3UU8A

The glic pentameric ligand-gated ion channel loop2-24' mutant reduced in solution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu8A01
1OEDA 5L4HA 4Z90A 4ILCA 2WNCA 4D01A 4UY2A 3TLSA 2W8FA 4HFEA 4XHEA 4ZRUA 4ZJTA 4TWFA 2YKSA 3EHZA 2Y58A 2XZ6A 5J5HA 2BYRA 2UZ6A 2PGZA 4QABA 2LKHA 4IL4A 3TLVA 2BG9A 2W8GA 4X5TA 4UXUA 3UU3A 2XYTA 5LG3A 3JAFA 2XQ6A 3ZDHA 4PIRA 3UQ4A 1I9BA 4TNWA 4A97A 2LKGA 2XZ5A 4LMLA 3P4WA 4ZZCA 5J5FA 5HEOA 4AFTA 4BQTA 2KSRA 2PH9A 3U8MA 3JAEA 1OEDE 2XQ5A 3PEOA 4IREA 4ILAA 4LMKA 2BYPA 2BYSA 3WTKA 2YN6A 4ALXA 2ZJUA 3SIOA 2XQ7A 3UQ7A 4ILBA 3SH1A 2BYNA 3WTOA 3ZDGA 3PMZA 5HCMA 2BG9E 4UM3S 3UU8A 3UU4A 2M6IA 5AFHA 4TWHA 5AFLA 4ZR6A 3T4MA 4ZK4A 5FJVA 3IGQA 3GUAA 5AFKA 3U8KA 4NPPA 5IUXA 5JMEA 3RQWA 5TVCA 3TLTA 5CO5A 5LXBA 2MAWA 3RHWA 3WTMA 5CFBA 2X00A 4IL9A 5L4EA 2C9TA 4TWDA 4HFDA 4EZ1A 2XQAA 5HCJA 3WTNA 3WTLA 2Y56A 2YMDA 5HEUA 1UX2A 2WNLA 4HFBA 3U8JA 2XNVA 2Y57A 2Y54A 3UU6A 3WIPA 3LSVA 4COFA 4AFHA 3TLWA 5AFJA 4NZBA 5AFMB 4UM1A 2XNUA 2LM2A 3SQ9A 2LLYA 4QACA 3EI0A 4ZJSA 3UUBA 3ZKRA 4HFHA 3TLUA 1OEDC 2BYQA 1UW6A 3WTHA 4QH4A 3UU5A 4HFCA 2BR8A 4BFQA 4QH5A 3WTJA 2Y7YA 3RIAA 5KZUA 4LMJA 1OEDB 4TNVA 2BG9C 2X00D 5AINA 2XQ8A 2YMEA 2XQ4A 4ZZBA 2ZJVA 3WTIA 5HEJA 4UM3A 2YOEA 5BRXA 2XNTA 3SQ6A 5J0ZA 3RI5A 2WNJA 4QH1A 3C79A 2BJ0A 4XK9A 5SYOA 3U8LA 4Z91A 5L47A 2M6BA 3P50A 2WN9A 4DBMA 5J5GA 5KE4A 5HEHA 3RQUA 4FRRA 4HFIA 4F8HA 4HQPA 3C84A 5AFNA 4A98A 2BR7A 4AFGA 3RIFA 2XQ9A 5AFMA 4QAAA 5HEGA 5BP0A 4ZK1A 2XYSA 3JADA 2WZYA 2QC1B 3EAMA 5J5IA 5BW2A 1UV6A 3U8NA 4B5DA 4WV9A 2VL0A 4UM3P 2XQ3A 2BG9B
chains in the Genus database with same CATH superfamily
3PV0F 3PDYA 4TWFA 5HAXA 2WSSV 4X5TA 5AQTB 4DR6T 3RGLA 4QX8B 4CXXA 2E8IA 5AQRB 4CI1B 3O1IA 4U74A 3WTKA 2HHHT 2YN6A 5JR9C 4CXYA 3PUXF 4KHPT 2A2FX 5AFLA 2WM9A 2C5JA 4TZ4C 3GWHA 4U7IA 3EUHA 3B5MA 5JDLA 1FMWA 5AQLB 2Y56A 5CA0E 4DNDA 3VU7H 1QSDA 3PUWF 2EHOD 3JCFA 3UFGA 3HKDE 2QYWA 2LSIA 3LBXB 3FXEB 3ZCIA 3IHRA 3AAEB 3ZT6A 3LBXA 1CUNA 1YKHB 2CHOA 2CBIA 4ILUA 4EEBA 3WAJA 4PJJA 5J2TE 2BDEA 2LEHA 4ZI3D 1MMNA 2XQ9A 2BKPA 2JQ9A 4BA9A 4ZK1A 3PJAA 4DR1T 5BW2A 2XTLA 2RPAA 3ZN1B 4FI5A 3ZC0A 3P4QA 2W8FA 2HPLA 3N5LA 4X1YE 5JH7E 2UUCT 4IE6A 3TLVA 4UXUA 1JNZA 2EHOB 4PFPA 4LMLA 5JRCB 3QB5K 4OFZA 2EHOA 3M3ZB 3AE9A 4ILBA 2DHRA 3ZYLA 5AFHA 2BS3A 5L3BB 5CFBA 3N2OA 4EZHA 1HCIA 2XQAA 4AXPA 3L8RA 4AQFA 2LHRA 3F2EA 3JC6C 3AA7B 4UM1A 2XNUA 1WLXA 2XJ7A 2BYQA 4NIQA 3QC9A 2W4XA 4HFVA 5KZUA 1Y64B 3ONXA 1HX1B 2DI4A 2IUBA 1WRDA 2CM0A 2UXBT 1ZEEA 2ES0A 1XMOT 2D5UA 2VVNA 2NWBA 4PK6A 3P50A 3I0OA 3BQIA 4FRRA 3NZPA 1I6ZA 5EZYE 4KHZF 5JQGE 2ZM2A 3JADA 3RH3A 1FEWA 4DR7T 2QRXA 1NWMX 2K48A 3KV5A 2KNDA 3NWIA 2A9UA 1EZ3A 3TLSA 2OA5A 2YKSA 3N9LA 3Q5DA 3EABA 2L3LA 3MA9A 2KXPB 3AEGA 3K3NA 4AQYT 1YD8G 3AXJB 5EK4A 1G73A 4C91A 3KV6A 1FMVA 3CK6A 3OTOT 2V7JA 1BR1A 3BK9A 3M65A 2FBWA 2VVSA 4JI5T 3FZFB 2W66A 4B3RT 1IAPA 2E9XD 4AIUA 3MZKB 4AKHA 3U8JA 3L09A 5FNVE 4DR5T 3LK2B 3ZN0B 4NZBA 2W63A 2CWYA 1R8IA 4HFHA 2Q9QD 4I55E 4YJ3E 4H9QC 4KBMB 5KXJA 3ZMVB 2SPCA 2C0SA 2D0UA 1E7PA 4UF0B 5HXEA 1LRZA 3E08A 2YMEA 1YQ3A 3ESLA 4ERRA 4UM3A 3PURA 2WWVA 1KNZA 5LHGB 3CVRA 4YSYA 3SS1A 3RQUA 3V5UA 4HQPA 1KNRA 5AFMA 2XASB 4EV6A 3PU8A 3G06A 4YXDA 3U8NA 3AEEA 4AQFC 2CEAA 5JDNA 5LMNT 5FXXA 3CX6B 4YSXA 5L3FB 1YQ4A 1D1CA 3UU3A 4HTEA 2Y6XA 2E9XA 3RYIE 1OEDE 4MHCA 4YTNA 4LF8T 2HN1A 3ZSSA 2Q9QA 4IDQA 5DQWA 2NW9A 4GKKT 5FYMA 5HXCA 5F3JA 1S35A 2W00A 3GUAA 5AFKA 3RHWA 3WTMA 5CGMA 5LJNA 2BKOA 1WYBA 1WR6A 2J47A 3FB2A 2DNXA 4PNIA 2BBJA 3WTNA 3WTLA 2WU5A 2L8KA 3EDUA 1HR0T 2J4GA 4ISTA 2RP4A 4TN7B 5KDMC 4O4IE 5FVKA 3CX7B 2XSBA 4DV1T 5DQVA 3ZLIA 4LF6T 4F6RC 3C79A 4ZXLA 4YTPA 4X62T 3ZYMA 3U8LA 4EB6E 3H37A 5C2TA 4O2BE 1HS7A 2X9HA 4IDZA 3ZYKA 2W0GA 2V1DB 2L9QA 4E7SA 2XYSA 3OYZA 4PJMA 5LOVE 4O4JE 5L4HA 1N32T 2ZM8A 2XZ6A 1N36T 5IYZE 1XWMA 2W8GA 3Q2MA 3ANWB 1AJ3A 4KI0F 4AFTA 1LVKA 2BYPA 2BYSA 4TUYE 3ZMTB 2HN2A 3ANWA 3CX8B 3FBZA 3UUMA 2FJEA 2LOPA 2IAKA 3SH1A 4YHHT 5HCMA 4AISA 3C64A 4U2YA 2C5IT 5FJVA 3R6NA 5L3GB 2V7LA 3DJBA 2XNVA 3F57A 2YU2A 2JMHA 4U3CA 1D1BA 1XNQT 4ISSA 3K1SA 2ZMAA 3CPZA 3AA1B 4CI3B 2MPKA 3ZT7A 1W0AA 2LJLA 3DTOA 4WBNE 2E9XC 3WTIA 4NXMT 3HL6A 1CHUA 5DJQC 5BRXA 2OLTA 4B6XA 2Q9QC 2LSYA 3C84A 4EXTA 5AFNA 4DV0T 5J2UE 5AQJB 1UX4A 4NUUA 2WZYA 4X1KE 3UTKA 2QC1B 5J5IA 1KFYA 2NW7A 2XQ3A 3AE1A 5E0OA 1OEDA 2J62A 1HG5A 4XHEA 4ZRUA 2PTFA 3GMIA 4GYRA 3N2KE 2WCAA 4QABA 1W09A 5JDHA 4PIRA 2VQFT 3N9NA 1XDOA 1MIVA 2XQ5A 4KX6A 2UXDT 2W2UA 3SIOA 4GK0E 2XQ7A 4DMVA 1LKXA 2ODUA 3VRBA 5CJ5A 2Z6EA 3Q9DA 5JTGA 3PUAA 1NENA 3SOLA 2N2NA 2H88A 3ETVA 4H63H 4P09A 5CA1E 4TWDA 1E1HB 3I9WA 4JEHB 2XPKA 1HX8A 4JUYA 3TLWA 5AFJA 3IA3A 2LM2A 1UURA 1MNEA 2LLYA 4IE0A 3ZKRA 4BFQA 5FL1A 3ZT5A 3I0QA 4ZI7E 4HE8A 2IW5B 5A1LA 2YOEA 2CXFA 4YFSA 2WZIA 4PK4A 2WN9A 2M6BA 4X64T 5J5GA 4ZI2D 1W0BA 1XMQT 1T98A 3RYCE 3MXZA 4UVBB 5ETWA 1U5PA 2VKDA 4X65T 2VL0A 4JBWF 3P4RA 3AECA 3ZMSB 4BJMA 4Z90A 2WNCA 2VASA 4ZJTA 5IHYA 2YDRA 4H9NC 3KV9A 5L3CB 1I9BA 4LFBT 3VR9A 2F4VT 4HN9A 2KSRA 3Q5EA 1SA0E 3AVRA 2KZ7B 3SFEA 5LP6E 3UQ7A 4I0UA 2NOXA 5BMVE 5FXVA 4CQIA 3RYFE 4CN1A 5EK2A 2N9DA 2BKNA 2BS2A 3FBLA 5TVCA 2CBJA 4MLKA 4UVAB 4XZCA 1J1JA 2IHR1 5LXTE 3AAIA 4DV6T 4HFBA 5AQSB 4OK0A 3AB3B 5FKYA 5JRCA 4JI6T 1OEDC 2YK0A 1HNZT 1BR4A 3UU5A 4J2CA 4E7ZA 3RIAA 2LE8A 3T1YT 3AE8A 4CZZB 4HKAA 2V6XA 4DMWA 5AQHB 3QK6A 1D0ZA 1ZOYA 2MBGA 2KT9A 3N9QA 3AE7A 4DBMA 3W15B 5KE4A 4B3MT 2KWIB 2MOZA 3B57A 4DUZT 2W61A 2I59A 1D0YA 2FJDA 5H6RB 1ZV4X 4ZOLE 2K24A 2V6YB 2WAUA 1I94T 3AAAB 5J5HA 4A56A 2LKHA 2CLYB 2XYTA 1UX5A 3IEEA 3LK3B 3ZPOA 2ZM6T 3U8MA 3LG7A 2MYSA 4G63A 3MKDA 3UU8A 2PBIA 5KX5E 4ZR6A 4L0RA 3FZLB 3A8YC 4JI2T 5FXZA 2WB5A 4EZ1A 2XAJB 2YMDA 4MBQA 1XDPA 2XM2A 2JPFA 3O1JA 5BR8T 4IGUA 3AXJA 2E2AA 4CXWA 2XQYA 4FJOA 4EYUA 3L3PA 5J1GA 2P9BA 5AINA 5FY1A 1W9RA 2E5VA 3K3QC 2LT3A 1WFDA 1J5WA 2V8SV 2K3WA 2CMRA 3PUQA 2KLQA 4O4HE 5HYAA 2X9WA 3PTRB 1MIWA 3CKDA 4UEMA 2XSAA 4UM3P 3O4XE 4ILCA 4X1IE 4UF0A 4G2AA 2EHOC 4QX7B 5HWYA 4IL4A 4C90A 4ZI2C 4DVDA 3RIUA 4IT4A 4P0BA 3ETUA 3RC8A 3O1HA 3P4WA 2BVMA 4A5XA 5LMUT 4NUVA 3UU4A 4X20E 3K8PC 4BAYB 5AQMB 2WBLA 3AE6A 3IGQA 5LXBA 2H89A 4GOUA 4ZI3C 4IL9A 5AQKB 3UFEA 5L4EA 5DABA 5HXRA 4H9RC 4DR2T 3AEFA 3IBPA 1T72A 1S94A 2H7VC 1T7SA 4JI4T 3CQCB 1M62A 2LHNA 1BR2A 2BR8A 3FXDB 2D0TA 1VRBA 4WZXA 4IE7A 4EGWA 5ABEA 1WR0A 5F5WA 1VCSA 1ZKEA 4P0AA 2VK9A 3BQKA 3BQLA 1O3XA 1L0VA 1HG2A 3OJAA 1V9DA 2JRKA 2NTXA 2LSKA 5LG4A 5HEHA 3ZJ2A 5EK3A 4N78D 4A98A 4AFGA 4ANJA 2H3RA 2WDVA 4B5DA 5LGUB 4XAXB 3U78A 4KUMB 1MMDA 3C98B 2ZM0A 2XAGB 3RLFF 3N2GE 2X0LB 4L5GA 2BYRA 1U4QA 3RKOA 4B3TT 2WWUA 5LG3A 2CRBA 4JYAT 4TNWA 2UUAT 2D2SA 4ILAA 3Q5XA 2CCQA 4BJNA 1X79A 1SHZC 3AEBA 4B3ST 4TV8E 3A5XA 5JR9B 4AKGA 1Z0PA 2KWHA 5LCYA 2UU9T 3U8KA 3KBTA 5CO5A 4DV3T 2B76A 2NR4A 5HCJA 1GQEA 1IBKT 3LSVA 3A7MA 3VKGA 4COFA 2XM1A 4YJ2E 3CQGB 2XAHB 2LSJA 2X67A 3EI0A 5LGTB 2VKJA 4I50E 2NTYA 4LMJA 1HNWT 1VCTA 2XAFB 4IE5A 2QVAA 2UXCT 3RIUC 1QLBA 2XQ8A 2XQ4A 2WU2A 5LGNB 5FP3A 5J0ZA 2WNJA 1YKEB 4EYYR 3ZCJA 1B7TA 4DIDB 5C3JA 4Z91A 3NZQA 2XHEB 4CN6A 4HFIA 2YDQA 4IDPA 3RKGA 3AE3A 4I43B 2GK9A 2M67A 3AA0B 3HKCE 2RA1A 1N33T 3PUZF 3PE0A 3CMLA 3RRWA 4NXNT 3EHZA 2V7IA 4UV9B 4H63V 2YU1A 4AKIA 4UVCB 2YDSA 1H7CA 2V7MA 2R6GF 4JI3T 1HF8A 2PJQA 2WDQA 3B13A 2UXXB 3FZKB 3Q5WA 4ALXA 5L3EB 1FIOA 5AQIB 4U72A 3ZSTA 3ZDGA 3HI2A 3VKHA 4PJNA 5LB7B 2CPTA 3K3OA 4JLEA 5GONE 5IUXA 4HEAA 1J5ET 5TAOA 2WQYA 4AKRB 4AI6A 2NP9A 4QXCB 1OWAA 2VKHA 4I4TE 5LJMA 4ZEYA 4WBOA 2WNLA 3EVYA 4YT0A 2WMOA 3O9XA 2CXLA 3SQ9A 4QACA 2A72A 4LF7T 1ZP0A 2IDOB 4LFAT 1HNXT 4YLHA 4QH5A 3WTJA 4MALA 4OYJA 3N9PA 4ADZA 3PJAJ 5KMGP 2ZJVA 1QUUA 4TX5A 4IHJE 3RYHE 3LFMA 4UR9A 3SQ6A 2BJ0A 4OHFA 5SYOA 5AFUL 5LYJE 3ABVA 3RIFA 4IDNA 1HTJF 2WZHA 4WW0A 3KVBA 1UV6A 2X9YA 3PMZA 4JEUB 4ZS2A 4DO0A 3FZMB 5L2LA 4V1Av 2W62A 3AVSA 4HWHA 3JAFA 1LVFA 4P1NA 5JREA 1MMGA 2LKGA 2NW8A 4X66T 2ACXA 1UK5A 2V5DA 5HEOA 3SWHA 5AQGB 4PFOA 3HR0A 3J7Yq 4OYKA 2BG9E 2X0HA 4KMCA 3TKLB 3S4UA 2BZBA 4M1PA 2I0MA 1KF6A 1G8XA 2DWGA 4PJLA 2C9TA 5HEUA 2Y54A 3PUGA 1ZHCA 3UU6A 3PUYF 2H7OA 4TV9E 5F8PA 2VL8A 3FZHB 4GIWA 2A3DA 2JQKA 4U2ZA 4JI8T 1BR0A 4WNKA 4CI2B 2X68A 3WAKA 1YXRA 4JI0T 3OBVE 2LM9A 4DR4T 2WS3A 4HWCA 5JDFA 4LF4T 3QUJA 4F8HA 5FY7A 1KEYA 4UV8B 4Q25A 3C4WA 2IMLA 3NBXX 4PK5A 4IIJE 3FHNA 1D0XA 2VKOA 3P8CD 4LFCT 4UY2A 1MNDA 4HFEA 5FVLA 4QXHB 2X0YA 3KDSE 3LDQB 2N1GA 3L39A 2PGZA 2C5KT 1WYCA 3HKBE 4ZS3A 5AQQB 2XZ5A 5J5FA 2CHNA 4DR3T 4PAGA 4DV5T 3CIRA 3P4PA 3P4SA 4EZ4A 2BYNA 2YINA 3WTOA 2AE9A 2CXDA 3ONJA 2M6IA 3QOFA 5IWAT 3PUSA 4H9OC 3KFWX 3TLTA 2V6YA 4HFDA 1E2AA 3RF1A 5ABGA 2ACZA 4EOZB 2ODVA 2X51A 4AFHA 5HWXA 1NAFA 3UUBA 4Z8XA 2Y48B 2VWAA 3WTHA 5LBMA 4K0UA 2KINB 4JI7T 4TNVA 1IJ5A 3ZJ1A 3AE2A 2LRLA 2DLRA 1VOMA 2JQQA 3ZMZB 5JDGA 2J1DG 2AXDS 2QA7A 2I6HA 5LA6E 3CWZB 2QGSA 1KK7A 1D1AA 5JDMA 2WY2A 5L47A 4H9SE 4ZHQE 2IIUA 4QKNA 5L3DB 4KP3C 2BBHA 3HKEE 4QAAA 5BP0A 2UUBT 4L9IA 5AQNB 1MMAA 2BG9B 2WP9A 3AE4A 1XZYA 4O8SA 3F31A 2Y58A 3J9X1 2UZ6A 2ZLYA 2BG9A 2HPJA 3UQ4A 2XAQB 4A97A 2JIWA 3ZC1A 3LK42 1WCRA 2IC9A 5FY0A 4WYVA 4ZZCA 2PH9A 3JAEA 3H3MA 3PEOA 1IZNB 1Y01A 1M7KA 4GYSA 4LF9T 3CQXC 3QB5A 5FMNA 2DWKA 4K0KT 3T4MA 3GA8A 4IE4A 5JMEA 1KNPA 4HWFA 1UGOA 1IBMT 3DP7A 2Y57A 2BVLA 1N34T 4OX9T 3WIPA 1Z8UA 5AFMB 4UIGA 3OYXA 2Y8DA 2E5LT 3NVOA 4ZJSA 3TLUA 3OPCA 4U33A 3N9MA 3OVUA 3UT5E 3C4XA 2Y7YA 2DL1A 3I9YA 3X1DA 2PG8A 5ADXL 4LF5T 3OKQA 5FL0A 2VQET 1NEKA 1US7B 2CA5A 4QH1A 2E9XB 4DBRA 1FJGT 3ONLC 3MK7C 4ASKA 1SUMB 4XBFB 3T1HT 4GKJT 2Q9QB 3E22E 4YY3T 2VURA 4EIWA 4DUYT 3AEAA 5LHIB 4WV9A 2X66A 4O4LE 2CLYC 2FJAA 4YSZA 1UCUA 2OV9A 3D0TA 2FJBA 5AQUB 2HH7A 4AKLA 3C4ZA 2XQ6A 1UUSA 4BQTA 4HWDA 3AA6B 3P7IA 4IREA 4LMKA 2JMKA 4DBQA 3I1AA 3SRZA 1SE7A 3WI3A 4DV7T 2K5BB 1T8BA 2LOSA 3KVAA 3C51A 2K9AA 4TWHA 5ABHA 3UULA 3HA4A 3RQWA 2MAWA 3GN5B 2VB6A 2G0UA 2WDRA 3ZEFB 1UX2A 4UELA 3NRXA 4AQGA 1IBLT 3GN5A 3EDVA 4GK5E 2XZEA 3N9OA 3QNUA 4HFCA 3IF8B 2V5CA 5AQPB 5JVDE 3RC3A 2UXNB 3V5SA 4DV4T 2BG9C 1HFAA 4YHJA 2X00D 5JR9A 4CN4A 4QWNB 2W67A 5HEJA 1IJ6A 2V7KA 2IC6A 2CE7A 5LNKA 4H9PC 3PU3A 3NRYA 4XK9A 2CWOA 2WMNA 2BR7A 1XNRT 2XUEA 4U7YA 3VRAA 3SFDA 3AE5A 3VHLA 1JNRA 3RPUA 3R84B 2D9DA 3MACA 4D01A 3KBUA 3T8OA 3RRCA 3ZMUB 5AQOB 1YW0A 5C8YE 5HXHA 4DV2T 4O2AE 3ZDHA 3H3AA 3PUVF 3NKZA 2MTQA 4HWIB 2ZJUA 5LBQB 3JC6D 2B1EA 2KMFA 2YEVC 4UM3S 4IDOA 4ZK4A 4NPPA 3U3IA 1DU2A 2X00A 5JDQA 4EEDA 3KINB 3KV4A 4EAHA 5HXSA 4U31A 2LRKA 4HGAA 2JQHA 2PFVA 5FXWA 4PW8A 3UUNA 2XY8B 2V26A 4YTMA 1MIYA 2FUPA 1UW6A 4QH4A 2X9XA 4JV5T 1OEDB 3E0ZA 5CB4E 3UUXB 5M4YA 4QXBB 4ZZBA 2DCFA 4MFRA 3VR8A 4JI1T 2XNTA 5AQVB 3RI5A 4QHOA 1OXZA 2BS4A 3AEDA 2LSGA 4UXNB 3LJCA 5ABFB 3MJXA 5HEGA 5AQFB 5H6QB 3RX6A 3EAMA 5LHHB 3C50A 2JJ9A 5ABFA 1X9BA
chains in the Genus database with same CATH topology
1OEDA 5L4HA 4Z90A 4ILCA 2WNCA 4D01A 4UY2A 3TLSA 2W8FA 4HFEA 4XHEA 4ZRUA 4ZJTA 4TWFA 2YKSA 3EHZA 2Y58A 2XZ6A 5J5HA 2BYRA 2UZ6A 2PGZA 4QABA 2LKHA 4IL4A 3TLVA 2BG9A 2W8GA 4X5TA 4UXUA 3UU3A 2XYTA 5LG3A 3JAFA 2XQ6A 3ZDHA 4PIRA 3UQ4A 1I9BA 4TNWA 4A97A 2LKGA 2XZ5A 4LMLA 3P4WA 4ZZCA 5J5FA 5HEOA 4AFTA 4BQTA 2KSRA 2PH9A 3U8MA 3JAEA 1OEDE 2XQ5A 3PEOA 4IREA 4ILAA 4LMKA 2BYPA 2BYSA 3WTKA 2YN6A 4ALXA 2ZJUA 3SIOA 2XQ7A 3UQ7A 4ILBA 3SH1A 2BYNA 3WTOA 3ZDGA 3PMZA 5HCMA 2BG9E 4UM3S 3UU8A 3UU4A 2M6IA 5AFHA 4TWHA 5AFLA 4ZR6A 3T4MA 4ZK4A 5FJVA 3IGQA 3GUAA 5AFKA 3U8KA 4NPPA 5IUXA 5JMEA 3RQWA 5TVCA 3TLTA 5CO5A 5LXBA 2MAWA 3RHWA 3WTMA 5CFBA 2X00A 4IL9A 5L4EA 2C9TA 4TWDA 4HFDA 4EZ1A 2XQAA 5HCJA 3WTNA 3WTLA 2Y56A 2YMDA 5HEUA 1UX2A 2WNLA 4HFBA 3U8JA 2XNVA 2Y57A 2Y54A 3UU6A 3WIPA 3LSVA 4COFA 4AFHA 3TLWA 5AFJA 4NZBA 5AFMB 4UM1A 2XNUA 2LM2A 3SQ9A 2LLYA 4QACA 3EI0A 4ZJSA 3UUBA 3ZKRA 4HFHA 3TLUA 1OEDC 2BYQA 1UW6A 3WTHA 4QH4A 3UU5A 4HFCA 2BR8A 4BFQA 4QH5A 3WTJA 2Y7YA 3RIAA 5KZUA 4LMJA 1OEDB 4TNVA 2BG9C 2X00D 5AINA 2XQ8A 2YMEA 2XQ4A 4ZZBA 2ZJVA 3WTIA 5HEJA 4UM3A 2YOEA 5BRXA 2XNTA 3SQ6A 5J0ZA 3RI5A 2WNJA 4QH1A 3C79A 2BJ0A 4XK9A 5SYOA 3U8LA 4Z91A 5L47A 2M6BA 3P50A 2WN9A 4DBMA 5J5GA 5KE4A 5HEHA 3RQUA 4FRRA 4HFIA 4F8HA 4HQPA 3C84A 5AFNA 4A98A 2BR7A 4AFGA 3RIFA 2XQ9A 5AFMA 4QAAA 5HEGA 5BP0A 4ZK1A 2XYSA 3JADA 2WZYA 2QC1B 3EAMA 5J5IA 5BW2A 1UV6A 3U8NA 4B5DA 4WV9A 2VL0A 4UM3P 2XQ3A 2BG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OED A;  5L4H A;  4Z90 A;  4ILC A;  2WNC A;  4D01 A;  4UY2 A;  3TLS A;  2W8F A;  4HFE A;  4XHE A;  4ZRU A;  4ZJT A;  4TWF A;  2YKS A;  3EHZ A;  2Y58 A;  2XZ6 A;  5J5H A;  2BYR A;  2UZ6 A;  2PGZ A;  4QAB A;  2LKH A;  4IL4 A;  3TLV A;  2BG9 A;  2W8G A;  4X5T A;  4UXU A;  3UU3 A;  2XYT A;  5LG3 A;  3JAF A;  2XQ6 A;  3ZDH A;  4PIR A;  3UQ4 A;  1I9B A;  4TNW A;  4A97 A;  2LKG A;  2XZ5 A;  4LML A;  3P4W A;  4ZZC A;  5J5F A;  5HEO A;  4AFT A;  4BQT A;  2KSR A;  2PH9 A;  3U8M A;  3JAE A;  1OED E;  2XQ5 A;  3PEO A;  4IRE A;  4ILA A;  4LMK A;  2BYP A;  2BYS A;  3WTK A;  2YN6 A;  4ALX A;  2ZJU A;  3SIO A;  2XQ7 A;  3UQ7 A;  4ILB A;  3SH1 A;  2BYN A;  3WTO A;  3ZDG A;  3PMZ A;  5HCM A;  2BG9 E;  4UM3 S;  3UU8 A;  3UU4 A;  2M6I A;  5AFH A;  4TWH A;  5AFL A;  4ZR6 A;  3T4M A;  4ZK4 A;  5FJV A;  3IGQ A;  3GUA A;  5AFK A;  3U8K A;  4NPP A;  5IUX A;  5JME A;  3RQW A;  5TVC A;  3TLT A;  5CO5 A;  5LXB A;  2MAW A;  3RHW A;  3WTM A;  5CFB A;  2X00 A;  4IL9 A;  5L4E A;  2C9T A;  4TWD A;  4HFD A;  4EZ1 A;  2XQA A;  5HCJ A;  3WTN A;  3WTL A;  2Y56 A;  2YMD A;  5HEU A;  1UX2 A;  2WNL A;  4HFB A;  3U8J A;  2XNV A;  2Y57 A;  2Y54 A;  3UU6 A;  3WIP A;  3LSV A;  4COF A;  4AFH A;  3TLW A;  5AFJ A;  4NZB A;  5AFM B;  4UM1 A;  2XNU A;  2LM2 A;  3SQ9 A;  2LLY A;  4QAC A;  3EI0 A;  4ZJS A;  3UUB A;  3ZKR A;  4HFH A;  3TLU A;  1OED C;  2BYQ A;  1UW6 A;  3WTH A;  4QH4 A;  3UU5 A;  4HFC A;  2BR8 A;  4BFQ A;  4QH5 A;  3WTJ A;  2Y7Y A;  3RIA A;  5KZU A;  4LMJ A;  1OED B;  4TNV A;  2BG9 C;  2X00 D;  5AIN A;  2XQ8 A;  2YME A;  2XQ4 A;  4ZZB A;  2ZJV A;  3WTI A;  5HEJ A;  4UM3 A;  2YOE A;  5BRX A;  2XNT A;  3SQ6 A;  5J0Z A;  3RI5 A;  2WNJ A;  4QH1 A;  3C79 A;  2BJ0 A;  4XK9 A;  5SYO A;  3U8L A;  4Z91 A;  5L47 A;  2M6B A;  3P50 A;  2WN9 A;  4DBM A;  5J5G A;  5KE4 A;  5HEH A;  3RQU A;  4FRR A;  4HFI A;  4F8H A;  4HQP A;  3C84 A;  5AFN A;  4A98 A;  2BR7 A;  4AFG A;  3RIF A;  2XQ9 A;  5AFM A;  4QAA A;  5HEG A;  5BP0 A;  4ZK1 A;  2XYS A;  3JAD A;  2WZY A;  2QC1 B;  3EAM A;  5J5I A;  5BW2 A;  1UV6 A;  3U8N A;  4B5D A;  4WV9 A;  2VL0 A;  4UM3 P;  2XQ3 A;  2BG9 B; 
#chains in the Genus database with same CATH topology
 3PV0 F;  3PDY A;  4TWF A;  5HAX A;  2WSS V;  4X5T A;  5AQT B;  4DR6 T;  3RGL A;  4QX8 B;  4CXX A;  2E8I A;  5AQR B;  4CI1 B;  3O1I A;  4U74 A;  3WTK A;  2HHH T;  2YN6 A;  5JR9 C;  4CXY A;  3PUX F;  4KHP T;  2A2F X;  5AFL A;  2WM9 A;  2C5J A;  4TZ4 C;  3GWH A;  4U7I A;  3EUH A;  3B5M A;  5JDL A;  1FMW A;  5AQL B;  2Y56 A;  5CA0 E;  4DND A;  3VU7 H;  1QSD A;  3PUW F;  2EHO D;  3JCF A;  3UFG A;  3HKD E;  2QYW A;  2LSI A;  3LBX B;  3FXE B;  3ZCI A;  3IHR A;  3AAE B;  3ZT6 A;  3LBX A;  1CUN A;  1YKH B;  2CHO A;  2CBI A;  4ILU A;  4EEB A;  3WAJ A;  4PJJ A;  5J2T E;  2BDE A;  2LEH A;  4ZI3 D;  1MMN A;  2XQ9 A;  2BKP A;  2JQ9 A;  4BA9 A;  4ZK1 A;  3PJA A;  4DR1 T;  5BW2 A;  2XTL A;  2RPA A;  3ZN1 B;  4FI5 A;  3ZC0 A;  3P4Q A;  2W8F A;  2HPL A;  3N5L A;  4X1Y E;  5JH7 E;  2UUC T;  4IE6 A;  3TLV A;  4UXU A;  1JNZ A;  2EHO B;  4PFP A;  4LML A;  5JRC B;  3QB5 K;  4OFZ A;  2EHO A;  3M3Z B;  3AE9 A;  4ILB A;  2DHR A;  3ZYL A;  5AFH A;  2BS3 A;  5L3B B;  5CFB A;  3N2O A;  4EZH A;  1HCI A;  2XQA A;  4AXP A;  3L8R A;  4AQF A;  2LHR A;  3F2E A;  3JC6 C;  3AA7 B;  4UM1 A;  2XNU A;  1WLX A;  2XJ7 A;  2BYQ A;  4NIQ A;  3QC9 A;  2W4X A;  4HFV A;  5KZU A;  1Y64 B;  3ONX A;  1HX1 B;  2DI4 A;  2IUB A;  1WRD A;  2CM0 A;  2UXB T;  1ZEE A;  2ES0 A;  1XMO T;  2D5U A;  2VVN A;  2NWB A;  4PK6 A;  3P50 A;  3I0O A;  3BQI A;  4FRR A;  3NZP A;  1I6Z A;  5EZY E;  4KHZ F;  5JQG E;  2ZM2 A;  3JAD A;  3RH3 A;  1FEW A;  4DR7 T;  2QRX A;  1NWM X;  2K48 A;  3KV5 A;  2KND A;  3NWI A;  2A9U A;  1EZ3 A;  3TLS A;  2OA5 A;  2YKS A;  3N9L A;  3Q5D A;  3EAB A;  2L3L A;  3MA9 A;  2KXP B;  3AEG A;  3K3N A;  4AQY T;  1YD8 G;  3AXJ B;  5EK4 A;  1G73 A;  4C91 A;  3KV6 A;  1FMV A;  3CK6 A;  3OTO T;  2V7J A;  1BR1 A;  3BK9 A;  3M65 A;  2FBW A;  2VVS A;  4JI5 T;  3FZF B;  2W66 A;  4B3R T;  1IAP A;  2E9X D;  4AIU A;  3MZK B;  4AKH A;  3U8J A;  3L09 A;  5FNV E;  4DR5 T;  3LK2 B;  3ZN0 B;  4NZB A;  2W63 A;  2CWY A;  1R8I A;  4HFH A;  2Q9Q D;  4I55 E;  4YJ3 E;  4H9Q C;  4KBM B;  5KXJ A;  3ZMV B;  2SPC A;  2C0S A;  2D0U A;  1E7P A;  4UF0 B;  5HXE A;  1LRZ A;  3E08 A;  2YME A;  1YQ3 A;  3ESL A;  4ERR A;  4UM3 A;  3PUR A;  2WWV A;  1KNZ A;  5LHG B;  3CVR A;  4YSY A;  3SS1 A;  3RQU A;  3V5U A;  4HQP A;  1KNR A;  5AFM A;  2XAS B;  4EV6 A;  3PU8 A;  3G06 A;  4YXD A;  3U8N A;  3AEE A;  4AQF C;  2CEA A;  5JDN A;  5LMN T;  5FXX A;  3CX6 B;  4YSX A;  5L3F B;  1YQ4 A;  1D1C A;  3UU3 A;  4HTE A;  2Y6X A;  2E9X A;  3RYI E;  1OED E;  4MHC A;  4YTN A;  4LF8 T;  2HN1 A;  3ZSS A;  2Q9Q A;  4IDQ A;  5DQW A;  2NW9 A;  4GKK T;  5FYM A;  5HXC A;  5F3J A;  1S35 A;  2W00 A;  3GUA A;  5AFK A;  3RHW A;  3WTM A;  5CGM A;  5LJN A;  2BKO A;  1WYB A;  1WR6 A;  2J47 A;  3FB2 A;  2DNX A;  4PNI A;  2BBJ A;  3WTN A;  3WTL A;  2WU5 A;  2L8K A;  3EDU A;  1HR0 T;  2J4G A;  4IST A;  2RP4 A;  4TN7 B;  5KDM C;  4O4I E;  5FVK A;  3CX7 B;  2XSB A;  4DV1 T;  5DQV A;  3ZLI A;  4LF6 T;  4F6R C;  3C79 A;  4ZXL A;  4YTP A;  4X62 T;  3ZYM A;  3U8L A;  4EB6 E;  3H37 A;  5C2T A;  4O2B E;  1HS7 A;  2X9H A;  4IDZ A;  3ZYK A;  2W0G A;  2V1D B;  2L9Q A;  4E7S A;  2XYS A;  3OYZ A;  4PJM A;  5LOV E;  4O4J E;  5L4H A;  1N32 T;  2ZM8 A;  2XZ6 A;  1N36 T;  5IYZ E;  1XWM A;  2W8G A;  3Q2M A;  3ANW B;  1AJ3 A;  4KI0 F;  4AFT A;  1LVK A;  2BYP A;  2BYS A;  4TUY E;  3ZMT B;  2HN2 A;  3ANW A;  3CX8 B;  3FBZ A;  3UUM A;  2FJE A;  2LOP A;  2IAK A;  3SH1 A;  4YHH T;  5HCM A;  4AIS A;  3C64 A;  4U2Y A;  2C5I T;  5FJV A;  3R6N A;  5L3G B;  2V7L A;  3DJB A;  2XNV A;  3F57 A;  2YU2 A;  2JMH A;  4U3C A;  1D1B A;  1XNQ T;  4ISS A;  3K1S A;  2ZMA A;  3CPZ A;  3AA1 B;  4CI3 B;  2MPK A;  3ZT7 A;  1W0A A;  2LJL A;  3DTO A;  4WBN E;  2E9X C;  3WTI A;  4NXM T;  3HL6 A;  1CHU A;  5DJQ C;  5BRX A;  2OLT A;  4B6X A;  2Q9Q C;  2LSY A;  3C84 A;  4EXT A;  5AFN A;  4DV0 T;  5J2U E;  5AQJ B;  1UX4 A;  4NUU A;  2WZY A;  4X1K E;  3UTK A;  2QC1 B;  5J5I A;  1KFY A;  2NW7 A;  2XQ3 A;  3AE1 A;  5E0O A;  1OED A;  2J62 A;  1HG5 A;  4XHE A;  4ZRU A;  2PTF A;  3GMI A;  4GYR A;  3N2K E;  2WCA A;  4QAB A;  1W09 A;  5JDH A;  4PIR A;  2VQF T;  3N9N A;  1XDO A;  1MIV A;  2XQ5 A;  4KX6 A;  2UXD T;  2W2U A;  3SIO A;  4GK0 E;  2XQ7 A;  4DMV A;  1LKX A;  2ODU A;  3VRB A;  5CJ5 A;  2Z6E A;  3Q9D A;  5JTG A;  3PUA A;  1NEN A;  3SOL A;  2N2N A;  2H88 A;  3ETV A;  4H63 H;  4P09 A;  5CA1 E;  4TWD A;  1E1H B;  3I9W A;  4JEH B;  2XPK A;  1HX8 A;  4JUY A;  3TLW A;  5AFJ A;  3IA3 A;  2LM2 A;  1UUR A;  1MNE A;  2LLY A;  4IE0 A;  3ZKR A;  4BFQ A;  5FL1 A;  3ZT5 A;  3I0Q A;  4ZI7 E;  4HE8 A;  2IW5 B;  5A1L A;  2YOE A;  2CXF A;  4YFS A;  2WZI A;  4PK4 A;  2WN9 A;  2M6B A;  4X64 T;  5J5G A;  4ZI2 D;  1W0B A;  1XMQ T;  1T98 A;  3RYC E;  3MXZ A;  4UVB B;  5ETW A;  1U5P A;  2VKD A;  4X65 T;  2VL0 A;  4JBW F;  3P4R A;  3AEC A;  3ZMS B;  4BJM A;  4Z90 A;  2WNC A;  2VAS A;  4ZJT A;  5IHY A;  2YDR A;  4H9N C;  3KV9 A;  5L3C B;  1I9B A;  4LFB T;  3VR9 A;  2F4V T;  4HN9 A;  2KSR A;  3Q5E A;  1SA0 E;  3AVR A;  2KZ7 B;  3SFE A;  5LP6 E;  3UQ7 A;  4I0U A;  2NOX A;  5BMV E;  5FXV A;  4CQI A;  3RYF E;  4CN1 A;  5EK2 A;  2N9D A;  2BKN A;  2BS2 A;  3FBL A;  5TVC A;  2CBJ A;  4MLK A;  4UVA B;  4XZC A;  1J1J A;  2IHR 1;  5LXT E;  3AAI A;  4DV6 T;  4HFB A;  5AQS B;  4OK0 A;  3AB3 B;  5FKY A;  5JRC A;  4JI6 T;  1OED C;  2YK0 A;  1HNZ T;  1BR4 A;  3UU5 A;  4J2C A;  4E7Z A;  3RIA A;  2LE8 A;  3T1Y T;  3AE8 A;  4CZZ B;  4HKA A;  2V6X A;  4DMW A;  5AQH B;  3QK6 A;  1D0Z A;  1ZOY A;  2MBG A;  2KT9 A;  3N9Q A;  3AE7 A;  4DBM A;  3W15 B;  5KE4 A;  4B3M T;  2KWI B;  2MOZ A;  3B57 A;  4DUZ T;  2W61 A;  2I59 A;  1D0Y A;  2FJD A;  5H6R B;  1ZV4 X;  4ZOL E;  2K24 A;  2V6Y B;  2WAU A;  1I94 T;  3AAA B;  5J5H A;  4A56 A;  2LKH A;  2CLY B;  2XYT A;  1UX5 A;  3IEE A;  3LK3 B;  3ZPO A;  2ZM6 T;  3U8M A;  3LG7 A;  2MYS A;  4G63 A;  3MKD A;  3UU8 A;  2PBI A;  5KX5 E;  4ZR6 A;  4L0R A;  3FZL B;  3A8Y C;  4JI2 T;  5FXZ A;  2WB5 A;  4EZ1 A;  2XAJ B;  2YMD A;  4MBQ A;  1XDP A;  2XM2 A;  2JPF A;  3O1J A;  5BR8 T;  4IGU A;  3AXJ A;  2E2A A;  4CXW A;  2XQY A;  4FJO A;  4EYU A;  3L3P A;  5J1G A;  2P9B A;  5AIN A;  5FY1 A;  1W9R A;  2E5V A;  3K3Q C;  2LT3 A;  1WFD A;  1J5W A;  2V8S V;  2K3W A;  2CMR A;  3PUQ A;  2KLQ A;  4O4H E;  5HYA A;  2X9W A;  3PTR B;  1MIW A;  3CKD A;  4UEM A;  2XSA A;  4UM3 P;  3O4X E;  4ILC A;  4X1I E;  4UF0 A;  4G2A A;  2EHO C;  4QX7 B;  5HWY A;  4IL4 A;  4C90 A;  4ZI2 C;  4DVD A;  3RIU A;  4IT4 A;  4P0B A;  3ETU A;  3RC8 A;  3O1H A;  3P4W A;  2BVM A;  4A5X A;  5LMU T;  4NUV A;  3UU4 A;  4X20 E;  3K8P C;  4BAY B;  5AQM B;  2WBL A;  3AE6 A;  3IGQ A;  5LXB A;  2H89 A;  4GOU A;  4ZI3 C;  4IL9 A;  5AQK B;  3UFE A;  5L4E A;  5DAB A;  5HXR A;  4H9R C;  4DR2 T;  3AEF A;  3IBP A;  1T72 A;  1S94 A;  2H7V C;  1T7S A;  4JI4 T;  3CQC B;  1M62 A;  2LHN A;  1BR2 A;  2BR8 A;  3FXD B;  2D0T A;  1VRB A;  4WZX A;  4IE7 A;  4EGW A;  5ABE A;  1WR0 A;  5F5W A;  1VCS A;  1ZKE A;  4P0A A;  2VK9 A;  3BQK A;  3BQL A;  1O3X A;  1L0V A;  1HG2 A;  3OJA A;  1V9D A;  2JRK A;  2NTX A;  2LSK A;  5LG4 A;  5HEH A;  3ZJ2 A;  5EK3 A;  4N78 D;  4A98 A;  4AFG A;  4ANJ A;  2H3R A;  2WDV A;  4B5D A;  5LGU B;  4XAX B;  3U78 A;  4KUM B;  1MMD A;  3C98 B;  2ZM0 A;  2XAG B;  3RLF F;  3N2G E;  2X0L B;  4L5G A;  2BYR A;  1U4Q A;  3RKO A;  4B3T T;  2WWU A;  5LG3 A;  2CRB A;  4JYA T;  4TNW A;  2UUA T;  2D2S A;  4ILA A;  3Q5X A;  2CCQ A;  4BJN A;  1X79 A;  1SHZ C;  3AEB A;  4B3S T;  4TV8 E;  3A5X A;  5JR9 B;  4AKG A;  1Z0P A;  2KWH A;  5LCY A;  2UU9 T;  3U8K A;  3KBT A;  5CO5 A;  4DV3 T;  2B76 A;  2NR4 A;  5HCJ A;  1GQE A;  1IBK T;  3LSV A;  3A7M A;  3VKG A;  4COF A;  2XM1 A;  4YJ2 E;  3CQG B;  2XAH B;  2LSJ A;  2X67 A;  3EI0 A;  5LGT B;  2VKJ A;  4I50 E;  2NTY A;  4LMJ A;  1HNW T;  1VCT A;  2XAF B;  4IE5 A;  2QVA A;  2UXC T;  3RIU C;  1QLB A;  2XQ8 A;  2XQ4 A;  2WU2 A;  5LGN B;  5FP3 A;  5J0Z A;  2WNJ A;  1YKE B;  4EYY R;  3ZCJ A;  1B7T A;  4DID B;  5C3J A;  4Z91 A;  3NZQ A;  2XHE B;  4CN6 A;  4HFI A;  2YDQ A;  4IDP A;  3RKG A;  3AE3 A;  4I43 B;  2GK9 A;  2M67 A;  3AA0 B;  3HKC E;  2RA1 A;  1N33 T;  3PUZ F;  3PE0 A;  3CML A;  3RRW A;  4NXN T;  3EHZ A;  2V7I A;  4UV9 B;  4H63 V;  2YU1 A;  4AKI A;  4UVC B;  2YDS A;  1H7C A;  2V7M A;  2R6G F;  4JI3 T;  1HF8 A;  2PJQ A;  2WDQ A;  3B13 A;  2UXX B;  3FZK B;  3Q5W A;  4ALX A;  5L3E B;  1FIO A;  5AQI B;  4U72 A;  3ZST A;  3ZDG A;  3HI2 A;  3VKH A;  4PJN A;  5LB7 B;  2CPT A;  3K3O A;  4JLE A;  5GON E;  5IUX A;  4HEA A;  1J5E T;  5TAO A;  2WQY A;  4AKR B;  4AI6 A;  2NP9 A;  4QXC B;  1OWA A;  2VKH A;  4I4T E;  5LJM A;  4ZEY A;  4WBO A;  2WNL A;  3EVY A;  4YT0 A;  2WMO A;  3O9X A;  2CXL A;  3SQ9 A;  4QAC A;  2A72 A;  4LF7 T;  1ZP0 A;  2IDO B;  4LFA T;  1HNX T;  4YLH A;  4QH5 A;  3WTJ A;  4MAL A;  4OYJ A;  3N9P A;  4ADZ A;  3PJA J;  5KMG P;  2ZJV A;  1QUU A;  4TX5 A;  4IHJ E;  3RYH E;  3LFM A;  4UR9 A;  3SQ6 A;  2BJ0 A;  4OHF A;  5SYO A;  5AFU L;  5LYJ E;  3ABV A;  3RIF A;  4IDN A;  1HTJ F;  2WZH A;  4WW0 A;  3KVB A;  1UV6 A;  2X9Y A;  3PMZ A;  4JEU B;  4ZS2 A;  4DO0 A;  3FZM B;  5L2L A;  4V1A v;  2W62 A;  3AVS A;  4HWH A;  3JAF A;  1LVF A;  4P1N A;  5JRE A;  1MMG A;  2LKG A;  2NW8 A;  4X66 T;  2ACX A;  1UK5 A;  2V5D A;  5HEO A;  3SWH A;  5AQG B;  4PFO A;  3HR0 A;  3J7Y q;  4OYK A;  2BG9 E;  2X0H A;  4KMC A;  3TKL B;  3S4U A;  2BZB A;  4M1P A;  2I0M A;  1KF6 A;  1G8X A;  2DWG A;  4PJL A;  2C9T A;  5HEU A;  2Y54 A;  3PUG A;  1ZHC A;  3UU6 A;  3PUY F;  2H7O A;  4TV9 E;  5F8P A;  2VL8 A;  3FZH B;  4GIW A;  2A3D A;  2JQK A;  4U2Z A;  4JI8 T;  1BR0 A;  4WNK A;  4CI2 B;  2X68 A;  3WAK A;  1YXR A;  4JI0 T;  3OBV E;  2LM9 A;  4DR4 T;  2WS3 A;  4HWC A;  5JDF A;  4LF4 T;  3QUJ A;  4F8H A;  5FY7 A;  1KEY A;  4UV8 B;  4Q25 A;  3C4W A;  2IML A;  3NBX X;  4PK5 A;  4IIJ E;  3FHN A;  1D0X A;  2VKO A;  3P8C D;  4LFC T;  4UY2 A;  1MND A;  4HFE A;  5FVL A;  4QXH B;  2X0Y A;  3KDS E;  3LDQ B;  2N1G A;  3L39 A;  2PGZ A;  2C5K T;  1WYC A;  3HKB E;  4ZS3 A;  5AQQ B;  2XZ5 A;  5J5F A;  2CHN A;  4DR3 T;  4PAG A;  4DV5 T;  3CIR A;  3P4P A;  3P4S A;  4EZ4 A;  2BYN A;  2YIN A;  3WTO A;  2AE9 A;  2CXD A;  3ONJ A;  2M6I A;  3QOF A;  5IWA T;  3PUS A;  4H9O C;  3KFW X;  3TLT A;  2V6Y A;  4HFD A;  1E2A A;  3RF1 A;  5ABG A;  2ACZ A;  4EOZ B;  2ODV A;  2X51 A;  4AFH A;  5HWX A;  1NAF A;  3UUB A;  4Z8X A;  2Y48 B;  2VWA A;  3WTH A;  5LBM A;  4K0U A;  2KIN B;  4JI7 T;  4TNV A;  1IJ5 A;  3ZJ1 A;  3AE2 A;  2LRL A;  2DLR A;  1VOM A;  2JQQ A;  3ZMZ B;  5JDG A;  2J1D G;  2AXD S;  2QA7 A;  2I6H A;  5LA6 E;  3CWZ B;  2QGS A;  1KK7 A;  1D1A A;  5JDM A;  2WY2 A;  5L47 A;  4H9S E;  4ZHQ E;  2IIU A;  4QKN A;  5L3D B;  4KP3 C;  2BBH A;  3HKE E;  4QAA A;  5BP0 A;  2UUB T;  4L9I A;  5AQN B;  1MMA A;  2BG9 B;  2WP9 A;  3AE4 A;  1XZY A;  4O8S A;  3F31 A;  2Y58 A;  3J9X 1;  2UZ6 A;  2ZLY A;  2BG9 A;  2HPJ A;  3UQ4 A;  2XAQ B;  4A97 A;  2JIW A;  3ZC1 A;  3LK4 2;  1WCR A;  2IC9 A;  5FY0 A;  4WYV A;  4ZZC A;  2PH9 A;  3JAE A;  3H3M A;  3PEO A;  1IZN B;  1Y01 A;  1M7K A;  4GYS A;  4LF9 T;  3CQX C;  3QB5 A;  5FMN A;  2DWK A;  4K0K T;  3T4M A;  3GA8 A;  4IE4 A;  5JME A;  1KNP A;  4HWF A;  1UGO A;  1IBM T;  3DP7 A;  2Y57 A;  2BVL A;  1N34 T;  4OX9 T;  3WIP A;  1Z8U A;  5AFM B;  4UIG A;  3OYX A;  2Y8D A;  2E5L T;  3NVO A;  4ZJS A;  3TLU A;  3OPC A;  4U33 A;  3N9M A;  3OVU A;  3UT5 E;  3C4X A;  2Y7Y A;  2DL1 A;  3I9Y A;  3X1D A;  2PG8 A;  5ADX L;  4LF5 T;  3OKQ A;  5FL0 A;  2VQE T;  1NEK A;  1US7 B;  2CA5 A;  4QH1 A;  2E9X B;  4DBR A;  1FJG T;  3ONL C;  3MK7 C;  4ASK A;  1SUM B;  4XBF B;  3T1H T;  4GKJ T;  2Q9Q B;  3E22 E;  4YY3 T;  2VUR A;  4EIW A;  4DUY T;  3AEA A;  5LHI B;  4WV9 A;  2X66 A;  4O4L E;  2CLY C;  2FJA A;  4YSZ A;  1UCU A;  2OV9 A;  3D0T A;  2FJB A;  5AQU B;  2HH7 A;  4AKL A;  3C4Z A;  2XQ6 A;  1UUS A;  4BQT A;  4HWD A;  3AA6 B;  3P7I A;  4IRE A;  4LMK A;  2JMK A;  4DBQ A;  3I1A A;  3SRZ A;  1SE7 A;  3WI3 A;  4DV7 T;  2K5B B;  1T8B A;  2LOS A;  3KVA A;  3C51 A;  2K9A A;  4TWH A;  5ABH A;  3UUL A;  3HA4 A;  3RQW A;  2MAW A;  3GN5 B;  2VB6 A;  2G0U A;  2WDR A;  3ZEF B;  1UX2 A;  4UEL A;  3NRX A;  4AQG A;  1IBL T;  3GN5 A;  3EDV A;  4GK5 E;  2XZE A;  3N9O A;  3QNU A;  4HFC A;  3IF8 B;  2V5C A;  5AQP B;  5JVD E;  3RC3 A;  2UXN B;  3V5S A;  4DV4 T;  2BG9 C;  1HFA A;  4YHJ A;  2X00 D;  5JR9 A;  4CN4 A;  4QWN B;  2W67 A;  5HEJ A;  1IJ6 A;  2V7K A;  2IC6 A;  2CE7 A;  5LNK A;  4H9P C;  3PU3 A;  3NRY A;  4XK9 A;  2CWO A;  2WMN A;  2BR7 A;  1XNR T;  2XUE A;  4U7Y A;  3VRA A;  3SFD A;  3AE5 A;  3VHL A;  1JNR A;  3RPU A;  3R84 B;  2D9D A;  3MAC A;  4D01 A;  3KBU A;  3T8O A;  3RRC A;  3ZMU B;  5AQO B;  1YW0 A;  5C8Y E;  5HXH A;  4DV2 T;  4O2A E;  3ZDH A;  3H3A A;  3PUV F;  3NKZ A;  2MTQ A;  4HWI B;  2ZJU A;  5LBQ B;  3JC6 D;  2B1E A;  2KMF A;  2YEV C;  4UM3 S;  4IDO A;  4ZK4 A;  4NPP A;  3U3I A;  1DU2 A;  2X00 A;  5JDQ A;  4EED A;  3KIN B;  3KV4 A;  4EAH A;  5HXS A;  4U31 A;  2LRK A;  4HGA A;  2JQH A;  2PFV A;  5FXW A;  4PW8 A;  3UUN A;  2XY8 B;  2V26 A;  4YTM A;  1MIY A;  2FUP A;  1UW6 A;  4QH4 A;  2X9X A;  4JV5 T;  1OED B;  3E0Z A;  5CB4 E;  3UUX B;  5M4Y A;  4QXB B;  4ZZB A;  2DCF A;  4MFR A;  3VR8 A;  4JI1 T;  2XNT A;  5AQV B;  3RI5 A;  4QHO A;  1OXZ A;  2BS4 A;  3AED A;  2LSG A;  4UXN B;  3LJC A;  5ABF B;  3MJX A;  5HEG A;  5AQF B;  5H6Q B;  3RX6 A;  3EAM A;  5LHH B;  3C50 A;  2JJ9 A;  5ABF A;  1X9B A; 
#chains in the Genus database with same CATH homology
 1OED A;  5L4H A;  4Z90 A;  4ILC A;  2WNC A;  4D01 A;  4UY2 A;  3TLS A;  2W8F A;  4HFE A;  4XHE A;  4ZRU A;  4ZJT A;  4TWF A;  2YKS A;  3EHZ A;  2Y58 A;  2XZ6 A;  5J5H A;  2BYR A;  2UZ6 A;  2PGZ A;  4QAB A;  2LKH A;  4IL4 A;  3TLV A;  2BG9 A;  2W8G A;  4X5T A;  4UXU A;  3UU3 A;  2XYT A;  5LG3 A;  3JAF A;  2XQ6 A;  3ZDH A;  4PIR A;  3UQ4 A;  1I9B A;  4TNW A;  4A97 A;  2LKG A;  2XZ5 A;  4LML A;  3P4W A;  4ZZC A;  5J5F A;  5HEO A;  4AFT A;  4BQT A;  2KSR A;  2PH9 A;  3U8M A;  3JAE A;  1OED E;  2XQ5 A;  3PEO A;  4IRE A;  4ILA A;  4LMK A;  2BYP A;  2BYS A;  3WTK A;  2YN6 A;  4ALX A;  2ZJU A;  3SIO A;  2XQ7 A;  3UQ7 A;  4ILB A;  3SH1 A;  2BYN A;  3WTO A;  3ZDG A;  3PMZ A;  5HCM A;  2BG9 E;  4UM3 S;  3UU8 A;  3UU4 A;  2M6I A;  5AFH A;  4TWH A;  5AFL A;  4ZR6 A;  3T4M A;  4ZK4 A;  5FJV A;  3IGQ A;  3GUA A;  5AFK A;  3U8K A;  4NPP A;  5IUX A;  5JME A;  3RQW A;  5TVC A;  3TLT A;  5CO5 A;  5LXB A;  2MAW A;  3RHW A;  3WTM A;  5CFB A;  2X00 A;  4IL9 A;  5L4E A;  2C9T A;  4TWD A;  4HFD A;  4EZ1 A;  2XQA A;  5HCJ A;  3WTN A;  3WTL A;  2Y56 A;  2YMD A;  5HEU A;  1UX2 A;  2WNL A;  4HFB A;  3U8J A;  2XNV A;  2Y57 A;  2Y54 A;  3UU6 A;  3WIP A;  3LSV A;  4COF A;  4AFH A;  3TLW A;  5AFJ A;  4NZB A;  5AFM B;  4UM1 A;  2XNU A;  2LM2 A;  3SQ9 A;  2LLY A;  4QAC A;  3EI0 A;  4ZJS A;  3UUB A;  3ZKR A;  4HFH A;  3TLU A;  1OED C;  2BYQ A;  1UW6 A;  3WTH A;  4QH4 A;  3UU5 A;  4HFC A;  2BR8 A;  4BFQ A;  4QH5 A;  3WTJ A;  2Y7Y A;  3RIA A;  5KZU A;  4LMJ A;  1OED B;  4TNV A;  2BG9 C;  2X00 D;  5AIN A;  2XQ8 A;  2YME A;  2XQ4 A;  4ZZB A;  2ZJV A;  3WTI A;  5HEJ A;  4UM3 A;  2YOE A;  5BRX A;  2XNT A;  3SQ6 A;  5J0Z A;  3RI5 A;  2WNJ A;  4QH1 A;  3C79 A;  2BJ0 A;  4XK9 A;  5SYO A;  3U8L A;  4Z91 A;  5L47 A;  2M6B A;  3P50 A;  2WN9 A;  4DBM A;  5J5G A;  5KE4 A;  5HEH A;  3RQU A;  4FRR A;  4HFI A;  4F8H A;  4HQP A;  3C84 A;  5AFN A;  4A98 A;  2BR7 A;  4AFG A;  3RIF A;  2XQ9 A;  5AFM A;  4QAA A;  5HEG A;  5BP0 A;  4ZK1 A;  2XYS A;  3JAD A;  2WZY A;  2QC1 B;  3EAM A;  5J5I A;  5BW2 A;  1UV6 A;  3U8N A;  4B5D A;  4WV9 A;  2VL0 A;  4UM3 P;  2XQ3 A;  2BG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...