3UU8A

The glic pentameric ligand-gated ion channel loop2-24' mutant reduced in solution
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
311
structure length
311
Chain Sequence
VSPPPPIADEPLTVNTGIYLIESYSLDDCAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPCTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glr4197 protein
publication title A locally closed conformation of a bacterial pentameric proton-gated ion channel.
pubmed doi rcsb
source organism Gloeobacter violaceus
molecule tags Membrane protein, transport protein
total genus 93
structure length 311
sequence length 311
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 3uu8A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 3uu8A01
2ZJVA 3RHWA 1I9BA 4XHEA 5HCMA 5J5IA 2XYTA 3TLUA 4Z91A 2Y58A 2WN9A 4D01A 4IL9A 2XNTA 4A98A 2M6BA 4X5TA 4ALXA 4UM3A 2XZ6A 4ZK1A 1OEDC 5AINA 4HFIA 5JMEA 4QH4A 3UUBA 2BJ0A 5SYOA 2W8FA 3IGQA 2XQ8A 2X00D 2XYSA 4IL4A 2WZYA 5KE4A 5LXBA 2KSRA 4HFHA 3SIOA 4NPPA 2WNJA 2VL0A 5AFLA 4HFDA 2XNUA 5J5HA 3UU4A 2LKGA 3P4WA 2XQ9A 4ZK4A 4UXUA 5IUXA 4ILCA 2LKHA 5CO5A 3UQ7A 5AFMB 3LSVA 2YN6A 3RIFA 3UU6A 2BYRA 4TWHA 4DBMA 3UQ4A 3WIPA 3WTJA 5BRXA 3UU8A 5L4HA 3TLSA 4TNWA 5TVCA 4ZZBA 3JAEA 2YOEA 5HCJA 4PIRA 3TLWA 3WTHA 3ZDGA 3WTKA 2BG9E 3U8LA 2MAWA 4COFA 5J0ZA 3C79A 4ZZCA 4BQTA 3UU3A 2Y54A 4UM3S 3WTNA 3T4MA 5KZUA 3WTMA 4B5DA 4ILAA 2XQ3A 2YMDA 2BG9C 4HQPA 3WTLA 4FRRA 4AFTA 4EZ1A 3GUAA 3UU5A 4F8HA 4QAAA 5BP0A 2LM2A 3TLVA 3ZDHA 5AFKA 3EHZA 3EI0A 4UM1A 2C9TA 2LLYA 2X00A 5AFJA 4HFBA 3EAMA 5L47A 5AFHA 3C84A 4ZJTA 4Z90A 3TLTA 2BYQA 3RQWA 4LMJA 4AFGA 4AFHA 4ILBA 2PGZA 2YMEA 3P50A 4NZBA 2XNVA 1OEDE 1UW6A 5L4EA 5J5GA 3WTIA 4UY2A 3WTOA 4IREA 2YKSA 2XQAA 2Y57A 3U8JA 5CFBA 4TNVA 4XK9A 2XQ5A 5HEOA 2BR7A 3JADA 2XQ6A 2Y7YA 3ZKRA 2BYNA 1OEDA 2WNLA 2BYSA 5J5FA 2Y56A 2XQ7A 4LMLA 2PH9A 4ZR6A 4TWDA 2XZ5A 5AFNA 3SH1A 2BG9A 4HFCA 2W8GA 2BYPA 4ZRUA 2UZ6A 4TWFA 3RI5A 3PEOA 2ZJUA 3PMZA 1OEDB 4UM3P 4ZJSA 3U8MA 4BFQA 4WV9A 4QACA 2BR8A 4LMKA 3JAFA 2QC1B 5LG3A 3U8KA 3RQUA 3RIAA 3SQ6A 5FJVA 3SQ9A 5HEJA 2BG9B 3U8NA 5HEGA 5AFMA 4QH1A 5HEUA 5HEHA 4HFEA 2WNCA 5BW2A 4A97A 1UX2A 4QABA 2XQ4A 2M6IA 4QH5A 1UV6A
chains in the Genus database with same CATH superfamily
2ZJVA 1Y01A 3B57A 3QB5K 4U2ZA 5LNKA 3PUVF 2K24A 1HTJF 2QA7A 2WNJA 2VL0A 1CUNA 3FBZA 2H7OA 3AAAB 4DR4T 2VVSA 3UQ4A 4DV4T 2C5KT 2UUBT 4AQYT 2DNXA 2WY2A 5H6QB 4ZZBA 2WDQA 3ZJ1A 3BQIA 4X64T 2CWYA 4YHHT 5LP6E 4PJJA 4ZS3A 3WTMA 2BG9C 3AA6B 3GMIA 3K3NA 3SWHA 3OPCA 2HPLA 2XAJB 3HKDE 3RYIE 2DI4A 2YK0A 4I55E 2KXPB 2LLYA 3JC6D 5FKYA 3RPUA 1B7TA 4LMJA 2I6HA 3H3AA 3ONLC 5J1GA 3VU7H 3F31A 4F6RC 4MBQA 2PG8A 4PAGA 2ZM8A 3MKDA 2BYSA 4EZHA 3VRAA 4DV1T 4MALA 4C90A 1OEDB 3RGLA 3HA4A 4JI2T 1DU2A 4IT4A 2ZMAA 2HH7A 1SHZC 4HFEA 3AE2A 2UUCT 1FEWA 3N9QA 2UXXB 2Y48B 4NUUA 2FUPA 4UV8B 4TX5A 3Q9DA 1YKEB 2A2FX 1T8BA 2JQ9A 2KSRA 4AKIA 2LSGA 3L3PA 4HFDA 2XQYA 2BBHA 3P4SA 2LT3A 2MTQA 1N32T 3IA3A 5FL0A 4QX8B 4PJNA 5L3DB 4QXBB 4Z8XA 3J9X1 3PU8A 2HN2A 3U78A 4BAYB 5LGNB 4EZ1A 5LGTB 4ISTA 3ZMTB 4CN4A 5AQUB 2RP4A 3LBXB 3EHZA 5LMUT 4UM1A 4DUYT 3MXZA 1WRDA 5HXSA 4ZJTA 4UVAB 5FVKA 4U33A 2WMOA 5M4YA 3ZMVB 2JQHA 3J7Yq 3OVUA 4IIJE 2WZHA 4KBMB 1FMVA 5F5WA 1FIOA 3OTOT 3U3IA 5JTGA 4K0KT 2W8GA 2ZJUA 2BVLA 2A3DA 3U8KA 4CI1B 3RC8A 4DVDA 3U8NA 3VHLA 4H9RC 5AQQB 1UV6A 4XAXB 2ACZA 3K8PC 3E22E 2WQYA 4UEMA 4PFPA 3I0QA 3C50A 2Q9QC 2Q9QD 1KF6A 3ZN0B 1MMGA 5AQLB 2NW8A 1U5PA 1WYBA 4HGAA 4UXUA 2LKHA 5CO5A 4BJMA 2PFVA 2CLYB 5L3CB 5L4HA 3BK9A 5IWAT 5ADXL 1L0VA 2C5IT 4B5DA 5A1LA 4HQPA 1WR0A 2UUAT 1XDPA 3MJXA 3RYHE 3LG7A 4H9PC 2W2UA 3CKDA 3FXEB 5AFJA 3EAMA 4YJ3E 5L3FB 2A72A 4Z90A 2BZBA 2SPCA 5KMGP 3AE9A 2LRKA 3WTIA 4I4TE 1QUUA 4HEAA 4EXTA 3B13A 4U7YA 3C4WA 3R84B 2DCFA 2M67A 1BR1A 3C64A 4YTPA 1UUSA 4AQFA 2IDOB 5HAXA 2WWVA 2H3RA 3PMZA 2VKOA 3JAFA 2D2SA 5L3BB 2XAHB 2FJDA 2W0GA 3LK2B 2J47A 1T98A 4HTEA 3H3MA 2WMNA 5JR9B 4O4IE 5FXXA 5ABHA 1BR4A 3N2GE 3T1YT 3M3ZB 5AINA 2WDVA 3IF8B 2J4GA 4YSXA 5KE4A 4IE0A 2EHOB 3ZJ2A 3RLFF 2BVMA 2D5UA 1HFAA 2W63A 3N2KE 3O4XE 3AA0B 1BR2A 3R6NA 2NTXA 4WW0A 4OFZA 2XUEA 4HWFA 5AQSB 3CK6A 5GONE 1XDOA 2BS4A 2L9QA 3JAEA 3TLWA 1UX5A 2MAWA 1IBKT 4UVCB 4JI5T 1SUMB 4ILAA 1X9BA 5J2TE 3RIUC 1Z8UA 3TKLB 3GUAA 2K3WA 3TLVA 2IMLA 2BKNA 2KWHA 5L47A 2MOZA 4DMWA 2LSKA 2NW7A 4CI3B 3RQWA 5JDHA 1W0BA 1WLXA 4NZBA 2XTLA 4EYYR 3ESLA 3AEGA 4DV3T 2X9YA 4ZHQE 4B3RT 3ZKRA 2OA5A 4A5XA 2FJAA 5CB4E 4WNKA 2CLYC 2CMRA 4N78D 2D0TA 3RIAA 3V5SA 3K1SA 3UUMA 1YQ3A 1WYCA 1UX2A 3SRZA 4XHEA 1NWMX 3CMLA 5ABGA 2Y58A 4X65T 2M6BA 3GN5A 3KV4A 4ALXA 5TAOA 2XZ6A 5FMNA 3CX8B 3NBXX 1MIYA 4HWDA 1O3XA 2IUBA 4LF9T 2CWOA 3Q5DA 3WTJA 4X1YE 3HR0A 5L3EB 2V1DB 5FNVE 2YMDA 3P4RA 3FBLA 4XBFB 5JDNA 2X9XA 4YTNA 4JI7T 3LK3B 4CI2B 2QYWA 4LFCT 3EI0A 2VKDA 5JR9C 4HFBA 1LKXA 3DP7A 1HR0T 2ZLYA 4AFHA 1WCRA 1T72A 4A56A 3NRXA 3AEFA 4JI0T 5CFBA 4M1PA 3A5XA 3RC3A 3EABA 3P7IA 1W9RA 4G2AA 3RKOA 4ANJA 4ZR6A 3Q5XA 1S35A 5FL1A 5FJVA 4YLHA 1VCTA 2XSAA 5KDMC 2H89A 4QH1A 5DABA 3ZN1B 3C84A 4CN6A 3AE4A 2C5JA 1IJ6A 4CXXA 4LF5T 1W09A 5LXTE 4X1KE 3KBTA 2W62A 2QGSA 2LEHA 3N9NA 4MFRA 2K9AA 1J5WA 2KZ7B 2X00D 1R8IA 4UV9B 3ZYMA 2XNUA 5J5HA 4CN1A 4CZZB 4ZK4A 1JNRA 4ADZA 1YXRA 5EK2A 5HWXA 1OWAA 2JMKA 3KV5A 5F3JA 4IDNA 1HS7A 2XAGB 5TVCA 3E0ZA 3N9LA 4B3MT 4ZOLE 2UXCT 4FJOA 3FZFB 3KDSE 1XWMA 3UFGA 2VK9A 2V7IA 3Q5EA 3UU5A 3WAJA 2LSIA 3HI2A 1IZNB 2JJ9A 2C9TA 3I0OA 2J62A 1X79A 2BYQA 4AFGA 4X62T 3ZT7A 2XNVA 4GKJT 5JREA 3WTOA 5LOVE 5KX5E 5L2LA 2WSSV 4LF7T 2XQ5A 4GYSA 3AAIA 2CBIA 2LSYA 1XMOT 4H63H 4ZRUA 3BQKA 4TWFA 3PEOA 3AE6A 4UR9A 4PJLA 2Q9QB 2BBJA 2HN1A 3RRCA 4YSZA 5HEUA 2DWKA 4QH5A 4YFSA 1V9DA 3RHWA 3ZT5A 1I9BA 1D0ZA 3KV9A 2ZM6T 2XYTA 4X20E 2ACXA 4TZ4C 2WN9A 4QXCB 3N9MA 3AXJA 4A98A 2E5LT 3LFMA 3CPZA 4QH4A 2WBLA 2V7JA 3FZKB 4NPPA 4DMVA 3UU4A 2LKGA 5FXWA 4HWHA 4ILCA 2A9UA 2MBGA 1IBMT 2VB6A 2X68A 1D0XA 3MA9A 3WTHA 3PUZF 4GOUA 3UUXB 3ZCIA 2W4XA 4H9SE 4ZZCA 4HFVA 2Y54A 4IGUA 5AQMB 1SE7A 4OHFA 4JEUB 2VQET 5FYMA 4OYKA 2DWGA 4UELA 1N34T 4I50E 2E9XA 1UW6A 5L4EA 4P09A 1US7B 1GQEA 3V5UA 2B1EA 4YXDA 4XZCA 4HWCA 4LMLA 2PH9A 1NEKA 2X66A 4UF0A 3RX6A 5KXJA 2CE7A 2QC1B 3RQUA 2XM1A 3QOFA 2V6YA 2WNCA 5LCYA 3AB3B 5JRCB 4KHZF 4HN9A 4DR6T 3PUWF 5CJ5A 5BR8T 4U74A 4K0UA 3VR8A 2XNTA 5IYZE 4UM3A 5LHHB 4HFIA 5EZYE 5H6RB 5LXBA 4IL4A 2LE8A 2W66A 4G63A 1KNPA 3AEEA 2LJLA 1KK7A 5AFMB 3ZSTA 3UU6A 1LRZA 3EUHA 1XNRT 5AQHB 3NKZA 2B76A 1KFYA 4TNWA 4AI6A 3N9OA 4JI6T 3AVRA 5AQGB 2VQFT 3QK6A 4H9QC 5JVDE 3RF1A 3QC9A 5FVLA 4WYVA 3FZLB 3RRWA 2BS2A 4JYAT 3DJBA 4ASKA 4NXMT 4ZS2A 2R6GF 5JDQA 4NXNT 4GK0E 2XQAA 4KHPT 1FJGT 5HXEA 4XK9A 4AKLA 3JADA 2WNLA 2W00A 4ILUA 4EV6A 2V5CA 1XNQT 3RI5A 4QX7B 2EHOA 3MACA 2JPFA 3ZMZB 3EDVA 4U72A 2UU9T 2WZIA 4DBRA 5IHYA 5HEHA 1ZV4X 3L39A 3AVSA 3M65A 5AQIB 3CWZB 5AQJB 3O1HA 3L8RA 1KEYA 4YT0A 4DV2T 3ONJA 4LF6T 1ZHCA 4KP3C 4PW8A 3ANWB 1D0YA 1S94A 2KINB 4U3CA 2HHHT 3AE5A 2KT9A 4KUMB 3T4MA 3C4XA 3KINB 4AIUA 1MMDA 3LDQB 3K3QC 5LYJE 3NWIA 1E7PA 2CXDA 4YJ2E 3F57A 3ZT6A 3ZMUB 1N33T 3P50A 3ZYLA 3HKCE 1ZP0A 4UY2A 2YKSA 4JI8T 3SOLA 4B3ST 4O2AE 2YEVC 1M62A 4OK0A 5J5FA 5HWYA 3ETVA 2XQ7A 2YDQA 2XZ5A 2JQKA 2XHEB 3B5MA 2BG9A 3I9WA 4BJNA 2UXNB 3AAEB 3OJAA 3LJCA 2IC9A 3SQ9A 3F2EA 5DJQC 1E2AA 4O4LE 2H7VC 2L8KA 3HKEE 2KMFA 4OYJA 4ERRA 1Z0PA 2V5DA 4CXYA 2NR4A 5LG4A 3N5LA 2OV9A 3CIRA 3CQGB 2CM0A 4IL9A 1D1BA 2N9DA 4AKGA 4KX6A 1AJ3A 5L3GB 2X0LB 4TV8E 1OXZA 3O1IA 2F4VT 2BJ0A 1G8XA 2WM9A 2JRKA 5AFLA 2C0SA 5IUXA 5HXRA 4H9OC 3AE7A 4DBMA 3WIPA 4O2BE 2XSBA 4QWNB 2K48A 1H7CA 3KV6A 3WTKA 4BQTA 5HXHA 4EIWA 4PK5A 3SFEA 3GA8A 4KI0F 3VRBA 2VASA 3ZMSB 4ZEYA 2PTFA 2WDRA 1G73A 3ZPOA 2WU2A 4X66T 4EGWA 3AEDA 2VKHA 2CRBA 3D0TA 1XZYA 3P8CD 3AEAA 3QUJA 2FBWA 2YINA 2UXBT 3U8JA 3KVBA 1LVKA 4JV5T 2QVAA 2LHRA 4MHCA 2BYNA 4P0AA 1MMNA 4TWDA 4IE7A 2CA5A 1CHUA 4BFQA 2I59A 2ODUA 4JEHB 5LG3A 4U2YA 4YHJA 4GKKT 2XPKA 5JQGE 3UULA 2I0MA 2WCAA 1HX8A 4A97A 3OBVE 2XQ4A 4EOZB 2WP9A 2NWBA 5HCMA 4AISA 3TLUA 2IHR1 4Z91A 4DR1T 2X0YA 5AQOB 2XZEA 2XM2A 4GK5E 3GN5B 4ZI7E 4UIGA 5FY7A 3PUAA 1MIVA 4WBOA 3H37A 3OYXA 4NIQA 3OKQA 2MYSA 2KLQA 3UU8A 1EZ3A 4EYUA 4EZ4A 2E8IA 2YOEA 4IHJE 3AA7B 3RYCE 4AQFC 4UM3S 5AQTB 3WTNA 5AQRB 2XQ3A 4DR5T 4BA9A 1M7KA 1I94T 2WS3A 2DLRA 2LM2A 2Q9QA 3KFWX 3PUYF 2V7MA 5ABFB 5FXZA 5LB7B 1HNWT 1KNZA 5LGUB 1MNDA 1OEDE 2AXDS 3SFDA 4UXNB 5FY1A 1OEDA 4H63V 1J5ET 3C98B 4HFCA 3FHNA 3U8MA 2BKPA 2BR8A 2WAUA 2GK9A 3RKGA 4P1NA 2V26A 4L0RA 2YN6A 3SH1A 3K3OA 5AQPB 3VR9A 2WU5A 3C4ZA 3UUNA 2LOSA 2D0UA 2NTYA 4LF8T 3W15B 1IJ5A 1QLBA 4HFHA 1FMWA 4CQIA 2NOXA 5LJMA 3ZYKA 3NVOA 3FZMB 1HG2A 2X67A 3L09A 3JC6C 3QB5A 4B6XA 5ETWA 2YU1A 4JI4T 5EK4A 3N2OA 3ZDGA 3Q2MA 2X51A 2NW9A 4AXPA 3LBXA 4FRRA 4AFTA 3G06A 4GIWA 3PV0F 1BR0A 5F8PA 3FZHB 3PUXF 2VKJA 1VCSA 3ZEFB 2VURA 5AFHA 4DR3T 2YDSA 5ABEA 2ZM2A 2XY8B 3MK7C 5LHIB 5AFUL 4DUZT 5JRCA 2PGZA 3A8YC 4B3TT 1MMAA 4JBWF 2IC6A 5HYAA 5LMNT 4V1Av 2Y7YA 3PUSA 2G0UA 2CHNA 4ZI2C 4ZI2D 1ZEEA 3RIUA 2UZ6A 4ZK1A 5LHGB 2DL1A 4WV9A 4DIDB 1T7SA 3PU3A 4QXHB 5AFMA 1UCUA 4LFAT 2XJ7A 4UVBB 2CXLA 2V6XA 3P4QA 3PTRB 5JDMA 5HXCA 4EAHA 4KMCA 3PDYA 2M6IA 1JNZA 3VKGA 2V7LA 3OYZA 5CA0E 1VRBA 4D01A 5AQVB 2D9DA 1QSDA 3AXJB 2XQ8A 3A7MA 3KVAA 3P4WA 2XQ9A 3IHRA 3AA1B 5BRXA 5JH7E 3VKHA 2NP9A 4L9IA 4TN7B 3PJAA 2ES0A 5J0ZA 3AE8A 5LBQB 4J2CA 3UTKA 5BMVE 4F8HA 2LOPA 1IBLT 4QAAA 2CCQA 3PUQA 3NRYA 2IIUA 2K5BB 2LM9A 1E1HB 2LHNA 3FB2A 3ZCJA 3ZSSA 5CGMA 1HF8A 4IE5A 3TLTA 4DR2T 4DV5T 3CQCB 3EVYA 4C91A 2YMEA 1D1CA 5J5GA 4GYRA 4IREA 1D1AA 2CXFA 3EDUA 4TV9E 2E9XB 2BR7A 3AEBA 4EB6E 2QRXA 2Y56A 2IW5B 5AFNA 2FJEA 2BYPA 2WB5A 2YU2A 1LVFA 1UK5A 4IDQA 4UF0B 4ISSA 5HEGA 5JR9A 5BW2A 3ANWA 4WBNE 2V6YB 3AE3A 2X0HA 2WWUA 2BS3A 4PK6A 5FY0A 2CPTA 2E2AA 5JDLA 2ODVA 1OEDC 5JMEA 3UUBA 3IGQA 2X9WA 2WZYA 2LRLA 2H88A 3T1HT 2XAQB 3AE1A 4HKAA 4JLEA 4I0UA 5C2TA 1HG5A 3UQ7A 3LSVA 4TWHA 1I6ZA 4IE6A 3AECA 4DO0A 1WR6A 2Z6EA 4U7IA 3U8LA 4IDPA 3O1JA 2HPJA 3KBUA 5FXVA 1HNZT 4O4JE 2XAFB 4PNIA 5J2UE 5BP0A 1SA0E 3GWHA 2JIWA 1IAPA 1ZKEA 2X00A 4WZXA 1VOMA 1W0AA 5E0OA 2JQQA 3UFEA 1UGOA 4P0BA 1KNRA 3ABVA 4HE8A 1MIWA 2Y6XA 2YDRA 2Y57A 3ZC1A 4TNVA 3NZQA 4YY3T 3HL6A 3ETUA 3S4UA 1YQ4A 5C3JA 2N1GA 4IDZA 3SS1A 1HCIA 4UM3P 3QNUA 4ZXLA 5JDFA 2OLTA 4JUYA 2BG9E 4H9NC 4NUVA 4ZI3C 4ZI3D 3CVRA 5J5IA 3MZKB 2UXDT 5AQFB 4X5TA 2VWAA 5SYOA 2W8FA 4JI1T 2JMHA 2ZM0A 1Y64B 2XYSA 3PJAJ 2P9BA 2FJBA 5C8YE 2MPKA 3P4PA 2E5VA 1NENA 5EK3A 3I1AA 3CX6B 4X1IE 4EEDA 2E9XC 2E9XD 3NZPA 4QKNA 1MNEA 4L5GA 2BYRA 4U31A 3TLSA 2PJQA 4PIRA 5HCJA 1J1JA 1YKHB 4Q25A 4COFA 4AQGA 3UU3A 4PFOA 5KZUA 3UT5E 3WTLA 4FI5A 4JI3T 1WFDA 5LBMA 5JDGA 3ZDHA 4DR7T 5AFKA 4PJMA 5AQKB 3CQXC 4IDOA 4YSYA 3X1DA 4E7SA 2X9HA 1YW0A 4EEBA 5FP3A 1N36T 4PK4A 3PUGA 2CEAA 3FXDB 2RPAA 3IBPA 3N9PA 1UURA 2W61A 2CBJA 5HEOA 3WAKA 2XQ6A 3CX7B 3JCFA 2BDEA 3LK42 2RA1A 4HWIB 2BG9B 5AQNB 2V7KA 5CA1E 3SQ6A 4DBQA 4DNDA 3HKBE 4IE4A 1ZOYA 2LSJA 2L3LA 3O9XA 4E7ZA 2W67A 2IAKA 2KNDA 3Q5WA 3C51A 2XASB 3PE0A 2J1DG 5LA6E 4DV6T 3SIOA 3I9YA 4O4HE 2VL8A 5ABFA 3ONXA 1XMQT 3DTOA 3RIFA 3IEEA 2AE9A 1YD8G 5DQVA 3ZC0A 4DV0T 3C79A 1UX4A 4DV7T 1U4QA 4TUYE 1NAFA 2EHOC 2EHOD 4AKRB 4OX9T 4LFBT 3T8OA 1HX1B 3E08A 5DQWA 2Y8DA 3RYFE 4O8SA 3WI3A 3ZLIA 2V8SV 2CHOA 4ILBA 2PBIA 2KWIB 4YTMA 1HNXT 2N2NA 3BQLA 4CXWA 4AKHA 4LF4T 4QHOA 4I43B 2BKOA 4MLKA 2DHRA 3PURA 2VVNA 4ZJSA 4QACA 4LMKA 5LJNA 5HEJA 3RH3A 4QABA
chains in the Genus database with same CATH topology
2ZJVA 3RHWA 1I9BA 4XHEA 5HCMA 5J5IA 2XYTA 3TLUA 4Z91A 2Y58A 2WN9A 4D01A 4IL9A 2XNTA 4A98A 2M6BA 4X5TA 4ALXA 4UM3A 2XZ6A 4ZK1A 1OEDC 5AINA 4HFIA 5JMEA 4QH4A 3UUBA 2BJ0A 5SYOA 2W8FA 3IGQA 2XQ8A 2X00D 2XYSA 4IL4A 2WZYA 5KE4A 5LXBA 2KSRA 4HFHA 3SIOA 4NPPA 2WNJA 2VL0A 5AFLA 4HFDA 2XNUA 5J5HA 3UU4A 2LKGA 3P4WA 2XQ9A 4ZK4A 4UXUA 5IUXA 4ILCA 2LKHA 5CO5A 3UQ7A 5AFMB 3LSVA 2YN6A 3RIFA 3UU6A 2BYRA 4TWHA 4DBMA 3UQ4A 3WIPA 3WTJA 5BRXA 3UU8A 5L4HA 3TLSA 4TNWA 5TVCA 4ZZBA 3JAEA 2YOEA 5HCJA 4PIRA 3TLWA 3WTHA 3ZDGA 3WTKA 2BG9E 3U8LA 2MAWA 4COFA 5J0ZA 3C79A 4ZZCA 4BQTA 3UU3A 2Y54A 4UM3S 3WTNA 3T4MA 5KZUA 3WTMA 4B5DA 4ILAA 2XQ3A 2YMDA 2BG9C 4HQPA 3WTLA 4FRRA 4AFTA 4EZ1A 3GUAA 3UU5A 4F8HA 4QAAA 5BP0A 2LM2A 3TLVA 3ZDHA 5AFKA 3EHZA 3EI0A 4UM1A 2C9TA 2LLYA 2X00A 5AFJA 4HFBA 3EAMA 5L47A 5AFHA 3C84A 4ZJTA 4Z90A 3TLTA 2BYQA 3RQWA 4LMJA 4AFGA 4AFHA 4ILBA 2PGZA 2YMEA 3P50A 4NZBA 2XNVA 1OEDE 1UW6A 5L4EA 5J5GA 3WTIA 4UY2A 3WTOA 4IREA 2YKSA 2XQAA 2Y57A 3U8JA 5CFBA 4TNVA 4XK9A 2XQ5A 5HEOA 2BR7A 3JADA 2XQ6A 2Y7YA 3ZKRA 2BYNA 1OEDA 2WNLA 2BYSA 5J5FA 2Y56A 2XQ7A 4LMLA 2PH9A 4ZR6A 4TWDA 2XZ5A 5AFNA 3SH1A 2BG9A 4HFCA 2W8GA 2BYPA 4ZRUA 2UZ6A 4TWFA 3RI5A 3PEOA 2ZJUA 3PMZA 1OEDB 4UM3P 4ZJSA 3U8MA 4BFQA 4WV9A 4QACA 2BR8A 4LMKA 3JAFA 2QC1B 5LG3A 3U8KA 3RQUA 3RIAA 3SQ6A 5FJVA 3SQ9A 5HEJA 2BG9B 3U8NA 5HEGA 5AFMA 4QH1A 5HEUA 5HEHA 4HFEA 2WNCA 5BW2A 4A97A 1UX2A 4QABA 2XQ4A 2M6IA 4QH5A 1UV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJV A;  3RHW A;  1I9B A;  4XHE A;  5HCM A;  5J5I A;  2XYT A;  3TLU A;  4Z91 A;  2Y58 A;  2WN9 A;  4D01 A;  4IL9 A;  2XNT A;  4A98 A;  2M6B A;  4X5T A;  4ALX A;  4UM3 A;  2XZ6 A;  4ZK1 A;  1OED C;  5AIN A;  4HFI A;  5JME A;  4QH4 A;  3UUB A;  2BJ0 A;  5SYO A;  2W8F A;  3IGQ A;  2XQ8 A;  2X00 D;  2XYS A;  4IL4 A;  2WZY A;  5KE4 A;  5LXB A;  2KSR A;  4HFH A;  3SIO A;  4NPP A;  2WNJ A;  2VL0 A;  5AFL A;  4HFD A;  2XNU A;  5J5H A;  3UU4 A;  2LKG A;  3P4W A;  2XQ9 A;  4ZK4 A;  4UXU A;  5IUX A;  4ILC A;  2LKH A;  5CO5 A;  3UQ7 A;  5AFM B;  3LSV A;  2YN6 A;  3RIF A;  3UU6 A;  2BYR A;  4TWH A;  4DBM A;  3UQ4 A;  3WIP A;  3WTJ A;  5BRX A;  3UU8 A;  5L4H A;  3TLS A;  4TNW A;  5TVC A;  4ZZB A;  3JAE A;  2YOE A;  5HCJ A;  4PIR A;  3TLW A;  3WTH A;  3ZDG A;  3WTK A;  2BG9 E;  3U8L A;  2MAW A;  4COF A;  5J0Z A;  3C79 A;  4ZZC A;  4BQT A;  3UU3 A;  2Y54 A;  4UM3 S;  3WTN A;  3T4M A;  5KZU A;  3WTM A;  4B5D A;  4ILA A;  2XQ3 A;  2YMD A;  2BG9 C;  4HQP A;  3WTL A;  4FRR A;  4AFT A;  4EZ1 A;  3GUA A;  3UU5 A;  4F8H A;  4QAA A;  5BP0 A;  2LM2 A;  3TLV A;  3ZDH A;  5AFK A;  3EHZ A;  3EI0 A;  4UM1 A;  2C9T A;  2LLY A;  2X00 A;  5AFJ A;  4HFB A;  3EAM A;  5L47 A;  5AFH A;  3C84 A;  4ZJT A;  4Z90 A;  3TLT A;  2BYQ A;  3RQW A;  4LMJ A;  4AFG A;  4AFH A;  4ILB A;  2PGZ A;  2YME A;  3P50 A;  4NZB A;  2XNV A;  1OED E;  1UW6 A;  5L4E A;  5J5G A;  3WTI A;  4UY2 A;  3WTO A;  4IRE A;  2YKS A;  2XQA A;  2Y57 A;  3U8J A;  5CFB A;  4TNV A;  4XK9 A;  2XQ5 A;  5HEO A;  2BR7 A;  3JAD A;  2XQ6 A;  2Y7Y A;  3ZKR A;  2BYN A;  1OED A;  2WNL A;  2BYS A;  5J5F A;  2Y56 A;  2XQ7 A;  4LML A;  2PH9 A;  4ZR6 A;  4TWD A;  2XZ5 A;  5AFN A;  3SH1 A;  2BG9 A;  4HFC A;  2W8G A;  2BYP A;  4ZRU A;  2UZ6 A;  4TWF A;  3RI5 A;  3PEO A;  2ZJU A;  3PMZ A;  1OED B;  4UM3 P;  4ZJS A;  3U8M A;  4BFQ A;  4WV9 A;  4QAC A;  2BR8 A;  4LMK A;  3JAF A;  2QC1 B;  5LG3 A;  3U8K A;  3RQU A;  3RIA A;  3SQ6 A;  5FJV A;  3SQ9 A;  5HEJ A;  2BG9 B;  3U8N A;  5HEG A;  5AFM A;  4QH1 A;  5HEU A;  5HEH A;  4HFE A;  2WNC A;  5BW2 A;  4A97 A;  1UX2 A;  4QAB A;  2XQ4 A;  2M6I A;  4QH5 A;  1UV6 A; 
#chains in the Genus database with same CATH topology
 2ZJV A;  1Y01 A;  3B57 A;  3QB5 K;  4U2Z A;  5LNK A;  3PUV F;  2K24 A;  1HTJ F;  2QA7 A;  2WNJ A;  2VL0 A;  1CUN A;  3FBZ A;  2H7O A;  3AAA B;  4DR4 T;  2VVS A;  3UQ4 A;  4DV4 T;  2C5K T;  2UUB T;  4AQY T;  2DNX A;  2WY2 A;  5H6Q B;  4ZZB A;  2WDQ A;  3ZJ1 A;  3BQI A;  4X64 T;  2CWY A;  4YHH T;  5LP6 E;  4PJJ A;  4ZS3 A;  3WTM A;  2BG9 C;  3AA6 B;  3GMI A;  3K3N A;  3SWH A;  3OPC A;  2HPL A;  2XAJ B;  3HKD E;  3RYI E;  2DI4 A;  2YK0 A;  4I55 E;  2KXP B;  2LLY A;  3JC6 D;  5FKY A;  3RPU A;  1B7T A;  4LMJ A;  2I6H A;  3H3A A;  3ONL C;  5J1G A;  3VU7 H;  3F31 A;  4F6R C;  4MBQ A;  2PG8 A;  4PAG A;  2ZM8 A;  3MKD A;  2BYS A;  4EZH A;  3VRA A;  4DV1 T;  4MAL A;  4C90 A;  1OED B;  3RGL A;  3HA4 A;  4JI2 T;  1DU2 A;  4IT4 A;  2ZMA A;  2HH7 A;  1SHZ C;  4HFE A;  3AE2 A;  2UUC T;  1FEW A;  3N9Q A;  2UXX B;  2Y48 B;  4NUU A;  2FUP A;  4UV8 B;  4TX5 A;  3Q9D A;  1YKE B;  2A2F X;  1T8B A;  2JQ9 A;  2KSR A;  4AKI A;  2LSG A;  3L3P A;  4HFD A;  2XQY A;  2BBH A;  3P4S A;  2LT3 A;  2MTQ A;  1N32 T;  3IA3 A;  5FL0 A;  4QX8 B;  4PJN A;  5L3D B;  4QXB B;  4Z8X A;  3J9X 1;  3PU8 A;  2HN2 A;  3U78 A;  4BAY B;  5LGN B;  4EZ1 A;  5LGT B;  4IST A;  3ZMT B;  4CN4 A;  5AQU B;  2RP4 A;  3LBX B;  3EHZ A;  5LMU T;  4UM1 A;  4DUY T;  3MXZ A;  1WRD A;  5HXS A;  4ZJT A;  4UVA B;  5FVK A;  4U33 A;  2WMO A;  5M4Y A;  3ZMV B;  2JQH A;  3J7Y q;  3OVU A;  4IIJ E;  2WZH A;  4KBM B;  1FMV A;  5F5W A;  1FIO A;  3OTO T;  3U3I A;  5JTG A;  4K0K T;  2W8G A;  2ZJU A;  2BVL A;  2A3D A;  3U8K A;  4CI1 B;  3RC8 A;  4DVD A;  3U8N A;  3VHL A;  4H9R C;  5AQQ B;  1UV6 A;  4XAX B;  2ACZ A;  3K8P C;  3E22 E;  2WQY A;  4UEM A;  4PFP A;  3I0Q A;  3C50 A;  2Q9Q C;  2Q9Q D;  1KF6 A;  3ZN0 B;  1MMG A;  5AQL B;  2NW8 A;  1U5P A;  1WYB A;  4HGA A;  4UXU A;  2LKH A;  5CO5 A;  4BJM A;  2PFV A;  2CLY B;  5L3C B;  5L4H A;  3BK9 A;  5IWA T;  5ADX L;  1L0V A;  2C5I T;  4B5D A;  5A1L A;  4HQP A;  1WR0 A;  2UUA T;  1XDP A;  3MJX A;  3RYH E;  3LG7 A;  4H9P C;  2W2U A;  3CKD A;  3FXE B;  5AFJ A;  3EAM A;  4YJ3 E;  5L3F B;  2A72 A;  4Z90 A;  2BZB A;  2SPC A;  5KMG P;  3AE9 A;  2LRK A;  3WTI A;  4I4T E;  1QUU A;  4HEA A;  4EXT A;  3B13 A;  4U7Y A;  3C4W A;  3R84 B;  2DCF A;  2M67 A;  1BR1 A;  3C64 A;  4YTP A;  1UUS A;  4AQF A;  2IDO B;  5HAX A;  2WWV A;  2H3R A;  3PMZ A;  2VKO A;  3JAF A;  2D2S A;  5L3B B;  2XAH B;  2FJD A;  2W0G A;  3LK2 B;  2J47 A;  1T98 A;  4HTE A;  3H3M A;  2WMN A;  5JR9 B;  4O4I E;  5FXX A;  5ABH A;  1BR4 A;  3N2G E;  3T1Y T;  3M3Z B;  5AIN A;  2WDV A;  3IF8 B;  2J4G A;  4YSX A;  5KE4 A;  4IE0 A;  2EHO B;  3ZJ2 A;  3RLF F;  2BVM A;  2D5U A;  1HFA A;  2W63 A;  3N2K E;  3O4X E;  3AA0 B;  1BR2 A;  3R6N A;  2NTX A;  4WW0 A;  4OFZ A;  2XUE A;  4HWF A;  5AQS B;  3CK6 A;  5GON E;  1XDO A;  2BS4 A;  2L9Q A;  3JAE A;  3TLW A;  1UX5 A;  2MAW A;  1IBK T;  4UVC B;  4JI5 T;  1SUM B;  4ILA A;  1X9B A;  5J2T E;  3RIU C;  1Z8U A;  3TKL B;  3GUA A;  2K3W A;  3TLV A;  2IML A;  2BKN A;  2KWH A;  5L47 A;  2MOZ A;  4DMW A;  2LSK A;  2NW7 A;  4CI3 B;  3RQW A;  5JDH A;  1W0B A;  1WLX A;  4NZB A;  2XTL A;  4EYY R;  3ESL A;  3AEG A;  4DV3 T;  2X9Y A;  4ZHQ E;  4B3R T;  3ZKR A;  2OA5 A;  4A5X A;  2FJA A;  5CB4 E;  4WNK A;  2CLY C;  2CMR A;  4N78 D;  2D0T A;  3RIA A;  3V5S A;  3K1S A;  3UUM A;  1YQ3 A;  1WYC A;  1UX2 A;  3SRZ A;  4XHE A;  1NWM X;  3CML A;  5ABG A;  2Y58 A;  4X65 T;  2M6B A;  3GN5 A;  3KV4 A;  4ALX A;  5TAO A;  2XZ6 A;  5FMN A;  3CX8 B;  3NBX X;  1MIY A;  4HWD A;  1O3X A;  2IUB A;  4LF9 T;  2CWO A;  3Q5D A;  3WTJ A;  4X1Y E;  3HR0 A;  5L3E B;  2V1D B;  5FNV E;  2YMD A;  3P4R A;  3FBL A;  4XBF B;  5JDN A;  2X9X A;  4YTN A;  4JI7 T;  3LK3 B;  4CI2 B;  2QYW A;  4LFC T;  3EI0 A;  2VKD A;  5JR9 C;  4HFB A;  1LKX A;  3DP7 A;  1HR0 T;  2ZLY A;  4AFH A;  1WCR A;  1T72 A;  4A56 A;  3NRX A;  3AEF A;  4JI0 T;  5CFB A;  4M1P A;  3A5X A;  3RC3 A;  3EAB A;  3P7I A;  1W9R A;  4G2A A;  3RKO A;  4ANJ A;  4ZR6 A;  3Q5X A;  1S35 A;  5FL1 A;  5FJV A;  4YLH A;  1VCT A;  2XSA A;  5KDM C;  2H89 A;  4QH1 A;  5DAB A;  3ZN1 B;  3C84 A;  4CN6 A;  3AE4 A;  2C5J A;  1IJ6 A;  4CXX A;  4LF5 T;  1W09 A;  5LXT E;  4X1K E;  3KBT A;  2W62 A;  2QGS A;  2LEH A;  3N9N A;  4MFR A;  2K9A A;  1J5W A;  2KZ7 B;  2X00 D;  1R8I A;  4UV9 B;  3ZYM A;  2XNU A;  5J5H A;  4CN1 A;  4CZZ B;  4ZK4 A;  1JNR A;  4ADZ A;  1YXR A;  5EK2 A;  5HWX A;  1OWA A;  2JMK A;  3KV5 A;  5F3J A;  4IDN A;  1HS7 A;  2XAG B;  5TVC A;  3E0Z A;  3N9L A;  4B3M T;  4ZOL E;  2UXC T;  4FJO A;  3FZF B;  3KDS E;  1XWM A;  3UFG A;  2VK9 A;  2V7I A;  3Q5E A;  3UU5 A;  3WAJ A;  2LSI A;  3HI2 A;  1IZN B;  2JJ9 A;  2C9T A;  3I0O A;  2J62 A;  1X79 A;  2BYQ A;  4AFG A;  4X62 T;  3ZT7 A;  2XNV A;  4GKJ T;  5JRE A;  3WTO A;  5LOV E;  5KX5 E;  5L2L A;  2WSS V;  4LF7 T;  2XQ5 A;  4GYS A;  3AAI A;  2CBI A;  2LSY A;  1XMO T;  4H63 H;  4ZRU A;  3BQK A;  4TWF A;  3PEO A;  3AE6 A;  4UR9 A;  4PJL A;  2Q9Q B;  2BBJ A;  2HN1 A;  3RRC A;  4YSZ A;  5HEU A;  2DWK A;  4QH5 A;  4YFS A;  1V9D A;  3RHW A;  3ZT5 A;  1I9B A;  1D0Z A;  3KV9 A;  2ZM6 T;  2XYT A;  4X20 E;  2ACX A;  4TZ4 C;  2WN9 A;  4QXC B;  3N9M A;  3AXJ A;  4A98 A;  2E5L T;  3LFM A;  3CPZ A;  4QH4 A;  2WBL A;  2V7J A;  3FZK B;  4NPP A;  4DMV A;  3UU4 A;  2LKG A;  5FXW A;  4HWH A;  4ILC A;  2A9U A;  2MBG A;  1IBM T;  2VB6 A;  2X68 A;  1D0X A;  3MA9 A;  3WTH A;  3PUZ F;  4GOU A;  3UUX B;  3ZCI A;  2W4X A;  4H9S E;  4ZZC A;  4HFV A;  2Y54 A;  4IGU A;  5AQM B;  1SE7 A;  4OHF A;  4JEU B;  2VQE T;  5FYM A;  4OYK A;  2DWG A;  4UEL A;  1N34 T;  4I50 E;  2E9X A;  1UW6 A;  5L4E A;  4P09 A;  1US7 B;  1GQE A;  3V5U A;  2B1E A;  4YXD A;  4XZC A;  4HWC A;  4LML A;  2PH9 A;  1NEK A;  2X66 A;  4UF0 A;  3RX6 A;  5KXJ A;  2CE7 A;  2QC1 B;  3RQU A;  2XM1 A;  3QOF A;  2V6Y A;  2WNC A;  5LCY A;  3AB3 B;  5JRC B;  4KHZ F;  4HN9 A;  4DR6 T;  3PUW F;  5CJ5 A;  5BR8 T;  4U74 A;  4K0U A;  3VR8 A;  2XNT A;  5IYZ E;  4UM3 A;  5LHH B;  4HFI A;  5EZY E;  5H6R B;  5LXB A;  4IL4 A;  2LE8 A;  2W66 A;  4G63 A;  1KNP A;  3AEE A;  2LJL A;  1KK7 A;  5AFM B;  3ZST A;  3UU6 A;  1LRZ A;  3EUH A;  1XNR T;  5AQH B;  3NKZ A;  2B76 A;  1KFY A;  4TNW A;  4AI6 A;  3N9O A;  4JI6 T;  3AVR A;  5AQG B;  2VQF T;  3QK6 A;  4H9Q C;  5JVD E;  3RF1 A;  3QC9 A;  5FVL A;  4WYV A;  3FZL B;  3RRW A;  2BS2 A;  4JYA T;  3DJB A;  4ASK A;  4NXM T;  4ZS2 A;  2R6G F;  5JDQ A;  4NXN T;  4GK0 E;  2XQA A;  4KHP T;  1FJG T;  5HXE A;  4XK9 A;  4AKL A;  3JAD A;  2WNL A;  2W00 A;  4ILU A;  4EV6 A;  2V5C A;  1XNQ T;  3RI5 A;  4QX7 B;  2EHO A;  3MAC A;  2JPF A;  3ZMZ B;  3EDV A;  4U72 A;  2UU9 T;  2WZI A;  4DBR A;  5IHY A;  5HEH A;  1ZV4 X;  3L39 A;  3AVS A;  3M65 A;  5AQI B;  3CWZ B;  5AQJ B;  3O1H A;  3L8R A;  1KEY A;  4YT0 A;  4DV2 T;  3ONJ A;  4LF6 T;  1ZHC A;  4KP3 C;  4PW8 A;  3ANW B;  1D0Y A;  1S94 A;  2KIN B;  4U3C A;  2HHH T;  3AE5 A;  2KT9 A;  4KUM B;  3T4M A;  3C4X A;  3KIN B;  4AIU A;  1MMD A;  3LDQ B;  3K3Q C;  5LYJ E;  3NWI A;  1E7P A;  2CXD A;  4YJ2 E;  3F57 A;  3ZT6 A;  3ZMU B;  1N33 T;  3P50 A;  3ZYL A;  3HKC E;  1ZP0 A;  4UY2 A;  2YKS A;  4JI8 T;  3SOL A;  4B3S T;  4O2A E;  2YEV C;  1M62 A;  4OK0 A;  5J5F A;  5HWY A;  3ETV A;  2XQ7 A;  2YDQ A;  2XZ5 A;  2JQK A;  2XHE B;  3B5M A;  2BG9 A;  3I9W A;  4BJN A;  2UXN B;  3AAE B;  3OJA A;  3LJC A;  2IC9 A;  3SQ9 A;  3F2E A;  5DJQ C;  1E2A A;  4O4L E;  2H7V C;  2L8K A;  3HKE E;  2KMF A;  4OYJ A;  4ERR A;  1Z0P A;  2V5D A;  4CXY A;  2NR4 A;  5LG4 A;  3N5L A;  2OV9 A;  3CIR A;  3CQG B;  2CM0 A;  4IL9 A;  1D1B A;  2N9D A;  4AKG A;  4KX6 A;  1AJ3 A;  5L3G B;  2X0L B;  4TV8 E;  1OXZ A;  3O1I A;  2F4V T;  2BJ0 A;  1G8X A;  2WM9 A;  2JRK A;  5AFL A;  2C0S A;  5IUX A;  5HXR A;  4H9O C;  3AE7 A;  4DBM A;  3WIP A;  4O2B E;  2XSB A;  4QWN B;  2K48 A;  1H7C A;  3KV6 A;  3WTK A;  4BQT A;  5HXH A;  4EIW A;  4PK5 A;  3SFE A;  3GA8 A;  4KI0 F;  3VRB A;  2VAS A;  3ZMS B;  4ZEY A;  2PTF A;  2WDR A;  1G73 A;  3ZPO A;  2WU2 A;  4X66 T;  4EGW A;  3AED A;  2VKH A;  2CRB A;  3D0T A;  1XZY A;  3P8C D;  3AEA A;  3QUJ A;  2FBW A;  2YIN A;  2UXB T;  3U8J A;  3KVB A;  1LVK A;  4JV5 T;  2QVA A;  2LHR A;  4MHC A;  2BYN A;  4P0A A;  1MMN A;  4TWD A;  4IE7 A;  2CA5 A;  1CHU A;  4BFQ A;  2I59 A;  2ODU A;  4JEH B;  5LG3 A;  4U2Y A;  4YHJ A;  4GKK T;  2XPK A;  5JQG E;  3UUL A;  2I0M A;  2WCA A;  1HX8 A;  4A97 A;  3OBV E;  2XQ4 A;  4EOZ B;  2WP9 A;  2NWB A;  5HCM A;  4AIS A;  3TLU A;  2IHR 1;  4Z91 A;  4DR1 T;  2X0Y A;  5AQO B;  2XZE A;  2XM2 A;  4GK5 E;  3GN5 B;  4ZI7 E;  4UIG A;  5FY7 A;  3PUA A;  1MIV A;  4WBO A;  3H37 A;  3OYX A;  4NIQ A;  3OKQ A;  2MYS A;  2KLQ A;  3UU8 A;  1EZ3 A;  4EYU A;  4EZ4 A;  2E8I A;  2YOE A;  4IHJ E;  3AA7 B;  3RYC E;  4AQF C;  4UM3 S;  5AQT B;  3WTN A;  5AQR B;  2XQ3 A;  4DR5 T;  4BA9 A;  1M7K A;  1I94 T;  2WS3 A;  2DLR A;  2LM2 A;  2Q9Q A;  3KFW X;  3PUY F;  2V7M A;  5ABF B;  5FXZ A;  5LB7 B;  1HNW T;  1KNZ A;  5LGU B;  1MND A;  1OED E;  2AXD S;  3SFD A;  4UXN B;  5FY1 A;  1OED A;  4H63 V;  1J5E T;  3C98 B;  4HFC A;  3FHN A;  3U8M A;  2BKP A;  2BR8 A;  2WAU A;  2GK9 A;  3RKG A;  4P1N A;  2V26 A;  4L0R A;  2YN6 A;  3SH1 A;  3K3O A;  5AQP B;  3VR9 A;  2WU5 A;  3C4Z A;  3UUN A;  2LOS A;  2D0U A;  2NTY A;  4LF8 T;  3W15 B;  1IJ5 A;  1QLB A;  4HFH A;  1FMW A;  4CQI A;  2NOX A;  5LJM A;  3ZYK A;  3NVO A;  3FZM B;  1HG2 A;  2X67 A;  3L09 A;  3JC6 C;  3QB5 A;  4B6X A;  5ETW A;  2YU1 A;  4JI4 T;  5EK4 A;  3N2O A;  3ZDG A;  3Q2M A;  2X51 A;  2NW9 A;  4AXP A;  3LBX A;  4FRR A;  4AFT A;  3G06 A;  4GIW A;  3PV0 F;  1BR0 A;  5F8P A;  3FZH B;  3PUX F;  2VKJ A;  1VCS A;  3ZEF B;  2VUR A;  5AFH A;  4DR3 T;  2YDS A;  5ABE A;  2ZM2 A;  2XY8 B;  3MK7 C;  5LHI B;  5AFU L;  4DUZ T;  5JRC A;  2PGZ A;  3A8Y C;  4B3T T;  1MMA A;  4JBW F;  2IC6 A;  5HYA A;  5LMN T;  4V1A v;  2Y7Y A;  3PUS A;  2G0U A;  2CHN A;  4ZI2 C;  4ZI2 D;  1ZEE A;  3RIU A;  2UZ6 A;  4ZK1 A;  5LHG B;  2DL1 A;  4WV9 A;  4DID B;  1T7S A;  3PU3 A;  4QXH B;  5AFM A;  1UCU A;  4LFA T;  2XJ7 A;  4UVB B;  2CXL A;  2V6X A;  3P4Q A;  3PTR B;  5JDM A;  5HXC A;  4EAH A;  4KMC A;  3PDY A;  2M6I A;  1JNZ A;  3VKG A;  2V7L A;  3OYZ A;  5CA0 E;  1VRB A;  4D01 A;  5AQV B;  2D9D A;  1QSD A;  3AXJ B;  2XQ8 A;  3A7M A;  3KVA A;  3P4W A;  2XQ9 A;  3IHR A;  3AA1 B;  5BRX A;  5JH7 E;  3VKH A;  2NP9 A;  4L9I A;  4TN7 B;  3PJA A;  2ES0 A;  5J0Z A;  3AE8 A;  5LBQ B;  4J2C A;  3UTK A;  5BMV E;  4F8H A;  2LOP A;  1IBL T;  4QAA A;  2CCQ A;  3PUQ A;  3NRY A;  2IIU A;  2K5B B;  2LM9 A;  1E1H B;  2LHN A;  3FB2 A;  3ZCJ A;  3ZSS A;  5CGM A;  1HF8 A;  4IE5 A;  3TLT A;  4DR2 T;  4DV5 T;  3CQC B;  3EVY A;  4C91 A;  2YME A;  1D1C A;  5J5G A;  4GYR A;  4IRE A;  1D1A A;  2CXF A;  3EDU A;  4TV9 E;  2E9X B;  2BR7 A;  3AEB A;  4EB6 E;  2QRX A;  2Y56 A;  2IW5 B;  5AFN A;  2FJE A;  2BYP A;  2WB5 A;  2YU2 A;  1LVF A;  1UK5 A;  4IDQ A;  4UF0 B;  4ISS A;  5HEG A;  5JR9 A;  5BW2 A;  3ANW A;  4WBN E;  2V6Y B;  3AE3 A;  2X0H A;  2WWU A;  2BS3 A;  4PK6 A;  5FY0 A;  2CPT A;  2E2A A;  5JDL A;  2ODV A;  1OED C;  5JME A;  3UUB A;  3IGQ A;  2X9W A;  2WZY A;  2LRL A;  2H88 A;  3T1H T;  2XAQ B;  3AE1 A;  4HKA A;  4JLE A;  4I0U A;  5C2T A;  1HG5 A;  3UQ7 A;  3LSV A;  4TWH A;  1I6Z A;  4IE6 A;  3AEC A;  4DO0 A;  1WR6 A;  2Z6E A;  4U7I A;  3U8L A;  4IDP A;  3O1J A;  2HPJ A;  3KBU A;  5FXV A;  1HNZ T;  4O4J E;  2XAF B;  4PNI A;  5J2U E;  5BP0 A;  1SA0 E;  3GWH A;  2JIW A;  1IAP A;  1ZKE A;  2X00 A;  4WZX A;  1VOM A;  1W0A A;  5E0O A;  2JQQ A;  3UFE A;  1UGO A;  4P0B A;  1KNR A;  3ABV A;  4HE8 A;  1MIW A;  2Y6X A;  2YDR A;  2Y57 A;  3ZC1 A;  4TNV A;  3NZQ A;  4YY3 T;  3HL6 A;  3ETU A;  3S4U A;  1YQ4 A;  5C3J A;  2N1G A;  4IDZ A;  3SS1 A;  1HCI A;  4UM3 P;  3QNU A;  4ZXL A;  5JDF A;  2OLT A;  4JUY A;  2BG9 E;  4H9N C;  4NUV A;  4ZI3 C;  4ZI3 D;  3CVR A;  5J5I A;  3MZK B;  2UXD T;  5AQF B;  4X5T A;  2VWA A;  5SYO A;  2W8F A;  4JI1 T;  2JMH A;  2ZM0 A;  1Y64 B;  2XYS A;  3PJA J;  2P9B A;  2FJB A;  5C8Y E;  2MPK A;  3P4P A;  2E5V A;  1NEN A;  5EK3 A;  3I1A A;  3CX6 B;  4X1I E;  4EED A;  2E9X C;  2E9X D;  3NZP A;  4QKN A;  1MNE A;  4L5G A;  2BYR A;  4U31 A;  3TLS A;  2PJQ A;  4PIR A;  5HCJ A;  1J1J A;  1YKH B;  4Q25 A;  4COF A;  4AQG A;  3UU3 A;  4PFO A;  5KZU A;  3UT5 E;  3WTL A;  4FI5 A;  4JI3 T;  1WFD A;  5LBM A;  5JDG A;  3ZDH A;  4DR7 T;  5AFK A;  4PJM A;  5AQK B;  3CQX C;  4IDO A;  4YSY A;  3X1D A;  4E7S A;  2X9H A;  1YW0 A;  4EEB A;  5FP3 A;  1N36 T;  4PK4 A;  3PUG A;  2CEA A;  3FXD B;  2RPA A;  3IBP A;  3N9P A;  1UUR A;  2W61 A;  2CBJ A;  5HEO A;  3WAK A;  2XQ6 A;  3CX7 B;  3JCF A;  2BDE A;  3LK4 2;  2RA1 A;  4HWI B;  2BG9 B;  5AQN B;  2V7K A;  5CA1 E;  3SQ6 A;  4DBQ A;  4DND A;  3HKB E;  4IE4 A;  1ZOY A;  2LSJ A;  2L3L A;  3O9X A;  4E7Z A;  2W67 A;  2IAK A;  2KND A;  3Q5W A;  3C51 A;  2XAS B;  3PE0 A;  2J1D G;  5LA6 E;  4DV6 T;  3SIO A;  3I9Y A;  4O4H E;  2VL8 A;  5ABF A;  3ONX A;  1XMQ T;  3DTO A;  3RIF A;  3IEE A;  2AE9 A;  1YD8 G;  5DQV A;  3ZC0 A;  4DV0 T;  3C79 A;  1UX4 A;  4DV7 T;  1U4Q A;  4TUY E;  1NAF A;  2EHO C;  2EHO D;  4AKR B;  4OX9 T;  4LFB T;  3T8O A;  1HX1 B;  3E08 A;  5DQW A;  2Y8D A;  3RYF E;  4O8S A;  3WI3 A;  3ZLI A;  2V8S V;  2CHO A;  4ILB A;  2PBI A;  2KWI B;  4YTM A;  1HNX T;  2N2N A;  3BQL A;  4CXW A;  4AKH A;  4LF4 T;  4QHO A;  4I43 B;  2BKO A;  4MLK A;  2DHR A;  3PUR A;  2VVN A;  4ZJS A;  4QAC A;  4LMK A;  5LJN A;  5HEJ A;  3RH3 A;  4QAB A; 
#chains in the Genus database with same CATH homology
 2ZJV A;  3RHW A;  1I9B A;  4XHE A;  5HCM A;  5J5I A;  2XYT A;  3TLU A;  4Z91 A;  2Y58 A;  2WN9 A;  4D01 A;  4IL9 A;  2XNT A;  4A98 A;  2M6B A;  4X5T A;  4ALX A;  4UM3 A;  2XZ6 A;  4ZK1 A;  1OED C;  5AIN A;  4HFI A;  5JME A;  4QH4 A;  3UUB A;  2BJ0 A;  5SYO A;  2W8F A;  3IGQ A;  2XQ8 A;  2X00 D;  2XYS A;  4IL4 A;  2WZY A;  5KE4 A;  5LXB A;  2KSR A;  4HFH A;  3SIO A;  4NPP A;  2WNJ A;  2VL0 A;  5AFL A;  4HFD A;  2XNU A;  5J5H A;  3UU4 A;  2LKG A;  3P4W A;  2XQ9 A;  4ZK4 A;  4UXU A;  5IUX A;  4ILC A;  2LKH A;  5CO5 A;  3UQ7 A;  5AFM B;  3LSV A;  2YN6 A;  3RIF A;  3UU6 A;  2BYR A;  4TWH A;  4DBM A;  3UQ4 A;  3WIP A;  3WTJ A;  5BRX A;  3UU8 A;  5L4H A;  3TLS A;  4TNW A;  5TVC A;  4ZZB A;  3JAE A;  2YOE A;  5HCJ A;  4PIR A;  3TLW A;  3WTH A;  3ZDG A;  3WTK A;  2BG9 E;  3U8L A;  2MAW A;  4COF A;  5J0Z A;  3C79 A;  4ZZC A;  4BQT A;  3UU3 A;  2Y54 A;  4UM3 S;  3WTN A;  3T4M A;  5KZU A;  3WTM A;  4B5D A;  4ILA A;  2XQ3 A;  2YMD A;  2BG9 C;  4HQP A;  3WTL A;  4FRR A;  4AFT A;  4EZ1 A;  3GUA A;  3UU5 A;  4F8H A;  4QAA A;  5BP0 A;  2LM2 A;  3TLV A;  3ZDH A;  5AFK A;  3EHZ A;  3EI0 A;  4UM1 A;  2C9T A;  2LLY A;  2X00 A;  5AFJ A;  4HFB A;  3EAM A;  5L47 A;  5AFH A;  3C84 A;  4ZJT A;  4Z90 A;  3TLT A;  2BYQ A;  3RQW A;  4LMJ A;  4AFG A;  4AFH A;  4ILB A;  2PGZ A;  2YME A;  3P50 A;  4NZB A;  2XNV A;  1OED E;  1UW6 A;  5L4E A;  5J5G A;  3WTI A;  4UY2 A;  3WTO A;  4IRE A;  2YKS A;  2XQA A;  2Y57 A;  3U8J A;  5CFB A;  4TNV A;  4XK9 A;  2XQ5 A;  5HEO A;  2BR7 A;  3JAD A;  2XQ6 A;  2Y7Y A;  3ZKR A;  2BYN A;  1OED A;  2WNL A;  2BYS A;  5J5F A;  2Y56 A;  2XQ7 A;  4LML A;  2PH9 A;  4ZR6 A;  4TWD A;  2XZ5 A;  5AFN A;  3SH1 A;  2BG9 A;  4HFC A;  2W8G A;  2BYP A;  4ZRU A;  2UZ6 A;  4TWF A;  3RI5 A;  3PEO A;  2ZJU A;  3PMZ A;  1OED B;  4UM3 P;  4ZJS A;  3U8M A;  4BFQ A;  4WV9 A;  4QAC A;  2BR8 A;  4LMK A;  3JAF A;  2QC1 B;  5LG3 A;  3U8K A;  3RQU A;  3RIA A;  3SQ6 A;  5FJV A;  3SQ9 A;  5HEJ A;  2BG9 B;  3U8N A;  5HEG A;  5AFM A;  4QH1 A;  5HEU A;  5HEH A;  4HFE A;  2WNC A;  5BW2 A;  4A97 A;  1UX2 A;  4QAB A;  2XQ4 A;  2M6I A;  4QH5 A;  1UV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...