3UUNA

Crystal structure of n-terminal first spectrin repeat of dystrophin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
116
structure length
116
Chain Sequence
EVNLDRYQTALEEVLSWLLSAEDTLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dystrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 52
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uunA00
1S35A 1U4QA 3F31A 3UUMA 1QUUA 1OWAA 1U5PA 3EDVA 2SPCA 3FB2A 3PE0A 2ODVA 1CUNA 2ODUA 3LBXA 3UUNA 1HCIA 1AJ3A 1WLXA 3LBXB 3UULA
chains in the Genus database with same CATH superfamily
3CVRA 3CK6A 2QA7A 1FMWA 3IA3A 1V9DA 1I94T 2IUBA 4YHJA 3MA9A 2E5VA 3HKEE 2WMNA 3ABVA 2CLYB 3MJXA 4LFAT 3FXEB 5AQHB 3PURA 4I43B 2I6HA 2LKGA 1HF8A 4MLKA 1UCUA 3T1HT 1WRDA 2L3LA 2LLYA 2CRBA 3RC8A 4X1IE 2YN6A 4DR1T 2XAFB 3O1JA 1JNZA 4GK5E 3WAKA 3NVOA 2BKNA 4NUUA 2V26A 4ZI3D 4HWCA 4DUZT 2V6YB 5HXHA 4KHPT 3EHZA 2HPJA 2PJQA 2ODUA 5E0OA 3DJBA 2OV9A 2QYWA 1ZV4X 4DVDA 3ZT6A 3RKOA 2N2NA 5JVDE 4HEAA 2YK0A 2XJ7A 3P50A 2JIWA 4EXTA 4O4JE 4ZOLE 3CWZB 2XQ6A 4DNDA 3RC3A 3KDSE 2VL0A 2V7IA 1XWMA 4GKJT 1UURA 1Z8UA 4DR3T 3UFGA 2Q9QC 2E9XD 1J1JA 1KFYA 1T7SA 2CCQA 1M7KA 3RIAA 2CMRA 2VKJA 2HHHT 3FB2A 2ZM2A 5ABGA 5EK2A 2V8SV 3AE5A 1XDOA 5L3CB 5FXWA 2LKHA 1QUUA 1OWAA 1X79A 1FIOA 2B1EA 1FEWA 2W00A 3ZT7A 2CEAA 3R6NA 1G8XA 1LVKA 4F6RC 5HWYA 2FJEA 4IDNA 2NW8A 4I50E 3RYHE 5CB4E 3F2EA 1UX5A 1BR4A 3QOFA 1XNRT 4HWHA 3ZEFB 4H9NC 4U3CA 2FUPA 3PTRB 2X0YA 5A1LA 4QH4A 4WZXA 4DV4T 2XM2A 4HWIB 4UF0A 4HFDA 4AQFC 2K24A 1ZHCA 5F5WA 3AEFA 4IL4A 4ZI2D 2ACZA 3OTOT 1IJ5A 2NP9A 2LM9A 4GOUA 2EHOC 3OVUA 3ZYLA 1OEDA 1G73A 4JV5T 2BVLA 4ZZBA 4DR2T 2SPCA 5LGNB 4OYKA 4PJNA 5BMVE 3NRXA 1XMQT 3Q5DA 2J47A 3FBLA 4HFHA 5AQLB 1VCTA 4JLEA 5AQMB 3RYCE 2JQQA 2WDVA 3JAFA 4ILUA 4U7YA 2V7MA 2NW7A 4AQGA 3J9X1 4OX9T 3SWHA 2OA5A 1KK7A 4YTNA 2PTFA 4MHCA 4C90A 3Q2MA 1N36T 4DR5T 2J4GA 3X1DA 3VHLA 2LEHA 5DQWA 4OFZA 1OEDE 2C5IT 3UQ4A 4O4IE 3AE9A 3HI2A 3ZYKA 4O8SA 4IE4A 4MALA 3CIRA 5FY1A 1SHZC 2K9AA 4LFBT 3ANWA 3JADA 2UXCT 4IDPA 5JR9A 3AA0B 2L9QA 3E0ZA 2R6GF 2UUBT 2LOPA 2BG9B 1Y64B 4YSXA 1XDPA 3K3QC 1QLBA 3NKZA 3N9MA 2VL8A 3O4XE 2XSAA 3GN5A 4ILBA 4DV6T 4LF7T 4P0BA 3ZMSB 3N2GE 5HXEA 5CGMA 2PFVA 4B3ST 5EZYE 4CZZB 1NEKA 2CWYA 4UVBB 1KNPA 3TKLB 3O1IA 5LG4A 3C50A 2XY8B 4O2AE 3T8OA 2XSBA 3PUWF 2VASA 2LT3A 5LG3A 1D1AA 5AQIB 2W62A 2DWGA 5AFUL 2W4XA 3UUXB 4JI5T 4UV9B 3B57A 4IGUA 4ZEYA 5CA0E 2Y48B 4HTEA 4IT4A 4IL9A 2M6IA 4TV9E 4ASKA 2AXDS 5LBQB 3E22E 2XTLA 2CE7A 3AEGA 5HEUA 4CXYA 3SS1A 3QC9A 1D0XA 2H89A 4HWDA 3ZMZB 3UFEA 4LF9T 3A5XA 4AQYT 2KNDA 3TLUA 4MFRA 4BAYB 4ADZA 5EK4A 4PAGA 1VOMA 5IHYA 2UU9T 4BJMA 4YSYA 2V1DB 3LFMA 3UU4A 4CN4A 2NWBA 1IZNB 4KMCA 3QNUA 5LP6E 4M1PA 2RPAA 5LMUT 2XZEA 4YHHT 1AJ3A 3AEBA 5IYZE 1BR2A 2BZBA 2V5CA 2X9HA 3PUGA 4XBFB 1XNQT 4QX7B 4DIDB 4LMLA 3JC6C 4X62T 2X9XA 3WAJA 5FL0A 3N9PA 2CHOA 3AVSA 1NENA 2W67A 4QH5A 5J1GA 2HPLA 3HR0A 1WLXA 3C4XA 4JI8T 3AAAB 5AQKB 3C64A 5KXJA 2JQKA 3AEDA 4CN6A 5HWXA 5FNVE 4P0AA 2C5KT 4UEMA 4X1KE 1X9BA 3ZYMA 3FBZA 3RIFA 1J5ET 2Z6EA 3AE1A 1U5PA 3N9NA 2WS3A 2LOSA 4UF0B 2CHNA 2IW5B 1KNZA 3KFWX 2IAKA 4UR9A 3P4SA 1WYBA 3KVBA 3QUJA 5JH7E 3I9YA 4AKGA 2JMKA 1UK5A 2J1DG 4FJOA 5JRCA 4NIQA 3UU8A 3PUXF 4U74A 4LF5T 2ZMAA 5ETWA 3QB5A 3VRBA 2WZIA 2NOXA 2VQFT 4JI2T 4LMKA 3TLTA 2D0TA 3O9XA 4HFIA 4YJ3E 2MPKA 3MZKB 3UUBA 3RRCA 2Q9QB 5L4HA 5LB7B 5J2TE 4B3MT 2FJBA 5AQQB 4PK5A 2GK9A 4PJMA 4EEDA 1CHUA 2DL1A 1N33T 5H6QB 4DV7T 1SE7A 4YY3T 5HXSA 4TUYE 1YQ4A 1W9RA 4ILAA 2XM1A 4PFPA 3NRYA 3N2KE 3LJCA 5LGUB 2MBGA 2XAGB 2BS2A 3ZN1B 1YXRA 5CJ5A 4ZXLA 2WWVA 4PFOA 2AE9A 4CI3B 2K48A 1MMAA 4TZ4C 1HS7A 3FZLB 1BR1A 4PJLA 3DP7A 5ABEA 5JR9B 1OEDC 3CX6B 4Q25A 4AKIA 2WQYA 5L2LA 3NBXX 2UUCT 4IDZA 1S94A 4L0RA 3MACA 3D0TA 3CQCB 2BDEA 2KWHA 3GN5B 3ZC1A 5LXTE 3KBUA 2ZM0A 4FI5A 3VRAA 5H6RB 2NTYA 2YU1A 4OYJA 2VWAA 2Y6XA 2K3WA 2WSSV 4U33A 5HEHA 3O1HA 1T72A 1Y01A 4UVAB 3AXJA 3P7IA 3IBPA 3PJAA 2DHRA 3ZKRA 2E5LT 3EI0A 4QH1A 3CQXC 4JEUB 4O4LE 4AKRB 4A97A 4WBNE 1MIVA 2E2AA 2EHOB 3FHNA 2VKHA 5ABFA 3A7MA 1B7TA 3CPZA 1LVFA 2YU2A 4DV0T 4UV8B 5AQTB 1HNZT 1H7CA 3KV9A 2CM0A 1IAPA 2X68A 2X51A 4DMWA 5BR8T 4IHJE 4XZCA 4JI1T 4PJJA 4IDQA 2D9DA 5HCMA 5JR9C 4AKHA 5FYMA 2XQ8A 4BJNA 3ZMTB 4QXCB 1VCSA 1WFDA 5FXVA 3V5SA 3UUNA 4JI3T 4H9SE 5LGTB 2X0LB 3AVRA 5EK3A 5AQSB 3I1AA 3Q5EA 5FKYA 2L8KA 2PBIA 4LF4T 3PUSA 3OJAA 3UU5A 5L3FB 2XPKA 3H3MA 4CXXA 5FY7A 4CXWA 2W2UA 3ZCJA 5ADXL 4IE0A 2A9UA 5HEGA 1MMGA 2NR4A 2V6XA 2UXDT 2VB6A 2XQ5A 2JRKA 3I0OA 1LKXA 1GQEA 1I6ZA 3TLSA 3SOLA 2WB5A 2IDOB 3C4WA 4IREA 4LF8T 4CQIA 5LBMA 3RGLA 2BBHA 5JDQA 3LBXA 3HKCE 4Z8XA 4HGAA 4A56A 3HKBE 4IE5A 5AQFB 2DCFA 1M62A 2CA5A 4BA9A 3L39A 3RI5A 2OLTA 4KUMB 2XQ3A 4PW8A 2D5UA 1EZ3A 3RPUA 5IWAT 3G06A 5JDMA 4LFCT 3UU3A 2D2SA 1US7B 4H9OC 3KINB 3OPCA 3LSVA 3BK9A 3LK3B 3CX8B 5LNKA 5AQVB 3OBVE 5IUXA 3P8CD 5L3DB 3R84B 2XQAA 3PDYA 3P4QA 3RKGA 3RQWA 4EB6E 3IHRA 1O3XA 5LJNA 2RA1A 2E8IA 4YTMA 5JRCB 2I0MA 4QHOA 4ILCA 3U78A 4X20E 1LRZA 2FBWA 1FJGT 1KNRA 4TWFA 3N9LA 4ZI3C 1HR0T 3CKDA 3AA7B 4WYVA 3ETVA 4KX6A 3NZPA 1KF6A 4H9QC 4B6XA 2WMOA 3NWIA 3PU3A 2LSJA 4GYRA 1D1BA 3TLVA 3MXZA 1WCRA 2WDQA 4JUYA 3M65A 2LE8A 2JPFA 5AQPB 2YINA 3RYFE 3FZKB 4LMJA 4OK0A 2F4VT 2LSGA 3QB5K 4NPPA 3A8YC 2ZM8A 3B5MA 4TNWA 2A72A 2V7JA 2MAWA 2HN2A 2UXBT 2NW9A 4DUYT 3VKGA 4Z91A 3UTKA 3CMLA 1UX4A 2N1GA 4TWDA 5L3EB 2UUAT 2BKPA 2XAQB 4JBWF 4DBRA 3SFEA 1MMNA 3J7Yq 2KLQA 2A2FX 3ZT5A 3EVYA 2IC6A 4XAXB 3AE7A 3AEAA 3EUHA 5TAOA 4U7IA 2Q9QD 5C3JA 2V5DA 3B13A 4DR6T 3RIUA 4IE7A 5AQNB 4COFA 4F8HA 2WBLA 1QSDA 4EAHA 3AXJB 4KI0F 3ZC0A 1NAFA 2QVAA 3RH3A 5L3BB 1D0ZA 2WM9A 3ZCIA 2W0GA 5ABFB 3H37A 3AE6A 4EYYR 3IEEA 4AKLA 3N9OA 4JI4T 2ZLYA 2QGSA 4IIJE 3GWHA 3VU7H 4U2YA 5DABA 5KMGP 4ZI2C 3HKDE 4HFCA 4ERRA 2M67A 3RF1A 3L09A 2LJLA 4B3TT 4YSZA 4X64T 3AAEB 1HFAA 1IBKT 3AE2A 2FJDA 4P1NA 3ONXA 3ONJA 2BKOA 2XAHB 2BVMA 3VKHA 3FZFB 2WAUA 3ETUA 4WNKA 1SUMB 4O4HE 4EYUA 4H63H 2WWUA 1HTJF 3WI3A 4QWNB 2E9XA 2CBIA 4YJ2E 4P09A 5AQJB 5C8YE 2EHOD 5HAXA 5FMNA 2ZM6T 5LCYA 3T1YT 4AISA 2DWKA 5F8PA 1OEDB 4QXBB 1XZYA 4KP3C 1ZP0A 4E7ZA 2CXLA 5JDNA 3LBXB 1L0VA 1MMDA 1UGOA 3M3ZB 1Z0PA 4ZS2A 2K5BB 2DNXA 2KT9A 2M6BA 2X9WA 1VRBA 2ODVA 4U31A 4A5XA 5M4YA 4DR4T 2BG9A 4ANJA 1MIYA 4WBOA 4B3RT 3RHWA 4HFEA 3BQLA 3ZJ2A 5AQGB 2HN1A 4L5GA 3K3OA 2Y8DA 2W61A 3LDQB 4X5TA 1FMVA 5KDMC 2IIUA 2XUEA 3V5UA 4DV3T 2A3DA 5C2TA 2VKDA 4G63A 5JDFA 4YT0A 2JMHA 4EV6A 4N78D 1ZOYA 1DU2A 4H63V 4MBQA 3ANWB 2X0HA 3ZPOA 2NTXA 4WW0A 3ZN0B 2YKSA 4QXHB 2BG9E 4A98A 4EEBA 1HNWT 3S4UA 4U2ZA 2CBJA 2ACXA 4QX8B 2KSRA 4E7SA 4DV2T 4ZZCA 1NWMX 2LRLA 2LHRA 3LK42 2WCAA 5HCJA 2CXFA 3U3IA 2C5JA 2W63A 2CPTA 2XQ9A 4ISSA 4OHFA 5LHIB 2CLYC 1MIWA 5CFBA 3ZMUB 2X67A 3W15B 2XASB 1WR6A 3NZQA 2JJ9A 3FZMB 3ONLC 3GMIA 2MOZA 3AA1B 3AA6B 4ISTA 5FVKA 1WR0A 4IE6A 4UIGA 4JI6T 4ZI7E 2YDRA 3FXDB 1HG2A 5HYAA 5L4EA 2D0UA 2WDRA 5LHHB 5LHGB 3PUAA 4NXMT 2XQ4A 1BR0A 3UUMA 2XQ7A 3AAIA 3RYIE 2CWOA 4EZ4A 2JQ9A 2YDSA 2WU2A 4QKNA 3JCFA 5JREA 3C51A 3PUQA 1N32T 2V7KA 1N34T 1JNRA 3PUYF 2IC9A 2IMLA 5LJMA 5HEOA 5J2UE 2ES0A 4X1YE 2CXDA 4O2BE 3MKDA 5FVLA 3IF8B 5LMNT 2QRXA 2MTQA 4DMVA 3JC6D 4TX5A 5J0ZA 5AQRB 4TNVA 2FJAA 3PUVF 4HFVA 2HH7A 3QK6A 1HCIA 2XAJB 5FP3A 4EZHA 3OYZA 3GA8A 2LSKA 5KX5E 3ZJ1A 2I59A 5L47A 3Q5XA 1XMOT 4ZS3A 3ZMVB 1YQ3A 2IHR1 2H88A 1J5WA 4PK6A 2N9DA 3KBTA 3ZSTA 4ZHQE 3AB3B 3KV5A 4L9IA 4TWHA 3LG7A 1S35A 3CQGB 1IJ6A 1T98A 3F57A 1ZKEA 2RP4A 2Q9QA 2H3RA 3BQIA 3RIUC 4PNIA 4GK0E 4GKKT 2E9XB 4H9RC 4IDOA 3HA4A 2VVNA 4UELA 3ZLIA 4CI2B 2V7LA 4KBMB 4HFBA 4GIWA 2X66A 2KXPB 3RX6A 1YKEB 4DV1T 4HWFA 4H9PC 2UXNB 5JDHA 2V6YA 2VK9A 4AXPA 2LSYA 1W09A 5LYJE 3H3AA 5LA6E 3KV4A 3RRWA 4EGWA 3C98B 5HXRA 5GONE 4DO0A 1T8BA 1MNEA 4J2CA 3VR9A 1R8IA 2UXXB 3P4PA 3OYXA 4NUVA 3KV6A 5F3JA 4HKAA 4EIWA 3PU8A 1W0AA 3L8RA 1KEYA 3AE4A 5CA1E 4C91A 5FY0A 3E08A 3HL6A 4AI6A 4G2AA 4AQFA 4PK4A 2E9XC 5DQVA 4Z90A 4JYAT 4I55E 1YW0A 3Q5WA 3PJAJ 1OXZA 3PUZF 3KVAA 4U72A 2EHOA 5JTGA 4YXDA 4YTPA 2B76A 4HE8A 1MNDA 3UULA 3N2OA 1E1HB 3BQKA 1HX1B 4JEHB 2BS3A 3AE8A 3TLWA 2WP9A 2WZHA 1SA0E 2YDQA 4EOZB 4NXNT 3Q9DA 1HNXT 1YD8G 3PE0A 4GYSA 4K0KT 1D0YA 2VQET 5HEJA 3I9WA 4JI0T 3AEEA 4V1Av 4K0UA 3I0QA 1HG5A 3K1SA 3F31A 2H7VC 2BS4A 2KINB 2MYSA 2BG9C 1HX8A 5AQUB 2VVSA 5HXCA 2W66A 2WU5A 3PV0F 1YKHB 3OKQA 3N5LA 2PG8A 4DV5T 4UVCB 3AE3A 2KMFA 4DR7T 4I4TE 5JDGA 1IBMT 3CX7B 3LK2B 3ZSSA 4UXNB 5FXZA 4YFSA 5JQGE 3EABA 3SFDA 3EDUA 1U4QA 4X66T 3UQ7A 2XQYA 3EDVA 3N9QA 3P4RA 2G0UA 2YEVC 4X65T 3EAMA 5JDLA 3RQUA 4HN9A 4CN1A 4CI1B 5FXXA 4JI7T 1IBLT 5FL1A 2VKOA 1CUNA 4LF6T 4AIUA 2LRKA 4TN7B 1UUSA 3JAEA 4YLHA 2XHEB 3VR8A 2C0SA 3K8PC 5AQOB 2X9YA 1E2AA 3SRZA 1W0BA 2YOEA 1E7PA 2JQHA 2KWIB 3P4WA 3K3NA 3DTOA 1ZEEA 4DBQA 2P9BA 4KHZF 3MK7C 2H7OA 3UT5E 2WY2A 3UU6A 1D1CA 4TV8E 2LM2A 3ESLA 5L3GB 3L3PA 4I0UA 2LSIA 5DJQC 2VURA 3RLFF 2LHNA 2J62A 1WYCA 2DI4A 5ABHA 2DLRA 3FZHB 2BBJA 2KZ7B 3AECA 3C4ZA 5LOVE
chains in the Genus database with same CATH topology
3P8CD 2NWBA 5LHHB 3CVRA 5LHGB 1IZNB 5L3DB 2QA7A 1FMWA 3PUAA 3R84B 4KMCA 1BR0A 3PDYA 3UUMA 1V9DA 5LP6E 4EB6E 3AAIA 4YHJA 3RYIE 4M1PA 2CWOA 3IHRA 1O3XA 3MA9A 3HKEE 2WMNA 4EZ4A 5LJNA 2RA1A 2CLYB 2E8IA 5JRCB 3MJXA 4QKNA 4QHOA 3FXEB 3U78A 5JREA 1AJ3A 5IYZE 3C51A 1BR2A 3PUQA 2BZBA 4X20E 1LRZA 3PURA 2V7KA 3N9LA 2X9HA 3PUGA 4XBFB 4I43B 4ZI3C 4QX7B 3JC6C 3CKDA 3AA7B 2X9XA 3WAJA 2IC9A 3ETVA 3N9PA 1HF8A 5LJMA 3AVSA 3NZPA 4MLKA 1UCUA 4H9QC 4B6XA 1WRDA 2WMOA 5J2UE 2L3LA 3RC8A 3PU3A 2LSJA 2ES0A 5J1GA 4X1YE 4X1IE 4GYRA 2CXDA 1D1BA 4O2BE 2XAFB 3O1JA 2HPLA 3HR0A 3MKDA 3MXZA 3IF8B 4GK5E 4JUYA 3M65A 1WLXA 3WAKA 2LE8A 3C4XA 2MTQA 2JPFA 4DMVA 4NUUA 2V26A 3AAAB 2YINA 3RYFE 4ZI3D 4OK0A 3JC6D 4TX5A 2LSGA 3C64A 2ZM8A 5HXHA 2A72A 2V7JA 5HWXA 5FNVE 4HFVA 4P0AA 2C5KT 2HH7A 2HPJA 2PJQA 3QK6A 2ODUA 4UEMA 4X1KE 5E0OA 1HCIA 2XAJB 2NW9A 3ZYMA 5FP3A 3FBZA 4EZHA 3DJBA 3VKGA 2Z6EA 1ZV4X 3OYZA 4DVDA 3GA8A 3UTKA 3RKOA 3CMLA 2N2NA 1UX4A 2LSKA 2N1GA 5JVDE 3ZJ1A 5KX5E 4HEAA 2I59A 3Q5XA 4ZS3A 3ZMVB 5L3EB 2YK0A 1U5PA 3N9NA 4EXTA 4PK6A 4O4JE 4ZOLE 2N9DA 2XAQB 3CWZB 4DNDA 3KBTA 2LOSA 3RC3A 4UF0B 2IW5B 4DBRA 3KDSE 2V7IA 1KNZA 4ZHQE 3AB3B 3KFWX 3KV5A 2IAKA 1MMNA 2Q9QC 4L9IA 3J7Yq 1WYBA 2KLQA 2E9XD 3LG7A 2A2FX 1S35A 3CQGB 3KVBA 1IJ6A 2CCQA 3QUJA 5JH7E 1T98A 3I9YA 3F57A 4AKGA 1ZKEA 2JMKA 2J1DG 3EVYA 2RP4A 2Q9QA 4FJOA 5JRCA 2IC6A 2CMRA 2H3RA 2VKJA 4XAXB 3FB2A 3EUHA 4U74A 3BQIA 2ZMAA 2ZM2A 5ETWA 5TAOA 5EK2A 4PNIA 4GK0E 2E9XB 4H9RC 2Q9QD 2NOXA 3HA4A 3B13A 4UELA 5L3CB 3ZLIA 4CI2B 2V7LA 5FXWA 4IE7A 1QUUA 2D0TA 1OWAA 2WBLA 3O9XA 1X79A 1FIOA 1QSDA 4KBMB 2B1EA 4YJ3E 4EAHA 3MZKB 1FEWA 4GIWA 2W00A 2X66A 2KXPB 3RX6A 3RRCA 2Q9QB 3ZC0A 1YKEB 1NAFA 3RH3A 5L3BB 1D0ZA 4H9PC 2WM9A 2UXNB 3ZCIA 2W0GA 2CEAA 3R6NA 1G8XA 1LVKA 4F6RC 5J2TE 5HWYA 5JDHA 3H37A 2VK9A 4PK5A 4AXPA 4EYYR 2NW8A 3IEEA 2LSYA 3N9OA 4I50E 4AKLA 5LYJE 2GK9A 4PJMA 3RYHE 5CB4E 2ZLYA 3H3AA 2QGSA 3F2EA 4IIJE 3GWHA 5H6QB 3VU7H 5LA6E 5HXSA 3KV4A 4TUYE 5DABA 5KMGP 1UX5A 3RRWA 1BR4A 4ZI2C 4PFPA 3HKDE 3C98B 3NRYA 2M67A 4ERRA 3L09A 2LJLA 5HXRA 5GONE 3N2KE 4DO0A 1MNEA 3LJCA 4H9NC 3ZEFB 5LGUB 2MBGA 2XAGB 4J2CA 3PTRB 3ZN1B 3AAEB 1HFAA 2UXXB 5A1LA 3OYXA 4NUVA 3KV6A 4PFOA 4CI3B 3ONXA 2K48A 1MMAA 5F3JA 4HKAA 4UF0A 4EIWA 3PU8A 4TZ4C 1HS7A 4AQFC 2K24A 1ZHCA 1BR1A 4PJLA 2XAHB 5CA1E 2BVMA 4C91A 3DP7A 5FY0A 3VKHA 3E08A 3HL6A 4ZI2D 5JR9B 4AI6A 1IJ5A 3CX6B 4G2AA 2NP9A 4AKIA 2LM9A 4AQFA 4GOUA 2EHOC 2WAUA 4PK4A 2E9XC 3ZYLA 5DQVA 3ETUA 4WNKA 5L2LA 3NBXX 4I55E 4O4HE 1YW0A 3Q5WA 4IDZA 1S94A 4L0RA 4EYUA 4H63H 1OXZA 3MACA 2WWUA 3D0TA 3KVAA 1HTJF 1G73A 2BDEA 2BVLA 3CQCB 3WI3A 4QWNB 4U72A 2KWHA 2SPCA 2EHOA 5LGNB 3GN5B 4OYKA 2E9XA 3ZC1A 4PJNA 5BMVE 5LXTE 3KBUA 3NRXA 2ZM0A 4FI5A 4YJ2E 4P09A 5H6RB 4HE8A 2NTYA 2YU1A 4OYJA 1MNDA 2VWAA 5C8YE 2Y6XA 2WSSV 3FBLA 3UULA 3N2OA 1E1HB 3O1HA 2EHOD 3BQKA 5HAXA 4JEHB 5FMNA 4JLEA 4UVAB 1SA0E 3RYCE 3P7IA 3IBPA 2JQQA 4EOZB 2DHRA 4ILUA 5LCYA 2DWKA 3Q9DA 5F8PA 1YD8G 3CQXC 3PE0A 4QXBB 4GYSA 4JEUB 4O4LE 4AKRB 1D0YA 4WBNE 2V7MA 1MIVA 2NW7A 4KP3C 2EHOB 3FHNA 4AQGA 4E7ZA 2VKHA 2CXLA 3I9WA 3J9X1 3SWHA 2OA5A 5JDNA 3LBXB 1KK7A 4V1Av 4K0UA 3I0QA 4MHCA 1MMDA 1B7TA 1HG5A 1Z0PA 3CPZA 1LVFA 2YU2A 2K5BB 4ZS2A 4C90A 3Q2MA 4UV8B 3F31A 2H7VC 1H7CA 2DNXA 2KINB 2MYSA 2KT9A 3KV9A 2CM0A 3VHLA 2LEHA 2X9WA 5DQWA 1VRBA 4OFZA 1IAPA 2C5IT 2ODVA 2X68A 4O4IE 2X51A 5M4YA 4DMWA 3HI2A 3ZYKA 4O8SA 4IHJE 4IE4A 1HX8A 4MALA 4XZCA 4ANJA 1MIYA 4WBOA 5FY1A 1SHZC 4PJJA 3BQLA 3ZJ2A 5HXCA 5JR9C 4AKHA 5FYMA 1YKHB 3OKQA 2K9AA 3N5LA 2PG8A 4BJNA 4UVCB 3ZMTB 4L5GA 3ANWA 3K3OA 2Y8DA 4QXCB 2W61A 2KMFA 5FXVA 1FMVA 3V5SA 5JR9A 4I4TE 3AA0B 5JDGA 3UUNA 5KDMC 2XUEA 3CX7B 3LK2B 4H9SE 2X0LB 3V5UA 2A3DA 5LGTB 3AVRA 2L9QA 3E0ZA 5EK3A 2VKDA 3I1AA 4UXNB 5FXZA 4G63A 4YFSA 2LOPA 5JDFA 5JQGE 2JMHA 1Y64B 4N78D 3EDUA 3K3QC 1U4QA 2L8KA 3N9MA 2PBIA 3PUSA 3OJAA 2VL8A 2XQYA 3O4XE 3GN5A 4H63V 5L3FB 3EDVA 4P0BA 4CXXA 4MBQA 3ANWB 3ZMSB 3N9QA 5FY7A 4CXWA 3N2GE 3ZPOA 5HXEA 2NTXA 3ZCJA 5ADXL 4IE0A 4WW0A 3ZN0B 2PFVA 1MMGA 5EZYE 4QXHB 4CZZB 2VB6A 2G0UA 2YEVC 2JRKA 3I0OA 1LKXA 2CWYA 5JDLA 4UVBB 3S4UA 4HN9A 4CI1B 5FXXA 3SOLA 2ACXA 4QX8B 3C4WA 2VKOA 4CQIA 3TKLB 1CUNA 3O1IA 5LG4A 5LBMA 5JDQA 3LBXA 3C50A 4TN7B 3HKCE 4E7SA 4O2AE 3T8OA 1NWMX 2XHEB 4YLHA 4Z8XA 2C0SA 3K8PC 4HGAA 4A56A 3HKBE 2VASA 2LT3A 1D1AA 2LHRA 2W62A 3LK42 2X9YA 2DWGA 3SRZA 2CXFA 5AFUL 4IE5A 3UUXB 3U3IA 4UV9B 2C5JA 3B57A 2W63A 4IGUA 2DCFA 2CA5A 5CA0E 2Y48B 4BA9A 2KWIB 3K3NA 3DTOA 1ZEEA 4DBQA 2P9BA 4ISSA 4HTEA 3MK7C 2H7OA 4OHFA 4KUMB 4PW8A 3UT5E 4TV9E 2D5UA 2CLYC 5LBQB 4ASKA 5LHIB 1MIWA 1EZ3A 3RPUA 3E22E 1D1CA 4TV8E 2XTLA 2CE7A 3ESLA 3ZMUB 5L3GB 4CXYA 3SS1A 2X67A 3L3PA 3QC9A 3W15B 2LSIA 5DJQC 1D0XA 2XASB 1WR6A 3NZQA 2JJ9A 5JDMA 3ZMZB 3UFEA 2LHNA 3GMIA 2D2SA 3A5XA 1US7B 1WYCA 2MOZA 3AA1B 2KNDA 3AA6B 4ISTA 4MFRA 4BAYB 4H9OC 4ADZA 5EK4A 3KINB 2DI4A 4PAGA 2DLRA 3BK9A 4IE6A 1VOMA 4UIGA 5IHYA 4ZI7E 3FXDB 3LK3B 3CX8B 2KZ7B 4BJMA 1HG2A 2V1DB 3LFMA 3C4ZA 5HYAA 2D0UA 5LOVE 5LNKA 3OBVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S35 A;  1U4Q A;  3F31 A;  3UUM A;  1QUU A;  1OWA A;  1U5P A;  3EDV A;  2SPC A;  3FB2 A;  3PE0 A;  2ODV A;  1CUN A;  2ODU A;  3LBX A;  3UUN A;  1HCI A;  1AJ3 A;  1WLX A;  3LBX B;  3UUL A; 
#chains in the Genus database with same CATH topology
 3CVR A;  3CK6 A;  2QA7 A;  1FMW A;  3IA3 A;  1V9D A;  1I94 T;  2IUB A;  4YHJ A;  3MA9 A;  2E5V A;  3HKE E;  2WMN A;  3ABV A;  2CLY B;  3MJX A;  4LFA T;  3FXE B;  5AQH B;  3PUR A;  4I43 B;  2I6H A;  2LKG A;  1HF8 A;  4MLK A;  1UCU A;  3T1H T;  1WRD A;  2L3L A;  2LLY A;  2CRB A;  3RC8 A;  4X1I E;  2YN6 A;  4DR1 T;  2XAF B;  3O1J A;  1JNZ A;  4GK5 E;  3WAK A;  3NVO A;  2BKN A;  4NUU A;  2V26 A;  4ZI3 D;  4HWC A;  4DUZ T;  2V6Y B;  5HXH A;  4KHP T;  3EHZ A;  2HPJ A;  2PJQ A;  2ODU A;  5E0O A;  3DJB A;  2OV9 A;  2QYW A;  1ZV4 X;  4DVD A;  3ZT6 A;  3RKO A;  2N2N A;  5JVD E;  4HEA A;  2YK0 A;  2XJ7 A;  3P50 A;  2JIW A;  4EXT A;  4O4J E;  4ZOL E;  3CWZ B;  2XQ6 A;  4DND A;  3RC3 A;  3KDS E;  2VL0 A;  2V7I A;  1XWM A;  4GKJ T;  1UUR A;  1Z8U A;  4DR3 T;  3UFG A;  2Q9Q C;  2E9X D;  1J1J A;  1KFY A;  1T7S A;  2CCQ A;  1M7K A;  3RIA A;  2CMR A;  2VKJ A;  2HHH T;  3FB2 A;  2ZM2 A;  5ABG A;  5EK2 A;  2V8S V;  3AE5 A;  1XDO A;  5L3C B;  5FXW A;  2LKH A;  1QUU A;  1OWA A;  1X79 A;  1FIO A;  2B1E A;  1FEW A;  2W00 A;  3ZT7 A;  2CEA A;  3R6N A;  1G8X A;  1LVK A;  4F6R C;  5HWY A;  2FJE A;  4IDN A;  2NW8 A;  4I50 E;  3RYH E;  5CB4 E;  3F2E A;  1UX5 A;  1BR4 A;  3QOF A;  1XNR T;  4HWH A;  3ZEF B;  4H9N C;  4U3C A;  2FUP A;  3PTR B;  2X0Y A;  5A1L A;  4QH4 A;  4WZX A;  4DV4 T;  2XM2 A;  4HWI B;  4UF0 A;  4HFD A;  4AQF C;  2K24 A;  1ZHC A;  5F5W A;  3AEF A;  4IL4 A;  4ZI2 D;  2ACZ A;  3OTO T;  1IJ5 A;  2NP9 A;  2LM9 A;  4GOU A;  2EHO C;  3OVU A;  3ZYL A;  1OED A;  1G73 A;  4JV5 T;  2BVL A;  4ZZB A;  4DR2 T;  2SPC A;  5LGN B;  4OYK A;  4PJN A;  5BMV E;  3NRX A;  1XMQ T;  3Q5D A;  2J47 A;  3FBL A;  4HFH A;  5AQL B;  1VCT A;  4JLE A;  5AQM B;  3RYC E;  2JQQ A;  2WDV A;  3JAF A;  4ILU A;  4U7Y A;  2V7M A;  2NW7 A;  4AQG A;  3J9X 1;  4OX9 T;  3SWH A;  2OA5 A;  1KK7 A;  4YTN A;  2PTF A;  4MHC A;  4C90 A;  3Q2M A;  1N36 T;  4DR5 T;  2J4G A;  3X1D A;  3VHL A;  2LEH A;  5DQW A;  4OFZ A;  1OED E;  2C5I T;  3UQ4 A;  4O4I E;  3AE9 A;  3HI2 A;  3ZYK A;  4O8S A;  4IE4 A;  4MAL A;  3CIR A;  5FY1 A;  1SHZ C;  2K9A A;  4LFB T;  3ANW A;  3JAD A;  2UXC T;  4IDP A;  5JR9 A;  3AA0 B;  2L9Q A;  3E0Z A;  2R6G F;  2UUB T;  2LOP A;  2BG9 B;  1Y64 B;  4YSX A;  1XDP A;  3K3Q C;  1QLB A;  3NKZ A;  3N9M A;  2VL8 A;  3O4X E;  2XSA A;  3GN5 A;  4ILB A;  4DV6 T;  4LF7 T;  4P0B A;  3ZMS B;  3N2G E;  5HXE A;  5CGM A;  2PFV A;  4B3S T;  5EZY E;  4CZZ B;  1NEK A;  2CWY A;  4UVB B;  1KNP A;  3TKL B;  3O1I A;  5LG4 A;  3C50 A;  2XY8 B;  4O2A E;  3T8O A;  2XSB A;  3PUW F;  2VAS A;  2LT3 A;  5LG3 A;  1D1A A;  5AQI B;  2W62 A;  2DWG A;  5AFU L;  2W4X A;  3UUX B;  4JI5 T;  4UV9 B;  3B57 A;  4IGU A;  4ZEY A;  5CA0 E;  2Y48 B;  4HTE A;  4IT4 A;  4IL9 A;  2M6I A;  4TV9 E;  4ASK A;  2AXD S;  5LBQ B;  3E22 E;  2XTL A;  2CE7 A;  3AEG A;  5HEU A;  4CXY A;  3SS1 A;  3QC9 A;  1D0X A;  2H89 A;  4HWD A;  3ZMZ B;  3UFE A;  4LF9 T;  3A5X A;  4AQY T;  2KND A;  3TLU A;  4MFR A;  4BAY B;  4ADZ A;  5EK4 A;  4PAG A;  1VOM A;  5IHY A;  2UU9 T;  4BJM A;  4YSY A;  2V1D B;  3LFM A;  3UU4 A;  4CN4 A;  2NWB A;  1IZN B;  4KMC A;  3QNU A;  5LP6 E;  4M1P A;  2RPA A;  5LMU T;  2XZE A;  4YHH T;  1AJ3 A;  3AEB A;  5IYZ E;  1BR2 A;  2BZB A;  2V5C A;  2X9H A;  3PUG A;  4XBF B;  1XNQ T;  4QX7 B;  4DID B;  4LML A;  3JC6 C;  4X62 T;  2X9X A;  3WAJ A;  5FL0 A;  3N9P A;  2CHO A;  3AVS A;  1NEN A;  2W67 A;  4QH5 A;  5J1G A;  2HPL A;  3HR0 A;  1WLX A;  3C4X A;  4JI8 T;  3AAA B;  5AQK B;  3C64 A;  5KXJ A;  2JQK A;  3AED A;  4CN6 A;  5HWX A;  5FNV E;  4P0A A;  2C5K T;  4UEM A;  4X1K E;  1X9B A;  3ZYM A;  3FBZ A;  3RIF A;  1J5E T;  2Z6E A;  3AE1 A;  1U5P A;  3N9N A;  2WS3 A;  2LOS A;  4UF0 B;  2CHN A;  2IW5 B;  1KNZ A;  3KFW X;  2IAK A;  4UR9 A;  3P4S A;  1WYB A;  3KVB A;  3QUJ A;  5JH7 E;  3I9Y A;  4AKG A;  2JMK A;  1UK5 A;  2J1D G;  4FJO A;  5JRC A;  4NIQ A;  3UU8 A;  3PUX F;  4U74 A;  4LF5 T;  2ZMA A;  5ETW A;  3QB5 A;  3VRB A;  2WZI A;  2NOX A;  2VQF T;  4JI2 T;  4LMK A;  3TLT A;  2D0T A;  3O9X A;  4HFI A;  4YJ3 E;  2MPK A;  3MZK B;  3UUB A;  3RRC A;  2Q9Q B;  5L4H A;  5LB7 B;  5J2T E;  4B3M T;  2FJB A;  5AQQ B;  4PK5 A;  2GK9 A;  4PJM A;  4EED A;  1CHU A;  2DL1 A;  1N33 T;  5H6Q B;  4DV7 T;  1SE7 A;  4YY3 T;  5HXS A;  4TUY E;  1YQ4 A;  1W9R A;  4ILA A;  2XM1 A;  4PFP A;  3NRY A;  3N2K E;  3LJC A;  5LGU B;  2MBG A;  2XAG B;  2BS2 A;  3ZN1 B;  1YXR A;  5CJ5 A;  4ZXL A;  2WWV A;  4PFO A;  2AE9 A;  4CI3 B;  2K48 A;  1MMA A;  4TZ4 C;  1HS7 A;  3FZL B;  1BR1 A;  4PJL A;  3DP7 A;  5ABE A;  5JR9 B;  1OED C;  3CX6 B;  4Q25 A;  4AKI A;  2WQY A;  5L2L A;  3NBX X;  2UUC T;  4IDZ A;  1S94 A;  4L0R A;  3MAC A;  3D0T A;  3CQC B;  2BDE A;  2KWH A;  3GN5 B;  3ZC1 A;  5LXT E;  3KBU A;  2ZM0 A;  4FI5 A;  3VRA A;  5H6R B;  2NTY A;  2YU1 A;  4OYJ A;  2VWA A;  2Y6X A;  2K3W A;  2WSS V;  4U33 A;  5HEH A;  3O1H A;  1T72 A;  1Y01 A;  4UVA B;  3AXJ A;  3P7I A;  3IBP A;  3PJA A;  2DHR A;  3ZKR A;  2E5L T;  3EI0 A;  4QH1 A;  3CQX C;  4JEU B;  4O4L E;  4AKR B;  4A97 A;  4WBN E;  1MIV A;  2E2A A;  2EHO B;  3FHN A;  2VKH A;  5ABF A;  3A7M A;  1B7T A;  3CPZ A;  1LVF A;  2YU2 A;  4DV0 T;  4UV8 B;  5AQT B;  1HNZ T;  1H7C A;  3KV9 A;  2CM0 A;  1IAP A;  2X68 A;  2X51 A;  4DMW A;  5BR8 T;  4IHJ E;  4XZC A;  4JI1 T;  4PJJ A;  4IDQ A;  2D9D A;  5HCM A;  5JR9 C;  4AKH A;  5FYM A;  2XQ8 A;  4BJN A;  3ZMT B;  4QXC B;  1VCS A;  1WFD A;  5FXV A;  3V5S A;  3UUN A;  4JI3 T;  4H9S E;  5LGT B;  2X0L B;  3AVR A;  5EK3 A;  5AQS B;  3I1A A;  3Q5E A;  5FKY A;  2L8K A;  2PBI A;  4LF4 T;  3PUS A;  3OJA A;  3UU5 A;  5L3F B;  2XPK A;  3H3M A;  4CXX A;  5FY7 A;  4CXW A;  2W2U A;  3ZCJ A;  5ADX L;  4IE0 A;  2A9U A;  5HEG A;  1MMG A;  2NR4 A;  2V6X A;  2UXD T;  2VB6 A;  2XQ5 A;  2JRK A;  3I0O A;  1LKX A;  1GQE A;  1I6Z A;  3TLS A;  3SOL A;  2WB5 A;  2IDO B;  3C4W A;  4IRE A;  4LF8 T;  4CQI A;  5LBM A;  3RGL A;  2BBH A;  5JDQ A;  3LBX A;  3HKC E;  4Z8X A;  4HGA A;  4A56 A;  3HKB E;  4IE5 A;  5AQF B;  2DCF A;  1M62 A;  2CA5 A;  4BA9 A;  3L39 A;  3RI5 A;  2OLT A;  4KUM B;  2XQ3 A;  4PW8 A;  2D5U A;  1EZ3 A;  3RPU A;  5IWA T;  3G06 A;  5JDM A;  4LFC T;  3UU3 A;  2D2S A;  1US7 B;  4H9O C;  3KIN B;  3OPC A;  3LSV A;  3BK9 A;  3LK3 B;  3CX8 B;  5LNK A;  5AQV B;  3OBV E;  5IUX A;  3P8C D;  5L3D B;  3R84 B;  2XQA A;  3PDY A;  3P4Q A;  3RKG A;  3RQW A;  4EB6 E;  3IHR A;  1O3X A;  5LJN A;  2RA1 A;  2E8I A;  4YTM A;  5JRC B;  2I0M A;  4QHO A;  4ILC A;  3U78 A;  4X20 E;  1LRZ A;  2FBW A;  1FJG T;  1KNR A;  4TWF A;  3N9L A;  4ZI3 C;  1HR0 T;  3CKD A;  3AA7 B;  4WYV A;  3ETV A;  4KX6 A;  3NZP A;  1KF6 A;  4H9Q C;  4B6X A;  2WMO A;  3NWI A;  3PU3 A;  2LSJ A;  4GYR A;  1D1B A;  3TLV A;  3MXZ A;  1WCR A;  2WDQ A;  4JUY A;  3M65 A;  2LE8 A;  2JPF A;  5AQP B;  2YIN A;  3RYF E;  3FZK B;  4LMJ A;  4OK0 A;  2F4V T;  2LSG A;  3QB5 K;  4NPP A;  3A8Y C;  2ZM8 A;  3B5M A;  4TNW A;  2A72 A;  2V7J A;  2MAW A;  2HN2 A;  2UXB T;  2NW9 A;  4DUY T;  3VKG A;  4Z91 A;  3UTK A;  3CML A;  1UX4 A;  2N1G A;  4TWD A;  5L3E B;  2UUA T;  2BKP A;  2XAQ B;  4JBW F;  4DBR A;  3SFE A;  1MMN A;  3J7Y q;  2KLQ A;  2A2F X;  3ZT5 A;  3EVY A;  2IC6 A;  4XAX B;  3AE7 A;  3AEA A;  3EUH A;  5TAO A;  4U7I A;  2Q9Q D;  5C3J A;  2V5D A;  3B13 A;  4DR6 T;  3RIU A;  4IE7 A;  5AQN B;  4COF A;  4F8H A;  2WBL A;  1QSD A;  4EAH A;  3AXJ B;  4KI0 F;  3ZC0 A;  1NAF A;  2QVA A;  3RH3 A;  5L3B B;  1D0Z A;  2WM9 A;  3ZCI A;  2W0G A;  5ABF B;  3H37 A;  3AE6 A;  4EYY R;  3IEE A;  4AKL A;  3N9O A;  4JI4 T;  2ZLY A;  2QGS A;  4IIJ E;  3GWH A;  3VU7 H;  4U2Y A;  5DAB A;  5KMG P;  4ZI2 C;  3HKD E;  4HFC A;  4ERR A;  2M67 A;  3RF1 A;  3L09 A;  2LJL A;  4B3T T;  4YSZ A;  4X64 T;  3AAE B;  1HFA A;  1IBK T;  3AE2 A;  2FJD A;  4P1N A;  3ONX A;  3ONJ A;  2BKO A;  2XAH B;  2BVM A;  3VKH A;  3FZF B;  2WAU A;  3ETU A;  4WNK A;  1SUM B;  4O4H E;  4EYU A;  4H63 H;  2WWU A;  1HTJ F;  3WI3 A;  4QWN B;  2E9X A;  2CBI A;  4YJ2 E;  4P09 A;  5AQJ B;  5C8Y E;  2EHO D;  5HAX A;  5FMN A;  2ZM6 T;  5LCY A;  3T1Y T;  4AIS A;  2DWK A;  5F8P A;  1OED B;  4QXB B;  1XZY A;  4KP3 C;  1ZP0 A;  4E7Z A;  2CXL A;  5JDN A;  3LBX B;  1L0V A;  1MMD A;  1UGO A;  3M3Z B;  1Z0P A;  4ZS2 A;  2K5B B;  2DNX A;  2KT9 A;  2M6B A;  2X9W A;  1VRB A;  2ODV A;  4U31 A;  4A5X A;  5M4Y A;  4DR4 T;  2BG9 A;  4ANJ A;  1MIY A;  4WBO A;  4B3R T;  3RHW A;  4HFE A;  3BQL A;  3ZJ2 A;  5AQG B;  2HN1 A;  4L5G A;  3K3O A;  2Y8D A;  2W61 A;  3LDQ B;  4X5T A;  1FMV A;  5KDM C;  2IIU A;  2XUE A;  3V5U A;  4DV3 T;  2A3D A;  5C2T A;  2VKD A;  4G63 A;  5JDF A;  4YT0 A;  2JMH A;  4EV6 A;  4N78 D;  1ZOY A;  1DU2 A;  4H63 V;  4MBQ A;  3ANW B;  2X0H A;  3ZPO A;  2NTX A;  4WW0 A;  3ZN0 B;  2YKS A;  4QXH B;  2BG9 E;  4A98 A;  4EEB A;  1HNW T;  3S4U A;  4U2Z A;  2CBJ A;  2ACX A;  4QX8 B;  2KSR A;  4E7S A;  4DV2 T;  4ZZC A;  1NWM X;  2LRL A;  2LHR A;  3LK4 2;  2WCA A;  5HCJ A;  2CXF A;  3U3I A;  2C5J A;  2W63 A;  2CPT A;  2XQ9 A;  4ISS A;  4OHF A;  5LHI B;  2CLY C;  1MIW A;  5CFB A;  3ZMU B;  2X67 A;  3W15 B;  2XAS B;  1WR6 A;  3NZQ A;  2JJ9 A;  3FZM B;  3ONL C;  3GMI A;  2MOZ A;  3AA1 B;  3AA6 B;  4IST A;  5FVK A;  1WR0 A;  4IE6 A;  4UIG A;  4JI6 T;  4ZI7 E;  2YDR A;  3FXD B;  1HG2 A;  5HYA A;  5L4E A;  2D0U A;  2WDR A;  5LHH B;  5LHG B;  3PUA A;  4NXM T;  2XQ4 A;  1BR0 A;  3UUM A;  2XQ7 A;  3AAI A;  3RYI E;  2CWO A;  4EZ4 A;  2JQ9 A;  2YDS A;  2WU2 A;  4QKN A;  3JCF A;  5JRE A;  3C51 A;  3PUQ A;  1N32 T;  2V7K A;  1N34 T;  1JNR A;  3PUY F;  2IC9 A;  2IML A;  5LJM A;  5HEO A;  5J2U E;  2ES0 A;  4X1Y E;  2CXD A;  4O2B E;  3MKD A;  5FVL A;  3IF8 B;  5LMN T;  2QRX A;  2MTQ A;  4DMV A;  3JC6 D;  4TX5 A;  5J0Z A;  5AQR B;  4TNV A;  2FJA A;  3PUV F;  4HFV A;  2HH7 A;  3QK6 A;  1HCI A;  2XAJ B;  5FP3 A;  4EZH A;  3OYZ A;  3GA8 A;  2LSK A;  5KX5 E;  3ZJ1 A;  2I59 A;  5L47 A;  3Q5X A;  1XMO T;  4ZS3 A;  3ZMV B;  1YQ3 A;  2IHR 1;  2H88 A;  1J5W A;  4PK6 A;  2N9D A;  3KBT A;  3ZST A;  4ZHQ E;  3AB3 B;  3KV5 A;  4L9I A;  4TWH A;  3LG7 A;  1S35 A;  3CQG B;  1IJ6 A;  1T98 A;  3F57 A;  1ZKE A;  2RP4 A;  2Q9Q A;  2H3R A;  3BQI A;  3RIU C;  4PNI A;  4GK0 E;  4GKK T;  2E9X B;  4H9R C;  4IDO A;  3HA4 A;  2VVN A;  4UEL A;  3ZLI A;  4CI2 B;  2V7L A;  4KBM B;  4HFB A;  4GIW A;  2X66 A;  2KXP B;  3RX6 A;  1YKE B;  4DV1 T;  4HWF A;  4H9P C;  2UXN B;  5JDH A;  2V6Y A;  2VK9 A;  4AXP A;  2LSY A;  1W09 A;  5LYJ E;  3H3A A;  5LA6 E;  3KV4 A;  3RRW A;  4EGW A;  3C98 B;  5HXR A;  5GON E;  4DO0 A;  1T8B A;  1MNE A;  4J2C A;  3VR9 A;  1R8I A;  2UXX B;  3P4P A;  3OYX A;  4NUV A;  3KV6 A;  5F3J A;  4HKA A;  4EIW A;  3PU8 A;  1W0A A;  3L8R A;  1KEY A;  3AE4 A;  5CA1 E;  4C91 A;  5FY0 A;  3E08 A;  3HL6 A;  4AI6 A;  4G2A A;  4AQF A;  4PK4 A;  2E9X C;  5DQV A;  4Z90 A;  4JYA T;  4I55 E;  1YW0 A;  3Q5W A;  3PJA J;  1OXZ A;  3PUZ F;  3KVA A;  4U72 A;  2EHO A;  5JTG A;  4YXD A;  4YTP A;  2B76 A;  4HE8 A;  1MND A;  3UUL A;  3N2O A;  1E1H B;  3BQK A;  1HX1 B;  4JEH B;  2BS3 A;  3AE8 A;  3TLW A;  2WP9 A;  2WZH A;  1SA0 E;  2YDQ A;  4EOZ B;  4NXN T;  3Q9D A;  1HNX T;  1YD8 G;  3PE0 A;  4GYS A;  4K0K T;  1D0Y A;  2VQE T;  5HEJ A;  3I9W A;  4JI0 T;  3AEE A;  4V1A v;  4K0U A;  3I0Q A;  1HG5 A;  3K1S A;  3F31 A;  2H7V C;  2BS4 A;  2KIN B;  2MYS A;  2BG9 C;  1HX8 A;  5AQU B;  2VVS A;  5HXC A;  2W66 A;  2WU5 A;  3PV0 F;  1YKH B;  3OKQ A;  3N5L A;  2PG8 A;  4DV5 T;  4UVC B;  3AE3 A;  2KMF A;  4DR7 T;  4I4T E;  5JDG A;  1IBM T;  3CX7 B;  3LK2 B;  3ZSS A;  4UXN B;  5FXZ A;  4YFS A;  5JQG E;  3EAB A;  3SFD A;  3EDU A;  1U4Q A;  4X66 T;  3UQ7 A;  2XQY A;  3EDV A;  3N9Q A;  3P4R A;  2G0U A;  2YEV C;  4X65 T;  3EAM A;  5JDL A;  3RQU A;  4HN9 A;  4CN1 A;  4CI1 B;  5FXX A;  4JI7 T;  1IBL T;  5FL1 A;  2VKO A;  1CUN A;  4LF6 T;  4AIU A;  2LRK A;  4TN7 B;  1UUS A;  3JAE A;  4YLH A;  2XHE B;  3VR8 A;  2C0S A;  3K8P C;  5AQO B;  2X9Y A;  1E2A A;  3SRZ A;  1W0B A;  2YOE A;  1E7P A;  2JQH A;  2KWI B;  3P4W A;  3K3N A;  3DTO A;  1ZEE A;  4DBQ A;  2P9B A;  4KHZ F;  3MK7 C;  2H7O A;  3UT5 E;  2WY2 A;  3UU6 A;  1D1C A;  4TV8 E;  2LM2 A;  3ESL A;  5L3G B;  3L3P A;  4I0U A;  2LSI A;  5DJQ C;  2VUR A;  3RLF F;  2LHN A;  2J62 A;  1WYC A;  2DI4 A;  5ABH A;  2DLR A;  3FZH B;  2BBJ A;  2KZ7 B;  3AEC A;  3C4Z A;  5LOV E; 
#chains in the Genus database with same CATH homology
 3P8C D;  2NWB A;  5LHH B;  3CVR A;  5LHG B;  1IZN B;  5L3D B;  2QA7 A;  1FMW A;  3PUA A;  3R84 B;  4KMC A;  1BR0 A;  3PDY A;  3UUM A;  1V9D A;  5LP6 E;  4EB6 E;  3AAI A;  4YHJ A;  3RYI E;  4M1P A;  2CWO A;  3IHR A;  1O3X A;  3MA9 A;  3HKE E;  2WMN A;  4EZ4 A;  5LJN A;  2RA1 A;  2CLY B;  2E8I A;  5JRC B;  3MJX A;  4QKN A;  4QHO A;  3FXE B;  3U78 A;  5JRE A;  1AJ3 A;  5IYZ E;  3C51 A;  1BR2 A;  3PUQ A;  2BZB A;  4X20 E;  1LRZ A;  3PUR A;  2V7K A;  3N9L A;  2X9H A;  3PUG A;  4XBF B;  4I43 B;  4ZI3 C;  4QX7 B;  3JC6 C;  3CKD A;  3AA7 B;  2X9X A;  3WAJ A;  2IC9 A;  3ETV A;  3N9P A;  1HF8 A;  5LJM A;  3AVS A;  3NZP A;  4MLK A;  1UCU A;  4H9Q C;  4B6X A;  1WRD A;  2WMO A;  5J2U E;  2L3L A;  3RC8 A;  3PU3 A;  2LSJ A;  2ES0 A;  5J1G A;  4X1Y E;  4X1I E;  4GYR A;  2CXD A;  1D1B A;  4O2B E;  2XAF B;  3O1J A;  2HPL A;  3HR0 A;  3MKD A;  3MXZ A;  3IF8 B;  4GK5 E;  4JUY A;  3M65 A;  1WLX A;  3WAK A;  2LE8 A;  3C4X A;  2MTQ A;  2JPF A;  4DMV A;  4NUU A;  2V26 A;  3AAA B;  2YIN A;  3RYF E;  4ZI3 D;  4OK0 A;  3JC6 D;  4TX5 A;  2LSG A;  3C64 A;  2ZM8 A;  5HXH A;  2A72 A;  2V7J A;  5HWX A;  5FNV E;  4HFV A;  4P0A A;  2C5K T;  2HH7 A;  2HPJ A;  2PJQ A;  3QK6 A;  2ODU A;  4UEM A;  4X1K E;  5E0O A;  1HCI A;  2XAJ B;  2NW9 A;  3ZYM A;  5FP3 A;  3FBZ A;  4EZH A;  3DJB A;  3VKG A;  2Z6E A;  1ZV4 X;  3OYZ A;  4DVD A;  3GA8 A;  3UTK A;  3RKO A;  3CML A;  2N2N A;  1UX4 A;  2LSK A;  2N1G A;  5JVD E;  3ZJ1 A;  5KX5 E;  4HEA A;  2I59 A;  3Q5X A;  4ZS3 A;  3ZMV B;  5L3E B;  2YK0 A;  1U5P A;  3N9N A;  4EXT A;  4PK6 A;  4O4J E;  4ZOL E;  2N9D A;  2XAQ B;  3CWZ B;  4DND A;  3KBT A;  2LOS A;  3RC3 A;  4UF0 B;  2IW5 B;  4DBR A;  3KDS E;  2V7I A;  1KNZ A;  4ZHQ E;  3AB3 B;  3KFW X;  3KV5 A;  2IAK A;  1MMN A;  2Q9Q C;  4L9I A;  3J7Y q;  1WYB A;  2KLQ A;  2E9X D;  3LG7 A;  2A2F X;  1S35 A;  3CQG B;  3KVB A;  1IJ6 A;  2CCQ A;  3QUJ A;  5JH7 E;  1T98 A;  3I9Y A;  3F57 A;  4AKG A;  1ZKE A;  2JMK A;  2J1D G;  3EVY A;  2RP4 A;  2Q9Q A;  4FJO A;  5JRC A;  2IC6 A;  2CMR A;  2H3R A;  2VKJ A;  4XAX B;  3FB2 A;  3EUH A;  4U74 A;  3BQI A;  2ZMA A;  2ZM2 A;  5ETW A;  5TAO A;  5EK2 A;  4PNI A;  4GK0 E;  2E9X B;  4H9R C;  2Q9Q D;  2NOX A;  3HA4 A;  3B13 A;  4UEL A;  5L3C B;  3ZLI A;  4CI2 B;  2V7L A;  5FXW A;  4IE7 A;  1QUU A;  2D0T A;  1OWA A;  2WBL A;  3O9X A;  1X79 A;  1FIO A;  1QSD A;  4KBM B;  2B1E A;  4YJ3 E;  4EAH A;  3MZK B;  1FEW A;  4GIW A;  2W00 A;  2X66 A;  2KXP B;  3RX6 A;  3RRC A;  2Q9Q B;  3ZC0 A;  1YKE B;  1NAF A;  3RH3 A;  5L3B B;  1D0Z A;  4H9P C;  2WM9 A;  2UXN B;  3ZCI A;  2W0G A;  2CEA A;  3R6N A;  1G8X A;  1LVK A;  4F6R C;  5J2T E;  5HWY A;  5JDH A;  3H37 A;  2VK9 A;  4PK5 A;  4AXP A;  4EYY R;  2NW8 A;  3IEE A;  2LSY A;  3N9O A;  4I50 E;  4AKL A;  5LYJ E;  2GK9 A;  4PJM A;  3RYH E;  5CB4 E;  2ZLY A;  3H3A A;  2QGS A;  3F2E A;  4IIJ E;  3GWH A;  5H6Q B;  3VU7 H;  5LA6 E;  5HXS A;  3KV4 A;  4TUY E;  5DAB A;  5KMG P;  1UX5 A;  3RRW A;  1BR4 A;  4ZI2 C;  4PFP A;  3HKD E;  3C98 B;  3NRY A;  2M67 A;  4ERR A;  3L09 A;  2LJL A;  5HXR A;  5GON E;  3N2K E;  4DO0 A;  1MNE A;  3LJC A;  4H9N C;  3ZEF B;  5LGU B;  2MBG A;  2XAG B;  4J2C A;  3PTR B;  3ZN1 B;  3AAE B;  1HFA A;  2UXX B;  5A1L A;  3OYX A;  4NUV A;  3KV6 A;  4PFO A;  4CI3 B;  3ONX A;  2K48 A;  1MMA A;  5F3J A;  4HKA A;  4UF0 A;  4EIW A;  3PU8 A;  4TZ4 C;  1HS7 A;  4AQF C;  2K24 A;  1ZHC A;  1BR1 A;  4PJL A;  2XAH B;  5CA1 E;  2BVM A;  4C91 A;  3DP7 A;  5FY0 A;  3VKH A;  3E08 A;  3HL6 A;  4ZI2 D;  5JR9 B;  4AI6 A;  1IJ5 A;  3CX6 B;  4G2A A;  2NP9 A;  4AKI A;  2LM9 A;  4AQF A;  4GOU A;  2EHO C;  2WAU A;  4PK4 A;  2E9X C;  3ZYL A;  5DQV A;  3ETU A;  4WNK A;  5L2L A;  3NBX X;  4I55 E;  4O4H E;  1YW0 A;  3Q5W A;  4IDZ A;  1S94 A;  4L0R A;  4EYU A;  4H63 H;  1OXZ A;  3MAC A;  2WWU A;  3D0T A;  3KVA A;  1HTJ F;  1G73 A;  2BDE A;  2BVL A;  3CQC B;  3WI3 A;  4QWN B;  4U72 A;  2KWH A;  2SPC A;  2EHO A;  5LGN B;  3GN5 B;  4OYK A;  2E9X A;  3ZC1 A;  4PJN A;  5BMV E;  5LXT E;  3KBU A;  3NRX A;  2ZM0 A;  4FI5 A;  4YJ2 E;  4P09 A;  5H6R B;  4HE8 A;  2NTY A;  2YU1 A;  4OYJ A;  1MND A;  2VWA A;  5C8Y E;  2Y6X A;  2WSS V;  3FBL A;  3UUL A;  3N2O A;  1E1H B;  3O1H A;  2EHO D;  3BQK A;  5HAX A;  4JEH B;  5FMN A;  4JLE A;  4UVA B;  1SA0 E;  3RYC E;  3P7I A;  3IBP A;  2JQQ A;  4EOZ B;  2DHR A;  4ILU A;  5LCY A;  2DWK A;  3Q9D A;  5F8P A;  1YD8 G;  3CQX C;  3PE0 A;  4QXB B;  4GYS A;  4JEU B;  4O4L E;  4AKR B;  1D0Y A;  4WBN E;  2V7M A;  1MIV A;  2NW7 A;  4KP3 C;  2EHO B;  3FHN A;  4AQG A;  4E7Z A;  2VKH A;  2CXL A;  3I9W A;  3J9X 1;  3SWH A;  2OA5 A;  5JDN A;  3LBX B;  1KK7 A;  4V1A v;  4K0U A;  3I0Q A;  4MHC A;  1MMD A;  1B7T A;  1HG5 A;  1Z0P A;  3CPZ A;  1LVF A;  2YU2 A;  2K5B B;  4ZS2 A;  4C90 A;  3Q2M A;  4UV8 B;  3F31 A;  2H7V C;  1H7C A;  2DNX A;  2KIN B;  2MYS A;  2KT9 A;  3KV9 A;  2CM0 A;  3VHL A;  2LEH A;  2X9W A;  5DQW A;  1VRB A;  4OFZ A;  1IAP A;  2C5I T;  2ODV A;  2X68 A;  4O4I E;  2X51 A;  5M4Y A;  4DMW A;  3HI2 A;  3ZYK A;  4O8S A;  4IHJ E;  4IE4 A;  1HX8 A;  4MAL A;  4XZC A;  4ANJ A;  1MIY A;  4WBO A;  5FY1 A;  1SHZ C;  4PJJ A;  3BQL A;  3ZJ2 A;  5HXC A;  5JR9 C;  4AKH A;  5FYM A;  1YKH B;  3OKQ A;  2K9A A;  3N5L A;  2PG8 A;  4BJN A;  4UVC B;  3ZMT B;  4L5G A;  3ANW A;  3K3O A;  2Y8D A;  4QXC B;  2W61 A;  2KMF A;  5FXV A;  1FMV A;  3V5S A;  5JR9 A;  4I4T E;  3AA0 B;  5JDG A;  3UUN A;  5KDM C;  2XUE A;  3CX7 B;  3LK2 B;  4H9S E;  2X0L B;  3V5U A;  2A3D A;  5LGT B;  3AVR A;  2L9Q A;  3E0Z A;  5EK3 A;  2VKD A;  3I1A A;  4UXN B;  5FXZ A;  4G63 A;  4YFS A;  2LOP A;  5JDF A;  5JQG E;  2JMH A;  1Y64 B;  4N78 D;  3EDU A;  3K3Q C;  1U4Q A;  2L8K A;  3N9M A;  2PBI A;  3PUS A;  3OJA A;  2VL8 A;  2XQY A;  3O4X E;  3GN5 A;  4H63 V;  5L3F B;  3EDV A;  4P0B A;  4CXX A;  4MBQ A;  3ANW B;  3ZMS B;  3N9Q A;  5FY7 A;  4CXW A;  3N2G E;  3ZPO A;  5HXE A;  2NTX A;  3ZCJ A;  5ADX L;  4IE0 A;  4WW0 A;  3ZN0 B;  2PFV A;  1MMG A;  5EZY E;  4QXH B;  4CZZ B;  2VB6 A;  2G0U A;  2YEV C;  2JRK A;  3I0O A;  1LKX A;  2CWY A;  5JDL A;  4UVB B;  3S4U A;  4HN9 A;  4CI1 B;  5FXX A;  3SOL A;  2ACX A;  4QX8 B;  3C4W A;  2VKO A;  4CQI A;  3TKL B;  1CUN A;  3O1I A;  5LG4 A;  5LBM A;  5JDQ A;  3LBX A;  3C50 A;  4TN7 B;  3HKC E;  4E7S A;  4O2A E;  3T8O A;  1NWM X;  2XHE B;  4YLH A;  4Z8X A;  2C0S A;  3K8P C;  4HGA A;  4A56 A;  3HKB E;  2VAS A;  2LT3 A;  1D1A A;  2LHR A;  2W62 A;  3LK4 2;  2X9Y A;  2DWG A;  3SRZ A;  2CXF A;  5AFU L;  4IE5 A;  3UUX B;  3U3I A;  4UV9 B;  2C5J A;  3B57 A;  2W63 A;  4IGU A;  2DCF A;  2CA5 A;  5CA0 E;  2Y48 B;  4BA9 A;  2KWI B;  3K3N A;  3DTO A;  1ZEE A;  4DBQ A;  2P9B A;  4ISS A;  4HTE A;  3MK7 C;  2H7O A;  4OHF A;  4KUM B;  4PW8 A;  3UT5 E;  4TV9 E;  2D5U A;  2CLY C;  5LBQ B;  4ASK A;  5LHI B;  1MIW A;  1EZ3 A;  3RPU A;  3E22 E;  1D1C A;  4TV8 E;  2XTL A;  2CE7 A;  3ESL A;  3ZMU B;  5L3G B;  4CXY A;  3SS1 A;  2X67 A;  3L3P A;  3QC9 A;  3W15 B;  2LSI A;  5DJQ C;  1D0X A;  2XAS B;  1WR6 A;  3NZQ A;  2JJ9 A;  5JDM A;  3ZMZ B;  3UFE A;  2LHN A;  3GMI A;  2D2S A;  3A5X A;  1US7 B;  1WYC A;  2MOZ A;  3AA1 B;  2KND A;  3AA6 B;  4IST A;  4MFR A;  4BAY B;  4H9O C;  4ADZ A;  5EK4 A;  3KIN B;  2DI4 A;  4PAG A;  2DLR A;  3BK9 A;  4IE6 A;  1VOM A;  4UIG A;  5IHY A;  4ZI7 E;  3FXD B;  3LK3 B;  3CX8 B;  2KZ7 B;  4BJM A;  1HG2 A;  2V1D B;  3LFM A;  3C4Z A;  5HYA A;  2D0U A;  5LOV E;  5LNK A;  3OBV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...