3UU8A

The glic pentameric ligand-gated ion channel loop2-24' mutant reduced in solution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu8A01
4LMLA 2WNJA 3RIAA 5HCJA 5CFBA 4WV9A 4UXUA 2YN6A 2LKHA 3TLVA 4HFCA 3C84A 4B5DA 2WZYA 3U8MA 4NZBA 5AFMA 5LXBA 2XYSA 4IL9A 3RQWA 4QH4A 4ALXA 5J5FA 3SH1A 4IREA 2XQAA 2UZ6A 3WTJA 3WTKA 3WTNA 4A98A 5L4HA 2YMDA 5HEJA 2QC1B 2X00D 5AFHA 1UX2A 2WNLA 4ZK1A 5HEHA 2C9TA 2BG9E 5AFNA 3EAMA 2W8FA 2BG9A 3SIOA 5L4EA 2VL0A 1OEDC 5AINA 4D01A 5IUXA 4HFBA 2XQ8A 2XNVA 2XZ5A 5BRXA 5HEOA 2M6BA 2PH9A 3TLWA 2BYQA 4ILCA 3P50A 4F8HA 3RHWA 4QH1A 3ZDGA 3TLTA 4UM1A 5KZUA 2XQ6A 2LLYA 3ZKRA 5L47A 4ZJSA 3JAFA 3JADA 4X5TA 2BJ0A 5AFKA 4BQTA 3UU5A 3U8NA 2XQ5A 4AFHA 2M6IA 3UU4A 4HFHA 4UM3A 4ZZBA 3EI0A 3UU3A 3WTIA 3IGQA 4UY2A 3TLUA 2YMEA 3RI5A 2W8GA 3LSVA 1UW6A 3GUAA 2XYTA 2LKGA 2LM2A 3EHZA 4TWFA 4ZZCA 1UV6A 4UM3P 4EZ1A 5JMEA 4AFGA 4ILBA 2X00A 4IL4A 5HEGA 2XQ7A 3RQUA 2Y58A 3SQ6A 3T4MA 2BR7A 3WTHA 4FRRA 5SYOA 4ZJTA 3SQ9A 4QH5A 4XHEA 5TVCA 5HCMA 4HFEA 3WTMA 4ZK4A 2XNTA 5BW2A 2XQ4A 2BYSA 2XNUA 2BG9B 2PGZA 4UM3S 4HFIA 5HEUA 5AFMB 3RIFA 3WTLA 3UQ4A 3JAEA 4NPPA 5J5GA 4DBMA 5J0ZA 3UU6A 4TNVA 2BR8A 3P4WA 5BP0A 4TWDA 5J5IA 2YOEA 2WN9A 4Z91A 2YKSA 2XQ9A 2Y54A 4A97A 1OEDE 3UU8A 1OEDA 2BYNA 2BG9C 1I9BA 4QABA 5KE4A 4HFDA 2KSRA 4ZR6A 1OEDB 3UUBA 3WIPA 5J5HA 4QACA 2WNCA 4Z90A 2BYPA 3U8KA 3UQ7A 4PIRA 2MAWA 5AFJA 2Y57A 3PEOA 4ILAA 5FJVA 2Y56A 4HQPA 2ZJVA 4QAAA 5CO5A 4BFQA 3ZDHA 2ZJUA 3C79A 3WTOA 2XZ6A 2XQ3A 2BYRA 4XK9A 4TNWA 4COFA 4ZRUA 4AFTA 3U8JA 4TWHA 5LG3A 4LMJA 3TLSA 3U8LA 2Y7YA 4LMKA 3PMZA 5AFLA
chains in the Genus database with same CATH superfamily
1I6ZA 5CA1E 5FL1A 5DJQC 4H9SE 4U74A 1HX8A 4CN4A 4IIJE 2XASB 2LSGA 3PJAJ 2ZM2A 4DV3T 3FZKB 3K3NA 3FZLB 5LCYA 2K5BB 4KUMB 4D01A 3BQIA 5JDGA 4WZXA 3AEEA 4PK4A 3Q5EA 5AQOB 4DVDA 4WYVA 3NZQA 4UV8B 1D1BA 1I94T 5DQWA 2VASA 3JADA 2BJ0A 3VHLA 2VVSA 3Q5DA 3W15B 1XWMA 2QRXA 4EZ1A 2BKNA 4DBRA 2UUCT 3WTMA 3HKCE 2P9BA 5TAOA 4DBMA 2ZM0A 1MIVA 2CMRA 1OEDA 3ETVA 3HL6A 2WM9A 3ZCIA 2F4VT 3CQGB 4DR7T 2Y57A 1LVKA 3AA0B 3ZEFB 2L8KA 3CKDA 2ZJUA 1HNXT 3TLSA 2KINB 3ONJA 1OXZA 4WBNE 4BA9A 3ONXA 3NWIA 4AIUA 5HCJA 4X1KE 3PUZF 2VB6A 1KNPA 2YDRA 3C84A 1Y64B 4B5DA 4UEMA 3C51A 2E5VA 3AE9A 4JLEA 3KBUA 4C90A 4OFZA 2H7OA 4L9IA 3E0ZA 2J47A 1MMNA 2CHOA 3EAMA 3SIOA 3RF1A 1OEDC 5AINA 4HFBA 2XQ8A 5FVKA 3RHWA 4LFAT 3NZPA 2E9XA 3M65A 2MOZA 1WCRA 3KVAA 4ZS2A 1YD8G 5KDMC 2ODVA 3BQKA 3EI0A 5AQJB 3UU3A 2FJAA 4DV2T 4UY2A 4X65T 2YINA 4KP3C 2PFVA 1N36T 3SQ6A 4FRRA 3RYFE 4ZJTA 2JIWA 2CXDA 3ZN0B 2PBIA 2PGZA 2KT9A 5LGUB 3PE0A 3DTOA 2E8IA 2I59A 3P4SA 5J5IA 2X51A 2YKSA 4Z91A 2CHNA 3N9NA 2Y54A 3CMLA 1YXRA 4ZR6A 1US7B 5JR9B 4GIWA 3LJCA 2VKDA 3UULA 4PJMA 1XNRT 4JI3T 3ZSSA 2WU5A 2DL1A 5LOVE 2UXBT 4LMKA 5JDFA 2UXNB 2CXFA 5AFLA 2PTFA 1WLXA 2YDSA 4JI0T 1XZYA 3RIUC 5IYZE 2CBJA 1FMWA 4H9RC 5AFHA 4IT4A 2BZBA 2FJDA 3VR8A 2LSIA 5IUXA 5EK3A 2Y8DA 4OHFA 4DV5T 3I0QA 4ZJSA 4UF0B 2VWAA 2DWGA 3FBZA 5JQGE 3WAJA 4U31A 2BS3A 4UR9A 2NOXA 4FJOA 5A1LA 3KBTA 2DHRA 3MK7C 4Z8XA 1L0VA 2XZEA 2W8GA 3GN5A 3EHZA 5FNVE 1UV6A 1ZEEA 2H7VC 1U4QA 4X1YE 4HFEA 4DV6T 5AFMB 3UQ4A 2KWHA 3X1DA 5J0ZA 5C2TA 5E0OA 1OEDE 4U7IA 1ZP0A 1KEYA 4HFDA 4CZZB 2CM0A 3AVRA 5LGNB 3PUGA 2MAWA 5J2TE 2ACXA 1XDPA 3GN5B 3LBXB 4TNWA 2MBGA 1T8BA 1SUMB 2JMKA 3HA4A 1KNRA 4MLKA 2X9HA 3FXEB 3TLVA 2WDVA 4HEAA 2CRBA 5L3GB 3CPZA 3IEEA 4IL9A 2BVLA 5F5WA 3JC6C 3N5LA 4CXXA 1HS7A 2YMDA 2IMLA 2ACZA 2BS2A 4U2ZA 3ZYKA 4EIWA 1IBLT 3A8YC 2WAUA 2BG9A 3QNUA 2VL0A 2XM2A 4O2AE 3P7IA 2IC9A 5BRXA 2HH7A 3EABA 3UT5E 4UM1A 3RC3A 4CI3B 2XQ6A 3PV0F 4I4TE 3O1IA 3S4UA 4EB6E 3JAFA 3AEFA 3FXDB 2L9QA 2WU2A 2XM1A 3RYIE 5HXRA 4NUVA 3M3ZB 4O4JE 2XYTA 2LKGA 3Q2MA 2XHEB 5LGTB 2B1EA 3KFWX 4ZI3C 5FXWA 5BW2A 4BJMA 2BG9B 3RIFA 2JQHA 2WCAA 3KV6A 4TNVA 5AQIB 5BP0A 2LJLA 2LSJA 2ODUA 4IE5A 4ZI7E 4JI8T 4K0KT 4KHPT 2W0GA 3K3QC 5FY1A 3OBVE 3ZMZB 1UURA 5ABFB 3AE4A 5JR9A 2Y56A 4UV9B 2LM9A 4ASKA 3QUJA 4EYYR 2EHOC 2NTXA 4EXTA 5KX5E 2YN6A 2LKHA 3F31A 1D1CA 3CX8B 2XYSA 3AVSA 1VCTA 2UZ6A 2WWVA 1FJGT 3CX7B 4M1PA 1WR6A 4O4LE 5FKYA 5AQKB 3MZKB 2WNLA 1QLBA 3AE8A 3PUVF 3SS1A 4AISA 2W61A 3ZMSB 2LEHA 1NAFA 3AE2A 2L3LA 2QGSA 4F8HA 4QH1A 4LF9T 3HR0A 5ETWA 5L47A 3WAKA 5LJNA 3MKDA 2UXDT 4UF0A 4AFHA 4HFHA 2KWIB 3AAIA 5CB4E 2D5UA 2SPCA 2ZMAA 3GWHA 3T4MA 5JTGA 4A56A 1ZV4X 5HAXA 1JNRA 5LBQB 4HFIA 4CI2B 4U72A 1JNZA 4NPPA 3ZC0A 5FY0A 2ES0A 2KZ7B 1FMVA 4JI7T 3UU8A 4EEBA 3OKQA 4IDQA 2WMNA 5H6QB 3RYCE 1OWAA 4HWIB 2ZJVA 5CO5A 3C79A 4I43B 3PUSA 3L8RA 3IF8B 3V5UA 3U8LA 4QX7B 3PMZA 3FZFB 2X9WA 2WNJA 2V5CA 4HFCA 2WBLA 3NBXX 3RQWA 4OX9T 2Y48B 1BR1A 4LFCT 2X00D 1S35A 2HN1A 2NW9A 3T8OA 3LFMA 2A2FX 2XZ5A 2E9XB 2UUAT 5KZUA 2A3DA 1UUSA 3FHNA 2X0LB 2WWUA 3ETUA 2VKOA 2AXDS 1MMAA 1QUUA 2BKOA 5BMVE 5L3CB 3AA6B 2X66A 4H9QC 4XBFB 4DO0A 4AFGA 5IHYA 2JQ9A 4IL4A 5HEGA 4B3ST 5FVLA 2CEAA 1Z0PA 2XQ4A 3OYZA 5ABHA 4JI5T 4IHJE 2D2SA 2BR8A 4YLHA 2BDEA 1MNDA 3N2GE 4FI5A 4KX6A 1VOMA 2C5IT 5ABEA 5LYJE 3UUBA 4P1NA 3KV5A 1EZ3A 5ABFA 2A9UA 2LRLA 5LMNT 4L5GA 3C98B 4EAHA 4ISTA 2LSKA 2WZYA 4PFPA 2VQFT 4PAGA 3H3AA 3CK6A 1W0AA 2QC1B 2CLYC 4IE4A 4UELA 1CUNA 5LBMA 2W8FA 3PUQA 4V1Av 2IHR1 2M6BA 3P4RA 4KBMB 3SWHA 3AXJA 4AKLA 2DLRA 3AECA 3KDSE 4IE7A 2LE8A 5JDHA 3K8PC 2W4XA 1BR0A 4UVCB 5LJMA 2RA1A 3GUAA 1FEWA 3C4XA 4TWFA 5LHGB 1HG2A 1KK7A 2XQ7A 3H3MA 4IE0A 3AA1B 3OYXA 2R6GF 3N9OA 4XHEA 3A7MA 2Q9QB 2NW7A 3B13A 5L3DB 3CQCB 3B5MA 4IDOA 2K3WA 3ZPOA 3B57A 3AE1A 2A72A 4H9PC 4QKNA 5FYMA 2DWKA 2BBHA 2BVMA 3Q9DA 3U8KA 2X0HA 4PFOA 3LBXA 4AKHA 3AE3A 4HKAA 2XZ6A 2XQ3A 4TWHA 1YQ4A 3J9X1 1HFAA 1UX4A 4MHCA 1Z8UA 1T72A 4H9OC 5AQNB 2UU9T 2V7LA 3Q5XA 3U78A 2KLQA 3RPUA 2N1GA 4A98A 5L4HA 1NWMX 2IUBA 4NIQA 3PUAA 4HWDA 5HEHA 4DMVA 4U2YA 3OVUA 4WW0A 3WI3A 2CE7A 3N9LA 5HEOA 3ONLC 4ILCA 4JEHB 3UTKA 1GQEA 2WZIA 3QB5A 5CA0E 5AQFB 4X1IE 4JBWF 3LDQB 4O4HE 3RRWA 5LG4A 3IGQA 2K48A 3LSVA 1UW6A 2KMFA 4JI4T 4HFVA 3N2KE 5AQQB 2VKHA 3JC6D 4YJ3E 1UCUA 2V6XA 2I6HA 4HGAA 2BBJA 2B76A 1B7TA 4YFSA 2WZHA 3PTRB 5LB7B 2ZM8A 4MALA 1YKHB 2E5LT 4ANJA 3RLFF 3DP7A 4Z90A 2I0MA 4YSXA 5AQGB 3IA3A 1WR0A 5BR8T 3AXJB 3EDVA 4IDZA 3WTOA 3FZMB 4ZRUA 3HKBE 4ZXLA 2W62A 4X20E 4DV0T 1N33T 3ZYMA 3IHRA 4QH4A 2FBWA 4QWNB 4IREA 4YXDA 4LF6T 4K0UA 1XMOT 3OJAA 5CGMA 5F8PA 3N9PA 1SHZC 3AEBA 4TV8E 3RH3A 4ZHQE 4DIDB 4JYAT 5LP6E 2PH9A 4O4IE 4CI1B 4AKRB 3ZMVB 4XZCA 3R6NA 2C5JA 3UUXB 1IJ6A 3K1SA 2XJ7A 4DR4T 5FY7A 1XNQT 2W67A 4BQTA 5HWYA 4DUYT 4A5XA 4CQIA 2J4GA 1U5PA 4QXHB 3RI5A 4QX8B 4ERRA 5DABA 5FL0A 1MIWA 1J5ET 5C8YE 5HXHA 3RGLA 3RYHE 2VL8A 3NRYA 2V6YA 5JDMA 3WTLA 2LSYA 2Q9QD 3DJBA 2J62A 4EOZB 4PJNA 2PJQA 3J7Yq 2E9XC 4JUYA 3UUMA 5KE4A 3SFDA 1IBKT 4C91A 4I55E 4JI1T 1UX5A 2WNCA 2BYPA 3FZHB 5FXXA 4ILAA 3UUNA 1LKXA 2JPFA 4QXBB 4AQFA 3EUHA 2IAKA 5JDQA 4YTMA 2QVAA 2YDQA 2HN2A 5LXTE 3QB5K 1BR4A 4L0RA 1IZNB 5AFMA 1X9BA 2XAFB 4HN9A 1CHUA 3AA7B 5ABGA 1Y01A 5AFNA 4QHOA 2UXCT 1MMGA 4U33A 2DI4A 1NENA 1E1HB 5AQLB 3MACA 3TLTA 1KF6A 4ZOLE 2VQET 4UVBB 4ZZBA 2CWOA 2N9DA 3WTIA 4HWCA 2V8SV 2LM2A 4ZZCA 3V5SA 1S94A 3RRCA 4NUUA 4YHHT 2X00A 4AKIA 3RQUA 4GKKT 1SA0E 4TX5A 2WQYA 2DNXA 2D9DA 2XNUA 3AE6A 4EEDA 4Q25A 2CCQA 5L3EB 4XAXB 3F57A 1MMDA 2WY2A 4MBQA 3CVRA 2RPAA 3LG7A 4YSYA 3ZN1B 4H9NC 3UQ7A 5AFJA 2XPKA 4ADZA 2XQYA 3ZJ1A 1WYBA 1IAPA 2BYRA 1ZOYA 5AQVB 2W66A 2FJEA 3I9WA 3IBPA 3SFEA 5J5FA 4OYJA 4AQYT 3P4PA 3LK3B 2C9TA 2VVNA 1SE7A 3G06A 3AE7A 2LRKA 3K3OA 1UGOA 3HI2A 1HTJF 4DR1T 2E2AA 2XTLA 4AI6A 3VKHA 4UIGA 2OLTA 5H6RB 3BK9A 5HXCA 2V7KA 3PU3A 4F6RC 5GONE 2QYWA 4O8SA 2Y58A 5AQRB 4CXYA 3SOLA 1HNZT 4UM3S 4MFRA 3VRAA 5C3JA 3UU6A 3PUWF 3GMIA 1KNZA 2GK9A 2XQ9A 2JRKA 4EYUA 2YU2A 1M7KA 4QABA 2YEVC 1BR2A 3MXZA 1OEDB 1NEKA 3VR9A 1FIOA 4HQPA 2J1DG 3ZDHA 3KV4A 3ZT6A 3PUYF 3A5XA 5FXVA 1J5WA 5LNKA 2ZM6T 5CFBA 4ZI2D 5JVDE 3RIUA 4WBOA 3U8MA 4NZBA 5LXBA 3C4ZA 4EZ4A 4PW8A 4G2AA 3SH1A 3WTJA 4DMWA 3NVOA 4LF7T 3WTNA 2CLYB 1MNEA 1UX2A 1HCIA 2JQQA 3EDUA 2BG9E 2V5DA 2V7IA 2NWBA 5HXEA 4E7SA 2XNVA 5LMUT 1YQ3A 3AEDA 3AAEB 3ZCJA 1VCSA 1HNWT 3ZKRA 5FXZA 3LK2B 4GYSA 4HE8A 4DR5T 2V26A 3MA9A 2XSAA 2XQ5A 3UU4A 3Q5WA 4UM3A 3GA8A 2IIUA 2H88A 3HKEE 1WRDA 4JI2T 2FUPA 5FMNA 4KHZF 2BR7A 5DQVA 5AQSB 4LF8T 3NRXA 3AEGA 2H3RA 5J5GA 5LHIB 3AEAA 2X9XA 3RX6A 4LF5T 4A97A 2PG8A 4YTNA 2NR4A 2LOSA 3P8CD 4H63V 5J5HA 1YW0A 4QXCB 4AXPA 4QAAA 2XAJB 2D0TA 4XK9A 4ISSA 1XMQT 3U8JA 4DV7T 1J1JA 1M62A 3O4XE 1W0BA 2C5KT 5JREA 2WS3A 5LA6E 4DR3T 4U7YA 5JDNA 3PU8A 3WTKA 2KNDA 4NXNT 3OTOT 4PJJA 2WP9A 5L4EA 3EVYA 4B3MT 2BYQA 2UUBT 4ZS3A 4IDNA 5EK4A 2WDQA 4O2BE 3VRBA 2X0YA 2M6IA 2NW8A 5J1GA 2BS4A 3E08A 3RKOA 3HKDE 5JRCB 5AFUL 2IC6A 4N78D 4YY3T 2W2UA 4PNIA 3F2EA 4DV4T 4DV1T 3SQ9A 5HCMA 2XNTA 5IWAT 3PJAA 1H7CA 4BAYB 3AE5A 5AQHB 2XY8B 4ZEYA 2VK9A 3RC8A 2WN9A 5F3JA 2V7MA 4CN6A 2HHHT 4U3CA 3BQLA 3N9QA 5AQPB 3TKLB 4DUZT 4J2CA 4P0BA 4YHJA 4PK5A 2FJBA 3ZLIA 4PIRA 4DR6T 4NXMT 4EZHA 2LOPA 5KMGP 3I9YA 1E2AA 4LMLA 4B6XA 4ZI3D 3O1HA 4EV6A 4JEUB 1N34T 1D0YA 2Q9QC 2Q9QA 4DNDA 2IW5B 2LHRA 3T1HT 3ZMUB 2KXPB 4I0UA 2V1DB 3MJXA 5ADXL 2CWYA 5FP3A 3I1AA 5L2LA 3CQXC 1YKEB 4WNKA 3NKZA 3P50A 5L3BB 2W63A 5J2UE 4H63H 1W9RA 2RP4A 2W00A 5AQMB 2XSBA 2K9AA 2VURA 4KI0F 3C64A 4I50E 4TN7B 3O9XA 2DCFA 3QC9A 2XAQB 2YMEA 4GYRA 2LT3A 4UM3P 4B3TT 1G8XA 4ILBA 3RKGA 3QOFA 2IDOB 5SYOA 2EHOB 4QH5A 4ZK4A 3UFEA 2QA7A 2NTYA 1LVFA 3UFGA 2YK0A 4TV9E 4E7ZA 2CA5A 2WB5A 4GK5E 2AE9A 3I0OA 2G0UA 5AQTB 1I9BA 2LHNA 3ANWA 4TZ4C 3WIPA 1T98A 4LFBT 4HWHA 1IJ5A 1D0ZA 3O1JA 5CJ5A 1QSDA 1HR0T 4GOUA 3ZJ2A 4LMJA 3ZC1A 5L3FB 1D0XA 3PURA 1IBMT 3CX6B 3KINB 2EHOA 3RIAA 4WV9A 3QK6A 4UVAB 4P09A 5JRCA 3VKGA 1E7PA 3AB3B 2OV9A 2C0SA 2XQAA 3ZT5A 5LHHB 5HEJA 1D1AA 5HXSA 4EGWA 2OA5A 4IGUA 4G63A 3FB2A 4X64T 4PJLA 5KXJA 3E22E 3AAAB 1LRZA 4JI6T 4X66T 4AKGA 3JCFA 4ILUA 2VKJA 1T7SA 2LLYA 2ZLYA 2CBIA 5HWXA 3LK42 3FBLA 1R8IA 2M67A 4X5TA 4B3RT 5AFKA 3U8NA 4BJNA 3ESLA 4YJ2E 4P0AA 2K24A 1HG5A 5JMEA 3ABVA 4JV5T 3WTHA 2JJ9A 3CIRA 2UXXB 5TVCA 3T1YT 2JQKA 2BYSA 3H37A 2V7JA 3N9MA 4LF4T 4TWDA 1X79A 4AQGA 2MYSA 1W09A 5JDLA 2HPJA 3L3PA 2BYNA 2XAGB 4OYKA 2BG9C 1DU2A 3KVBA 3CWZB 1HF8A 2CXLA 4UXNB 2XAHB 4YSZA 5AQUB 5LG3A 2E9XD 2CPTA 1KFYA 2D0UA 5HYAA 2NP9A 1HX1B 4UXUA 4HWFA 2V6YB 4HTEA 4IE6A 4ALXA 2Z6EA 2WSSV 1AJ3A 2YU1A 3VU7H 2X68A 1G73A 4ZK1A 2WMOA 3ZT7A 5M4YA 3PDYA 3PUXF 1UK5A 3ZMTB 3TLWA 3ZDGA 4AQFC 3C50A 4DBQA 2N2NA 4DR2T 3UU5A 3ANWB 2WDRA 1ZHCA 2XUEA 2BKPA 3C4WA 4X62T 2MTQA 2MPKA 5EZYE 5JR9C 4YT0A 3L39A 1N32T 3TLUA 4GKJT 3U3IA 4YTPA 3N2OA 4PK6A 3L09A 4CN1A 1ZKEA 3OPCA 2EHOD 1WFDA 4GK0E 1MIYA 5HEUA 3JAEA 2H89A 2Y6XA 1V9DA 3SRZA 4ZI2C 3P4WA 3R84B 2YOEA 1VRBA 1O3XA 4CXWA 1WYCA 5EK2A 5JH7E 2KSRA 3ZSTA 2X67A 3P4QA 4QACA 2JMHA 4TUYE 3PEOA 5FJVA 2HPLA 3D0TA 4BFQA 4KMCA 3KV9A 3ZYLA 4AFTA 4COFA 2X9YA 4OK0A 2Y7YA 4IDPA 1XDOA
chains in the Genus database with same CATH topology
4LMLA 2WNJA 3RIAA 5HCJA 5CFBA 4WV9A 4UXUA 2YN6A 2LKHA 3TLVA 4HFCA 3C84A 4B5DA 2WZYA 3U8MA 4NZBA 5AFMA 5LXBA 2XYSA 4IL9A 3RQWA 4QH4A 4ALXA 5J5FA 3SH1A 4IREA 2XQAA 2UZ6A 3WTJA 3WTKA 3WTNA 4A98A 5L4HA 2YMDA 5HEJA 2QC1B 2X00D 5AFHA 1UX2A 2WNLA 4ZK1A 5HEHA 2C9TA 2BG9E 5AFNA 3EAMA 2W8FA 2BG9A 3SIOA 5L4EA 2VL0A 1OEDC 5AINA 4D01A 5IUXA 4HFBA 2XQ8A 2XNVA 2XZ5A 5BRXA 5HEOA 2M6BA 2PH9A 3TLWA 2BYQA 4ILCA 3P50A 4F8HA 3RHWA 4QH1A 3ZDGA 3TLTA 4UM1A 5KZUA 2XQ6A 2LLYA 3ZKRA 5L47A 4ZJSA 3JAFA 3JADA 4X5TA 2BJ0A 5AFKA 4BQTA 3UU5A 3U8NA 2XQ5A 4AFHA 2M6IA 3UU4A 4HFHA 4UM3A 4ZZBA 3EI0A 3UU3A 3WTIA 3IGQA 4UY2A 3TLUA 2YMEA 3RI5A 2W8GA 3LSVA 1UW6A 3GUAA 2XYTA 2LKGA 2LM2A 3EHZA 4TWFA 4ZZCA 1UV6A 4UM3P 4EZ1A 5JMEA 4AFGA 4ILBA 2X00A 4IL4A 5HEGA 2XQ7A 3RQUA 2Y58A 3SQ6A 3T4MA 2BR7A 3WTHA 4FRRA 5SYOA 4ZJTA 3SQ9A 4QH5A 4XHEA 5TVCA 5HCMA 4HFEA 3WTMA 4ZK4A 2XNTA 5BW2A 2XQ4A 2BYSA 2XNUA 2BG9B 2PGZA 4UM3S 4HFIA 5HEUA 5AFMB 3RIFA 3WTLA 3UQ4A 3JAEA 4NPPA 5J5GA 4DBMA 5J0ZA 3UU6A 4TNVA 2BR8A 3P4WA 5BP0A 4TWDA 5J5IA 2YOEA 2WN9A 4Z91A 2YKSA 2XQ9A 2Y54A 4A97A 1OEDE 3UU8A 1OEDA 2BYNA 2BG9C 1I9BA 4QABA 5KE4A 4HFDA 2KSRA 4ZR6A 1OEDB 3UUBA 3WIPA 5J5HA 4QACA 2WNCA 4Z90A 2BYPA 3U8KA 3UQ7A 4PIRA 2MAWA 5AFJA 2Y57A 3PEOA 4ILAA 5FJVA 2Y56A 4HQPA 2ZJVA 4QAAA 5CO5A 4BFQA 3ZDHA 2ZJUA 3C79A 3WTOA 2XZ6A 2XQ3A 2BYRA 4XK9A 4TNWA 4COFA 4ZRUA 4AFTA 3U8JA 4TWHA 5LG3A 4LMJA 3TLSA 3U8LA 2Y7YA 4LMKA 3PMZA 5AFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LML A;  2WNJ A;  3RIA A;  5HCJ A;  5CFB A;  4WV9 A;  4UXU A;  2YN6 A;  2LKH A;  3TLV A;  4HFC A;  3C84 A;  4B5D A;  2WZY A;  3U8M A;  4NZB A;  5AFM A;  5LXB A;  2XYS A;  4IL9 A;  3RQW A;  4QH4 A;  4ALX A;  5J5F A;  3SH1 A;  4IRE A;  2XQA A;  2UZ6 A;  3WTJ A;  3WTK A;  3WTN A;  4A98 A;  5L4H A;  2YMD A;  5HEJ A;  2QC1 B;  2X00 D;  5AFH A;  1UX2 A;  2WNL A;  4ZK1 A;  5HEH A;  2C9T A;  2BG9 E;  5AFN A;  3EAM A;  2W8F A;  2BG9 A;  3SIO A;  5L4E A;  2VL0 A;  1OED C;  5AIN A;  4D01 A;  5IUX A;  4HFB A;  2XQ8 A;  2XNV A;  2XZ5 A;  5BRX A;  5HEO A;  2M6B A;  2PH9 A;  3TLW A;  2BYQ A;  4ILC A;  3P50 A;  4F8H A;  3RHW A;  4QH1 A;  3ZDG A;  3TLT A;  4UM1 A;  5KZU A;  2XQ6 A;  2LLY A;  3ZKR A;  5L47 A;  4ZJS A;  3JAF A;  3JAD A;  4X5T A;  2BJ0 A;  5AFK A;  4BQT A;  3UU5 A;  3U8N A;  2XQ5 A;  4AFH A;  2M6I A;  3UU4 A;  4HFH A;  4UM3 A;  4ZZB A;  3EI0 A;  3UU3 A;  3WTI A;  3IGQ A;  4UY2 A;  3TLU A;  2YME A;  3RI5 A;  2W8G A;  3LSV A;  1UW6 A;  3GUA A;  2XYT A;  2LKG A;  2LM2 A;  3EHZ A;  4TWF A;  4ZZC A;  1UV6 A;  4UM3 P;  4EZ1 A;  5JME A;  4AFG A;  4ILB A;  2X00 A;  4IL4 A;  5HEG A;  2XQ7 A;  3RQU A;  2Y58 A;  3SQ6 A;  3T4M A;  2BR7 A;  3WTH A;  4FRR A;  5SYO A;  4ZJT A;  3SQ9 A;  4QH5 A;  4XHE A;  5TVC A;  5HCM A;  4HFE A;  3WTM A;  4ZK4 A;  2XNT A;  5BW2 A;  2XQ4 A;  2BYS A;  2XNU A;  2BG9 B;  2PGZ A;  4UM3 S;  4HFI A;  5HEU A;  5AFM B;  3RIF A;  3WTL A;  3UQ4 A;  3JAE A;  4NPP A;  5J5G A;  4DBM A;  5J0Z A;  3UU6 A;  4TNV A;  2BR8 A;  3P4W A;  5BP0 A;  4TWD A;  5J5I A;  2YOE A;  2WN9 A;  4Z91 A;  2YKS A;  2XQ9 A;  2Y54 A;  4A97 A;  1OED E;  3UU8 A;  1OED A;  2BYN A;  2BG9 C;  1I9B A;  4QAB A;  5KE4 A;  4HFD A;  2KSR A;  4ZR6 A;  1OED B;  3UUB A;  3WIP A;  5J5H A;  4QAC A;  2WNC A;  4Z90 A;  2BYP A;  3U8K A;  3UQ7 A;  4PIR A;  2MAW A;  5AFJ A;  2Y57 A;  3PEO A;  4ILA A;  5FJV A;  2Y56 A;  4HQP A;  2ZJV A;  4QAA A;  5CO5 A;  4BFQ A;  3ZDH A;  2ZJU A;  3C79 A;  3WTO A;  2XZ6 A;  2XQ3 A;  2BYR A;  4XK9 A;  4TNW A;  4COF A;  4ZRU A;  4AFT A;  3U8J A;  4TWH A;  5LG3 A;  4LMJ A;  3TLS A;  3U8L A;  2Y7Y A;  4LMK A;  3PMZ A;  5AFL A; 
#chains in the Genus database with same CATH topology
 1I6Z A;  5CA1 E;  5FL1 A;  5DJQ C;  4H9S E;  4U74 A;  1HX8 A;  4CN4 A;  4IIJ E;  2XAS B;  2LSG A;  3PJA J;  2ZM2 A;  4DV3 T;  3FZK B;  3K3N A;  3FZL B;  5LCY A;  2K5B B;  4KUM B;  4D01 A;  3BQI A;  5JDG A;  4WZX A;  3AEE A;  4PK4 A;  3Q5E A;  5AQO B;  4DVD A;  4WYV A;  3NZQ A;  4UV8 B;  1D1B A;  1I94 T;  5DQW A;  2VAS A;  3JAD A;  2BJ0 A;  3VHL A;  2VVS A;  3Q5D A;  3W15 B;  1XWM A;  2QRX A;  4EZ1 A;  2BKN A;  4DBR A;  2UUC T;  3WTM A;  3HKC E;  2P9B A;  5TAO A;  4DBM A;  2ZM0 A;  1MIV A;  2CMR A;  1OED A;  3ETV A;  3HL6 A;  2WM9 A;  3ZCI A;  2F4V T;  3CQG B;  4DR7 T;  2Y57 A;  1LVK A;  3AA0 B;  3ZEF B;  2L8K A;  3CKD A;  2ZJU A;  1HNX T;  3TLS A;  2KIN B;  3ONJ A;  1OXZ A;  4WBN E;  4BA9 A;  3ONX A;  3NWI A;  4AIU A;  5HCJ A;  4X1K E;  3PUZ F;  2VB6 A;  1KNP A;  2YDR A;  3C84 A;  1Y64 B;  4B5D A;  4UEM A;  3C51 A;  2E5V A;  3AE9 A;  4JLE A;  3KBU A;  4C90 A;  4OFZ A;  2H7O A;  4L9I A;  3E0Z A;  2J47 A;  1MMN A;  2CHO A;  3EAM A;  3SIO A;  3RF1 A;  1OED C;  5AIN A;  4HFB A;  2XQ8 A;  5FVK A;  3RHW A;  4LFA T;  3NZP A;  2E9X A;  3M65 A;  2MOZ A;  1WCR A;  3KVA A;  4ZS2 A;  1YD8 G;  5KDM C;  2ODV A;  3BQK A;  3EI0 A;  5AQJ B;  3UU3 A;  2FJA A;  4DV2 T;  4UY2 A;  4X65 T;  2YIN A;  4KP3 C;  2PFV A;  1N36 T;  3SQ6 A;  4FRR A;  3RYF E;  4ZJT A;  2JIW A;  2CXD A;  3ZN0 B;  2PBI A;  2PGZ A;  2KT9 A;  5LGU B;  3PE0 A;  3DTO A;  2E8I A;  2I59 A;  3P4S A;  5J5I A;  2X51 A;  2YKS A;  4Z91 A;  2CHN A;  3N9N A;  2Y54 A;  3CML A;  1YXR A;  4ZR6 A;  1US7 B;  5JR9 B;  4GIW A;  3LJC A;  2VKD A;  3UUL A;  4PJM A;  1XNR T;  4JI3 T;  3ZSS A;  2WU5 A;  2DL1 A;  5LOV E;  2UXB T;  4LMK A;  5JDF A;  2UXN B;  2CXF A;  5AFL A;  2PTF A;  1WLX A;  2YDS A;  4JI0 T;  1XZY A;  3RIU C;  5IYZ E;  2CBJ A;  1FMW A;  4H9R C;  5AFH A;  4IT4 A;  2BZB A;  2FJD A;  3VR8 A;  2LSI A;  5IUX A;  5EK3 A;  2Y8D A;  4OHF A;  4DV5 T;  3I0Q A;  4ZJS A;  4UF0 B;  2VWA A;  2DWG A;  3FBZ A;  5JQG E;  3WAJ A;  4U31 A;  2BS3 A;  4UR9 A;  2NOX A;  4FJO A;  5A1L A;  3KBT A;  2DHR A;  3MK7 C;  4Z8X A;  1L0V A;  2XZE A;  2W8G A;  3GN5 A;  3EHZ A;  5FNV E;  1UV6 A;  1ZEE A;  2H7V C;  1U4Q A;  4X1Y E;  4HFE A;  4DV6 T;  5AFM B;  3UQ4 A;  2KWH A;  3X1D A;  5J0Z A;  5C2T A;  5E0O A;  1OED E;  4U7I A;  1ZP0 A;  1KEY A;  4HFD A;  4CZZ B;  2CM0 A;  3AVR A;  5LGN B;  3PUG A;  2MAW A;  5J2T E;  2ACX A;  1XDP A;  3GN5 B;  3LBX B;  4TNW A;  2MBG A;  1T8B A;  1SUM B;  2JMK A;  3HA4 A;  1KNR A;  4MLK A;  2X9H A;  3FXE B;  3TLV A;  2WDV A;  4HEA A;  2CRB A;  5L3G B;  3CPZ A;  3IEE A;  4IL9 A;  2BVL A;  5F5W A;  3JC6 C;  3N5L A;  4CXX A;  1HS7 A;  2YMD A;  2IML A;  2ACZ A;  2BS2 A;  4U2Z A;  3ZYK A;  4EIW A;  1IBL T;  3A8Y C;  2WAU A;  2BG9 A;  3QNU A;  2VL0 A;  2XM2 A;  4O2A E;  3P7I A;  2IC9 A;  5BRX A;  2HH7 A;  3EAB A;  3UT5 E;  4UM1 A;  3RC3 A;  4CI3 B;  2XQ6 A;  3PV0 F;  4I4T E;  3O1I A;  3S4U A;  4EB6 E;  3JAF A;  3AEF A;  3FXD B;  2L9Q A;  2WU2 A;  2XM1 A;  3RYI E;  5HXR A;  4NUV A;  3M3Z B;  4O4J E;  2XYT A;  2LKG A;  3Q2M A;  2XHE B;  5LGT B;  2B1E A;  3KFW X;  4ZI3 C;  5FXW A;  5BW2 A;  4BJM A;  2BG9 B;  3RIF A;  2JQH A;  2WCA A;  3KV6 A;  4TNV A;  5AQI B;  5BP0 A;  2LJL A;  2LSJ A;  2ODU A;  4IE5 A;  4ZI7 E;  4JI8 T;  4K0K T;  4KHP T;  2W0G A;  3K3Q C;  5FY1 A;  3OBV E;  3ZMZ B;  1UUR A;  5ABF B;  3AE4 A;  5JR9 A;  2Y56 A;  4UV9 B;  2LM9 A;  4ASK A;  3QUJ A;  4EYY R;  2EHO C;  2NTX A;  4EXT A;  5KX5 E;  2YN6 A;  2LKH A;  3F31 A;  1D1C A;  3CX8 B;  2XYS A;  3AVS A;  1VCT A;  2UZ6 A;  2WWV A;  1FJG T;  3CX7 B;  4M1P A;  1WR6 A;  4O4L E;  5FKY A;  5AQK B;  3MZK B;  2WNL A;  1QLB A;  3AE8 A;  3PUV F;  3SS1 A;  4AIS A;  2W61 A;  3ZMS B;  2LEH A;  1NAF A;  3AE2 A;  2L3L A;  2QGS A;  4F8H A;  4QH1 A;  4LF9 T;  3HR0 A;  5ETW A;  5L47 A;  3WAK A;  5LJN A;  3MKD A;  2UXD T;  4UF0 A;  4AFH A;  4HFH A;  2KWI B;  3AAI A;  5CB4 E;  2D5U A;  2SPC A;  2ZMA A;  3GWH A;  3T4M A;  5JTG A;  4A56 A;  1ZV4 X;  5HAX A;  1JNR A;  5LBQ B;  4HFI A;  4CI2 B;  4U72 A;  1JNZ A;  4NPP A;  3ZC0 A;  5FY0 A;  2ES0 A;  2KZ7 B;  1FMV A;  4JI7 T;  3UU8 A;  4EEB A;  3OKQ A;  4IDQ A;  2WMN A;  5H6Q B;  3RYC E;  1OWA A;  4HWI B;  2ZJV A;  5CO5 A;  3C79 A;  4I43 B;  3PUS A;  3L8R A;  3IF8 B;  3V5U A;  3U8L A;  4QX7 B;  3PMZ A;  3FZF B;  2X9W A;  2WNJ A;  2V5C A;  4HFC A;  2WBL A;  3NBX X;  3RQW A;  4OX9 T;  2Y48 B;  1BR1 A;  4LFC T;  2X00 D;  1S35 A;  2HN1 A;  2NW9 A;  3T8O A;  3LFM A;  2A2F X;  2XZ5 A;  2E9X B;  2UUA T;  5KZU A;  2A3D A;  1UUS A;  3FHN A;  2X0L B;  2WWU A;  3ETU A;  2VKO A;  2AXD S;  1MMA A;  1QUU A;  2BKO A;  5BMV E;  5L3C B;  3AA6 B;  2X66 A;  4H9Q C;  4XBF B;  4DO0 A;  4AFG A;  5IHY A;  2JQ9 A;  4IL4 A;  5HEG A;  4B3S T;  5FVL A;  2CEA A;  1Z0P A;  2XQ4 A;  3OYZ A;  5ABH A;  4JI5 T;  4IHJ E;  2D2S A;  2BR8 A;  4YLH A;  2BDE A;  1MND A;  3N2G E;  4FI5 A;  4KX6 A;  1VOM A;  2C5I T;  5ABE A;  5LYJ E;  3UUB A;  4P1N A;  3KV5 A;  1EZ3 A;  5ABF A;  2A9U A;  2LRL A;  5LMN T;  4L5G A;  3C98 B;  4EAH A;  4IST A;  2LSK A;  2WZY A;  4PFP A;  2VQF T;  4PAG A;  3H3A A;  3CK6 A;  1W0A A;  2QC1 B;  2CLY C;  4IE4 A;  4UEL A;  1CUN A;  5LBM A;  2W8F A;  3PUQ A;  4V1A v;  2IHR 1;  2M6B A;  3P4R A;  4KBM B;  3SWH A;  3AXJ A;  4AKL A;  2DLR A;  3AEC A;  3KDS E;  4IE7 A;  2LE8 A;  5JDH A;  3K8P C;  2W4X A;  1BR0 A;  4UVC B;  5LJM A;  2RA1 A;  3GUA A;  1FEW A;  3C4X A;  4TWF A;  5LHG B;  1HG2 A;  1KK7 A;  2XQ7 A;  3H3M A;  4IE0 A;  3AA1 B;  3OYX A;  2R6G F;  3N9O A;  4XHE A;  3A7M A;  2Q9Q B;  2NW7 A;  3B13 A;  5L3D B;  3CQC B;  3B5M A;  4IDO A;  2K3W A;  3ZPO A;  3B57 A;  3AE1 A;  2A72 A;  4H9P C;  4QKN A;  5FYM A;  2DWK A;  2BBH A;  2BVM A;  3Q9D A;  3U8K A;  2X0H A;  4PFO A;  3LBX A;  4AKH A;  3AE3 A;  4HKA A;  2XZ6 A;  2XQ3 A;  4TWH A;  1YQ4 A;  3J9X 1;  1HFA A;  1UX4 A;  4MHC A;  1Z8U A;  1T72 A;  4H9O C;  5AQN B;  2UU9 T;  2V7L A;  3Q5X A;  3U78 A;  2KLQ A;  3RPU A;  2N1G A;  4A98 A;  5L4H A;  1NWM X;  2IUB A;  4NIQ A;  3PUA A;  4HWD A;  5HEH A;  4DMV A;  4U2Y A;  3OVU A;  4WW0 A;  3WI3 A;  2CE7 A;  3N9L A;  5HEO A;  3ONL C;  4ILC A;  4JEH B;  3UTK A;  1GQE A;  2WZI A;  3QB5 A;  5CA0 E;  5AQF B;  4X1I E;  4JBW F;  3LDQ B;  4O4H E;  3RRW A;  5LG4 A;  3IGQ A;  2K48 A;  3LSV A;  1UW6 A;  2KMF A;  4JI4 T;  4HFV A;  3N2K E;  5AQQ B;  2VKH A;  3JC6 D;  4YJ3 E;  1UCU A;  2V6X A;  2I6H A;  4HGA A;  2BBJ A;  2B76 A;  1B7T A;  4YFS A;  2WZH A;  3PTR B;  5LB7 B;  2ZM8 A;  4MAL A;  1YKH B;  2E5L T;  4ANJ A;  3RLF F;  3DP7 A;  4Z90 A;  2I0M A;  4YSX A;  5AQG B;  3IA3 A;  1WR0 A;  5BR8 T;  3AXJ B;  3EDV A;  4IDZ A;  3WTO A;  3FZM B;  4ZRU A;  3HKB E;  4ZXL A;  2W62 A;  4X20 E;  4DV0 T;  1N33 T;  3ZYM A;  3IHR A;  4QH4 A;  2FBW A;  4QWN B;  4IRE A;  4YXD A;  4LF6 T;  4K0U A;  1XMO T;  3OJA A;  5CGM A;  5F8P A;  3N9P A;  1SHZ C;  3AEB A;  4TV8 E;  3RH3 A;  4ZHQ E;  4DID B;  4JYA T;  5LP6 E;  2PH9 A;  4O4I E;  4CI1 B;  4AKR B;  3ZMV B;  4XZC A;  3R6N A;  2C5J A;  3UUX B;  1IJ6 A;  3K1S A;  2XJ7 A;  4DR4 T;  5FY7 A;  1XNQ T;  2W67 A;  4BQT A;  5HWY A;  4DUY T;  4A5X A;  4CQI A;  2J4G A;  1U5P A;  4QXH B;  3RI5 A;  4QX8 B;  4ERR A;  5DAB A;  5FL0 A;  1MIW A;  1J5E T;  5C8Y E;  5HXH A;  3RGL A;  3RYH E;  2VL8 A;  3NRY A;  2V6Y A;  5JDM A;  3WTL A;  2LSY A;  2Q9Q D;  3DJB A;  2J62 A;  4EOZ B;  4PJN A;  2PJQ A;  3J7Y q;  2E9X C;  4JUY A;  3UUM A;  5KE4 A;  3SFD A;  1IBK T;  4C91 A;  4I55 E;  4JI1 T;  1UX5 A;  2WNC A;  2BYP A;  3FZH B;  5FXX A;  4ILA A;  3UUN A;  1LKX A;  2JPF A;  4QXB B;  4AQF A;  3EUH A;  2IAK A;  5JDQ A;  4YTM A;  2QVA A;  2YDQ A;  2HN2 A;  5LXT E;  3QB5 K;  1BR4 A;  4L0R A;  1IZN B;  5AFM A;  1X9B A;  2XAF B;  4HN9 A;  1CHU A;  3AA7 B;  5ABG A;  1Y01 A;  5AFN A;  4QHO A;  2UXC T;  1MMG A;  4U33 A;  2DI4 A;  1NEN A;  1E1H B;  5AQL B;  3MAC A;  3TLT A;  1KF6 A;  4ZOL E;  2VQE T;  4UVB B;  4ZZB A;  2CWO A;  2N9D A;  3WTI A;  4HWC A;  2V8S V;  2LM2 A;  4ZZC A;  3V5S A;  1S94 A;  3RRC A;  4NUU A;  4YHH T;  2X00 A;  4AKI A;  3RQU A;  4GKK T;  1SA0 E;  4TX5 A;  2WQY A;  2DNX A;  2D9D A;  2XNU A;  3AE6 A;  4EED A;  4Q25 A;  2CCQ A;  5L3E B;  4XAX B;  3F57 A;  1MMD A;  2WY2 A;  4MBQ A;  3CVR A;  2RPA A;  3LG7 A;  4YSY A;  3ZN1 B;  4H9N C;  3UQ7 A;  5AFJ A;  2XPK A;  4ADZ A;  2XQY A;  3ZJ1 A;  1WYB A;  1IAP A;  2BYR A;  1ZOY A;  5AQV B;  2W66 A;  2FJE A;  3I9W A;  3IBP A;  3SFE A;  5J5F A;  4OYJ A;  4AQY T;  3P4P A;  3LK3 B;  2C9T A;  2VVN A;  1SE7 A;  3G06 A;  3AE7 A;  2LRK A;  3K3O A;  1UGO A;  3HI2 A;  1HTJ F;  4DR1 T;  2E2A A;  2XTL A;  4AI6 A;  3VKH A;  4UIG A;  2OLT A;  5H6R B;  3BK9 A;  5HXC A;  2V7K A;  3PU3 A;  4F6R C;  5GON E;  2QYW A;  4O8S A;  2Y58 A;  5AQR B;  4CXY A;  3SOL A;  1HNZ T;  4UM3 S;  4MFR A;  3VRA A;  5C3J A;  3UU6 A;  3PUW F;  3GMI A;  1KNZ A;  2GK9 A;  2XQ9 A;  2JRK A;  4EYU A;  2YU2 A;  1M7K A;  4QAB A;  2YEV C;  1BR2 A;  3MXZ A;  1OED B;  1NEK A;  3VR9 A;  1FIO A;  4HQP A;  2J1D G;  3ZDH A;  3KV4 A;  3ZT6 A;  3PUY F;  3A5X A;  5FXV A;  1J5W A;  5LNK A;  2ZM6 T;  5CFB A;  4ZI2 D;  5JVD E;  3RIU A;  4WBO A;  3U8M A;  4NZB A;  5LXB A;  3C4Z A;  4EZ4 A;  4PW8 A;  4G2A A;  3SH1 A;  3WTJ A;  4DMW A;  3NVO A;  4LF7 T;  3WTN A;  2CLY B;  1MNE A;  1UX2 A;  1HCI A;  2JQQ A;  3EDU A;  2BG9 E;  2V5D A;  2V7I A;  2NWB A;  5HXE A;  4E7S A;  2XNV A;  5LMU T;  1YQ3 A;  3AED A;  3AAE B;  3ZCJ A;  1VCS A;  1HNW T;  3ZKR A;  5FXZ A;  3LK2 B;  4GYS A;  4HE8 A;  4DR5 T;  2V26 A;  3MA9 A;  2XSA A;  2XQ5 A;  3UU4 A;  3Q5W A;  4UM3 A;  3GA8 A;  2IIU A;  2H88 A;  3HKE E;  1WRD A;  4JI2 T;  2FUP A;  5FMN A;  4KHZ F;  2BR7 A;  5DQV A;  5AQS B;  4LF8 T;  3NRX A;  3AEG A;  2H3R A;  5J5G A;  5LHI B;  3AEA A;  2X9X A;  3RX6 A;  4LF5 T;  4A97 A;  2PG8 A;  4YTN A;  2NR4 A;  2LOS A;  3P8C D;  4H63 V;  5J5H A;  1YW0 A;  4QXC B;  4AXP A;  4QAA A;  2XAJ B;  2D0T A;  4XK9 A;  4ISS A;  1XMQ T;  3U8J A;  4DV7 T;  1J1J A;  1M62 A;  3O4X E;  1W0B A;  2C5K T;  5JRE A;  2WS3 A;  5LA6 E;  4DR3 T;  4U7Y A;  5JDN A;  3PU8 A;  3WTK A;  2KND A;  4NXN T;  3OTO T;  4PJJ A;  2WP9 A;  5L4E A;  3EVY A;  4B3M T;  2BYQ A;  2UUB T;  4ZS3 A;  4IDN A;  5EK4 A;  2WDQ A;  4O2B E;  3VRB A;  2X0Y A;  2M6I A;  2NW8 A;  5J1G A;  2BS4 A;  3E08 A;  3RKO A;  3HKD E;  5JRC B;  5AFU L;  2IC6 A;  4N78 D;  4YY3 T;  2W2U A;  4PNI A;  3F2E A;  4DV4 T;  4DV1 T;  3SQ9 A;  5HCM A;  2XNT A;  5IWA T;  3PJA A;  1H7C A;  4BAY B;  3AE5 A;  5AQH B;  2XY8 B;  4ZEY A;  2VK9 A;  3RC8 A;  2WN9 A;  5F3J A;  2V7M A;  4CN6 A;  2HHH T;  4U3C A;  3BQL A;  3N9Q A;  5AQP B;  3TKL B;  4DUZ T;  4J2C A;  4P0B A;  4YHJ A;  4PK5 A;  2FJB A;  3ZLI A;  4PIR A;  4DR6 T;  4NXM T;  4EZH A;  2LOP A;  5KMG P;  3I9Y A;  1E2A A;  4LML A;  4B6X A;  4ZI3 D;  3O1H A;  4EV6 A;  4JEU B;  1N34 T;  1D0Y A;  2Q9Q C;  2Q9Q A;  4DND A;  2IW5 B;  2LHR A;  3T1H T;  3ZMU B;  2KXP B;  4I0U A;  2V1D B;  3MJX A;  5ADX L;  2CWY A;  5FP3 A;  3I1A A;  5L2L A;  3CQX C;  1YKE B;  4WNK A;  3NKZ A;  3P50 A;  5L3B B;  2W63 A;  5J2U E;  4H63 H;  1W9R A;  2RP4 A;  2W00 A;  5AQM B;  2XSB A;  2K9A A;  2VUR A;  4KI0 F;  3C64 A;  4I50 E;  4TN7 B;  3O9X A;  2DCF A;  3QC9 A;  2XAQ B;  2YME A;  4GYR A;  2LT3 A;  4UM3 P;  4B3T T;  1G8X A;  4ILB A;  3RKG A;  3QOF A;  2IDO B;  5SYO A;  2EHO B;  4QH5 A;  4ZK4 A;  3UFE A;  2QA7 A;  2NTY A;  1LVF A;  3UFG A;  2YK0 A;  4TV9 E;  4E7Z A;  2CA5 A;  2WB5 A;  4GK5 E;  2AE9 A;  3I0O A;  2G0U A;  5AQT B;  1I9B A;  2LHN A;  3ANW A;  4TZ4 C;  3WIP A;  1T98 A;  4LFB T;  4HWH A;  1IJ5 A;  1D0Z A;  3O1J A;  5CJ5 A;  1QSD A;  1HR0 T;  4GOU A;  3ZJ2 A;  4LMJ A;  3ZC1 A;  5L3F B;  1D0X A;  3PUR A;  1IBM T;  3CX6 B;  3KIN B;  2EHO A;  3RIA A;  4WV9 A;  3QK6 A;  4UVA B;  4P09 A;  5JRC A;  3VKG A;  1E7P A;  3AB3 B;  2OV9 A;  2C0S A;  2XQA A;  3ZT5 A;  5LHH B;  5HEJ A;  1D1A A;  5HXS A;  4EGW A;  2OA5 A;  4IGU A;  4G63 A;  3FB2 A;  4X64 T;  4PJL A;  5KXJ A;  3E22 E;  3AAA B;  1LRZ A;  4JI6 T;  4X66 T;  4AKG A;  3JCF A;  4ILU A;  2VKJ A;  1T7S A;  2LLY A;  2ZLY A;  2CBI A;  5HWX A;  3LK4 2;  3FBL A;  1R8I A;  2M67 A;  4X5T A;  4B3R T;  5AFK A;  3U8N A;  4BJN A;  3ESL A;  4YJ2 E;  4P0A A;  2K24 A;  1HG5 A;  5JME A;  3ABV A;  4JV5 T;  3WTH A;  2JJ9 A;  3CIR A;  2UXX B;  5TVC A;  3T1Y T;  2JQK A;  2BYS A;  3H37 A;  2V7J A;  3N9M A;  4LF4 T;  4TWD A;  1X79 A;  4AQG A;  2MYS A;  1W09 A;  5JDL A;  2HPJ A;  3L3P A;  2BYN A;  2XAG B;  4OYK A;  2BG9 C;  1DU2 A;  3KVB A;  3CWZ B;  1HF8 A;  2CXL A;  4UXN B;  2XAH B;  4YSZ A;  5AQU B;  5LG3 A;  2E9X D;  2CPT A;  1KFY A;  2D0U A;  5HYA A;  2NP9 A;  1HX1 B;  4UXU A;  4HWF A;  2V6Y B;  4HTE A;  4IE6 A;  4ALX A;  2Z6E A;  2WSS V;  1AJ3 A;  2YU1 A;  3VU7 H;  2X68 A;  1G73 A;  4ZK1 A;  2WMO A;  3ZT7 A;  5M4Y A;  3PDY A;  3PUX F;  1UK5 A;  3ZMT B;  3TLW A;  3ZDG A;  4AQF C;  3C50 A;  4DBQ A;  2N2N A;  4DR2 T;  3UU5 A;  3ANW B;  2WDR A;  1ZHC A;  2XUE A;  2BKP A;  3C4W A;  4X62 T;  2MTQ A;  2MPK A;  5EZY E;  5JR9 C;  4YT0 A;  3L39 A;  1N32 T;  3TLU A;  4GKJ T;  3U3I A;  4YTP A;  3N2O A;  4PK6 A;  3L09 A;  4CN1 A;  1ZKE A;  3OPC A;  2EHO D;  1WFD A;  4GK0 E;  1MIY A;  5HEU A;  3JAE A;  2H89 A;  2Y6X A;  1V9D A;  3SRZ A;  4ZI2 C;  3P4W A;  3R84 B;  2YOE A;  1VRB A;  1O3X A;  4CXW A;  1WYC A;  5EK2 A;  5JH7 E;  2KSR A;  3ZST A;  2X67 A;  3P4Q A;  4QAC A;  2JMH A;  4TUY E;  3PEO A;  5FJV A;  2HPL A;  3D0T A;  4BFQ A;  4KMC A;  3KV9 A;  3ZYL A;  4AFT A;  4COF A;  2X9Y A;  4OK0 A;  2Y7Y A;  4IDP A;  1XDO A; 
#chains in the Genus database with same CATH homology
 4LML A;  2WNJ A;  3RIA A;  5HCJ A;  5CFB A;  4WV9 A;  4UXU A;  2YN6 A;  2LKH A;  3TLV A;  4HFC A;  3C84 A;  4B5D A;  2WZY A;  3U8M A;  4NZB A;  5AFM A;  5LXB A;  2XYS A;  4IL9 A;  3RQW A;  4QH4 A;  4ALX A;  5J5F A;  3SH1 A;  4IRE A;  2XQA A;  2UZ6 A;  3WTJ A;  3WTK A;  3WTN A;  4A98 A;  5L4H A;  2YMD A;  5HEJ A;  2QC1 B;  2X00 D;  5AFH A;  1UX2 A;  2WNL A;  4ZK1 A;  5HEH A;  2C9T A;  2BG9 E;  5AFN A;  3EAM A;  2W8F A;  2BG9 A;  3SIO A;  5L4E A;  2VL0 A;  1OED C;  5AIN A;  4D01 A;  5IUX A;  4HFB A;  2XQ8 A;  2XNV A;  2XZ5 A;  5BRX A;  5HEO A;  2M6B A;  2PH9 A;  3TLW A;  2BYQ A;  4ILC A;  3P50 A;  4F8H A;  3RHW A;  4QH1 A;  3ZDG A;  3TLT A;  4UM1 A;  5KZU A;  2XQ6 A;  2LLY A;  3ZKR A;  5L47 A;  4ZJS A;  3JAF A;  3JAD A;  4X5T A;  2BJ0 A;  5AFK A;  4BQT A;  3UU5 A;  3U8N A;  2XQ5 A;  4AFH A;  2M6I A;  3UU4 A;  4HFH A;  4UM3 A;  4ZZB A;  3EI0 A;  3UU3 A;  3WTI A;  3IGQ A;  4UY2 A;  3TLU A;  2YME A;  3RI5 A;  2W8G A;  3LSV A;  1UW6 A;  3GUA A;  2XYT A;  2LKG A;  2LM2 A;  3EHZ A;  4TWF A;  4ZZC A;  1UV6 A;  4UM3 P;  4EZ1 A;  5JME A;  4AFG A;  4ILB A;  2X00 A;  4IL4 A;  5HEG A;  2XQ7 A;  3RQU A;  2Y58 A;  3SQ6 A;  3T4M A;  2BR7 A;  3WTH A;  4FRR A;  5SYO A;  4ZJT A;  3SQ9 A;  4QH5 A;  4XHE A;  5TVC A;  5HCM A;  4HFE A;  3WTM A;  4ZK4 A;  2XNT A;  5BW2 A;  2XQ4 A;  2BYS A;  2XNU A;  2BG9 B;  2PGZ A;  4UM3 S;  4HFI A;  5HEU A;  5AFM B;  3RIF A;  3WTL A;  3UQ4 A;  3JAE A;  4NPP A;  5J5G A;  4DBM A;  5J0Z A;  3UU6 A;  4TNV A;  2BR8 A;  3P4W A;  5BP0 A;  4TWD A;  5J5I A;  2YOE A;  2WN9 A;  4Z91 A;  2YKS A;  2XQ9 A;  2Y54 A;  4A97 A;  1OED E;  3UU8 A;  1OED A;  2BYN A;  2BG9 C;  1I9B A;  4QAB A;  5KE4 A;  4HFD A;  2KSR A;  4ZR6 A;  1OED B;  3UUB A;  3WIP A;  5J5H A;  4QAC A;  2WNC A;  4Z90 A;  2BYP A;  3U8K A;  3UQ7 A;  4PIR A;  2MAW A;  5AFJ A;  2Y57 A;  3PEO A;  4ILA A;  5FJV A;  2Y56 A;  4HQP A;  2ZJV A;  4QAA A;  5CO5 A;  4BFQ A;  3ZDH A;  2ZJU A;  3C79 A;  3WTO A;  2XZ6 A;  2XQ3 A;  2BYR A;  4XK9 A;  4TNW A;  4COF A;  4ZRU A;  4AFT A;  3U8J A;  4TWH A;  5LG3 A;  4LMJ A;  3TLS A;  3U8L A;  2Y7Y A;  4LMK A;  3PMZ A;  5AFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...