3UU8A

The glic pentameric ligand-gated ion channel loop2-24' mutant reduced in solution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
molecule keywords Glr4197 protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu8A01
3U8KA 5AFKA 2WN9A 4AFGA 4HFHA 2UZ6A 3TLWA 3ZDGA 5BP0A 4UY2A 5J5HA 3UQ4A 3RQUA 3EI0A 1UW6A 2WZYA 3U8MA 3WTKA 2BG9A 5CFBA 5HEHA 4EZ1A 4ILBA 5HEGA 4HQPA 3IGQA 5AFHA 3UU3A 1OEDA 2LLYA 4UM3P 2YN6A 3UUBA 4HFCA 5TVCA 2MAWA 5J5IA 3UU5A 2YKSA 2XQ7A 3GUAA 5J0ZA 4NZBA 2BG9B 3WTMA 4TNVA 4ILAA 3UQ7A 2XNTA 2XYTA 4UM1A 4ZJTA 4QH1A 4Z90A 2BR8A 3LSVA 3RHWA 5KZUA 4DBMA 4BQTA 3EAMA 2BYQA 3C79A 3T4MA 5AFMB 4ILCA 5J5GA 3WTIA 3P4WA 4D01A 3UU6A 3RQWA 3UU4A 5LXBA 5AFNA 2XNVA 3RIAA 5BRXA 2Y57A 4LMJA 3TLTA 5FJVA 3SQ9A 3WTJA 2VL0A 2XQ6A 3P50A 3ZKRA 3WTHA 4B5DA 5KE4A 4ZRUA 2BYRA 4XHEA 5HEJA 3U8NA 2BYNA 3PEOA 3RI5A 4AFHA 4A97A 4IL9A 2XQ3A 4HFEA 1UX2A 2QC1B 3JADA 2LKGA 2ZJVA 2W8GA 2W8FA 4BFQA 2XYSA 3WIPA 2BG9E 4LMLA 4FRRA 2LKHA 4NPPA 5HEOA 2X00D 2YMDA 3WTNA 2X00A 2XZ5A 4UM3S 5L4EA 3RIFA 4ZZCA 1OEDC 5L47A 2BG9C 3PMZA 4QABA 4QAAA 3ZDHA 4UXUA 3WTOA 3EHZA 4X5TA 4QH4A 2KSRA 2WNCA 4WV9A 4XK9A 5AFLA 5CO5A 2Y54A 4AFTA 4ZK1A 2M6BA 5IUXA 3C84A 4HFIA 4ALXA 2WNJA 5J5FA 2ZJUA 2Y56A 4TWHA 2XZ6A 2BJ0A 3JAEA 3TLSA 4TWDA 5LG3A 4A98A 5AFJA 4ZJSA 4UM3A 5JMEA 4ZZBA 1OEDB 1OEDE 5HCJA 4F8HA 2XQAA 5L4HA 2XNUA 4PIRA 4TNWA 4ZR6A 5BW2A 4COFA 5AFMA 5HCMA 4ZK4A 3WTLA 4HFDA 2YOEA 4TWFA 4IREA 2Y58A 2XQ5A 3SH1A 4HFBA 3SQ6A 3U8JA 5SYOA 2XQ9A 4LMKA 3UU8A 1UV6A 2XQ4A 4QACA 2XQ8A 4Z91A 2Y7YA 2BYSA 3JAFA 2YMEA 3TLUA 2LM2A 4QH5A 3SIOA 5AINA 2C9TA 2M6IA 1I9BA 2BYPA 5HEUA 4IL4A 2BR7A 2WNLA 3TLVA 2PH9A 3U8LA 2PGZA
chains in the Genus database with same CATH superfamily
3N9QA 3PUWF 4HFHA 3A5XA 3T8OA 4IHJE 3BQKA 4P0BA 2CXFA 4U74A 1YD8G 3RYFE 3CWZB 1UCUA 4UF0B 4ZI2D 3RC3A 4GYRA 4PJLA 5J5IA 4GKJT 3IF8B 3PE0A 3EDUA 3KBTA 2BR8A 4BQTA 4DMVA 4ILCA 1S94A 2RP4A 4U31A 2WP9A 4ZI2C 4HFVA 3UU6A 3OYXA 5LXBA 4O2AE 3O4XE 4DR5T 4ILUA 2KXPB 3BK9A 3PV0F 2W0GA 3NKZA 4AFHA 2XSBA 2W8FA 4BFQA 5AQQB 3ABVA 1NEKA 2J4GA 1KK7A 1HNXT 5C3JA 4O4JE 3B57A 4EXTA 1L0VA 1WR6A 1XDPA 2WNCA 4WV9A 5HYAA 1G8XA 3F31A 1W0BA 4ZEYA 3L3PA 2XAJB 3LK3B 1J1JA 2HH7A 3BQIA 5FY7A 4EZ4A 1V9DA 2YEVC 3FBZA 5HXRA 4LMKA 2DWKA 5C2TA 2WDQA 4HWDA 5AINA 3ZN0B 4IE4A 1HCIA 3TLVA 2V7KA 2JQKA 4MFRA 2JMHA 3TLWA 1XZYA 3MA9A 3N9MA 3LBXB 1XMOT 4DV0T 2MAWA 2UUBT 2WMNA 4NZBA 3J7Yq 3WTMA 2QRXA 4DO0A 1BR0A 4ZXLA 3C51A 3N2KE 3EAMA 5ABFB 3O1HA 4D01A 5AFNA 3AEDA 3WTJA 4BJMA 1BR2A 1IBLT 3CX6B 3FB2A 3ZLIA 4UF0A 2UUAT 3AE9A 5FY0A 5FVKA 2UXDT 1NAFA 2VASA 1LRZA 5DABA 3RIFA 2E5VA 5A1LA 2Q9QD 2BG9C 2H88A 4UXUA 2V1DB 2QA7A 2CBJA 3EDVA 5L3GB 4EV6A 5H6RB 2X0LB 2Q9QC 3AE6A 3NRXA 2CWYA 2H3RA 5E0OA 4OX9T 3RRCA 5HWYA 3VRBA 4QWNB 4AIUA 4IREA 1FEWA 3U8JA 4EOZB 2J62A 3RLFF 2XQ8A 5LGUB 3Q9DA 3PJAA 2WBLA 2E9XC 3IBPA 3OBVE 3ZJ1A 3U8LA 3ZMSB 5AQVB 3M65A 2MBGA 5EK4A 2BG9A 5CB4E 4EZ1A 4HGAA 2LSKA 2XPKA 4LFBT 4ILBA 2E9XD 4QX8B 2ES0A 3GN5A 1T72A 1WCRA 2LRLA 4PFOA 1CHUA 4TNVA 1HFAA 2KINB 2EHOB 3C50A 3C79A 3UU4A 3OYZA 3RIAA 2Y57A 2CMRA 3TLTA 4ANJA 3P50A 3ZMTB 2V5DA 2WZHA 3NRYA 3WAKA 4DR4T 4JI5T 2XYSA 1R8IA 4LMLA 1YQ4A 2DI4A 3Q2MA 4I0UA 3RRWA 2CA5A 4BJNA 3I0QA 3P4QA 5IUXA 5J5FA 3H3MA 1LVFA 5LG3A 1X9BA 2VQFT 2LJLA 1W9RA 3ONLC 4MALA 4Z8XA 4PW8A 4PFPA 2LHNA 1W09A 2FUPA 5LG4A 1UV6A 5ETWA 2OV9A 5EK3A 3R84B 2Y7YA 2C9TA 4AQYT 3RH3A 3LK2B 4Q25A 1HNWT 4U7YA 4ZHQE 3AAIA 2XTLA 2LLYA 4HFCA 3ANWB 1YKEB 2K3WA 3UUNA 4UM1A 3PUAA 4KX6A 2X67A 5KZUA 3FZLB 3BQLA 3CK6A 2ODVA 3TKLB 1UK5A 3K3OA 1W0AA 1NENA 2E2AA 1FMVA 4L9IA 4IE0A 2QVAA 3AVSA 4I43B 1XNRT 2NTXA 3E0ZA 2XHEB 4X1KE 4N78D 4PJMA 3ETUA 4TN7B 3FZMB 4WBOA 2LE8A 3LG7A 3ZN1B 4X1YE 4ASKA 4OK0A 3VR9A 3PUYF 4QH4A 5AFLA 2K5BB 5KXJA 5ABFA 4L5GA 2UU9T 4HFIA 4FJOA 2VQET 2N1GA 2W2UA 5IYZE 2MPKA 4QXBB 5HCJA 3KINB 3AECA 3AA6B 2C5KT 1U5PA 4PJJA 4AKHA 3UU8A 5J1GA 2BYSA 2JQ9A 3O9XA 2NW7A 3KV4A 2PH9A 4LFCT 4O4IE 1ZEEA 4AFGA 5LCYA 1Z0PA 3I1AA 4KHZF 3PUXF 5LBQB 2WU2A 5JDQA 1OEDA 3QNUA 4H9SE 5JDGA 4GKKT 3B5MA 4HEAA 4DR3T 4ILAA 3KV5A 2QYWA 2CXDA 4AI6A 4IE7A 1N33T 3P4WA 4TV8E 4JYAT 2WS3A 4GOUA 5DQWA 3AEEA 3AE7A 4LMJA 4B6XA 2LHRA 3KV6A 4IE6A 5FP3A 5JR9C 3K8PC 4ZS3A 5HXHA 2N9DA 4GYSA 3PMZA 1WLXA 1UUSA 5BR8T 2CM0A 2EHOC 4ZK1A 2M6BA 5L3CB 3RIUC 3PUVF 4DV2T 2BJ0A 4CXYA 3Q5WA 1KNZA 3VU7H 3TLSA 3CPZA 4ZZBA 2CLYB 4I4TE 5FNVE 4COFA 4XAXB 4DV7T 2JJ9A 3GA8A 4DR6T 2VKDA 3C4WA 1WRDA 2Y6XA 3TLUA 5FXWA 4IL4A 2BR7A 5L3DB 4UVCB 4AKGA 3N9PA 5FY1A 3ZDGA 5LGNB 4UY2A 3JC6D 5AQRB 5JRCA 4UIGA 3AA1B 1UX5A 2L8KA 2WWUA 5EZYE 3UU3A 1G73A 4UM3P 1WYBA 3CX8B 3UT5E 3NBXX 3KVBA 3NZQA 4JEUB 5HXSA 2WDVA 3EVYA 3P7IA 4AQFC 4L0RA 3B13A 4HTEA 3VKGA 5HEJA 3N9OA 4IL9A 4E7ZA 2QC1B 5AQOB 1WR0A 4JI8T 2MOZA 3VR8A 2X9XA 1X79A 4AXPA 2W00A 5F5WA 4JEHB 1HNZT 4KMCA 2ZM0A 4PNIA 3PTRB 4YT0A 2WAUA 3OKQA 4ERRA 2X51A 4ZR6A 5AFMA 5HCMA 3ETVA 2XAFB 2Y48B 4XZCA 3CMLA 2UUCT 3JAFA 3NZPA 1WYCA 3X1DA 5JDMA 3RF1A 2PTFA 3F2EA 4AKRB 3FZKB 3KV9A 3M3ZB 4K0KT 5IWAT 5KX5E 4X62T 5CFBA 3PJAJ 4DUZT 2Z6EA 2IAKA 3ZCIA 3WI3A 2WCAA 5F8PA 5TVCA 3V5UA 2BS4A 2D0UA 4JI2T 1ZOYA 4J2CA 1AJ3A 3CQCB 4XBFB 3E08A 2KNDA 4MBQA 2BYQA 2V6YB 3KVAA 3Q5DA 1SE7A 2KLQA 4I50E 2WDRA 1D1CA 5KE4A 2DNXA 3N9LA 5AQTB 4KP3C 5GONE 4KHPT 2A9UA 3SS1A 2LSGA 3WIPA 3ONXA 4FRRA 4YTNA 4AKLA 5J2UE 4YJ3E 3ZSTA 2KT9A 2ACXA 1OWAA 5J2TE 3N2GE 5AQKB 3VRAA 4QAAA 2BS2A 2FJBA 2KSRA 3HKDE 3AE1A 4AFTA 4O8SA 4ZI3C 2WNJA 2IMLA 5AQSB 3RYHE 3HI2A 3RKGA 2PJQA 1OEDB 4I55E 4JI7T 3UUXB 1HG5A 4UV8B 3SH1A 3DTOA 2DHRA 5HWXA 4HFBA 3MXZA 3FZFB 3E22E 2K48A 1QLBA 4OHFA 3ZMVB 4PJNA 4P09A 2MYSA 4ISTA 2H7VC 4OYKA 2XAHB 4HWCA 3AEAA 3JC6C 2D5UA 2WZYA 4H9QC 1KEYA 2W61A 2XZEA 5AFHA 3PUGA 1IAPA 5HXCA 3UULA 2P9BA 3I9YA 2W4XA 3PUZF 3RYIE 4X64T 4QH1A 4U72A 2V7IA 1IJ6A 4IDNA 4YXDA 4UELA 2GK9A 3AB3B 5AQPB 2YU2A 2E5LT 4QXHB 4YSYA 2RPAA 3DJBA 3AAEB 3K3NA 3RC8A 2KMFA 2XQ3A 2AE9A 2CXLA 2NW9A 4MLKA 1KNPA 4EGWA 2BKNA 3PDYA 3ZDHA 5ADXL 3SFDA 2CRBA 4EEDA 4EB6E 3VKHA 3UUMA 4X65T 2ZJUA 1D0ZA 4EZHA 2JRKA 3C4XA 1VCTA 1E7PA 4A56A 4ZJSA 4DV3T 1OXZA 5DJQC 3A7MA 4IGUA 3IHRA 5LNKA 2LSJA 5SYOA 3AA7B 3ZMUB 2H7OA 4QH5A 4DVDA 2CCQA 3KBUA 2ZM6T 3U8MA 3WTKA 1KNRA 4IT4A 5FMNA 5ABHA 3CX7B 2YN6A 5TAOA 3GUAA 2HPJA 3FHNA 5HXEA 3PU3A 1D0YA 4YSZA 2BZBA 5J5GA 1QSDA 1HTJF 3MJXA 3I9WA 2XNVA 5BRXA 4TUYE 3IA3A 4UEMA 1N36T 4O4LE 4UV9B 1YW0A 4XHEA 2V6YA 2I6HA 1UX2A 4HFEA 2XY8B 2WZIA 3QUJA 4OYJA 3R6NA 1CUNA 3AXJA 4ADZA 4CN1A 2PG8A 2VL8A 3RIUA 3P4PA 4EYYR 4EEBA 2Q9QB 5LHHB 2K9AA 4ALXA 2BBHA 2Y56A 3AEGA 4YY3T 2M67A 4TV9E 4A98A 5DQVA 2WB5A 2XNUA 4PIRA 5LB7B 2VKHA 4X20E 4NXNT 1SUMB 2XQ9A 2HN1A 2XQ4A 1MNDA 3MK7C 4Z91A 1FIOA 2YMEA 2LEHA 5JR9B 4HWIB 3AE5A 3SFEA 4JI6T 1I9BA 5HEUA 3J9X1 1T7SA 2LSIA 2DWGA 4LF7T 3T1YT 2BKOA 3KDSE 3ANWA 3QK6A 5J5HA 4JI3T 3AE8A 3HKBE 2WWVA 3ZC0A 1YXRA 2BVLA 3FZHB 5HEGA 3O1JA 1HX8A 4JUYA 3ZYMA 3UU5A 4U2YA 2BKPA 1IBMT 4BAYB 2C0SA 2YK0A 1XMQT 3LDQB 2JIWA 3T4MA 2V5CA 1S35A 1BR1A 3RQWA 4IDOA 4HWFA 4UVAB 3P4SA 5LMNT 3ZJ2A 1FMWA 4B5DA 4ZRUA 2CHNA 4CN4A 4AKIA 1IJ5A 2W66A 3PEOA 2OLTA 4A97A 3JADA 2ZJVA 2LKGA 3P8CD 3OPCA 2FJEA 5H6QB 3UFGA 1MIVA 1T8BA 5JRCB 4FI5A 2XZ5A 5L4EA 4ZZCA 2IC9A 1FJGT 5M4YA 4KI0F 4ZS2A 4XK9A 1JNZA 1IBKT 2ZMAA 3P4RA 2W67A 2H89A 5FL1A 2C5IT 3UTKA 3JAEA 2XM1A 4TWDA 5AFJA 3HL6A 1MMDA 4JI4T 2X9YA 5BW2A 4ZI3D 4AISA 4YHHT 2UXCT 3LK42 1Y01A 3SIOA 2XAGB 4WZXA 4DR1T 3C4ZA 4B3TT 2X0HA 3DP7A 3ZPOA 2X9WA 2NR4A 1MMAA 2YDRA 1WFDA 2XASB 5CA1E 3QOFA 5LYJE 4QKNA 2X0YA 5AQLB 4JI0T 4CZZB 4CN6A 4NUUA 4JV5T 1VCSA 4NUVA 4MHCA 4B3ST 2HHHT 4G2AA 5LMUT 5KMGP 2BVMA 2WU5A 3UQ7A 1XNQT 2DLRA 3N2OA 4Z90A 4V1Av 3RHWA 3D0TA 4AQGA 2X68A 3GWHA 5LOVE 2KWIB 3L39A 2FJAA 4EAHA 2XAQB 4PAGA 1Z8UA 3SQ9A 4EYUA 1VOMA 3NWIA 3W15B 4P0AA 3FXDB 4YHJA 1SA0E 2ODUA 4X66T 2BYNA 2LSYA 2NOXA 2UXXB 5L3EB 2V7MA 1UURA 4EIWA 2IUBA 5L47A 2WY2A 3WTOA 4X5TA 2N2NA 2I0MA 3ZT7A 2JQHA 2CLYC 3AEFA 2WQYA 4TWHA 5LXTE 4UM3A 3CQXC 3Q5XA 1OEDE 1KFYA 3H37A 3WTLA 4HFDA 4LF5T 3A8YC 1D0XA 5LJNA 2LM2A 4HKAA 2BYPA 3AA0B 2V7LA 1N32T 4JLEA 2B1EA 2WMOA 4LF9T 3UQ4A 1N34T 3EI0A 1XWMA 4UVBB 4GK5E 1US7B 5HEHA 3L8RA 4O4HE 1T98A 5LJMA 3GMIA 1IZNB 4ZI7E 4F6RC 3SWHA 3GN5B 3SOLA 2XYTA 1HG2A 4JBWF 4HWHA 2R6GF 4B3RT 3JCFA 1E2AA 2IHR1 1B7TA 4TZ4C 2LT3A 4E7SA 3WTHA 2BYRA 2MTQA 3HA4A 5C8YE 4GK0E 2LKHA 3QB5A 2X00D 4JI1T 2X00A 2XJ7A 4UM3S 3K3QC 1OEDC 1D1AA 2CPTA 2XUEA 2Y54A 5JDHA 2V7JA 3ONJA 5LHIB 2IIUA 1HX1B 5FXVA 5AQGB 2EHOD 5JH7E 3F57A 5BMVE 3UFEA 1YQ3A 3EUHA 2XQ5A 4AQFA 5LGTB 2CBIA 4U33A 4HE8A 1UX4A 2V8SV 2X66A 4M1PA 2PGZA 2NWBA 5AFKA 3RGLA 3IEEA 1HS7A 2IDOB 5JVDE 1M7KA 2FJDA 4DV6T 2KZ7B 4H9RC 4DR7T 4HQPA 3KFWX 1MIWA 3FXEB 2X9HA 2A72A 4CQIA 3RKOA 1I6ZA 2YKSA 3SRZA 3CQGB 2C5JA 2V6XA 4H63H 2W63A 4WNKA 2E8IA 3LSVA 4DIDB 3AVRA 1ZKEA 5AQIB 1XDOA 1LKXA 2J1DG 4YJ2E 2VKOA 3PUQA 2XQ6A 5AQMB 3RI5A 3OVUA 2YDQA 4DNDA 5FL0A 2FBWA 4UR9A 2CEAA 1J5WA 5IHYA 4DBQA 1HF8A 5HEOA 4LFAT 4ZOLE 3LJCA 2XSAA 1MMGA 1U4QA 4DBRA 4QABA 3L09A 4DV1T 4DR2T 1D1BA 3ZYLA 5CJ5A 4LF8T 5LA6E 5LHGB 3MZKB 4NIQA 5ABGA 4LF4T 4ZK4A 2I59A 2PBIA 5L3FB 4QX7B 2YOEA 3SQ6A 4YSXA 2VURA 3ZMZB 1MIYA 3OTOT 3CKDA 1SHZC 4YFSA 5L3BB 4X1IE 2M6IA 4ISSA 2A3DA 3U8KA 1VRBA 4LF6T 2UZ6A 1J5ET 2KWHA 1UW6A 5JR9A 2HPLA 5LP6E 1Y64B 4KUMB 1MNEA 3ZYKA 2BDEA 1UGOA 5AQUB 2B76A 2YU1A 5J0ZA 2BG9B 2VWAA 4ZJTA 2WM9A 4WW0A 3H3AA 4DBMA 2XQYA 1H7CA 2CHOA 3WTIA 4IDQA 4C91A 3OJAA 4K0UA 4C90A 5AQHB 3ZKRA 4CI1B 4DMWA 4DV4T 2WSSV 3LFMA 3VHLA 2PFVA 3CVRA 2W8GA 3HKCE 2JPFA 4IDPA 4H9PC 4NPPA 2YMDA 2JQQA 4PK5A 1ZV4X 3I0OA 3Q5EA 3LBXA 3EABA 2SPCA 3AE4A 2XZ6A 4YTMA 4G63A 2ZLYA 2ZM8A 4F8HA 2XQAA 5L4HA 4TNWA 5JQGE 3CIRA 2LOPA 2G0UA 3T1HT 5AQJB 2CWOA 1M62A 2V26A 4QACA 2OA5A 2UXBT 3RX6A 3C64A 2D0TA 4HN9A 2LM9A 2WNLA 5AFUL 3ESLA 2XM2A 2Q9QA 5BP0A 3AE3A 2VVSA 3RQUA 2ACZA 3MACA 5L2LA 3ZT5A 2RA1A 3IGQA 3WAJA 3ZC1A 2LRKA 3UUBA 1HR0T 4TX5A 5AQNB 4CXXA 2YDSA 2VVNA 2XNTA 5LBMA 4B3MT 2Y8DA 5AFMB 3U78A 2K24A 4A5XA 1NWMX 5HAXA 5FJVA 4PK6A 5CA0E 4IIJE 2VL0A 3K1SA 4P1NA 3AE2A 1KF6A 4IDZA 3N5LA 5FKYA 2BG9E 2DCFA 3MKDA 2W62A 2HN2A 2F4VT 3RYCE 5ABEA 5JTGA 2J47A 3AEBA 2D2SA 3C84A 1YKHB 4GIWA 3G06A 1JNRA 4CI2B 4BA9A 5F3JA 3O1IA 2NTYA 5KDMC 5FVLA 3HKEE 4YTPA 4QHOA 2IW5B 3V5SA 3S4UA 2UXNB 3PURA 4UXNB 3C98B 2QGSA 2VKJA 4DV5T 1E1HB 4IE5A 5JREA 2WN9A 4U7IA 4U3CA 4WBNE 5FYMA 2D9DA 3RPUA 1QUUA 5JDNA 2ZM2A 3PUSA 2VB6A 5FXXA 2XQ7A 2NP9A 3U3IA 4WYVA 3PU8A 2IC6A 2A2FX 3ZCJA 5FXZA 5CGMA 2L9QA 5JDFA 4CXWA 3FBLA 2NW8A 2BBJA 2JMKA 2EHOA 3ZSSA 3AXJB 1MMNA 2VK9A 4H9OC 3U8NA 4O2BE 1ZP0A 4OFZA 2E9XB 1I94T 1BR4A 3WTNA 4U2ZA 3AAAB 4H63V 3HR0A 4KBMB 3EHZA 3N9NA 5CO5A 2E9XA 3QB5K 4QXCB 1O3XA 3ZEFB 4H9NC 5AQFB 5JMEA 3QC9A 4DUYT 2BS3A 5JDLA 1EZ3A 4YLHA 4TWFA 2Y58A 1DU2A 4CI3B 1ZHCA 5EK2A 4NXMT 2YINA 2L3LA 3NVOA 1GQEA 3ZT6A 4PK4A 2LOSA 1LVKA 2AXDS 2DL1A 2CE7A
chains in the Genus database with same CATH topology
3U8KA 5AFKA 2WN9A 4AFGA 4HFHA 2UZ6A 3TLWA 3ZDGA 5BP0A 4UY2A 5J5HA 3UQ4A 3RQUA 3EI0A 1UW6A 2WZYA 3U8MA 3WTKA 2BG9A 5CFBA 5HEHA 4EZ1A 4ILBA 5HEGA 4HQPA 3IGQA 5AFHA 3UU3A 1OEDA 2LLYA 4UM3P 2YN6A 3UUBA 4HFCA 5TVCA 2MAWA 5J5IA 3UU5A 2YKSA 2XQ7A 3GUAA 5J0ZA 4NZBA 2BG9B 3WTMA 4TNVA 4ILAA 3UQ7A 2XNTA 2XYTA 4UM1A 4ZJTA 4QH1A 4Z90A 2BR8A 3LSVA 3RHWA 5KZUA 4DBMA 4BQTA 3EAMA 2BYQA 3C79A 3T4MA 5AFMB 4ILCA 5J5GA 3WTIA 3P4WA 4D01A 3UU6A 3RQWA 3UU4A 5LXBA 5AFNA 2XNVA 3RIAA 5BRXA 2Y57A 4LMJA 3TLTA 5FJVA 3SQ9A 3WTJA 2VL0A 2XQ6A 3P50A 3ZKRA 3WTHA 4B5DA 5KE4A 4ZRUA 2BYRA 4XHEA 5HEJA 3U8NA 2BYNA 3PEOA 3RI5A 4AFHA 4A97A 4IL9A 2XQ3A 4HFEA 1UX2A 2QC1B 3JADA 2LKGA 2ZJVA 2W8GA 2W8FA 4BFQA 2XYSA 3WIPA 2BG9E 4LMLA 4FRRA 2LKHA 4NPPA 5HEOA 2X00D 2YMDA 3WTNA 2X00A 2XZ5A 4UM3S 5L4EA 3RIFA 4ZZCA 1OEDC 5L47A 2BG9C 3PMZA 4QABA 4QAAA 3ZDHA 4UXUA 3WTOA 3EHZA 4X5TA 4QH4A 2KSRA 2WNCA 4WV9A 4XK9A 5AFLA 5CO5A 2Y54A 4AFTA 4ZK1A 2M6BA 5IUXA 3C84A 4HFIA 4ALXA 2WNJA 5J5FA 2ZJUA 2Y56A 4TWHA 2XZ6A 2BJ0A 3JAEA 3TLSA 4TWDA 5LG3A 4A98A 5AFJA 4ZJSA 4UM3A 5JMEA 4ZZBA 1OEDB 1OEDE 5HCJA 4F8HA 2XQAA 5L4HA 2XNUA 4PIRA 4TNWA 4ZR6A 5BW2A 4COFA 5AFMA 5HCMA 4ZK4A 3WTLA 4HFDA 2YOEA 4TWFA 4IREA 2Y58A 2XQ5A 3SH1A 4HFBA 3SQ6A 3U8JA 5SYOA 2XQ9A 4LMKA 3UU8A 1UV6A 2XQ4A 4QACA 2XQ8A 4Z91A 2Y7YA 2BYSA 3JAFA 2YMEA 3TLUA 2LM2A 4QH5A 3SIOA 5AINA 2C9TA 2M6IA 1I9BA 2BYPA 5HEUA 4IL4A 2BR7A 2WNLA 3TLVA 2PH9A 3U8LA 2PGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8K A;  5AFK A;  2WN9 A;  4AFG A;  4HFH A;  2UZ6 A;  3TLW A;  3ZDG A;  5BP0 A;  4UY2 A;  5J5H A;  3UQ4 A;  3RQU A;  3EI0 A;  1UW6 A;  2WZY A;  3U8M A;  3WTK A;  2BG9 A;  5CFB A;  5HEH A;  4EZ1 A;  4ILB A;  5HEG A;  4HQP A;  3IGQ A;  5AFH A;  3UU3 A;  1OED A;  2LLY A;  4UM3 P;  2YN6 A;  3UUB A;  4HFC A;  5TVC A;  2MAW A;  5J5I A;  3UU5 A;  2YKS A;  2XQ7 A;  3GUA A;  5J0Z A;  4NZB A;  2BG9 B;  3WTM A;  4TNV A;  4ILA A;  3UQ7 A;  2XNT A;  2XYT A;  4UM1 A;  4ZJT A;  4QH1 A;  4Z90 A;  2BR8 A;  3LSV A;  3RHW A;  5KZU A;  4DBM A;  4BQT A;  3EAM A;  2BYQ A;  3C79 A;  3T4M A;  5AFM B;  4ILC A;  5J5G A;  3WTI A;  3P4W A;  4D01 A;  3UU6 A;  3RQW A;  3UU4 A;  5LXB A;  5AFN A;  2XNV A;  3RIA A;  5BRX A;  2Y57 A;  4LMJ A;  3TLT A;  5FJV A;  3SQ9 A;  3WTJ A;  2VL0 A;  2XQ6 A;  3P50 A;  3ZKR A;  3WTH A;  4B5D A;  5KE4 A;  4ZRU A;  2BYR A;  4XHE A;  5HEJ A;  3U8N A;  2BYN A;  3PEO A;  3RI5 A;  4AFH A;  4A97 A;  4IL9 A;  2XQ3 A;  4HFE A;  1UX2 A;  2QC1 B;  3JAD A;  2LKG A;  2ZJV A;  2W8G A;  2W8F A;  4BFQ A;  2XYS A;  3WIP A;  2BG9 E;  4LML A;  4FRR A;  2LKH A;  4NPP A;  5HEO A;  2X00 D;  2YMD A;  3WTN A;  2X00 A;  2XZ5 A;  4UM3 S;  5L4E A;  3RIF A;  4ZZC A;  1OED C;  5L47 A;  2BG9 C;  3PMZ A;  4QAB A;  4QAA A;  3ZDH A;  4UXU A;  3WTO A;  3EHZ A;  4X5T A;  4QH4 A;  2KSR A;  2WNC A;  4WV9 A;  4XK9 A;  5AFL A;  5CO5 A;  2Y54 A;  4AFT A;  4ZK1 A;  2M6B A;  5IUX A;  3C84 A;  4HFI A;  4ALX A;  2WNJ A;  5J5F A;  2ZJU A;  2Y56 A;  4TWH A;  2XZ6 A;  2BJ0 A;  3JAE A;  3TLS A;  4TWD A;  5LG3 A;  4A98 A;  5AFJ A;  4ZJS A;  4UM3 A;  5JME A;  4ZZB A;  1OED B;  1OED E;  5HCJ A;  4F8H A;  2XQA A;  5L4H A;  2XNU A;  4PIR A;  4TNW A;  4ZR6 A;  5BW2 A;  4COF A;  5AFM A;  5HCM A;  4ZK4 A;  3WTL A;  4HFD A;  2YOE A;  4TWF A;  4IRE A;  2Y58 A;  2XQ5 A;  3SH1 A;  4HFB A;  3SQ6 A;  3U8J A;  5SYO A;  2XQ9 A;  4LMK A;  3UU8 A;  1UV6 A;  2XQ4 A;  4QAC A;  2XQ8 A;  4Z91 A;  2Y7Y A;  2BYS A;  3JAF A;  2YME A;  3TLU A;  2LM2 A;  4QH5 A;  3SIO A;  5AIN A;  2C9T A;  2M6I A;  1I9B A;  2BYP A;  5HEU A;  4IL4 A;  2BR7 A;  2WNL A;  3TLV A;  2PH9 A;  3U8L A;  2PGZ A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  3PUW F;  4HFH A;  3A5X A;  3T8O A;  4IHJ E;  3BQK A;  4P0B A;  2CXF A;  4U74 A;  1YD8 G;  3RYF E;  3CWZ B;  1UCU A;  4UF0 B;  4ZI2 D;  3RC3 A;  4GYR A;  4PJL A;  5J5I A;  4GKJ T;  3IF8 B;  3PE0 A;  3EDU A;  3KBT A;  2BR8 A;  4BQT A;  4DMV A;  4ILC A;  1S94 A;  2RP4 A;  4U31 A;  2WP9 A;  4ZI2 C;  4HFV A;  3UU6 A;  3OYX A;  5LXB A;  4O2A E;  3O4X E;  4DR5 T;  4ILU A;  2KXP B;  3BK9 A;  3PV0 F;  2W0G A;  3NKZ A;  4AFH A;  2XSB A;  2W8F A;  4BFQ A;  5AQQ B;  3ABV A;  1NEK A;  2J4G A;  1KK7 A;  1HNX T;  5C3J A;  4O4J E;  3B57 A;  4EXT A;  1L0V A;  1WR6 A;  1XDP A;  2WNC A;  4WV9 A;  5HYA A;  1G8X A;  3F31 A;  1W0B A;  4ZEY A;  3L3P A;  2XAJ B;  3LK3 B;  1J1J A;  2HH7 A;  3BQI A;  5FY7 A;  4EZ4 A;  1V9D A;  2YEV C;  3FBZ A;  5HXR A;  4LMK A;  2DWK A;  5C2T A;  2WDQ A;  4HWD A;  5AIN A;  3ZN0 B;  4IE4 A;  1HCI A;  3TLV A;  2V7K A;  2JQK A;  4MFR A;  2JMH A;  3TLW A;  1XZY A;  3MA9 A;  3N9M A;  3LBX B;  1XMO T;  4DV0 T;  2MAW A;  2UUB T;  2WMN A;  4NZB A;  3J7Y q;  3WTM A;  2QRX A;  4DO0 A;  1BR0 A;  4ZXL A;  3C51 A;  3N2K E;  3EAM A;  5ABF B;  3O1H A;  4D01 A;  5AFN A;  3AED A;  3WTJ A;  4BJM A;  1BR2 A;  1IBL T;  3CX6 B;  3FB2 A;  3ZLI A;  4UF0 A;  2UUA T;  3AE9 A;  5FY0 A;  5FVK A;  2UXD T;  1NAF A;  2VAS A;  1LRZ A;  5DAB A;  3RIF A;  2E5V A;  5A1L A;  2Q9Q D;  2BG9 C;  2H88 A;  4UXU A;  2V1D B;  2QA7 A;  2CBJ A;  3EDV A;  5L3G B;  4EV6 A;  5H6R B;  2X0L B;  2Q9Q C;  3AE6 A;  3NRX A;  2CWY A;  2H3R A;  5E0O A;  4OX9 T;  3RRC A;  5HWY A;  3VRB A;  4QWN B;  4AIU A;  4IRE A;  1FEW A;  3U8J A;  4EOZ B;  2J62 A;  3RLF F;  2XQ8 A;  5LGU B;  3Q9D A;  3PJA A;  2WBL A;  2E9X C;  3IBP A;  3OBV E;  3ZJ1 A;  3U8L A;  3ZMS B;  5AQV B;  3M65 A;  2MBG A;  5EK4 A;  2BG9 A;  5CB4 E;  4EZ1 A;  4HGA A;  2LSK A;  2XPK A;  4LFB T;  4ILB A;  2E9X D;  4QX8 B;  2ES0 A;  3GN5 A;  1T72 A;  1WCR A;  2LRL A;  4PFO A;  1CHU A;  4TNV A;  1HFA A;  2KIN B;  2EHO B;  3C50 A;  3C79 A;  3UU4 A;  3OYZ A;  3RIA A;  2Y57 A;  2CMR A;  3TLT A;  4ANJ A;  3P50 A;  3ZMT B;  2V5D A;  2WZH A;  3NRY A;  3WAK A;  4DR4 T;  4JI5 T;  2XYS A;  1R8I A;  4LML A;  1YQ4 A;  2DI4 A;  3Q2M A;  4I0U A;  3RRW A;  2CA5 A;  4BJN A;  3I0Q A;  3P4Q A;  5IUX A;  5J5F A;  3H3M A;  1LVF A;  5LG3 A;  1X9B A;  2VQF T;  2LJL A;  1W9R A;  3ONL C;  4MAL A;  4Z8X A;  4PW8 A;  4PFP A;  2LHN A;  1W09 A;  2FUP A;  5LG4 A;  1UV6 A;  5ETW A;  2OV9 A;  5EK3 A;  3R84 B;  2Y7Y A;  2C9T A;  4AQY T;  3RH3 A;  3LK2 B;  4Q25 A;  1HNW T;  4U7Y A;  4ZHQ E;  3AAI A;  2XTL A;  2LLY A;  4HFC A;  3ANW B;  1YKE B;  2K3W A;  3UUN A;  4UM1 A;  3PUA A;  4KX6 A;  2X67 A;  5KZU A;  3FZL B;  3BQL A;  3CK6 A;  2ODV A;  3TKL B;  1UK5 A;  3K3O A;  1W0A A;  1NEN A;  2E2A A;  1FMV A;  4L9I A;  4IE0 A;  2QVA A;  3AVS A;  4I43 B;  1XNR T;  2NTX A;  3E0Z A;  2XHE B;  4X1K E;  4N78 D;  4PJM A;  3ETU A;  4TN7 B;  3FZM B;  4WBO A;  2LE8 A;  3LG7 A;  3ZN1 B;  4X1Y E;  4ASK A;  4OK0 A;  3VR9 A;  3PUY F;  4QH4 A;  5AFL A;  2K5B B;  5KXJ A;  5ABF A;  4L5G A;  2UU9 T;  4HFI A;  4FJO A;  2VQE T;  2N1G A;  2W2U A;  5IYZ E;  2MPK A;  4QXB B;  5HCJ A;  3KIN B;  3AEC A;  3AA6 B;  2C5K T;  1U5P A;  4PJJ A;  4AKH A;  3UU8 A;  5J1G A;  2BYS A;  2JQ9 A;  3O9X A;  2NW7 A;  3KV4 A;  2PH9 A;  4LFC T;  4O4I E;  1ZEE A;  4AFG A;  5LCY A;  1Z0P A;  3I1A A;  4KHZ F;  3PUX F;  5LBQ B;  2WU2 A;  5JDQ A;  1OED A;  3QNU A;  4H9S E;  5JDG A;  4GKK T;  3B5M A;  4HEA A;  4DR3 T;  4ILA A;  3KV5 A;  2QYW A;  2CXD A;  4AI6 A;  4IE7 A;  1N33 T;  3P4W A;  4TV8 E;  4JYA T;  2WS3 A;  4GOU A;  5DQW A;  3AEE A;  3AE7 A;  4LMJ A;  4B6X A;  2LHR A;  3KV6 A;  4IE6 A;  5FP3 A;  5JR9 C;  3K8P C;  4ZS3 A;  5HXH A;  2N9D A;  4GYS A;  3PMZ A;  1WLX A;  1UUS A;  5BR8 T;  2CM0 A;  2EHO C;  4ZK1 A;  2M6B A;  5L3C B;  3RIU C;  3PUV F;  4DV2 T;  2BJ0 A;  4CXY A;  3Q5W A;  1KNZ A;  3VU7 H;  3TLS A;  3CPZ A;  4ZZB A;  2CLY B;  4I4T E;  5FNV E;  4COF A;  4XAX B;  4DV7 T;  2JJ9 A;  3GA8 A;  4DR6 T;  2VKD A;  3C4W A;  1WRD A;  2Y6X A;  3TLU A;  5FXW A;  4IL4 A;  2BR7 A;  5L3D B;  4UVC B;  4AKG A;  3N9P A;  5FY1 A;  3ZDG A;  5LGN B;  4UY2 A;  3JC6 D;  5AQR B;  5JRC A;  4UIG A;  3AA1 B;  1UX5 A;  2L8K A;  2WWU A;  5EZY E;  3UU3 A;  1G73 A;  4UM3 P;  1WYB A;  3CX8 B;  3UT5 E;  3NBX X;  3KVB A;  3NZQ A;  4JEU B;  5HXS A;  2WDV A;  3EVY A;  3P7I A;  4AQF C;  4L0R A;  3B13 A;  4HTE A;  3VKG A;  5HEJ A;  3N9O A;  4IL9 A;  4E7Z A;  2QC1 B;  5AQO B;  1WR0 A;  4JI8 T;  2MOZ A;  3VR8 A;  2X9X A;  1X79 A;  4AXP A;  2W00 A;  5F5W A;  4JEH B;  1HNZ T;  4KMC A;  2ZM0 A;  4PNI A;  3PTR B;  4YT0 A;  2WAU A;  3OKQ A;  4ERR A;  2X51 A;  4ZR6 A;  5AFM A;  5HCM A;  3ETV A;  2XAF B;  2Y48 B;  4XZC A;  3CML A;  2UUC T;  3JAF A;  3NZP A;  1WYC A;  3X1D A;  5JDM A;  3RF1 A;  2PTF A;  3F2E A;  4AKR B;  3FZK B;  3KV9 A;  3M3Z B;  4K0K T;  5IWA T;  5KX5 E;  4X62 T;  5CFB A;  3PJA J;  4DUZ T;  2Z6E A;  2IAK A;  3ZCI A;  3WI3 A;  2WCA A;  5F8P A;  5TVC A;  3V5U A;  2BS4 A;  2D0U A;  4JI2 T;  1ZOY A;  4J2C A;  1AJ3 A;  3CQC B;  4XBF B;  3E08 A;  2KND A;  4MBQ A;  2BYQ A;  2V6Y B;  3KVA A;  3Q5D A;  1SE7 A;  2KLQ A;  4I50 E;  2WDR A;  1D1C A;  5KE4 A;  2DNX A;  3N9L A;  5AQT B;  4KP3 C;  5GON E;  4KHP T;  2A9U A;  3SS1 A;  2LSG A;  3WIP A;  3ONX A;  4FRR A;  4YTN A;  4AKL A;  5J2U E;  4YJ3 E;  3ZST A;  2KT9 A;  2ACX A;  1OWA A;  5J2T E;  3N2G E;  5AQK B;  3VRA A;  4QAA A;  2BS2 A;  2FJB A;  2KSR A;  3HKD E;  3AE1 A;  4AFT A;  4O8S A;  4ZI3 C;  2WNJ A;  2IML A;  5AQS B;  3RYH E;  3HI2 A;  3RKG A;  2PJQ A;  1OED B;  4I55 E;  4JI7 T;  3UUX B;  1HG5 A;  4UV8 B;  3SH1 A;  3DTO A;  2DHR A;  5HWX A;  4HFB A;  3MXZ A;  3FZF B;  3E22 E;  2K48 A;  1QLB A;  4OHF A;  3ZMV B;  4PJN A;  4P09 A;  2MYS A;  4IST A;  2H7V C;  4OYK A;  2XAH B;  4HWC A;  3AEA A;  3JC6 C;  2D5U A;  2WZY A;  4H9Q C;  1KEY A;  2W61 A;  2XZE A;  5AFH A;  3PUG A;  1IAP A;  5HXC A;  3UUL A;  2P9B A;  3I9Y A;  2W4X A;  3PUZ F;  3RYI E;  4X64 T;  4QH1 A;  4U72 A;  2V7I A;  1IJ6 A;  4IDN A;  4YXD A;  4UEL A;  2GK9 A;  3AB3 B;  5AQP B;  2YU2 A;  2E5L T;  4QXH B;  4YSY A;  2RPA A;  3DJB A;  3AAE B;  3K3N A;  3RC8 A;  2KMF A;  2XQ3 A;  2AE9 A;  2CXL A;  2NW9 A;  4MLK A;  1KNP A;  4EGW A;  2BKN A;  3PDY A;  3ZDH A;  5ADX L;  3SFD A;  2CRB A;  4EED A;  4EB6 E;  3VKH A;  3UUM A;  4X65 T;  2ZJU A;  1D0Z A;  4EZH A;  2JRK A;  3C4X A;  1VCT A;  1E7P A;  4A56 A;  4ZJS A;  4DV3 T;  1OXZ A;  5DJQ C;  3A7M A;  4IGU A;  3IHR A;  5LNK A;  2LSJ A;  5SYO A;  3AA7 B;  3ZMU B;  2H7O A;  4QH5 A;  4DVD A;  2CCQ A;  3KBU A;  2ZM6 T;  3U8M A;  3WTK A;  1KNR A;  4IT4 A;  5FMN A;  5ABH A;  3CX7 B;  2YN6 A;  5TAO A;  3GUA A;  2HPJ A;  3FHN A;  5HXE A;  3PU3 A;  1D0Y A;  4YSZ A;  2BZB A;  5J5G A;  1QSD A;  1HTJ F;  3MJX A;  3I9W A;  2XNV A;  5BRX A;  4TUY E;  3IA3 A;  4UEM A;  1N36 T;  4O4L E;  4UV9 B;  1YW0 A;  4XHE A;  2V6Y A;  2I6H A;  1UX2 A;  4HFE A;  2XY8 B;  2WZI A;  3QUJ A;  4OYJ A;  3R6N A;  1CUN A;  3AXJ A;  4ADZ A;  4CN1 A;  2PG8 A;  2VL8 A;  3RIU A;  3P4P A;  4EYY R;  4EEB A;  2Q9Q B;  5LHH B;  2K9A A;  4ALX A;  2BBH A;  2Y56 A;  3AEG A;  4YY3 T;  2M67 A;  4TV9 E;  4A98 A;  5DQV A;  2WB5 A;  2XNU A;  4PIR A;  5LB7 B;  2VKH A;  4X20 E;  4NXN T;  1SUM B;  2XQ9 A;  2HN1 A;  2XQ4 A;  1MND A;  3MK7 C;  4Z91 A;  1FIO A;  2YME A;  2LEH A;  5JR9 B;  4HWI B;  3AE5 A;  3SFE A;  4JI6 T;  1I9B A;  5HEU A;  3J9X 1;  1T7S A;  2LSI A;  2DWG A;  4LF7 T;  3T1Y T;  2BKO A;  3KDS E;  3ANW A;  3QK6 A;  5J5H A;  4JI3 T;  3AE8 A;  3HKB E;  2WWV A;  3ZC0 A;  1YXR A;  2BVL A;  3FZH B;  5HEG A;  3O1J A;  1HX8 A;  4JUY A;  3ZYM A;  3UU5 A;  4U2Y A;  2BKP A;  1IBM T;  4BAY B;  2C0S A;  2YK0 A;  1XMQ T;  3LDQ B;  2JIW A;  3T4M A;  2V5C A;  1S35 A;  1BR1 A;  3RQW A;  4IDO A;  4HWF A;  4UVA B;  3P4S A;  5LMN T;  3ZJ2 A;  1FMW A;  4B5D A;  4ZRU A;  2CHN A;  4CN4 A;  4AKI A;  1IJ5 A;  2W66 A;  3PEO A;  2OLT A;  4A97 A;  3JAD A;  2ZJV A;  2LKG A;  3P8C D;  3OPC A;  2FJE A;  5H6Q B;  3UFG A;  1MIV A;  1T8B A;  5JRC B;  4FI5 A;  2XZ5 A;  5L4E A;  4ZZC A;  2IC9 A;  1FJG T;  5M4Y A;  4KI0 F;  4ZS2 A;  4XK9 A;  1JNZ A;  1IBK T;  2ZMA A;  3P4R A;  2W67 A;  2H89 A;  5FL1 A;  2C5I T;  3UTK A;  3JAE A;  2XM1 A;  4TWD A;  5AFJ A;  3HL6 A;  1MMD A;  4JI4 T;  2X9Y A;  5BW2 A;  4ZI3 D;  4AIS A;  4YHH T;  2UXC T;  3LK4 2;  1Y01 A;  3SIO A;  2XAG B;  4WZX A;  4DR1 T;  3C4Z A;  4B3T T;  2X0H A;  3DP7 A;  3ZPO A;  2X9W A;  2NR4 A;  1MMA A;  2YDR A;  1WFD A;  2XAS B;  5CA1 E;  3QOF A;  5LYJ E;  4QKN A;  2X0Y A;  5AQL B;  4JI0 T;  4CZZ B;  4CN6 A;  4NUU A;  4JV5 T;  1VCS A;  4NUV A;  4MHC A;  4B3S T;  2HHH T;  4G2A A;  5LMU T;  5KMG P;  2BVM A;  2WU5 A;  3UQ7 A;  1XNQ T;  2DLR A;  3N2O A;  4Z90 A;  4V1A v;  3RHW A;  3D0T A;  4AQG A;  2X68 A;  3GWH A;  5LOV E;  2KWI B;  3L39 A;  2FJA A;  4EAH A;  2XAQ B;  4PAG A;  1Z8U A;  3SQ9 A;  4EYU A;  1VOM A;  3NWI A;  3W15 B;  4P0A A;  3FXD B;  4YHJ A;  1SA0 E;  2ODU A;  4X66 T;  2BYN A;  2LSY A;  2NOX A;  2UXX B;  5L3E B;  2V7M A;  1UUR A;  4EIW A;  2IUB A;  5L47 A;  2WY2 A;  3WTO A;  4X5T A;  2N2N A;  2I0M A;  3ZT7 A;  2JQH A;  2CLY C;  3AEF A;  2WQY A;  4TWH A;  5LXT E;  4UM3 A;  3CQX C;  3Q5X A;  1OED E;  1KFY A;  3H37 A;  3WTL A;  4HFD A;  4LF5 T;  3A8Y C;  1D0X A;  5LJN A;  2LM2 A;  4HKA A;  2BYP A;  3AA0 B;  2V7L A;  1N32 T;  4JLE A;  2B1E A;  2WMO A;  4LF9 T;  3UQ4 A;  1N34 T;  3EI0 A;  1XWM A;  4UVB B;  4GK5 E;  1US7 B;  5HEH A;  3L8R A;  4O4H E;  1T98 A;  5LJM A;  3GMI A;  1IZN B;  4ZI7 E;  4F6R C;  3SWH A;  3GN5 B;  3SOL A;  2XYT A;  1HG2 A;  4JBW F;  4HWH A;  2R6G F;  4B3R T;  3JCF A;  1E2A A;  2IHR 1;  1B7T A;  4TZ4 C;  2LT3 A;  4E7S A;  3WTH A;  2BYR A;  2MTQ A;  3HA4 A;  5C8Y E;  4GK0 E;  2LKH A;  3QB5 A;  2X00 D;  4JI1 T;  2X00 A;  2XJ7 A;  4UM3 S;  3K3Q C;  1OED C;  1D1A A;  2CPT A;  2XUE A;  2Y54 A;  5JDH A;  2V7J A;  3ONJ A;  5LHI B;  2IIU A;  1HX1 B;  5FXV A;  5AQG B;  2EHO D;  5JH7 E;  3F57 A;  5BMV E;  3UFE A;  1YQ3 A;  3EUH A;  2XQ5 A;  4AQF A;  5LGT B;  2CBI A;  4U33 A;  4HE8 A;  1UX4 A;  2V8S V;  2X66 A;  4M1P A;  2PGZ A;  2NWB A;  5AFK A;  3RGL A;  3IEE A;  1HS7 A;  2IDO B;  5JVD E;  1M7K A;  2FJD A;  4DV6 T;  2KZ7 B;  4H9R C;  4DR7 T;  4HQP A;  3KFW X;  1MIW A;  3FXE B;  2X9H A;  2A72 A;  4CQI A;  3RKO A;  1I6Z A;  2YKS A;  3SRZ A;  3CQG B;  2C5J A;  2V6X A;  4H63 H;  2W63 A;  4WNK A;  2E8I A;  3LSV A;  4DID B;  3AVR A;  1ZKE A;  5AQI B;  1XDO A;  1LKX A;  2J1D G;  4YJ2 E;  2VKO A;  3PUQ A;  2XQ6 A;  5AQM B;  3RI5 A;  3OVU A;  2YDQ A;  4DND A;  5FL0 A;  2FBW A;  4UR9 A;  2CEA A;  1J5W A;  5IHY A;  4DBQ A;  1HF8 A;  5HEO A;  4LFA T;  4ZOL E;  3LJC A;  2XSA A;  1MMG A;  1U4Q A;  4DBR A;  4QAB A;  3L09 A;  4DV1 T;  4DR2 T;  1D1B A;  3ZYL A;  5CJ5 A;  4LF8 T;  5LA6 E;  5LHG B;  3MZK B;  4NIQ A;  5ABG A;  4LF4 T;  4ZK4 A;  2I59 A;  2PBI A;  5L3F B;  4QX7 B;  2YOE A;  3SQ6 A;  4YSX A;  2VUR A;  3ZMZ B;  1MIY A;  3OTO T;  3CKD A;  1SHZ C;  4YFS A;  5L3B B;  4X1I E;  2M6I A;  4ISS A;  2A3D A;  3U8K A;  1VRB A;  4LF6 T;  2UZ6 A;  1J5E T;  2KWH A;  1UW6 A;  5JR9 A;  2HPL A;  5LP6 E;  1Y64 B;  4KUM B;  1MNE A;  3ZYK A;  2BDE A;  1UGO A;  5AQU B;  2B76 A;  2YU1 A;  5J0Z A;  2BG9 B;  2VWA A;  4ZJT A;  2WM9 A;  4WW0 A;  3H3A A;  4DBM A;  2XQY A;  1H7C A;  2CHO A;  3WTI A;  4IDQ A;  4C91 A;  3OJA A;  4K0U A;  4C90 A;  5AQH B;  3ZKR A;  4CI1 B;  4DMW A;  4DV4 T;  2WSS V;  3LFM A;  3VHL A;  2PFV A;  3CVR A;  2W8G A;  3HKC E;  2JPF A;  4IDP A;  4H9P C;  4NPP A;  2YMD A;  2JQQ A;  4PK5 A;  1ZV4 X;  3I0O A;  3Q5E A;  3LBX A;  3EAB A;  2SPC A;  3AE4 A;  2XZ6 A;  4YTM A;  4G63 A;  2ZLY A;  2ZM8 A;  4F8H A;  2XQA A;  5L4H A;  4TNW A;  5JQG E;  3CIR A;  2LOP A;  2G0U A;  3T1H T;  5AQJ B;  2CWO A;  1M62 A;  2V26 A;  4QAC A;  2OA5 A;  2UXB T;  3RX6 A;  3C64 A;  2D0T A;  4HN9 A;  2LM9 A;  2WNL A;  5AFU L;  3ESL A;  2XM2 A;  2Q9Q A;  5BP0 A;  3AE3 A;  2VVS A;  3RQU A;  2ACZ A;  3MAC A;  5L2L A;  3ZT5 A;  2RA1 A;  3IGQ A;  3WAJ A;  3ZC1 A;  2LRK A;  3UUB A;  1HR0 T;  4TX5 A;  5AQN B;  4CXX A;  2YDS A;  2VVN A;  2XNT A;  5LBM A;  4B3M T;  2Y8D A;  5AFM B;  3U78 A;  2K24 A;  4A5X A;  1NWM X;  5HAX A;  5FJV A;  4PK6 A;  5CA0 E;  4IIJ E;  2VL0 A;  3K1S A;  4P1N A;  3AE2 A;  1KF6 A;  4IDZ A;  3N5L A;  5FKY A;  2BG9 E;  2DCF A;  3MKD A;  2W62 A;  2HN2 A;  2F4V T;  3RYC E;  5ABE A;  5JTG A;  2J47 A;  3AEB A;  2D2S A;  3C84 A;  1YKH B;  4GIW A;  3G06 A;  1JNR A;  4CI2 B;  4BA9 A;  5F3J A;  3O1I A;  2NTY A;  5KDM C;  5FVL A;  3HKE E;  4YTP A;  4QHO A;  2IW5 B;  3V5S A;  3S4U A;  2UXN B;  3PUR A;  4UXN B;  3C98 B;  2QGS A;  2VKJ A;  4DV5 T;  1E1H B;  4IE5 A;  5JRE A;  2WN9 A;  4U7I A;  4U3C A;  4WBN E;  5FYM A;  2D9D A;  3RPU A;  1QUU A;  5JDN A;  2ZM2 A;  3PUS A;  2VB6 A;  5FXX A;  2XQ7 A;  2NP9 A;  3U3I A;  4WYV A;  3PU8 A;  2IC6 A;  2A2F X;  3ZCJ A;  5FXZ A;  5CGM A;  2L9Q A;  5JDF A;  4CXW A;  3FBL A;  2NW8 A;  2BBJ A;  2JMK A;  2EHO A;  3ZSS A;  3AXJ B;  1MMN A;  2VK9 A;  4H9O C;  3U8N A;  4O2B E;  1ZP0 A;  4OFZ A;  2E9X B;  1I94 T;  1BR4 A;  3WTN A;  4U2Z A;  3AAA B;  4H63 V;  3HR0 A;  4KBM B;  3EHZ A;  3N9N A;  5CO5 A;  2E9X A;  3QB5 K;  4QXC B;  1O3X A;  3ZEF B;  4H9N C;  5AQF B;  5JME A;  3QC9 A;  4DUY T;  2BS3 A;  5JDL A;  1EZ3 A;  4YLH A;  4TWF A;  2Y58 A;  1DU2 A;  4CI3 B;  1ZHC A;  5EK2 A;  4NXM T;  2YIN A;  2L3L A;  3NVO A;  1GQE A;  3ZT6 A;  4PK4 A;  2LOS A;  1LVK A;  2AXD S;  2DL1 A;  2CE7 A; 
#chains in the Genus database with same CATH homology
 3U8K A;  5AFK A;  2WN9 A;  4AFG A;  4HFH A;  2UZ6 A;  3TLW A;  3ZDG A;  5BP0 A;  4UY2 A;  5J5H A;  3UQ4 A;  3RQU A;  3EI0 A;  1UW6 A;  2WZY A;  3U8M A;  3WTK A;  2BG9 A;  5CFB A;  5HEH A;  4EZ1 A;  4ILB A;  5HEG A;  4HQP A;  3IGQ A;  5AFH A;  3UU3 A;  1OED A;  2LLY A;  4UM3 P;  2YN6 A;  3UUB A;  4HFC A;  5TVC A;  2MAW A;  5J5I A;  3UU5 A;  2YKS A;  2XQ7 A;  3GUA A;  5J0Z A;  4NZB A;  2BG9 B;  3WTM A;  4TNV A;  4ILA A;  3UQ7 A;  2XNT A;  2XYT A;  4UM1 A;  4ZJT A;  4QH1 A;  4Z90 A;  2BR8 A;  3LSV A;  3RHW A;  5KZU A;  4DBM A;  4BQT A;  3EAM A;  2BYQ A;  3C79 A;  3T4M A;  5AFM B;  4ILC A;  5J5G A;  3WTI A;  3P4W A;  4D01 A;  3UU6 A;  3RQW A;  3UU4 A;  5LXB A;  5AFN A;  2XNV A;  3RIA A;  5BRX A;  2Y57 A;  4LMJ A;  3TLT A;  5FJV A;  3SQ9 A;  3WTJ A;  2VL0 A;  2XQ6 A;  3P50 A;  3ZKR A;  3WTH A;  4B5D A;  5KE4 A;  4ZRU A;  2BYR A;  4XHE A;  5HEJ A;  3U8N A;  2BYN A;  3PEO A;  3RI5 A;  4AFH A;  4A97 A;  4IL9 A;  2XQ3 A;  4HFE A;  1UX2 A;  2QC1 B;  3JAD A;  2LKG A;  2ZJV A;  2W8G A;  2W8F A;  4BFQ A;  2XYS A;  3WIP A;  2BG9 E;  4LML A;  4FRR A;  2LKH A;  4NPP A;  5HEO A;  2X00 D;  2YMD A;  3WTN A;  2X00 A;  2XZ5 A;  4UM3 S;  5L4E A;  3RIF A;  4ZZC A;  1OED C;  5L47 A;  2BG9 C;  3PMZ A;  4QAB A;  4QAA A;  3ZDH A;  4UXU A;  3WTO A;  3EHZ A;  4X5T A;  4QH4 A;  2KSR A;  2WNC A;  4WV9 A;  4XK9 A;  5AFL A;  5CO5 A;  2Y54 A;  4AFT A;  4ZK1 A;  2M6B A;  5IUX A;  3C84 A;  4HFI A;  4ALX A;  2WNJ A;  5J5F A;  2ZJU A;  2Y56 A;  4TWH A;  2XZ6 A;  2BJ0 A;  3JAE A;  3TLS A;  4TWD A;  5LG3 A;  4A98 A;  5AFJ A;  4ZJS A;  4UM3 A;  5JME A;  4ZZB A;  1OED B;  1OED E;  5HCJ A;  4F8H A;  2XQA A;  5L4H A;  2XNU A;  4PIR A;  4TNW A;  4ZR6 A;  5BW2 A;  4COF A;  5AFM A;  5HCM A;  4ZK4 A;  3WTL A;  4HFD A;  2YOE A;  4TWF A;  4IRE A;  2Y58 A;  2XQ5 A;  3SH1 A;  4HFB A;  3SQ6 A;  3U8J A;  5SYO A;  2XQ9 A;  4LMK A;  3UU8 A;  1UV6 A;  2XQ4 A;  4QAC A;  2XQ8 A;  4Z91 A;  2Y7Y A;  2BYS A;  3JAF A;  2YME A;  3TLU A;  2LM2 A;  4QH5 A;  3SIO A;  5AIN A;  2C9T A;  2M6I A;  1I9B A;  2BYP A;  5HEU A;  4IL4 A;  2BR7 A;  2WNL A;  3TLV A;  2PH9 A;  3U8L A;  2PGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...