UW6A 2PH9A 4UM3A 3C84A 2X00D 2XQ9A 4IL9A 4TWDA 2BYNA 4XK9A 4D01A 3RI5A 2C9TA 2YOEA 2YKSA 2M6IA 3P4WA 2YN6A 3JAFA 2XQ6A 3WTLA 3WTIA 5AINA 2LKHA 2XQ4A 2BJ0A 4DBMA 4UY2A 2XYTA 1OEDC 3EAMA 2BR8A 2LLYA 2X00A 2BYQA 3RHWA 3TLTA 3WTKA 4HFDA 2WN9A 3UU8A 2Y54A 4TWHA 3C79A 5FJVA 5BP0A 3IGQA 5L4HA 2WNJA 2BR7A 4HFIA 2XNVA 2Y56A 4HFCA 4UXUA 2BYPA 3RQUA 5L4EA 4ALXA 2YMDA 5HEUA 4QH5A 4ZR6A 1UX2A 3WTMA 4TNWA 3U8JA 5CFBA 4FRRA 5L47A 4F8HA 2PGZA 3RQWA 3SQ6A 4ZJTA 4BFQA 4QACA 4HFEA 4A98A 4HFBA 3RIAA 2XYSA 1I9BA 2QC1B 3U8NA 4COFA 2XQ3A 4UM1A 2MAWA 3TLSA 4TWFA 4ZZBA 2XQAA 4XHEA 4B5DA 5BRXA 3UQ7A 4HFHA 2BYSA 2XQ5A 5J5IA 5HEGA 4ILBA 5TVCA 2Y57A 3WTJA 2XQ7A 4PIRA 4ILCA 4IL4A 2BG9B 2XZ6A 3SH1A 5AFKA 3WIPA 3UU3A 4AFTA 5LG3A 3UU4A 2XNUA 2M6BA 2YMEA 3SQ9A 4UM3S 5JMEA 2LKGA 5HEHA 4QABA 4LMKA 2ZJVA 3UUBA 4AFHA 3ZDHA 3WTOA 3LSVA 2XZ5A 4LMLA 2KSRA 5AFHA 3TLWA 3U8LA 3PEOA 4ZK4A 4QH4A 5AFMA 2W8GA 2BG9A 3JAEA 3P50A 3JADA 2UZ6A 4LMJA 2WZYA 2XQ8A 5HEOA 4Z90A 4ZZCA 5J5GA 3T4MA 3EI0A 3TLVA 4QAAA 4BQTA 3WTNA 5AFMB 3EHZA 5LXBA 4NPPA 2BG9C 4ZRUA 3PMZA 3U8MA 5J0ZA 4ZJSA 4ZK1A 3WTHA 5BW2A 3RIFA 4AFGA 2XNTA 4EZ1A 5KZUA 2VL0A 2BG9E 4NZBA 5SYOA 5HCMA 1OEDB 2LM2A 2WNLA 5KE4A 5AFLA 5J5FA 3U8KA 4QH1A 3UU6A 2ZJUA 4IREA 2WNCA
chains in the Genus database with same CATH superfamily
3CQCB 3EVYA 3K1SA 4UM3P 4AQFC 4DMWA 5LXTE 5AFNA 4EOZB 5EK4A 4X5TA 4YHJA 5FXVA 2YOEA 2YKSA 2XQ4A 3ZC0A 3ZT7A 3CX6B 1G73A 3IEEA 4UVBB 1QUUA 4KBMB 2X0LB 2J47A 4U2YA 4X62T 4EGWA 2C5JA 4QH5A 5KMGP 1QSDA 2K3WA 2OA5A 2CHNA 1KNPA 4G63A 4CQIA 1HF8A 3AE8A 1MMGA 3U8NA 3AEGA 4UXNB 4B5DA 4DV5T 3UQ7A 4IE5A 1Z0PA 3KINB 3RC8A 4ILCA 2WAUA 4CN1A 1VCTA 3N9LA 3RRCA 3V5SA 5ABEA 3K8PC 2IHR1 3FXEB 5FL1A 3ZDHA 2MOZA 3ZLIA 2V26A 4KP3C 3ONLC 4LF5T 5F5WA 3U8LA 1M7KA 5AFMA 4CXWA 1WCRA 4AQYT 3OVUA 2BDEA 2CA5A 1T7SA 2CPTA 3VR9A 3PUGA 5KE4A 4WNKA 5LA6E 4BA9A 4U31A 1WR0A 2MYSA 4UV9B 4AKGA 4HE8A 4O4LE 5HCJA 1MMNA 5CO5A 3UQ4A 2BYRA 2NR4A 2BYNA 3ETVA 3VU7H 4HWCA 4U2ZA 2X66A 5AQFB 2RA1A 1D0YA 2BYPA 4O4JE 2B1EA 4TNWA 4YTNA 5JR9A 3P4QA 5L3BB 4AQGA 1T98A 2BBHA 2YINA 3FBLA 3N9PA 2XQ3A 2N9DA 2BBJA 4JBWF 2CBJA 4IT4A 5HXRA 2BYSA 3Q5EA 3CX7B 2D9DA 3FZFB 4I55E 3NWIA 5LOVE 2CLYC 3FZKB 2V1DB 5LG3A 3B13A 2WP9A 3HKCE 4XBFB 2YDQA 3LK3B 1I6ZA 2W67A 4LMLA 3E08A 5AQTB 4OK0A 5FNVE 5JR9C 3N9OA 3T1HT 3RGLA 2WZYA 2KZ7B 1X9BA 4LF6T 3FHNA 1BR1A 2DWKA 5AQHB 4UF0A 5LMUT 4H9OC 4MFRA 1W9RA 5E0OA 5LG4A 3T1YT 1SA0E 4ASKA 3FB2A 4EEBA 4QKNA 2CMRA 4AISA 2X68A 1OXZA 2Y7YA 3P8CD 3PUSA 4HWFA 3OBVE 4H63H 4U7YA 2BS2A 1UGOA 5IUXA 4HQPA 1YQ4A 4UM3A 1UW6A 4D01A 3KBUA 4QXCB 3FBZA 1WYBA 3LBXB 2WZHA 4MLKA 3AXJA 3AE2A 4TWHA 4TV8E 5LJNA 2LOSA 2E9XD 4EZHA 4XAXB 3U8JA 3RQWA 2VB6A 2A9UA 3PTRB 5ABHA 4A98A 3RIAA 1OWAA 1I9BA 3DP7A 4HFHA 4GYSA 5JVDE 2DWGA 2Y8DA 2LT3A 3ZCIA 4ZI2C 1ZKEA 2BG9B 4DBQA 2V8SV 3NRYA 4I0UA 5JRCA 3LK42 3PUWF 5AFHA 1UCUA 5AFUL 4P1NA 3FZMB 4LFCT 3SFEA 3L8RA 3R6NA 4ZZCA 3SOLA 5LGNB 2BS3A 1HX8A 2ZM2A 4M1PA 2HN1A 1FJGT 3E22E 3ZN0B 1OEDE 3ZJ1A 3C51A 2J1DG 1KF6A 4OYJA 3TLUA 5F8PA 2NTXA 2PTFA 1H7CA 4ZI7E 2M6IA 4H9SE 4GKKT 2BVMA 3AEFA 2BYQA 1WRDA 4AXPA 5HAXA 1JNRA 2E5VA 4IIJE 2LRLA 5FJVA 5BP0A 3O9XA 3QB5A 2L9QA 4FI5A 4ALXA 5FY7A 4ZR6A 4ILUA 4DR4T 2EHOD 1HG5A 2XAJB 2E9XA 2CBIA 3UT5E 4EV6A 3BQKA 3F2EA 4UR9A 4YTMA 4ILBA 4KX6A 2WWVA 3W15B 3J9X1 3IF8B 1HCIA 4PFPA 3U78A 5LYJE 2LKGA 4HKAA 4DMVA 3C4ZA 2GK9A 4JI0T 5JDHA 3TLWA 1IAPA 4IGUA 5EK3A 1ZOYA 3RYHE 4Q25A 2NWBA 2XQ8A 2KWHA 4ADZA 4GK5E 2YU1A 3JCFA 1UUSA 3HL6A 4EZ1A 4DR7T 2WY2A 3PJAA 2C5KT 5HCMA 1US7B 4HWDA 1B7TA 5AQNB 2X51A 2UUAT 4CXYA 2WNCA 2H88A 5HEJA 3LFMA 5BMVE 2K9AA 2WMOA 3C4WA 4GOUA 5AQLB 4WYVA 4LF7T 2ODVA 3O1JA 2HHHT 2XM1A 4DBMA 4X20E 3AE9A 2BKNA 3LG7A 2E8IA 3ZSSA 1MIYA 3ANWB 5LCYA 5L3CB 2IIUA 5H6RB 2AE9A 3C4XA 4YFSA 4QXBB 4KUMB 5AQJB 2YU2A 3PE0A 4DUZT 1E7PA 4HFEA 2EHOA 3PUYF 2MAWA 4IE7A 3TLSA 4YJ2E 5KXJA 2WSSV 5ADXL 2XQ5A 3AAAB 5JH7E 3ZCJA 4NUVA 2XQ7A 3AE7A 3OYZA 2CXLA 2XZ6A 2QVAA 2WZIA 3AVSA 4PJJA 5HEHA 3HKDE 2XZ5A 4EXTA 2JQKA 3Q9DA 5C2TA 3P50A 3JADA 4G2AA 4DR5T 4QX8B 4X1KE 3T4MA 2HPJA 3VHLA 4JYAT 4EYUA 2D5UA 5BW2A 3QK6A 5LMNT 4AQFA 2KMFA 2LM2A 2WNLA 3CIRA 4EZ4A 5FY1A 3AEBA 2LM9A 3GUAA 4DUYT 4UEMA 3UU5A 3Q2MA 4KI0F 1FMVA 4X1IE 1AJ3A 2VKOA 5HWXA 4TWDA 2DHRA 2MBGA 1XMQT 3WTLA 5AINA 2LKHA 4DVDA 5L3DB 3RHWA 4I4TE 1IJ5A 2XASB 2ZM6T 5ETWA 5KX5E 3PURA 2Y48B 5FXWA 4O4IE 4YSZA 1XWMA 5HXCA 2YMDA 2NW8A 1SHZC 2JQHA 4U72A 3C98B 4UVAB 1HNWT 3SQ6A 4BFQA 5L3FB 4IDZA 2WQYA 4YT0A 1BR2A 4ZZBA 3DJBA 1UURA 2CXFA 5FYMA 3ZMVB 4PIRA 2CCQA 5AQSB 4ZS2A 4ISTA 3UU4A 4QHOA 2XAQB 3CKDA 5LGTB 4X65T 2XSAA 4AFHA 4UF0B 4TX5A 2CWYA 4AKLA 2KSRA 3V5UA 3RYFE 1E2AA 3WI3A 2K24A 2XM2A 3KFWX 5HWYA 2MPKA 2UXDT 3EI0A 3C64A 5IHYA 1I94T 4NPPA 1XNRT 5LBQB 5JDFA 4DIDB 2ZLYA 4H9QC 4ZS3A 4IDPA 4ZI3C 3AA1B 4IREA 2RPAA 4HTEA 2Y58A 1IBLT 2WDRA 3CX8B 4YSXA 2WWUA 2W0GA 3DTOA 3AXJB 3M65A 2IDOB 4JI1T 2WCAA 4WV9A 4O2AE 3RI5A 4U7IA 1BR0A 5HXEA 2Q9QC 2ODUA 5LB7B 4DV0T 4UIGA 4E7ZA 1SE7A 2JMKA 1XNQT 3ZYMA 3Q5WA 5L2LA 1FMWA 4DV1T 2M67A 3N9NA 3I1AA 2DCFA 4ZI2D 2PGZA 2HH7A 2XSBA 4YHHT 2XYSA 4A56A 3OYXA 4GIWA 4P09A 4PK5A 5ABFB 4XHEA 2YDSA 5JRCB 2H89A 2VKHA 4LFBT 1HFAA 2LSGA 4XZCA 3UU3A 3CWZB 5L3EB 2N2NA 2JIWA 5DJQC 3UUBA 5LNKA 4JI2T 5AQRB 2W8GA 5KDMC 4ZOLE 2UZ6A 2K48A 4DR6T 2NW9A 1LVFA 4WZXA 3RIFA 3UUNA 2VL8A 3LJCA 2XQYA 3P4SA 4JEHB 5SYOA 4YXDA 4ZEYA 1JNZA 1XDPA 3KV4A 4MBQA 1HTJF 3JC6C 3KDSE 4JI7T 3FZHB 3BQIA 3N2GE 2XJ7A 4PK4A 1KK7A 2VVSA 4TV9E 4YLHA 3KV9A 5FP3A 2XTLA 5CJ5A 3JAFA 3WTIA 1OEDC 5JQGE 2VWAA 1D1BA 2E9XB 3TLTA 4DR2T 1WR6A 4HFDA 4PJNA 2QRXA 3ZN1B 3ZMZB 4UXUA 4EYYR 2JPFA 1G8XA 2NP9A 2V5CA 1D0XA 2D0UA 5CFBA 4F8HA 2IAKA 2IMLA 4TWFA 4OX9T 2PJQA 3NZQA 5TVCA 2ZMAA 3HKEE 3X1DA 4O8SA 3SFDA 2H7VC 3MJXA 1R8IA 5CB4E 3EDVA 3LSVA 1D1AA 1J5WA 1UX4A 3UTKA 2KNDA 4ANJA 4N78D 1KNRA 5AQQB 4B6XA 2LSJA 3TLVA 5LXBA 4ZK1A 3EABA 2PFVA 2UUBT 3HKBE 3ETUA 2XNTA 2VL0A 4B3TT 4I43B 2JRKA 3L09A 3Q5DA 2J4GA 2PBIA 4TUYE 2WS3A 4H9RC 2UXXB 1MNEA 4AIUA 4QXHB 1O3XA 2X00D 5HXSA 4WBNE 4CI3B 3LDQB 3P4WA 2RP4A 2XQ6A 5FXZA 2XYTA 3EAMA 3N5LA 2BR8A 4L9IA 2QGSA 3RLFF 5AQVB 1SUMB 2EHOB 1UX5A 2ES0A 1FEWA 3ZC1A 1UX2A 5L47A 3AAEB 2V7LA 2WBLA 4X1YE 1S35A 1N34T 3GN5A 3UUMA 5IYZE 3ZT6A 4JI8T 2JMHA 3WTJA 3OPCA 3EUHA 1MIVA 5AFKA 2BKPA 3OTOT 5CA0E 4IE4A 2V7JA 2X9XA 3CQXC 3AE1A 4H9PC 3AE6A 3JAEA 3KVAA 1V9DA 5J5GA 4KHZF 3EHZA 3H3MA 2IUBA 4JEUB 2VKDA 2P9BA 4BJNA 3WTHA 3PUZF 3AEDA 4C91A 1BR4A 4WW0A 1N32T 2FBWA 2LHRA 4KMCA 3GMIA 3Q5XA 4DR3T 1LRZA 3N2KE 4DV2T 1YD8G 1LKXA 4JI5T 3VKGA 3IA3A 3RC3A 3RIUC 3PU8A 2W8FA 2WMNA 5KZUA 5DABA 3LK2B 1WFDA 3AE3A 2BJ0A 4HFVA 5J2UE 2LLYA 2X00A 3AVRA 4ZXLA 1Y01A 2DNXA 2CWOA 3UFGA 4YSYA 3IGQA 3ABVA 2BR7A 2Z6EA 5LP6E 2DLRA 3K3QC 3RQUA 1HX1B 3WAJA 3AA0B 2V7MA 5JDMA 4CN4A 4FRRA 2CRBA 3K3NA 1J5ET 5F3JA 2V7IA 4OHFA 3PUXF 4IE0A 4HFBA 5ABGA 4COFA 4UM1A 3D0TA 3BK9A 3CMLA 3ONJA 5HEGA 2YDRA 2Y57A 2VURA 1VOMA 3ZPOA 2LE8A 4ERRA 2CEAA 3O1IA 2XNUA 3VRBA 4DR1T 2MTQA 4PAGA 2X67A 5FMNA 3N2OA 2CM0A 2C0SA 4ZI3D 3A5XA 2N1GA 5HEOA 2WU2A 4QAAA 4BQTA 5AFMB 2BG9C 4JI3T 4ZRUA 3ONXA 4AKHA 4ZJSA 2C5IT 5AQPB 1NAFA 1QLBA 1MMAA 3PUQA 2Q9QD 2LRKA 4E7SA 1N36T 1UV6A 5J5HA 2VQET 3OKQA 2OV9A 5M4YA 4UV8B 3RYCE 3ZKRA 1HNXT 2D2SA 3U8KA 2PH9A 2XQ9A 4BJMA 4CI2B 3R84B 3PUAA 1S94A 3IBPA 3SS1A 5AQIB 4NXNT 2XY8B 5EK2A 2X9HA 2NTYA 4CZZB 1T72A 5L4HA 4HFCA 2I59A 5CGMA 2CLYB 4J2CA 5HEUA 1D1CA 4PJLA 3ZMTB 4JUYA 4YY3T 5JDNA 5LBMA 4FJOA 2JQ9A 2XAHB 1UK5A 3HA4A 3RKGA 4QACA 3QC9A 2WU5A 3H37A 5FKYA 1HR0T 5JR9B 4MHCA 5LHGB 5AQKB 5J5IA 3NVOA 3ZMUB 3SH1A 3KBTA 4BAYB 3AAIA 5A1LA 2AXDS 3B5MA 4NUUA 3SWHA 3QB5K 4U74A 4Z8XA 2FJEA 3NBXX 5EZYE 4UELA 4X66T 3PEOA 4ZK4A 3K3OA 4EAHA 2LSIA 2LOPA 4DV6T 4PW8A 3JC6D 1NWMX 4L0RA 5AQGB 3PV0F 5L3GB 4H63V 3WTNA 3HR0A 4JI6T 2QYWA 5AQMB 5FVLA 2BG9E 2FJDA 2UU9T 2LSYA 3OJAA 3UU6A 4HN9A 1ZEEA 2UXNB 4DBRA 3PUVF 4IDQA 3I9YA 3AE5A 5LJMA 2Q9QA 1X79A 4ILAA 3NZPA 1XZYA 4ISSA 2V5DA 1CUNA 1IBMT 3ANWA 2VQFT 2W4XA 3P7IA 3AE4A 3WTKA 4PNIA 2E2AA 3RF1A 2XPKA 1T8BA 2Y56A 5C3JA 2H7OA 4HWIB 3RYIE 3ZYLA 2W63A 3AEAA 3SRZA 3A8YC 4EIWA 4LF4T 2QC1B 4JLEA 2WM9A 2BZBA 1MNDA 2BKOA 2LHNA 3PDYA 1EZ3A 1YXRA 4UM3S 2ZJVA 4TZ4C 3WTOA 1U5PA 2ZM8A 1WLXA 3UFEA 4JV5T 4IDOA 3QOFA 4B3RT 3TKLB 2A72A 4Z90A 3ZT5A 2H3RA 5LHHB 1YKHB 2W62A 2YEVC 1XMOT 4U33A 2V6YA 3MK7C 2FUPA 3RKOA 4QH1A 5J1GA 2W00A 2ZJUA 4QX7B 2LJLA 2VK9A 3E0ZA 3ZDGA 4GK0E 1MMDA 1U4QA 4P0BA 3HI2A 2X9WA 5AFJA 5JDQA 1OEDA 5JDLA 2W61A 4XK9A 3C84A 2W2UA 4JI4T 1YQ3A 1DU2A 3G06A 4DV7T 1ZHCA 2XAFB 3FZLB 4HFIA 2KXPB 3P4PA 5L4EA 3GN5B 3B57A 4UVCB 1IBKT 1KNZA 2D0TA 3CQGB 1W09A 5H6QB 4IHJE 2IC9A 5BRXA 2WB5A 3QUJA 2A2FX 4I50E 2NW7A 1CHUA 3MA9A 4DV3T 5TAOA 5JMEA 1YW0A 3RPUA 3KV6A 5C8YE 4C90A 4HEAA 3N9MA 3VRAA 5CA1E 3AB3B 4QH4A 1KFYA 2UUCT 2BS4A 2PG8A 2UXBT 2BVLA 2OLTA 4DO0A 5AQUB 4NZBA 2A3DA 1E1HB 2HN2A 3J7Yq 5AQOB 4CXXA 3NKZA 4NIQA 2IC6A 4YTPA 3P4RA 4TN7B 3CK6A 1W0AA 1WYCA 2YK0A 1MIWA 2G0UA 3F31A 2CE7A 4O2BE 4B3ST 4AKRB 2ACZA 3O1HA 3KVBA 4UY2A 3I0OA 3PJAJ 3ESLA 2DI4A 4LF9T 2WN9A 4NXMT 2KT9A 2XNVA 3MXZA 1NEKA 3L3PA 3PU3A 2WDQA 4O4HE 2HPLA 4P0AA 4AI6A 2V7KA 5ABFA 4CN6A 1W0BA 3MKDA 2KWIB 1Z8UA 3RRWA 3N9QA 4OYKA 1M62A 2XHEB 4IL4A 2XUEA 4AFTA 2I0MA 4DV4T 2M6BA 5FY0A 4QWNB 3ZSTA 3F57A 2KINB 4B3MT 2QA7A 5J2TE 2SPCA 1J1JA 2CHOA 4LMJA 1ZV4X 1N33T 3VKHA 2K5BB 1ZP0A 3WAKA 3ZMSB 2FJBA 2ZM0A 3MACA 3CPZA 3RIUA 4IE6A 4IDNA 3T8OA 1VCSA 1VRBA 2Y6XA 4CI1B 2CXDA 4A97A 4Z91A 4YJ3E 5GONE 2DL1A 4IL9A 4HWHA 2C9TA 3GWHA 2E5LT 5BR8T 1HG2A 2X9YA 2LEHA 3I0QA 4LFAT 3UU8A 2Y54A 4U3CA 2L3LA 2WNJA 4L5GA 5LGUB 2NOXA 4V1Av 2JQQA 5JDGA 3A7MA 4HGAA 5JREA 1YKEB 3LBXA 2WDVA 4ZJTA 3ZJ2A 5LHIB 1HNZT 1HS7A 2W66A 2L8KA 4MALA 3EDUA 2E9XC 1XDOA 5HXHA 3GA8A 5DQWA 3RX6A 1Y64B 3CVRA 3FXDB 3WIPA 5HYAA 4F6RC 2YMEA 1IJ6A 3O4XE 4LF8T 4QABA 4KHPT 4LMKA 4PK6A 5JTGA 2F4VT 2IW5B 1L0VA 2I6HA 2V6XA 2BG9A 3H3AA 3KV5A 3QNUA 4OFZA 3ZEFB 4X64T 3U8MA 5J0ZA 3BQLA 4DNDA 2Q9QB 2XAGB 2ACXA 3AEEA 5AFLA 3IHRA 4TNVA 3MZKB 2LSKA 5DQVA 3SIOA 2FJAA 2YN6A 3RH3A 4EB6E 3C79A 4A5XA 1FIOA 3ZYKA 2UXCT 5FXXA 2XZEA 4GYRA 3M3ZB 4GKJT 3WTMA 3C50A 2VASA 4PFOA 4EEDA 3AECA 4WBOA 1IZNB 2XQAA 2KLQA 1NENA 4K0UA 2VKJA 2R6GF 2EHOC 1KEYA 3NRXA 2X0HA 3SQ9A 3VR8A 3UULA 4K0KT 4PJMA 3I9WA 3U3IA 2JJ9A 5FVKA 4ZHQE 1GQEA 2V6YB 3UUXB 5FL0A 4AKIA 3AA7B 3L39A 1LVKA 3AA6B 3S4UA 5IWAT 3PMZA 2B76A 4AFGA 2X0YA 2VVNA 1OEDB 4H9NC 1D0ZA 2J62A 5J5FA
chains in the Genus database with same CATH topology
1OEDE 4TNVA 1UV6A 2Y58A 2Y7YA 4UM3P 3ZDGA 5HEJA 3UU5A 5AFNA 5J5HA 3TLUA 5HCJA 5AFJA 5CO5A 3ZKRA 3UQ4A 4A97A 4ILAA 5IUXA 3GUAA 1OEDA 4HQPA 4WV9A 3SIOA 2BYRA 4X5TA 2W8FA 4Z91A 1UW6A 2PH9A 4UM3A 3C84A 2X00D 2XQ9A 4IL9A 4TWDA 2BYNA 4XK9A 4D01A 3RI5A 2C9TA 2YOEA 2YKSA 2M6IA 3P4WA 2YN6A 3JAFA 2XQ6A 3WTLA 3WTIA 5AINA 2LKHA 2XQ4A 2BJ0A 4DBMA 4UY2A 2XYTA 1OEDC 3EAMA 2BR8A 2LLYA 2X00A 2BYQA 3RHWA 3TLTA 3WTKA 4HFDA 2WN9A 3UU8A 2Y54A 4TWHA 3C79A 5FJVA 5BP0A 3IGQA 5L4HA 2WNJA 2BR7A 4HFIA 2XNVA 2Y56A 4HFCA 4UXUA 2BYPA 3RQUA 5L4EA 4ALXA 2YMDA 5HEUA 4QH5A 4ZR6A 1UX2A 3WTMA 4TNWA 3U8JA 5CFBA 4FRRA 5L47A 4F8HA 2PGZA 3RQWA 3SQ6A 4ZJTA 4BFQA 4QACA 4HFEA 4A98A 4HFBA 3RIAA 2XYSA 1I9BA 2QC1B 3U8NA 4COFA 2XQ3A 4UM1A 2MAWA 3TLSA 4TWFA 4ZZBA 2XQAA 4XHEA 4B5DA 5BRXA 3UQ7A 4HFHA 2BYSA 2XQ5A 5J5IA 5HEGA 4ILBA 5TVCA 2Y57A 3WTJA 2XQ7A 4PIRA 4ILCA 4IL4A 2BG9B 2XZ6A 3SH1A 5AFKA 3WIPA 3UU3A 4AFTA 5LG3A 3UU4A 2XNUA 2M6BA 2YMEA 3SQ9A 4UM3S 5JMEA 2LKGA 5HEHA 4QABA 4LMKA 2ZJVA 3UUBA 4AFHA 3ZDHA 3WTOA 3LSVA 2XZ5A 4LMLA 2KSRA 5AFHA 3TLWA 3U8LA 3PEOA 4ZK4A 4QH4A 5AFMA 2W8GA 2BG9A 3JAEA 3P50A 3JADA 2UZ6A 4LMJA 2WZYA 2XQ8A 5HEOA 4Z90A 4ZZCA 5J5GA 3T4MA 3EI0A 3TLVA 4QAAA 4BQTA 3WTNA 5AFMB 3EHZA 5LXBA 4NPPA 2BG9C 4ZRUA 3PMZA 3U8MA 5J0ZA 4ZJSA 4ZK1A 3WTHA 5BW2A 3RIFA 4AFGA 2XNTA 4EZ1A 5KZUA 2VL0A 2BG9E 4NZBA 5SYOA 5HCMA 1OEDB 2LM2A 2WNLA 5KE4A 5AFLA 5J5FA 3U8KA 4QH1A 3UU6A 2ZJUA 4IREA 2WNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED E;  4TNV A;  1UV6 A;  2Y58 A;  2Y7Y A;  4UM3 P;  3ZDG A;  5HEJ A;  3UU5 A;  5AFN A;  5J5H A;  3TLU A;  5HCJ A;  5AFJ A;  5CO5 A;  3ZKR A;  3UQ4 A;  4A97 A;  4ILA A;  5IUX A;  3GUA A;  1OED A;  4HQP A;  4WV9 A;  3SIO A;  2BYR A;  4X5T A;  2W8F A;  4Z91 A;  1UW6 A;  2PH9 A;  4UM3 A;  3C84 A;  2X00 D;  2XQ9 A;  4IL9 A;  4TWD A;  2BYN A;  4XK9 A;  4D01 A;  3RI5 A;  2C9T A;  2YOE A;  2YKS A;  2M6I A;  3P4W A;  2YN6 A;  3JAF A;  2XQ6 A;  3WTL A;  3WTI A;  5AIN A;  2LKH A;  2XQ4 A;  2BJ0 A;  4DBM A;  4UY2 A;  2XYT A;  1OED C;  3EAM A;  2BR8 A;  2LLY A;  2X00 A;  2BYQ A;  3RHW A;  3TLT A;  3WTK A;  4HFD A;  2WN9 A;  3UU8 A;  2Y54 A;  4TWH A;  3C79 A;  5FJV A;  5BP0 A;  3IGQ A;  5L4H A;  2WNJ A;  2BR7 A;  4HFI A;  2XNV A;  2Y56 A;  4HFC A;  4UXU A;  2BYP A;  3RQU A;  5L4E A;  4ALX A;  2YMD A;  5HEU A;  4QH5 A;  4ZR6 A;  1UX2 A;  3WTM A;  4TNW A;  3U8J A;  5CFB A;  4FRR A;  5L47 A;  4F8H A;  2PGZ A;  3RQW A;  3SQ6 A;  4ZJT A;  4BFQ A;  4QAC A;  4HFE A;  4A98 A;  4HFB A;  3RIA A;  2XYS A;  1I9B A;  2QC1 B;  3U8N A;  4COF A;  2XQ3 A;  4UM1 A;  2MAW A;  3TLS A;  4TWF A;  4ZZB A;  2XQA A;  4XHE A;  4B5D A;  5BRX A;  3UQ7 A;  4HFH A;  2BYS A;  2XQ5 A;  5J5I A;  5HEG A;  4ILB A;  5TVC A;  2Y57 A;  3WTJ A;  2XQ7 A;  4PIR A;  4ILC A;  4IL4 A;  2BG9 B;  2XZ6 A;  3SH1 A;  5AFK A;  3WIP A;  3UU3 A;  4AFT A;  5LG3 A;  3UU4 A;  2XNU A;  2M6B A;  2YME A;  3SQ9 A;  4UM3 S;  5JME A;  2LKG A;  5HEH A;  4QAB A;  4LMK A;  2ZJV A;  3UUB A;  4AFH A;  3ZDH A;  3WTO A;  3LSV A;  2XZ5 A;  4LML A;  2KSR A;  5AFH A;  3TLW A;  3U8L A;  3PEO A;  4ZK4 A;  4QH4 A;  5AFM A;  2W8G A;  2BG9 A;  3JAE A;  3P50 A;  3JAD A;  2UZ6 A;  4LMJ A;  2WZY A;  2XQ8 A;  5HEO A;  4Z90 A;  4ZZC A;  5J5G A;  3T4M A;  3EI0 A;  3TLV A;  4QAA A;  4BQT A;  3WTN A;  5AFM B;  3EHZ A;  5LXB A;  4NPP A;  2BG9 C;  4ZRU A;  3PMZ A;  3U8M A;  5J0Z A;  4ZJS A;  4ZK1 A;  3WTH A;  5BW2 A;  3RIF A;  4AFG A;  2XNT A;  4EZ1 A;  5KZU A;  2VL0 A;  2BG9 E;  4NZB A;  5SYO A;  5HCM A;  1OED B;  2LM2 A;  2WNL A;  5KE4 A;  5AFL A;  5J5F A;  3U8K A;  4QH1 A;  3UU6 A;  2ZJU A;  4IRE A;  2WNC A; 
#chains in the Genus database with same CATH topology
 3CQC B;  3EVY A;  3K1S A;  4UM3 P;  4AQF C;  4DMW A;  5LXT E;  5AFN A;  4EOZ B;  5EK4 A;  4X5T A;  4YHJ A;  5FXV A;  2YOE A;  2YKS A;  2XQ4 A;  3ZC0 A;  3ZT7 A;  3CX6 B;  1G73 A;  3IEE A;  4UVB B;  1QUU A;  4KBM B;  2X0L B;  2J47 A;  4U2Y A;  4X62 T;  4EGW A;  2C5J A;  4QH5 A;  5KMG P;  1QSD A;  2K3W A;  2OA5 A;  2CHN A;  1KNP A;  4G63 A;  4CQI A;  1HF8 A;  3AE8 A;  1MMG A;  3U8N A;  3AEG A;  4UXN B;  4B5D A;  4DV5 T;  3UQ7 A;  4IE5 A;  1Z0P A;  3KIN B;  3RC8 A;  4ILC A;  2WAU A;  4CN1 A;  1VCT A;  3N9L A;  3RRC A;  3V5S A;  5ABE A;  3K8P C;  2IHR 1;  3FXE B;  5FL1 A;  3ZDH A;  2MOZ A;  3ZLI A;  2V26 A;  4KP3 C;  3ONL C;  4LF5 T;  5F5W A;  3U8L A;  1M7K A;  5AFM A;  4CXW A;  1WCR A;  4AQY T;  3OVU A;  2BDE A;  2CA5 A;  1T7S A;  2CPT A;  3VR9 A;  3PUG A;  5KE4 A;  4WNK A;  5LA6 E;  4BA9 A;  4U31 A;  1WR0 A;  2MYS A;  4UV9 B;  4AKG A;  4HE8 A;  4O4L E;  5HCJ A;  1MMN A;  5CO5 A;  3UQ4 A;  2BYR A;  2NR4 A;  2BYN A;  3ETV A;  3VU7 H;  4HWC A;  4U2Z A;  2X66 A;  5AQF B;  2RA1 A;  1D0Y A;  2BYP A;  4O4J E;  2B1E A;  4TNW A;  4YTN A;  5JR9 A;  3P4Q A;  5L3B B;  4AQG A;  1T98 A;  2BBH A;  2YIN A;  3FBL A;  3N9P A;  2XQ3 A;  2N9D A;  2BBJ A;  4JBW F;  2CBJ A;  4IT4 A;  5HXR A;  2BYS A;  3Q5E A;  3CX7 B;  2D9D A;  3FZF B;  4I55 E;  3NWI A;  5LOV E;  2CLY C;  3FZK B;  2V1D B;  5LG3 A;  3B13 A;  2WP9 A;  3HKC E;  4XBF B;  2YDQ A;  3LK3 B;  1I6Z A;  2W67 A;  4LML A;  3E08 A;  5AQT B;  4OK0 A;  5FNV E;  5JR9 C;  3N9O A;  3T1H T;  3RGL A;  2WZY A;  2KZ7 B;  1X9B A;  4LF6 T;  3FHN A;  1BR1 A;  2DWK A;  5AQH B;  4UF0 A;  5LMU T;  4H9O C;  4MFR A;  1W9R A;  5E0O A;  5LG4 A;  3T1Y T;  1SA0 E;  4ASK A;  3FB2 A;  4EEB A;  4QKN A;  2CMR A;  4AIS A;  2X68 A;  1OXZ A;  2Y7Y A;  3P8C D;  3PUS A;  4HWF A;  3OBV E;  4H63 H;  4U7Y A;  2BS2 A;  1UGO A;  5IUX A;  4HQP A;  1YQ4 A;  4UM3 A;  1UW6 A;  4D01 A;  3KBU A;  4QXC B;  3FBZ A;  1WYB A;  3LBX B;  2WZH A;  4MLK A;  3AXJ A;  3AE2 A;  4TWH A;  4TV8 E;  5LJN A;  2LOS A;  2E9X D;  4EZH A;  4XAX B;  3U8J A;  3RQW A;  2VB6 A;  2A9U A;  3PTR B;  5ABH A;  4A98 A;  3RIA A;  1OWA A;  1I9B A;  3DP7 A;  4HFH A;  4GYS A;  5JVD E;  2DWG A;  2Y8D A;  2LT3 A;  3ZCI A;  4ZI2 C;  1ZKE A;  2BG9 B;  4DBQ A;  2V8S V;  3NRY A;  4I0U A;  5JRC A;  3LK4 2;  3PUW F;  5AFH A;  1UCU A;  5AFU L;  4P1N A;  3FZM B;  4LFC T;  3SFE A;  3L8R A;  3R6N A;  4ZZC A;  3SOL A;  5LGN B;  2BS3 A;  1HX8 A;  2ZM2 A;  4M1P A;  2HN1 A;  1FJG T;  3E22 E;  3ZN0 B;  1OED E;  3ZJ1 A;  3C51 A;  2J1D G;  1KF6 A;  4OYJ A;  3TLU A;  5F8P A;  2NTX A;  2PTF A;  1H7C A;  4ZI7 E;  2M6I A;  4H9S E;  4GKK T;  2BVM A;  3AEF A;  2BYQ A;  1WRD A;  4AXP A;  5HAX A;  1JNR A;  2E5V A;  4IIJ E;  2LRL A;  5FJV A;  5BP0 A;  3O9X A;  3QB5 A;  2L9Q A;  4FI5 A;  4ALX A;  5FY7 A;  4ZR6 A;  4ILU A;  4DR4 T;  2EHO D;  1HG5 A;  2XAJ B;  2E9X A;  2CBI A;  3UT5 E;  4EV6 A;  3BQK A;  3F2E A;  4UR9 A;  4YTM A;  4ILB A;  4KX6 A;  2WWV A;  3W15 B;  3J9X 1;  3IF8 B;  1HCI A;  4PFP A;  3U78 A;  5LYJ E;  2LKG A;  4HKA A;  4DMV A;  3C4Z A;  2GK9 A;  4JI0 T;  5JDH A;  3TLW A;  1IAP A;  4IGU A;  5EK3 A;  1ZOY A;  3RYH E;  4Q25 A;  2NWB A;  2XQ8 A;  2KWH A;  4ADZ A;  4GK5 E;  2YU1 A;  3JCF A;  1UUS A;  3HL6 A;  4EZ1 A;  4DR7 T;  2WY2 A;  3PJA A;  2C5K T;  5HCM A;  1US7 B;  4HWD A;  1B7T A;  5AQN B;  2X51 A;  2UUA T;  4CXY A;  2WNC A;  2H88 A;  5HEJ A;  3LFM A;  5BMV E;  2K9A A;  2WMO A;  3C4W A;  4GOU A;  5AQL B;  4WYV A;  4LF7 T;  2ODV A;  3O1J A;  2HHH T;  2XM1 A;  4DBM A;  4X20 E;  3AE9 A;  2BKN A;  3LG7 A;  2E8I A;  3ZSS A;  1MIY A;  3ANW B;  5LCY A;  5L3C B;  2IIU A;  5H6R B;  2AE9 A;  3C4X A;  4YFS A;  4QXB B;  4KUM B;  5AQJ B;  2YU2 A;  3PE0 A;  4DUZ T;  1E7P A;  4HFE A;  2EHO A;  3PUY F;  2MAW A;  4IE7 A;  3TLS A;  4YJ2 E;  5KXJ A;  2WSS V;  5ADX L;  2XQ5 A;  3AAA B;  5JH7 E;  3ZCJ A;  4NUV A;  2XQ7 A;  3AE7 A;  3OYZ A;  2CXL A;  2XZ6 A;  2QVA A;  2WZI A;  3AVS A;  4PJJ A;  5HEH A;  3HKD E;  2XZ5 A;  4EXT A;  2JQK A;  3Q9D A;  5C2T A;  3P50 A;  3JAD A;  4G2A A;  4DR5 T;  4QX8 B;  4X1K E;  3T4M A;  2HPJ A;  3VHL A;  4JYA T;  4EYU A;  2D5U A;  5BW2 A;  3QK6 A;  5LMN T;  4AQF A;  2KMF A;  2LM2 A;  2WNL A;  3CIR A;  4EZ4 A;  5FY1 A;  3AEB A;  2LM9 A;  3GUA A;  4DUY T;  4UEM A;  3UU5 A;  3Q2M A;  4KI0 F;  1FMV A;  4X1I E;  1AJ3 A;  2VKO A;  5HWX A;  4TWD A;  2DHR A;  2MBG A;  1XMQ T;  3WTL A;  5AIN A;  2LKH A;  4DVD A;  5L3D B;  3RHW A;  4I4T E;  1IJ5 A;  2XAS B;  2ZM6 T;  5ETW A;  5KX5 E;  3PUR A;  2Y48 B;  5FXW A;  4O4I E;  4YSZ A;  1XWM A;  5HXC A;  2YMD A;  2NW8 A;  1SHZ C;  2JQH A;  4U72 A;  3C98 B;  4UVA B;  1HNW T;  3SQ6 A;  4BFQ A;  5L3F B;  4IDZ A;  2WQY A;  4YT0 A;  1BR2 A;  4ZZB A;  3DJB A;  1UUR A;  2CXF A;  5FYM A;  3ZMV B;  4PIR A;  2CCQ A;  5AQS B;  4ZS2 A;  4IST A;  3UU4 A;  4QHO A;  2XAQ B;  3CKD A;  5LGT B;  4X65 T;  2XSA A;  4AFH A;  4UF0 B;  4TX5 A;  2CWY A;  4AKL A;  2KSR A;  3V5U A;  3RYF E;  1E2A A;  3WI3 A;  2K24 A;  2XM2 A;  3KFW X;  5HWY A;  2MPK A;  2UXD T;  3EI0 A;  3C64 A;  5IHY A;  1I94 T;  4NPP A;  1XNR T;  5LBQ B;  5JDF A;  4DID B;  2ZLY A;  4H9Q C;  4ZS3 A;  4IDP A;  4ZI3 C;  3AA1 B;  4IRE A;  2RPA A;  4HTE A;  2Y58 A;  1IBL T;  2WDR A;  3CX8 B;  4YSX A;  2WWU A;  2W0G A;  3DTO A;  3AXJ B;  3M65 A;  2IDO B;  4JI1 T;  2WCA A;  4WV9 A;  4O2A E;  3RI5 A;  4U7I A;  1BR0 A;  5HXE A;  2Q9Q C;  2ODU A;  5LB7 B;  4DV0 T;  4UIG A;  4E7Z A;  1SE7 A;  2JMK A;  1XNQ T;  3ZYM A;  3Q5W A;  5L2L A;  1FMW A;  4DV1 T;  2M67 A;  3N9N A;  3I1A A;  2DCF A;  4ZI2 D;  2PGZ A;  2HH7 A;  2XSB A;  4YHH T;  2XYS A;  4A56 A;  3OYX A;  4GIW A;  4P09 A;  4PK5 A;  5ABF B;  4XHE A;  2YDS A;  5JRC B;  2H89 A;  2VKH A;  4LFB T;  1HFA A;  2LSG A;  4XZC A;  3UU3 A;  3CWZ B;  5L3E B;  2N2N A;  2JIW A;  5DJQ C;  3UUB A;  5LNK A;  4JI2 T;  5AQR B;  2W8G A;  5KDM C;  4ZOL E;  2UZ6 A;  2K48 A;  4DR6 T;  2NW9 A;  1LVF A;  4WZX A;  3RIF A;  3UUN A;  2VL8 A;  3LJC A;  2XQY A;  3P4S A;  4JEH B;  5SYO A;  4YXD A;  4ZEY A;  1JNZ A;  1XDP A;  3KV4 A;  4MBQ A;  1HTJ F;  3JC6 C;  3KDS E;  4JI7 T;  3FZH B;  3BQI A;  3N2G E;  2XJ7 A;  4PK4 A;  1KK7 A;  2VVS A;  4TV9 E;  4YLH A;  3KV9 A;  5FP3 A;  2XTL A;  5CJ5 A;  3JAF A;  3WTI A;  1OED C;  5JQG E;  2VWA A;  1D1B A;  2E9X B;  3TLT A;  4DR2 T;  1WR6 A;  4HFD A;  4PJN A;  2QRX A;  3ZN1 B;  3ZMZ B;  4UXU A;  4EYY R;  2JPF A;  1G8X A;  2NP9 A;  2V5C A;  1D0X A;  2D0U A;  5CFB A;  4F8H A;  2IAK A;  2IML A;  4TWF A;  4OX9 T;  2PJQ A;  3NZQ A;  5TVC A;  2ZMA A;  3HKE E;  3X1D A;  4O8S A;  3SFD A;  2H7V C;  3MJX A;  1R8I A;  5CB4 E;  3EDV A;  3LSV A;  1D1A A;  1J5W A;  1UX4 A;  3UTK A;  2KND A;  4ANJ A;  4N78 D;  1KNR A;  5AQQ B;  4B6X A;  2LSJ A;  3TLV A;  5LXB A;  4ZK1 A;  3EAB A;  2PFV A;  2UUB T;  3HKB E;  3ETU A;  2XNT A;  2VL0 A;  4B3T T;  4I43 B;  2JRK A;  3L09 A;  3Q5D A;  2J4G A;  2PBI A;  4TUY E;  2WS3 A;  4H9R C;  2UXX B;  1MNE A;  4AIU A;  4QXH B;  1O3X A;  2X00 D;  5HXS A;  4WBN E;  4CI3 B;  3LDQ B;  3P4W A;  2RP4 A;  2XQ6 A;  5FXZ A;  2XYT A;  3EAM A;  3N5L A;  2BR8 A;  4L9I A;  2QGS A;  3RLF F;  5AQV B;  1SUM B;  2EHO B;  1UX5 A;  2ES0 A;  1FEW A;  3ZC1 A;  1UX2 A;  5L47 A;  3AAE B;  2V7L A;  2WBL A;  4X1Y E;  1S35 A;  1N34 T;  3GN5 A;  3UUM A;  5IYZ E;  3ZT6 A;  4JI8 T;  2JMH A;  3WTJ A;  3OPC A;  3EUH A;  1MIV A;  5AFK A;  2BKP A;  3OTO T;  5CA0 E;  4IE4 A;  2V7J A;  2X9X A;  3CQX C;  3AE1 A;  4H9P C;  3AE6 A;  3JAE A;  3KVA A;  1V9D A;  5J5G A;  4KHZ F;  3EHZ A;  3H3M A;  2IUB A;  4JEU B;  2VKD A;  2P9B A;  4BJN A;  3WTH A;  3PUZ F;  3AED A;  4C91 A;  1BR4 A;  4WW0 A;  1N32 T;  2FBW A;  2LHR A;  4KMC A;  3GMI A;  3Q5X A;  4DR3 T;  1LRZ A;  3N2K E;  4DV2 T;  1YD8 G;  1LKX A;  4JI5 T;  3VKG A;  3IA3 A;  3RC3 A;  3RIU C;  3PU8 A;  2W8F A;  2WMN A;  5KZU A;  5DAB A;  3LK2 B;  1WFD A;  3AE3 A;  2BJ0 A;  4HFV A;  5J2U E;  2LLY A;  2X00 A;  3AVR A;  4ZXL A;  1Y01 A;  2DNX A;  2CWO A;  3UFG A;  4YSY A;  3IGQ A;  3ABV A;  2BR7 A;  2Z6E A;  5LP6 E;  2DLR A;  3K3Q C;  3RQU A;  1HX1 B;  3WAJ A;  3AA0 B;  2V7M A;  5JDM A;  4CN4 A;  4FRR A;  2CRB A;  3K3N A;  1J5E T;  5F3J A;  2V7I A;  4OHF A;  3PUX F;  4IE0 A;  4HFB A;  5ABG A;  4COF A;  4UM1 A;  3D0T A;  3BK9 A;  3CML A;  3ONJ A;  5HEG A;  2YDR A;  2Y57 A;  2VUR A;  1VOM A;  3ZPO A;  2LE8 A;  4ERR A;  2CEA A;  3O1I A;  2XNU A;  3VRB A;  4DR1 T;  2MTQ A;  4PAG A;  2X67 A;  5FMN A;  3N2O A;  2CM0 A;  2C0S A;  4ZI3 D;  3A5X A;  2N1G A;  5HEO A;  2WU2 A;  4QAA A;  4BQT A;  5AFM B;  2BG9 C;  4JI3 T;  4ZRU A;  3ONX A;  4AKH A;  4ZJS A;  2C5I T;  5AQP B;  1NAF A;  1QLB A;  1MMA A;  3PUQ A;  2Q9Q D;  2LRK A;  4E7S A;  1N36 T;  1UV6 A;  5J5H A;  2VQE T;  3OKQ A;  2OV9 A;  5M4Y A;  4UV8 B;  3RYC E;  3ZKR A;  1HNX T;  2D2S A;  3U8K A;  2PH9 A;  2XQ9 A;  4BJM A;  4CI2 B;  3R84 B;  3PUA A;  1S94 A;  3IBP A;  3SS1 A;  5AQI B;  4NXN T;  2XY8 B;  5EK2 A;  2X9H A;  2NTY A;  4CZZ B;  1T72 A;  5L4H A;  4HFC A;  2I59 A;  5CGM A;  2CLY B;  4J2C A;  5HEU A;  1D1C A;  4PJL A;  3ZMT B;  4JUY A;  4YY3 T;  5JDN A;  5LBM A;  4FJO A;  2JQ9 A;  2XAH B;  1UK5 A;  3HA4 A;  3RKG A;  4QAC A;  3QC9 A;  2WU5 A;  3H37 A;  5FKY A;  1HR0 T;  5JR9 B;  4MHC A;  5LHG B;  5AQK B;  5J5I A;  3NVO A;  3ZMU B;  3SH1 A;  3KBT A;  4BAY B;  3AAI A;  5A1L A;  2AXD S;  3B5M A;  4NUU A;  3SWH A;  3QB5 K;  4U74 A;  4Z8X A;  2FJE A;  3NBX X;  5EZY E;  4UEL A;  4X66 T;  3PEO A;  4ZK4 A;  3K3O A;  4EAH A;  2LSI A;  2LOP A;  4DV6 T;  4PW8 A;  3JC6 D;  1NWM X;  4L0R A;  5AQG B;  3PV0 F;  5L3G B;  4H63 V;  3WTN A;  3HR0 A;  4JI6 T;  2QYW A;  5AQM B;  5FVL A;  2BG9 E;  2FJD A;  2UU9 T;  2LSY A;  3OJA A;  3UU6 A;  4HN9 A;  1ZEE A;  2UXN B;  4DBR A;  3PUV F;  4IDQ A;  3I9Y A;  3AE5 A;  5LJM A;  2Q9Q A;  1X79 A;  4ILA A;  3NZP A;  1XZY A;  4ISS A;  2V5D A;  1CUN A;  1IBM T;  3ANW A;  2VQF T;  2W4X A;  3P7I A;  3AE4 A;  3WTK A;  4PNI A;  2E2A A;  3RF1 A;  2XPK A;  1T8B A;  2Y56 A;  5C3J A;  2H7O A;  4HWI B;  3RYI E;  3ZYL A;  2W63 A;  3AEA A;  3SRZ A;  3A8Y C;  4EIW A;  4LF4 T;  2QC1 B;  4JLE A;  2WM9 A;  2BZB A;  1MND A;  2BKO A;  2LHN A;  3PDY A;  1EZ3 A;  1YXR A;  4UM3 S;  2ZJV A;  4TZ4 C;  3WTO A;  1U5P A;  2ZM8 A;  1WLX A;  3UFE A;  4JV5 T;  4IDO A;  3QOF A;  4B3R T;  3TKL B;  2A72 A;  4Z90 A;  3ZT5 A;  2H3R A;  5LHH B;  1YKH B;  2W62 A;  2YEV C;  1XMO T;  4U33 A;  2V6Y A;  3MK7 C;  2FUP A;  3RKO A;  4QH1 A;  5J1G A;  2W00 A;  2ZJU A;  4QX7 B;  2LJL A;  2VK9 A;  3E0Z A;  3ZDG A;  4GK0 E;  1MMD A;  1U4Q A;  4P0B A;  3HI2 A;  2X9W A;  5AFJ A;  5JDQ A;  1OED A;  5JDL A;  2W61 A;  4XK9 A;  3C84 A;  2W2U A;  4JI4 T;  1YQ3 A;  1DU2 A;  3G06 A;  4DV7 T;  1ZHC A;  2XAF B;  3FZL B;  4HFI A;  2KXP B;  3P4P A;  5L4E A;  3GN5 B;  3B57 A;  4UVC B;  1IBK T;  1KNZ A;  2D0T A;  3CQG B;  1W09 A;  5H6Q B;  4IHJ E;  2IC9 A;  5BRX A;  2WB5 A;  3QUJ A;  2A2F X;  4I50 E;  2NW7 A;  1CHU A;  3MA9 A;  4DV3 T;  5TAO A;  5JME A;  1YW0 A;  3RPU A;  3KV6 A;  5C8Y E;  4C90 A;  4HEA A;  3N9M A;  3VRA A;  5CA1 E;  3AB3 B;  4QH4 A;  1KFY A;  2UUC T;  2BS4 A;  2PG8 A;  2UXB T;  2BVL A;  2OLT A;  4DO0 A;  5AQU B;  4NZB A;  2A3D A;  1E1H B;  2HN2 A;  3J7Y q;  5AQO B;  4CXX A;  3NKZ A;  4NIQ A;  2IC6 A;  4YTP A;  3P4R A;  4TN7 B;  3CK6 A;  1W0A A;  1WYC A;  2YK0 A;  1MIW A;  2G0U A;  3F31 A;  2CE7 A;  4O2B E;  4B3S T;  4AKR B;  2ACZ A;  3O1H A;  3KVB A;  4UY2 A;  3I0O A;  3PJA J;  3ESL A;  2DI4 A;  4LF9 T;  2WN9 A;  4NXM T;  2KT9 A;  2XNV A;  3MXZ A;  1NEK A;  3L3P A;  3PU3 A;  2WDQ A;  4O4H E;  2HPL A;  4P0A A;  4AI6 A;  2V7K A;  5ABF A;  4CN6 A;  1W0B A;  3MKD A;  2KWI B;  1Z8U A;  3RRW A;  3N9Q A;  4OYK A;  1M62 A;  2XHE B;  4IL4 A;  2XUE A;  4AFT A;  2I0M A;  4DV4 T;  2M6B A;  5FY0 A;  4QWN B;  3ZST A;  3F57 A;  2KIN B;  4B3M T;  2QA7 A;  5J2T E;  2SPC A;  1J1J A;  2CHO A;  4LMJ A;  1ZV4 X;  1N33 T;  3VKH A;  2K5B B;  1ZP0 A;  3WAK A;  3ZMS B;  2FJB A;  2ZM0 A;  3MAC A;  3CPZ A;  3RIU A;  4IE6 A;  4IDN A;  3T8O A;  1VCS A;  1VRB A;  2Y6X A;  4CI1 B;  2CXD A;  4A97 A;  4Z91 A;  4YJ3 E;  5GON E;  2DL1 A;  4IL9 A;  4HWH A;  2C9T A;  3GWH A;  2E5L T;  5BR8 T;  1HG2 A;  2X9Y A;  2LEH A;  3I0Q A;  4LFA T;  3UU8 A;  2Y54 A;  4U3C A;  2L3L A;  2WNJ A;  4L5G A;  5LGU B;  2NOX A;  4V1A v;  2JQQ A;  5JDG A;  3A7M A;  4HGA A;  5JRE A;  1YKE B;  3LBX A;  2WDV A;  4ZJT A;  3ZJ2 A;  5LHI B;  1HNZ T;  1HS7 A;  2W66 A;  2L8K A;  4MAL A;  3EDU A;  2E9X C;  1XDO A;  5HXH A;  3GA8 A;  5DQW A;  3RX6 A;  1Y64 B;  3CVR A;  3FXD B;  3WIP A;  5HYA A;  4F6R C;  2YME A;  1IJ6 A;  3O4X E;  4LF8 T;  4QAB A;  4KHP T;  4LMK A;  4PK6 A;  5JTG A;  2F4V T;  2IW5 B;  1L0V A;  2I6H A;  2V6X A;  2BG9 A;  3H3A A;  3KV5 A;  3QNU A;  4OFZ A;  3ZEF B;  4X64 T;  3U8M A;  5J0Z A;  3BQL A;  4DND A;  2Q9Q B;  2XAG B;  2ACX A;  3AEE A;  5AFL A;  3IHR A;  4TNV A;  3MZK B;  2LSK A;  5DQV A;  3SIO A;  2FJA A;  2YN6 A;  3RH3 A;  4EB6 E;  3C79 A;  4A5X A;  1FIO A;  3ZYK A;  2UXC T;  5FXX A;  2XZE A;  4GYR A;  3M3Z B;  4GKJ T;  3WTM A;  3C50 A;  2VAS A;  4PFO A;  4EED A;  3AEC A;  4WBO A;  1IZN B;  2XQA A;  2KLQ A;  1NEN A;  4K0U A;  2VKJ A;  2R6G F;  2EHO C;  1KEY A;  3NRX A;  2X0H A;  3SQ9 A;  3VR8 A;  3UUL A;  4K0K T;  4PJM A;  3I9W A;  3U3I A;  2JJ9 A;  5FVK A;  4ZHQ E;  1GQE A;  2V6Y B;  3UUX B;  5FL0 A;  4AKI A;  3AA7 B;  3L39 A;  1LVK A;  3AA6 B;  3S4U A;  5IWA T;  3PMZ A;  2B76 A;  4AFG A;  2X0Y A;  2VVN A;  1OED B;  4H9N C;  1D0Z A;  2J62 A;  5J5F A; 
#chains in the Genus database with same CATH homology
 1OED E;  4TNV A;  1UV6 A;  2Y58 A;  2Y7Y A;  4UM3 P;  3ZDG A;  5HEJ A;  3UU5 A;  5AFN A;  5J5H A;  3TLU A;  5HCJ A;  5AFJ A;  5CO5 A;  3ZKR A;  3UQ4 A;  4A97 A;  4ILA A;  5IUX A;  3GUA A;  1OED A;  4HQP A;  4WV9 A;  3SIO A;  2BYR A;  4X5T A;  2W8F A;  4Z91 A;  1UW6 A;  2PH9 A;  4UM3 A;  3C84 A;  2X00 D;  2XQ9 A;  4IL9 A;  4TWD A;  2BYN A;  4XK9 A;  4D01 A;  3RI5 A;  2C9T A;  2YOE A;  2YKS A;  2M6I A;  3P4W A;  2YN6 A;  3JAF A;  2XQ6 A;  3WTL A;  3WTI A;  5AIN A;  2LKH A;  2XQ4 A;  2BJ0 A;  4DBM A;  4UY2 A;  2XYT A;  1OED C;  3EAM A;  2BR8 A;  2LLY A;  2X00 A;  2BYQ A;  3RHW A;  3TLT A;  3WTK A;  4HFD A;  2WN9 A;  3UU8 A;  2Y54 A;  4TWH A;  3C79 A;  5FJV A;  5BP0 A;  3IGQ A;  5L4H A;  2WNJ A;  2BR7 A;  4HFI A;  2XNV A;  2Y56 A;  4HFC A;  4UXU A;  2BYP A;  3RQU A;  5L4E A;  4ALX A;  2YMD A;  5HEU A;  4QH5 A;  4ZR6 A;  1UX2 A;  3WTM A;  4TNW A;  3U8J A;  5CFB A;  4FRR A;  5L47 A;  4F8H A;  2PGZ A;  3RQW A;  3SQ6 A;  4ZJT A;  4BFQ A;  4QAC A;  4HFE A;  4A98 A;  4HFB A;  3RIA A;  2XYS A;  1I9B A;  2QC1 B;  3U8N A;  4COF A;  2XQ3 A;  4UM1 A;  2MAW A;  3TLS A;  4TWF A;  4ZZB A;  2XQA A;  4XHE A;  4B5D A;  5BRX A;  3UQ7 A;  4HFH A;  2BYS A;  2XQ5 A;  5J5I A;  5HEG A;  4ILB A;  5TVC A;  2Y57 A;  3WTJ A;  2XQ7 A;  4PIR A;  4ILC A;  4IL4 A;  2BG9 B;  2XZ6 A;  3SH1 A;  5AFK A;  3WIP A;  3UU3 A;  4AFT A;  5LG3 A;  3UU4 A;  2XNU A;  2M6B A;  2YME A;  3SQ9 A;  4UM3 S;  5JME A;  2LKG A;  5HEH A;  4QAB A;  4LMK A;  2ZJV A;  3UUB A;  4AFH A;  3ZDH A;  3WTO A;  3LSV A;  2XZ5 A;  4LML A;  2KSR A;  5AFH A;  3TLW A;  3U8L A;  3PEO A;  4ZK4 A;  4QH4 A;  5AFM A;  2W8G A;  2BG9 A;  3JAE A;  3P50 A;  3JAD A;  2UZ6 A;  4LMJ A;  2WZY A;  2XQ8 A;  5HEO A;  4Z90 A;  4ZZC A;  5J5G A;  3T4M A;  3EI0 A;  3TLV A;  4QAA A;  4BQT A;  3WTN A;  5AFM B;  3EHZ A;  5LXB A;  4NPP A;  2BG9 C;  4ZRU A;  3PMZ A;  3U8M A;  5J0Z A;  4ZJS A;  4ZK1 A;  3WTH A;  5BW2 A;  3RIF A;  4AFG A;  2XNT A;  4EZ1 A;  5KZU A;  2VL0 A;  2BG9 E;  4NZB A;  5SYO A;  5HCM A;  1OED B;  2LM2 A;  2WNL A;  5KE4 A;  5AFL A;  5J5F A;  3U8K A;  4QH1 A;  3UU6 A;  2ZJU A;  4IRE A;  2WNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...