3UUNA

Crystal structure of n-terminal first spectrin repeat of dystrophin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
116
structure length
116
Chain Sequence
b'EVNLDRYQTALEEVLSWLLSAEDTLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dystrophin
publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 52
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uunA00
1WLXA 1CUNA 2SPCA 1QUUA 3UUMA 3LBXB 1S35A 3PE0A 3F31A 1U4QA 3FB2A 3UULA 2ODUA 1HCIA 2ODVA 3UUNA 1AJ3A 1OWAA 3LBXA 3EDVA 1U5PA
chains in the Genus database with same CATH superfamily
1WLXA 3BK9A 4QKNA 4DV3T 1MMAA 1W0AA 1HG5A 2X9WA 1N36T 1VOMA 4UVBB 4MALA 2Q9QD 2VQFT 4ZI2D 3A5XA 4BAYB 2LJLA 1ZV4X 3U3IA 3AB3B 3ANWA 2BDEA 3RIUA 4JLEA 2BG9E 5DABA 4ZZBA 5HEJA 3I9YA 3K3QC 1BR1A 1WYCA 5H6RB 4HE8A 3FXDB 5ABFB 2DNXA 4HFDA 2HN2A 4U3CA 4O4HE 4EEBA 3V5SA 4UF0A 5JDHA 4TUYE 2IHR1 3EAMA 3LFMA 1Z0PA 4HFVA 3LK42 4U2ZA 3QC9A 5HXCA 2QVAA 4O8SA 4UV8B 4ZI3C 2I6HA 3QUJA 3ONJA 3G06A 2UXNB 2V8SV 4U72A 2B76A 3KVAA 3ZPOA 2V7KA 1XMQT 2E9XC 3PE0A 3OKQA 1T8BA 2WSSV 1N34T 5LYJE 3ZYKA 3P4PA 5IHYA 2YDRA 2XASB 3Q5EA 4AKHA 3AE8A 3J7Yq 5E0OA 3PJAA 4DBQA 5FXWA 3JC6C 4EZ4A 5BMVE 2AXDS 2BS4A 4JBWF 4HWFA 4ZS2A 5HCMA 3UQ7A 4CZZB 2FJEA 4NUUA 2ODVA 1NAFA 4HWIB 1CUNA 4IDNA 1IJ6A 4PJLA 4JI0T 1I6ZA 3TLVA 5TAOA 1XDPA 4LF6T 3C4XA 4B3MT 2J1DG 3KVBA 4DR1T 3RLFF 3IEEA 2UUAT 4NIQA 3T1YT 2LHRA 3ZMTB 2C5KT 2JQ9A 3KBUA 3C4ZA 3LBXB 5JDNA 2CWOA 1D1CA 3PDYA 3N9NA 3HKBE 1IBLT 3GWHA 1KNRA 1T7SA 5L3DB 1IJ5A 4NPPA 2OA5A 1BR0A 3CPZA 2Z6EA 3NVOA 3O1IA 2JQQA 1D0ZA 4JI6T 3GMIA 4GKKT 3CWZB 1IZNB 4DV6T 3RRCA 4YJ2E 2D0UA 2YN6A 3RC8A 4QHOA 4LFCT 1E2AA 2BBHA 3RIUC 2FJDA 2J47A 2V1DB 2OLTA 1XDOA 3O1HA 5LGTB 2XUEA 4X20E 3ZCJA 3N9PA 1LVKA 2E8IA 1IBMT 2V7LA 3H3MA 3RHWA 5JR9B 2K48A 5FXZA 3GN5B 4N78D 3UULA 2XZEA 4IE7A 4ASKA 5EK2A 2YINA 5HWYA 3Q5WA 3AA1B 2VURA 5JDQA 1HR0T 2LLYA 3RKOA 3T8OA 5AQUB 2DHRA 3RGLA 4CI1B 2RP4A 4IDPA 5HAXA 3RYHE 1CHUA 2WBLA 1YQ3A 2DI4A 3ETUA 3S4UA 2C5JA 4F8HA 4QH5A 2NTXA 4P09A 2PG8A 3F57A 2CXDA 2F4VT 2LM9A 4IREA 4DUYT 2WAUA 1BR4A 2L3LA 5JQGE 1VCTA 4O4IE 2DL1A 1W09A 3PUYF 5JR9A 5L3GB 3GN5A 4GOUA 4DV1T 3AEGA 4DR2T 4TNVA 4HWHA 3P4RA 2WMOA 2HPJA 4P1NA 3MZKB 2I59A 3FZKB 4DR4T 1UK5A 3WI3A 2XQYA 3CIRA 3ZMVB 4DR3T 2MBGA 3L39A 4H9QC 1S94A 3CX7B 5FL0A 4Z90A 1S35A 5J0ZA 4EEDA 4YHHT 4O4JE 3AVSA 2EHOA 1N33T 2MOZA 3H37A 2D2SA 4PAGA 2G0UA 1OEDC 4QXHB 2UUCT 2Y6XA 2WS3A 4B6XA 2X9HA 3WAJA 4HWCA 5L47A 2XQAA 3PUAA 2JJ9A 4UELA 3K3OA 2VQET 3VU7H 4A97A 5FY7A 2X51A 2MTQA 1T98A 4M1PA 3J9X1 4ILUA 2HN1A 3SRZA 2YU1A 2V7MA 2LHNA 4PK6A 2VL8A 3RH3A 3KV9A 3TLWA 3VHLA 3RIFA 1FIOA 2XQ3A 1SUMB 5BR8T 4IDOA 2XM2A 2H88A 3LSVA 4TWHA 1FJGT 5HEOA 3HKCE 4U7IA 2JRKA 3HI2A 4U31A 2V7JA 3KFWX 3L3PA 5DQWA 1ZKEA 5AQRB 3NBXX 4OX9T 3IBPA 3ZN0B 4EOZB 5LG4A 3ZYMA 5LHHB 5JRCB 3UU3A 4AQFC 3AE4A 3NZQA 2PJQA 4DV0T 2PFVA 5LHIB 3LJCA 5KMGP 2LOPA 4L0RA 2A9UA 2KWIB 4GKJT 2FUPA 4U7YA 4KX6A 4JI5T 2VKDA 1KF6A 2V6YA 4FJOA 3EVYA 4EYYR 3N9LA 1GQEA 4WBOA 1QLBA 2WM9A 3PJAJ 2X67A 4EZHA 3AAIA 2J4GA 3UQ4A 3PTRB 5FMNA 3ZYLA 2FJAA 3IHRA 2NOXA 2Q9QA 2WZIA 4IDZA 5L2LA 1MIVA 5JVDE 5A1LA 2YOEA 4XAXB 1XMOT 5JDGA 4JEUB 4LMKA 1UX5A 1R8IA 4DV5T 4ILAA 3NKZA 1NEKA 1O3XA 3PU3A 3P4SA 1FMWA 5FP3A 2WMNA 1Z8UA 1E1HB 2BG9A 5FVKA 4H9OC 3SFEA 4ERRA 5FL1A 3C98B 3UFEA 4JI3T 3JADA 5JREA 4YFSA 4IT4A 4C91A 3N2GE 2RA1A 2W61A 2BS3A 4KHPT 3AAAB 3D0TA 3UU5A 2WWVA 4AISA 2QYWA 3I9WA 5IYZE 5L4EA 5CA0E 5DJQC 3CK6A 3SWHA 2EHOC 4UIGA 3ZN1B 1UURA 2V6XA 1XNRT 4C90A 5HXEA 2M6BA 4TN7B 3NRYA 4IE0A 2M6IA 4CI3B 2XQ8A 4J2CA 4CXWA 2VB6A 3ZJ1A 4CQIA 1NENA 5AFUL 4TV8E 3OPCA 1KNZA 3HR0A 5JTGA 2KNDA 1WFDA 5AQGB 2LRKA 1U5PA 5HCJA 3PUVF 3A7MA 3ZSTA 3SOLA 5AQLB 3RI5A 3PV0F 3C51A 1JNRA 3AE1A 2CXFA 2QRXA 2CM0A 5HYAA 2CCQA 4AIUA 4YTNA 3VR9A 4DV2T 3B57A 1VRBA 2UXBT 1EZ3A 5ABEA 2OV9A 1T72A 1X79A 2CRBA 3C50A 2AE9A 4KUMB 5C3JA 4HWDA 3U78A 3UTKA 2ODUA 2C0SA 2VKOA 1AJ3A 1MMDA 3HKDE 5IWAT 3AE7A 5ABFA 2CMRA 4XZCA 3AEDA 3IF8B 5AQVB 3NWIA 1MMNA 3V5UA 5JDFA 2CLYC 5LCYA 4COFA 4DR5T 5AQQB 3EUHA 3UU6A 4MBQA 3SS1A 4TX5A 2HPLA 2D5UA 3CQXC 3KV6A 4NUVA 4QH1A 2CA5A 4G63A 5LXTE 4CXXA 1KEYA 4PJMA 4XBFB 2QGSA 3B5MA 2JQKA 3UUBA 4YTPA 4UEMA 5AQHB 2IW5B 1UUSA 1HCIA 4PFPA 2Q9QC 5FY0A 4ZZCA 4X1KE 4U2YA 2JQHA 3AEBA 1Y64B 2XAGB 4DIDB 5CA1E 2JIWA 3BQIA 4O2BE 4HEAA 1SHZC 4I55E 3F2EA 4JYAT 2CHNA 5DQVA 4L9IA 4Q25A 2X9YA 3TLTA 2P9BA 2YEVC 4LF8T 4ZHQE 1J5ET 2BG9C 2JMKA 3FXEB 4X1IE 1HNZT 2GK9A 4KI0F 4PJJA 3NRXA 2BKNA 4LF5T 3T1HT 3P4WA 4A98A 1OEDE 3UUNA 4YHJA 2BVLA 3AE3A 2IDOB 2LRLA 4AXPA 2YU2A 4DV4T 2XSBA 2KSRA 2WDVA 1KFYA 2VVSA 4IGUA 4JI1T 3DP7A 4PK5A 4I43B 4EYUA 1N32T 4DMVA 3QK6A 4JI7T 3LBXA 2C5IT 2X68A 3QNUA 2H89A 4EB6E 3UUMA 2VASA 4YTMA 2VKJA 5ETWA 2FJBA 4HKAA 4U74A 1G73A 4PFOA 4DR7T 2PTFA 2LSGA 2L9QA 4QXCB 1LVFA 3QOFA 2WQYA 4OYJA 3GA8A 3FBZA 3UFGA 4ZS3A 3OTOT 1ZP0A 4PNIA 3VRBA 2BBJA 4A5XA 5L3BB 2ACZA 3CKDA 5C2TA 5LMUT 5LA6E 2ZM8A 3LK3B 4KMCA 5LOVE 3TLUA 2LT3A 2WCAA 3JCFA 2DCFA 4E7ZA 2B1EA 4B3ST 3AXJB 2XQ7A 1BR2A 2WDRA 2CE7A 3RRWA 4JI4T 3Q2MA 5CFBA 3HKEE 5LJMA 4AKGA 2WP9A 4AKLA 1XNQT 2A2FX 2E9XB 4TV9E 3CQGB 3EI0A 5LMNT 3CX8B 4IE6A 4P0BA 5HEHA 4JUYA 3QB5A 4HFHA 2N2NA 4IL4A 5LB7B 2HH7A 3ZT6A 4ZOLE 4DNDA 1D1AA 4HFBA 1YW0A 2LM2A 3B13A 4TWDA 5EK4A 5LNKA 2WZHA 3ONXA 4GYSA 2K9AA 3W15B 5AQJB 4QX7B 2M67A 3ZC0A 3WAKA 4I50E 5J2TE 3P7IA 1UX4A 1UGOA 3VRAA 2IC9A 2SPCA 2CWYA 4UXNB 4CN4A 4JEHB 2NP9A 1UCUA 1SE7A 4B3RT 3UT5E 5JDLA 3LDQB 3UU8A 4MFRA 3MJXA 3PUGA 1JNZA 2RPAA 3JAFA 3ZMZB 3L8RA 3AEFA 5KX5E 2A72A 2WY2A 3PUQA 3O4XE 4YJ3E 2XHEB 5JH7E 1YD8G 3AECA 4ZI3D 3VKGA 3P50A 3RYIE 1J5WA 4TWFA 2XQ9A 3OYZA 3FZMB 2V26A 2CEAA 2X0HA 2E9XD 5L4HA 1WRDA 2L8KA 3N9MA 2E2AA 2IC6A 3E08A 5LHGB 2XSAA 3IA3A 4JV5T 1IBKT 2KXPB 4KHZF 4AI6A 2KLQA 3KINB 2BZBA 4WZXA 2D0TA 1X9BA 3F31A 1D0XA 3JC6D 1W0BA 3ABVA 1NWMX 1XWMA 5HXSA 4WNKA 2N1GA 1Y01A 2VKHA 1J1JA 4X1YE 3RQWA 4BJMA 4YT0A 5KDMC 3ZKRA 4UF0B 3I0QA 5C8YE 3PU8A 2UU9T 4O4LE 3R84B 4GK5E 2BKOA 3M65A 1MNDA 2IMLA 4QX8B 5AQOB 4KBMB 2HHHT 4DVDA 1L0VA 5JR9C 1V9DA 3BQKA 1HG2A 5ABHA 4CXYA 2IIUA 4YSYA 2W63A 2XQ5A 4K0KT 5ADXL 3Q5DA 4LF7T 2LSJA 4X65T 2LOSA 4JI2T 1QSDA 5JRCA 4X64T 5FKYA 2XQ6A 2W4XA 2XJ7A 2ZM0A 2XQ4A 4P0AA 2WWUA 3ZSSA 4LMJA 2XAHB 5EZYE 3TKLB 4H63H 4DUZT 4NXMT 2NTYA 1HNXT 3ETVA 4DV7T 5L3CB 2CBJA 4GYRA 2XM1A 1WR6A 2VVNA 4Z91A 4QWNB 1IAPA 2MAWA 2WU2A 5HXRA 5CGMA 4CI2B 1SA0E 4K0UA 3O1JA 3X1DA 1YQ4A 5AQFB 2XY8B 3ZJ2A 3KV4A 2BKPA 3H3AA 3C4WA 4AQGA 1DU2A 5KXJA 5CB4E 4PW8A 1HS7A 5HXHA 2W67A 2KMFA 4H9PC 4H9NC 2JPFA 4UVCB 2VL0A 3PUSA 2LSKA 2K24A 4L5GA 3AA0B 4FI5A 4U33A 4TNWA 2CHOA 2XAQB 5M4YA 4I0UA 2YKSA 4ILBA 3CQCB 1KNPA 2KZ7B 2D9DA 3RKGA 5F8PA 5FYMA 1FMVA 2W0GA 4X62T 4X5TA 3I1AA 4ILCA 5CJ5A 1OEDB 3FZHB 3EABA 4EGWA 4AKRB 4X66T 3BQLA 5J1GA 5FNVE 3UUXB 3E22E 2IAKA 4QH4A 4ISTA 1W9RA 4JI8T 4AKIA 4ADZA 3O9XA 2WDQA 4TZ4C 2XAJB 2X9XA 1ZEEA 3MA9A 5HEGA 5L3EB 1MIWA 3LG7A 3ZCIA 2WB5A 3ZEFB 4IE4A 1D1BA 2NW8A 3RIAA 2R6GF 1I94T 4ISSA 2W2UA 1E7PA 4YY3T 3AE2A 5AQNB 3UU4A 4EXTA 4ZXLA 3HA4A 3P8CD 4ZI2C 2WU5A 2E5VA 4BA9A 1HF8A 3RF1A 1HFAA 1OXZA 1US7B 2NWBA 4DMWA 3AA6B 1HX1B 4IDQA 1WCRA 5LBQB 3N2KE 3CMLA 3FZLB 2XTLA 2X0YA 5LJNA 2CPTA 1MMGA 5FXVA 3MACA 3DTOA 2NW7A 1OEDA 2NR4A 3QB5K 4IL9A 4OHFA 3OYXA 1B7TA 2KINB 4DR6T 3VKHA 4IIJE 1ZOYA 3ZLIA 4OK0A 4PJNA 4YSZA 2DWKA 4I4TE 4LFAT 2VWAA 1MNEA 4H9SE 4WW0A 3EHZA 5AQSB 2H3RA 5FXXA 1H7CA 2UXDT 4LMLA 4EV6A 5JDMA 3P4QA 4DO0A 3RX6A 4HFCA 5AQIB 2ZM2A 2YDSA 1LRZA 3AE6A 2H7VC 4OFZA 2ZM6T 4YXDA 1M7KA 3ZC1A 3KBTA 2W66A 2IUBA 3RQUA 2LEHA 3ZMSB 4G2AA 3K8PC 2NW9A 1M62A 5AQKB 2DWGA 2LKGA 4GK0E 2ES0A 3OJAA 5FVLA 3LK2B 2PBIA 2KT9A 2Y48B 3KDSE 2E5LT 3TLSA 3N9QA 2A3DA 3OVUA 4AQFA 4LF9T 5J2UE 3VR8A 2CXLA 2UXCT 1U4QA 5LGNB 2K3WA 3Q5XA 3EDUA 3A8YC 4BJNA 4MHCA 4O2AE 3E0ZA 4LFBT 1FEWA 3I0OA 3PUWF 2EHOB 3AAEB 2V5DA 4CN1A 5F5WA 4CN6A 5F3JA 1XZYA 4NXNT 3MKDA 3R6NA 2V7IA 4GIWA 3NZPA 4KP3C 4V1Av 2XAFB 3MK7C 3AEAA 3ZT5A 1YKHB 2LSYA 2X0LB 3RC3A 3C64A 5H6QB 5L3FB 5HEUA 2ACXA 2QA7A 5LGUB 4H9RC 3RYFE 2CBIA 1VCSA 4YLHA 3MXZA 1QUUA 3CX6B 4ANJA 3RYCE 4E7SA 2LE8A 3AEEA 1OWAA 5HWXA 1MIYA 3ONLC 3EDVA 4ZI7E 2BS2A 5EK3A 1WR0A 1HX8A 2MYSA 2UXXB 4IE5A 5GONE 2N9DA 1LKXA 4LF4T 4UVAB 4HFIA 2KWHA 3KV5A 1D0YA 2K5BB 4MLKA 3PUXF 2LSIA 2Y8DA 4WYVA 2CLYB 5LP6E 2FBWA 1YKEB 3N9OA 2I0MA 3ZT7A 5LG3A 3OBVE 2V6YB 4HTEA 3PURA 3SFDA 2EHOD 3JAEA 2XPKA 3AXJA 5LBMA 4WBNE 2J62A 3N2OA 4HN9A 3PUZF 3FBLA 1G8XA 4PK4A 1HNWT 3AE5A 2Q9QB 4F6RC 2E9XA 1WYBA 3L09A 1HTJF 2MPKA 4AQYT 2YK0A 5ABGA 3ZMUB 4H63V 4EIWA 3AE9A 4ZEYA 2YDQA 2H7OA 3M3ZB 4HGAA 4IHJE 4OYKA 3Q9DA 3HL6A 2BG9B 1ZHCA 3ESLA 2UUBT 5FY1A 3FB2A 3CVRA 5AQTB 3ANWB 1KK7A 2X66A 4EAHA 3DJBA 4Z8XA 4HFEA 5IUXA 3RPUA 4B3TT 3AA7B 2JMHA 1YXRA 2W62A 4QXBB 5AQPB 2ZMAA 4A56A 3K3NA 3AVRA 2ZLYA 2W00A 3FHNA 4UV9B 3FZFB 2VK9A 3K1SA 2BVMA 5AQMB 4YSXA 4UR9A 2LKHA 4DBRA 2DLRA 2V5CA 3N5LA
chains in the Genus database with same CATH topology
2X68A 4QXHB 1WLXA 2Y6XA 3BK9A 4QKNA 2IAKA 4ISTA 4EB6E 3UUMA 1MMAA 4B6XA 2X9HA 3WAJA 4ADZA 4AKIA 3PUAA 2JJ9A 4UELA 1HG5A 3K3OA 3O9XA 3VU7H 2VASA 4TZ4C 2X9WA 2XAJB 1VOMA 2X9XA 4UVBB 1ZEEA 3MA9A 5FY7A 2X51A 5L3EB 2VKJA 4MALA 2MTQA 1T98A 4M1PA 5ETWA 3J9X1 4ILUA 4HKAA 4U74A 3SRZA 2YU1A 1MIWA 2LHNA 2Q9QD 2V7MA 2VL8A 3LG7A 4PK6A 3ZCIA 4ZI2D 1G73A 3A5XA 4PFOA 4BAYB 3RH3A 3ZEFB 3KV9A 2LSGA 4IE4A 1D1BA 2NW8A 2LJLA 3VHLA 1ZV4X 3U3IA 3AB3B 2L9QA 4QXCB 3ANWA 1FIOA 1LVFA 4ISSA 2BDEA 4OYJA 3GA8A 3FBZA 4ZS3A 4JLEA 5DABA 4EXTA 4PNIA 3HA4A 3I9YA 3P8CD 4ZI2C 5L3BB 3HKCE 3K3QC 4BA9A 1BR1A 1HF8A 2JRKA 3CKDA 3HI2A 1HFAA 1OXZA 5LA6E 1US7B 2ZM8A 1WYCA 2NWBA 5H6RB 2V7JA 3KFWX 3LK3B 4KMCA 4DMWA 3L3PA 5DQWA 4HE8A 1ZKEA 3FXDB 5LOVE 3AA6B 2LT3A 2DNXA 3NBXX 3IBPA 4O4HE 5LBQB 3ZN0B 4EOZB 5LG4A 3N2KE 3CMLA 3ZYMA 2XTLA 3V5SA 4UF0A 5LJNA 1MMGA 5FXVA 3MACA 3DTOA 2DCFA 2NW7A 5LHHB 4E7ZA 5JRCB 2B1EA 5JDHA 4TUYE 4OHFA 4AQFC 3OYXA 1B7TA 2KINB 3NZQA 1BR2A 4IIJE 3ZLIA 2PJQA 4OK0A 3VKHA 4PJNA 3LFMA 2DWKA 2PFVA 1Z0PA 4HFVA 5LHIB 3LJCA 3LK42 4I4TE 2VWAA 3QC9A 2CE7A 5KMGP 1MNEA 3RRWA 5HXCA 3Q2MA 4H9SE 2LOPA 4WW0A 4O8SA 4L0RA 3HKEE 2KWIB 4UV8B 2H3RA 5LJMA 4AKGA 4ZI3C 3QUJA 1H7CA 5FXXA 4AKLA 2A2FX 2E9XB 4TV9E 2UXNB 2VKDA 3CQGB 5JDMA 4FJOA 3CX8B 4U72A 3EVYA 4IE6A 3KVAA 3RX6A 4DO0A 4EYYR 3ZPOA 4P0BA 3N9LA 2ZM2A 2V7KA 4JUYA 4WBOA 1LRZA 2WM9A 2N2NA 2E9XC 2X67A 3PE0A 4EZHA 3OKQA 3AAIA 2WSSV 2H7VC 2HH7A 5LYJE 3ZYKA 4OFZA 3PTRB 5FMNA 3ZYLA 4ZOLE 4DNDA 5IHYA 1D1AA 3ZC1A 3IHRA 2NOXA 2XASB 3KBTA 2Q9QA 1YW0A 4IDZA 5L2LA 4AKHA 1MIVA 3B13A 2LEHA 3ZMSB 3J7Yq 5EK4A 5JVDE 4G2AA 3K8PC 5A1LA 2NW9A 5LNKA 4XAXB 5E0OA 3ONXA 4GYSA 2K9AA 4JEUB 5JDGA 1UX5A 4DBQA 2DWGA 3W15B 4GK0E 2ES0A 4QX7B 3OJAA 2M67A 5FXWA 3LK2B 2PBIA 3JC6C 3ZC0A 2KT9A 3WAKA 4EZ4A 2Y48B 4I50E 5BMVE 1O3XA 5J2TE 3PU3A 4ZS2A 3KDSE 1UX4A 3P7IA 4CZZB 4NUUA 2ODVA 2IC9A 1FMWA 3N9QA 5FP3A 2WMNA 2A3DA 1NAFA 1E1HB 1CUNA 2SPCA 4AQFA 4H9OC 2CWYA 4UXNB 4ERRA 3C98B 5J2UE 1IJ6A 4PJLA 3UFEA 4JEHB 5JREA 2CXLA 4YFSA 2NP9A 1UCUA 5TAOA 4C91A 1U4QA 3C4XA 5LGNB 2J1DG 3N2GE 3UT5E 5JDLA 2RA1A 2W61A 3Q5XA 3KVBA 4MFRA 3EDUA 3MJXA 4BJNA 4MHCA 3PUGA 3AAAB 4O2AE 3D0TA 3E0ZA 1FEWA 3IEEA 3I0OA 2EHOB 3ZMZB 3AAEB 2LHRA 3I9WA 5IYZE 5KX5E 2A72A 3ZMTB 5F3JA 5CA0E 3PUQA 2C5KT 3KBUA 3O4XE 3C4ZA 4YJ3E 3LBXB 2XHEB 5JDNA 3MKDA 5DJQC 5JH7E 3R6NA 2V7IA 1YD8G 3SWHA 2CWOA 2EHOC 4GIWA 4UIGA 3ZN1B 3NZPA 1D1CA 4KP3C 3PDYA 4V1Av 3N9NA 3HKBE 4ZI3D 4C90A 2XAFB 3MK7C 5HXEA 4TN7B 3VKGA 3NRYA 1YKHB 3GWHA 4IE0A 3RYIE 4CI3B 2LSYA 3OYZA 2X0LB 5L3DB 3RC3A 4J2CA 3C64A 1IJ5A 2V26A 4CXWA 2CEAA 2OA5A 5H6QB 5L3FB 1BR0A 2ACXA 2VB6A 3ZJ1A 2E9XD 4CQIA 2QA7A 5AFUL 4TV8E 1WRDA 2L8KA 3N9MA 5LGUB 2IC6A 3E08A 4H9RC 3HR0A 5LHGB 1KNZA 3CPZA 3RYFE 2Z6EA 2KNDA 3O1IA 2JQQA 1D0ZA 2KXPB 1U5PA 3GMIA 3CWZB 3MXZA 4YLHA 4AI6A 1IZNB 1QUUA 3CX6B 2KLQA 3RRCA 3KINB 3SOLA 4YJ2E 2D0UA 2BZBA 4ANJA 3RYCE 3RC8A 4QHOA 2D0TA 3F31A 1D0XA 4E7SA 3JC6D 2LE8A 3C51A 2V1DB 2CXFA 1NWMX 3O1HA 5LGTB 1OWAA 5HWXA 1MIYA 2CM0A 5HYAA 5HXSA 2CCQA 4WNKA 2N1GA 3EDVA 2XUEA 2VKHA 4X20E 4X1YE 3ZCJA 4ZI7E 3N9PA 1LVKA 3B57A 1VRBA 2E8IA 2UXXB 1HX8A 2MYSA 4IE5A 1EZ3A 5EK3A 4UF0B 4BJMA 3I0QA 5KDMC 5GONE 5C8YE 1X79A 2V7LA 3PU8A 2N9DA 1LKXA 5JR9B 4O4LE 3C50A 4UVAB 4KUMB 2K48A 5FXZA 3R84B 3GN5B 4GK5E 2KWHA 4N78D 3U78A 3UULA 3KV5A 1D0YA 3UTKA 4IE7A 3M65A 4ASKA 2ODUA 5EK2A 2C0SA 1MNDA 2K5BB 2VKOA 2YINA 4MLKA 2LSIA 1MMDA 4QX8B 1AJ3A 2Y8DA 5HWYA 2CLYB 4KBMB 4DVDA 3HKDE 3Q5WA 3AA1B 5JR9C 2CMRA 5LP6E 1YKEB 1V9DA 4XZCA 3BQKA 1HG2A 3N9OA 5JDQA 3IF8B 4CXYA 3OBVE 2W63A 5ADXL 1MMNA 3V5UA 5JDFA 4HTEA 2LSJA 3PURA 3RKOA 3T8OA 2CLYC 5LCYA 2LOSA 2EHOD 3EUHA 1QSDA 5JRCA 2DHRA 4MBQA 3SS1A 4TX5A 2HPLA 5LBMA 4CI1B 2RP4A 5HAXA 3RYHE 2D5UA 3CQXC 2WBLA 3KV6A 4WBNE 4NUVA 3N2OA 2ZM0A 4HN9A 4P0AA 2CA5A 2WWUA 4G63A 3FBLA 1G8XA 2XAHB 4PK4A 5EZYE 4H63H 3TKLB 2Q9QB 2NTYA 2DI4A 3ETUA 5LXTE 4CXXA 4F6RC 3ETVA 4PJMA 4XBFB 2QGSA 2E9XA 5L3CB 1WYBA 3L09A 4GYRA 4UEMA 1WR6A 2IW5B 3S4UA 4QWNB 2C5JA 1HCIA 1HTJF 4PFPA 2Q9QC 5FY0A 2YK0A 1IAPA 4X1KE 3ZMUB 4H63V 5HXRA 4EIWA 2NTXA 4P09A 4CI2B 1SA0E 2PG8A 1Y64B 3F57A 4K0UA 2CXDA 3O1JA 2XAGB 2LM9A 5CA1E 2H7OA 3BQIA 3ZJ2A 4HGAA 4O2BE 4IHJE 4OYKA 4HEAA 1SHZC 4I55E 3KV4A 3Q9DA 3HL6A 3F2EA 2WAUA 1BR4A 5DQVA 1ZHCA 3ESLA 2L3LA 4L9IA 5FY1A 3FB2A 3H3AA 3C4WA 3CVRA 4AQGA 5CB4E 5JQGE 4O4IE 2X9YA 4PW8A 3ANWB 1HS7A 2P9BA 1KK7A 2X66A 4EAHA 3DJBA 2YEVC 5HXHA 4ZHQE 5JR9A 5L3GB 2KMFA 2JMKA 4H9NC 4H9PC 3GN5A 4Z8XA 2JPFA 4GOUA 3FXEB 4UVCB 4X1IE 2GK9A 4PJJA 2WMOA 3RPUA 3AA7B 3NRXA 2HPJA 2JMHA 3PUSA 2LSKA 2K24A 4L5GA 3AA0B 2W62A 4FI5A 4QXBB 2ZMAA 4A56A 3K3NA 3AVRA 2ZLYA 2W00A 2XAQB 3FHNA 3MZKB 5M4YA 3CQCB 3UUNA 2I59A 4YHJA 3WI3A 4UV9B 2KZ7B 2VK9A 2XQYA 2BVLA 3ZMVB 5F8PA 5FYMA 2MBGA 2BVMA 1FMVA 4H9QC 2W0GA 4AXPA 2YU2A 1S94A 3CX7B 3I1AA 1S35A 4IGUA 4O4JE 3AVSA 3DP7A 2EHOA 4AKRB 4PK5A 2MOZA 3H37A 3BQLA 2D2SA 2DLRA 4I43B 4DBRA 5J1GA 4EYUA 4DMVA 3QK6A 5FNVE 3N5LA 4PAGA 2G0UA 3LBXA 3UUXB 3E22E 2C5IT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLX A;  1CUN A;  2SPC A;  1QUU A;  3UUM A;  3LBX B;  1S35 A;  3PE0 A;  3F31 A;  1U4Q A;  3FB2 A;  3UUL A;  2ODU A;  1HCI A;  2ODV A;  3UUN A;  1AJ3 A;  1OWA A;  3LBX A;  3EDV A;  1U5P A; 
#chains in the Genus database with same CATH topology
 1WLX A;  3BK9 A;  4QKN A;  4DV3 T;  1MMA A;  1W0A A;  1HG5 A;  2X9W A;  1N36 T;  1VOM A;  4UVB B;  4MAL A;  2Q9Q D;  2VQF T;  4ZI2 D;  3A5X A;  4BAY B;  2LJL A;  1ZV4 X;  3U3I A;  3AB3 B;  3ANW A;  2BDE A;  3RIU A;  4JLE A;  2BG9 E;  5DAB A;  4ZZB A;  5HEJ A;  3I9Y A;  3K3Q C;  1BR1 A;  1WYC A;  5H6R B;  4HE8 A;  3FXD B;  5ABF B;  2DNX A;  4HFD A;  2HN2 A;  4U3C A;  4O4H E;  4EEB A;  3V5S A;  4UF0 A;  5JDH A;  4TUY E;  2IHR 1;  3EAM A;  3LFM A;  1Z0P A;  4HFV A;  3LK4 2;  4U2Z A;  3QC9 A;  5HXC A;  2QVA A;  4O8S A;  4UV8 B;  4ZI3 C;  2I6H A;  3QUJ A;  3ONJ A;  3G06 A;  2UXN B;  2V8S V;  4U72 A;  2B76 A;  3KVA A;  3ZPO A;  2V7K A;  1XMQ T;  2E9X C;  3PE0 A;  3OKQ A;  1T8B A;  2WSS V;  1N34 T;  5LYJ E;  3ZYK A;  3P4P A;  5IHY A;  2YDR A;  2XAS B;  3Q5E A;  4AKH A;  3AE8 A;  3J7Y q;  5E0O A;  3PJA A;  4DBQ A;  5FXW A;  3JC6 C;  4EZ4 A;  5BMV E;  2AXD S;  2BS4 A;  4JBW F;  4HWF A;  4ZS2 A;  5HCM A;  3UQ7 A;  4CZZ B;  2FJE A;  4NUU A;  2ODV A;  1NAF A;  4HWI B;  1CUN A;  4IDN A;  1IJ6 A;  4PJL A;  4JI0 T;  1I6Z A;  3TLV A;  5TAO A;  1XDP A;  4LF6 T;  3C4X A;  4B3M T;  2J1D G;  3KVB A;  4DR1 T;  3RLF F;  3IEE A;  2UUA T;  4NIQ A;  3T1Y T;  2LHR A;  3ZMT B;  2C5K T;  2JQ9 A;  3KBU A;  3C4Z A;  3LBX B;  5JDN A;  2CWO A;  1D1C A;  3PDY A;  3N9N A;  3HKB E;  1IBL T;  3GWH A;  1KNR A;  1T7S A;  5L3D B;  1IJ5 A;  4NPP A;  2OA5 A;  1BR0 A;  3CPZ A;  2Z6E A;  3NVO A;  3O1I A;  2JQQ A;  1D0Z A;  4JI6 T;  3GMI A;  4GKK T;  3CWZ B;  1IZN B;  4DV6 T;  3RRC A;  4YJ2 E;  2D0U A;  2YN6 A;  3RC8 A;  4QHO A;  4LFC T;  1E2A A;  2BBH A;  3RIU C;  2FJD A;  2J47 A;  2V1D B;  2OLT A;  1XDO A;  3O1H A;  5LGT B;  2XUE A;  4X20 E;  3ZCJ A;  3N9P A;  1LVK A;  2E8I A;  1IBM T;  2V7L A;  3H3M A;  3RHW A;  5JR9 B;  2K48 A;  5FXZ A;  3GN5 B;  4N78 D;  3UUL A;  2XZE A;  4IE7 A;  4ASK A;  5EK2 A;  2YIN A;  5HWY A;  3Q5W A;  3AA1 B;  2VUR A;  5JDQ A;  1HR0 T;  2LLY A;  3RKO A;  3T8O A;  5AQU B;  2DHR A;  3RGL A;  4CI1 B;  2RP4 A;  4IDP A;  5HAX A;  3RYH E;  1CHU A;  2WBL A;  1YQ3 A;  2DI4 A;  3ETU A;  3S4U A;  2C5J A;  4F8H A;  4QH5 A;  2NTX A;  4P09 A;  2PG8 A;  3F57 A;  2CXD A;  2F4V T;  2LM9 A;  4IRE A;  4DUY T;  2WAU A;  1BR4 A;  2L3L A;  5JQG E;  1VCT A;  4O4I E;  2DL1 A;  1W09 A;  3PUY F;  5JR9 A;  5L3G B;  3GN5 A;  4GOU A;  4DV1 T;  3AEG A;  4DR2 T;  4TNV A;  4HWH A;  3P4R A;  2WMO A;  2HPJ A;  4P1N A;  3MZK B;  2I59 A;  3FZK B;  4DR4 T;  1UK5 A;  3WI3 A;  2XQY A;  3CIR A;  3ZMV B;  4DR3 T;  2MBG A;  3L39 A;  4H9Q C;  1S94 A;  3CX7 B;  5FL0 A;  4Z90 A;  1S35 A;  5J0Z A;  4EED A;  4YHH T;  4O4J E;  3AVS A;  2EHO A;  1N33 T;  2MOZ A;  3H37 A;  2D2S A;  4PAG A;  2G0U A;  1OED C;  4QXH B;  2UUC T;  2Y6X A;  2WS3 A;  4B6X A;  2X9H A;  3WAJ A;  4HWC A;  5L47 A;  2XQA A;  3PUA A;  2JJ9 A;  4UEL A;  3K3O A;  2VQE T;  3VU7 H;  4A97 A;  5FY7 A;  2X51 A;  2MTQ A;  1T98 A;  4M1P A;  3J9X 1;  4ILU A;  2HN1 A;  3SRZ A;  2YU1 A;  2V7M A;  2LHN A;  4PK6 A;  2VL8 A;  3RH3 A;  3KV9 A;  3TLW A;  3VHL A;  3RIF A;  1FIO A;  2XQ3 A;  1SUM B;  5BR8 T;  4IDO A;  2XM2 A;  2H88 A;  3LSV A;  4TWH A;  1FJG T;  5HEO A;  3HKC E;  4U7I A;  2JRK A;  3HI2 A;  4U31 A;  2V7J A;  3KFW X;  3L3P A;  5DQW A;  1ZKE A;  5AQR B;  3NBX X;  4OX9 T;  3IBP A;  3ZN0 B;  4EOZ B;  5LG4 A;  3ZYM A;  5LHH B;  5JRC B;  3UU3 A;  4AQF C;  3AE4 A;  3NZQ A;  2PJQ A;  4DV0 T;  2PFV A;  5LHI B;  3LJC A;  5KMG P;  2LOP A;  4L0R A;  2A9U A;  2KWI B;  4GKJ T;  2FUP A;  4U7Y A;  4KX6 A;  4JI5 T;  2VKD A;  1KF6 A;  2V6Y A;  4FJO A;  3EVY A;  4EYY R;  3N9L A;  1GQE A;  4WBO A;  1QLB A;  2WM9 A;  3PJA J;  2X67 A;  4EZH A;  3AAI A;  2J4G A;  3UQ4 A;  3PTR B;  5FMN A;  3ZYL A;  2FJA A;  3IHR A;  2NOX A;  2Q9Q A;  2WZI A;  4IDZ A;  5L2L A;  1MIV A;  5JVD E;  5A1L A;  2YOE A;  4XAX B;  1XMO T;  5JDG A;  4JEU B;  4LMK A;  1UX5 A;  1R8I A;  4DV5 T;  4ILA A;  3NKZ A;  1NEK A;  1O3X A;  3PU3 A;  3P4S A;  1FMW A;  5FP3 A;  2WMN A;  1Z8U A;  1E1H B;  2BG9 A;  5FVK A;  4H9O C;  3SFE A;  4ERR A;  5FL1 A;  3C98 B;  3UFE A;  4JI3 T;  3JAD A;  5JRE A;  4YFS A;  4IT4 A;  4C91 A;  3N2G E;  2RA1 A;  2W61 A;  2BS3 A;  4KHP T;  3AAA B;  3D0T A;  3UU5 A;  2WWV A;  4AIS A;  2QYW A;  3I9W A;  5IYZ E;  5L4E A;  5CA0 E;  5DJQ C;  3CK6 A;  3SWH A;  2EHO C;  4UIG A;  3ZN1 B;  1UUR A;  2V6X A;  1XNR T;  4C90 A;  5HXE A;  2M6B A;  4TN7 B;  3NRY A;  4IE0 A;  2M6I A;  4CI3 B;  2XQ8 A;  4J2C A;  4CXW A;  2VB6 A;  3ZJ1 A;  4CQI A;  1NEN A;  5AFU L;  4TV8 E;  3OPC A;  1KNZ A;  3HR0 A;  5JTG A;  2KND A;  1WFD A;  5AQG B;  2LRK A;  1U5P A;  5HCJ A;  3PUV F;  3A7M A;  3ZST A;  3SOL A;  5AQL B;  3RI5 A;  3PV0 F;  3C51 A;  1JNR A;  3AE1 A;  2CXF A;  2QRX A;  2CM0 A;  5HYA A;  2CCQ A;  4AIU A;  4YTN A;  3VR9 A;  4DV2 T;  3B57 A;  1VRB A;  2UXB T;  1EZ3 A;  5ABE A;  2OV9 A;  1T72 A;  1X79 A;  2CRB A;  3C50 A;  2AE9 A;  4KUM B;  5C3J A;  4HWD A;  3U78 A;  3UTK A;  2ODU A;  2C0S A;  2VKO A;  1AJ3 A;  1MMD A;  3HKD E;  5IWA T;  3AE7 A;  5ABF A;  2CMR A;  4XZC A;  3AED A;  3IF8 B;  5AQV B;  3NWI A;  1MMN A;  3V5U A;  5JDF A;  2CLY C;  5LCY A;  4COF A;  4DR5 T;  5AQQ B;  3EUH A;  3UU6 A;  4MBQ A;  3SS1 A;  4TX5 A;  2HPL A;  2D5U A;  3CQX C;  3KV6 A;  4NUV A;  4QH1 A;  2CA5 A;  4G63 A;  5LXT E;  4CXX A;  1KEY A;  4PJM A;  4XBF B;  2QGS A;  3B5M A;  2JQK A;  3UUB A;  4YTP A;  4UEM A;  5AQH B;  2IW5 B;  1UUS A;  1HCI A;  4PFP A;  2Q9Q C;  5FY0 A;  4ZZC A;  4X1K E;  4U2Y A;  2JQH A;  3AEB A;  1Y64 B;  2XAG B;  4DID B;  5CA1 E;  2JIW A;  3BQI A;  4O2B E;  4HEA A;  1SHZ C;  4I55 E;  3F2E A;  4JYA T;  2CHN A;  5DQV A;  4L9I A;  4Q25 A;  2X9Y A;  3TLT A;  2P9B A;  2YEV C;  4LF8 T;  4ZHQ E;  1J5E T;  2BG9 C;  2JMK A;  3FXE B;  4X1I E;  1HNZ T;  2GK9 A;  4KI0 F;  4PJJ A;  3NRX A;  2BKN A;  4LF5 T;  3T1H T;  3P4W A;  4A98 A;  1OED E;  3UUN A;  4YHJ A;  2BVL A;  3AE3 A;  2IDO B;  2LRL A;  4AXP A;  2YU2 A;  4DV4 T;  2XSB A;  2KSR A;  2WDV A;  1KFY A;  2VVS A;  4IGU A;  4JI1 T;  3DP7 A;  4PK5 A;  4I43 B;  4EYU A;  1N32 T;  4DMV A;  3QK6 A;  4JI7 T;  3LBX A;  2C5I T;  2X68 A;  3QNU A;  2H89 A;  4EB6 E;  3UUM A;  2VAS A;  4YTM A;  2VKJ A;  5ETW A;  2FJB A;  4HKA A;  4U74 A;  1G73 A;  4PFO A;  4DR7 T;  2PTF A;  2LSG A;  2L9Q A;  4QXC B;  1LVF A;  3QOF A;  2WQY A;  4OYJ A;  3GA8 A;  3FBZ A;  3UFG A;  4ZS3 A;  3OTO T;  1ZP0 A;  4PNI A;  3VRB A;  2BBJ A;  4A5X A;  5L3B B;  2ACZ A;  3CKD A;  5C2T A;  5LMU T;  5LA6 E;  2ZM8 A;  3LK3 B;  4KMC A;  5LOV E;  3TLU A;  2LT3 A;  2WCA A;  3JCF A;  2DCF A;  4E7Z A;  2B1E A;  4B3S T;  3AXJ B;  2XQ7 A;  1BR2 A;  2WDR A;  2CE7 A;  3RRW A;  4JI4 T;  3Q2M A;  5CFB A;  3HKE E;  5LJM A;  4AKG A;  2WP9 A;  4AKL A;  1XNQ T;  2A2F X;  2E9X B;  4TV9 E;  3CQG B;  3EI0 A;  5LMN T;  3CX8 B;  4IE6 A;  4P0B A;  5HEH A;  4JUY A;  3QB5 A;  4HFH A;  2N2N A;  4IL4 A;  5LB7 B;  2HH7 A;  3ZT6 A;  4ZOL E;  4DND A;  1D1A A;  4HFB A;  1YW0 A;  2LM2 A;  3B13 A;  4TWD A;  5EK4 A;  5LNK A;  2WZH A;  3ONX A;  4GYS A;  2K9A A;  3W15 B;  5AQJ B;  4QX7 B;  2M67 A;  3ZC0 A;  3WAK A;  4I50 E;  5J2T E;  3P7I A;  1UX4 A;  1UGO A;  3VRA A;  2IC9 A;  2SPC A;  2CWY A;  4UXN B;  4CN4 A;  4JEH B;  2NP9 A;  1UCU A;  1SE7 A;  4B3R T;  3UT5 E;  5JDL A;  3LDQ B;  3UU8 A;  4MFR A;  3MJX A;  3PUG A;  1JNZ A;  2RPA A;  3JAF A;  3ZMZ B;  3L8R A;  3AEF A;  5KX5 E;  2A72 A;  2WY2 A;  3PUQ A;  3O4X E;  4YJ3 E;  2XHE B;  5JH7 E;  1YD8 G;  3AEC A;  4ZI3 D;  3VKG A;  3P50 A;  3RYI E;  1J5W A;  4TWF A;  2XQ9 A;  3OYZ A;  3FZM B;  2V26 A;  2CEA A;  2X0H A;  2E9X D;  5L4H A;  1WRD A;  2L8K A;  3N9M A;  2E2A A;  2IC6 A;  3E08 A;  5LHG B;  2XSA A;  3IA3 A;  4JV5 T;  1IBK T;  2KXP B;  4KHZ F;  4AI6 A;  2KLQ A;  3KIN B;  2BZB A;  4WZX A;  2D0T A;  1X9B A;  3F31 A;  1D0X A;  3JC6 D;  1W0B A;  3ABV A;  1NWM X;  1XWM A;  5HXS A;  4WNK A;  2N1G A;  1Y01 A;  2VKH A;  1J1J A;  4X1Y E;  3RQW A;  4BJM A;  4YT0 A;  5KDM C;  3ZKR A;  4UF0 B;  3I0Q A;  5C8Y E;  3PU8 A;  2UU9 T;  4O4L E;  3R84 B;  4GK5 E;  2BKO A;  3M65 A;  1MND A;  2IML A;  4QX8 B;  5AQO B;  4KBM B;  2HHH T;  4DVD A;  1L0V A;  5JR9 C;  1V9D A;  3BQK A;  1HG2 A;  5ABH A;  4CXY A;  2IIU A;  4YSY A;  2W63 A;  2XQ5 A;  4K0K T;  5ADX L;  3Q5D A;  4LF7 T;  2LSJ A;  4X65 T;  2LOS A;  4JI2 T;  1QSD A;  5JRC A;  4X64 T;  5FKY A;  2XQ6 A;  2W4X A;  2XJ7 A;  2ZM0 A;  2XQ4 A;  4P0A A;  2WWU A;  3ZSS A;  4LMJ A;  2XAH B;  5EZY E;  3TKL B;  4H63 H;  4DUZ T;  4NXM T;  2NTY A;  1HNX T;  3ETV A;  4DV7 T;  5L3C B;  2CBJ A;  4GYR A;  2XM1 A;  1WR6 A;  2VVN A;  4Z91 A;  4QWN B;  1IAP A;  2MAW A;  2WU2 A;  5HXR A;  5CGM A;  4CI2 B;  1SA0 E;  4K0U A;  3O1J A;  3X1D A;  1YQ4 A;  5AQF B;  2XY8 B;  3ZJ2 A;  3KV4 A;  2BKP A;  3H3A A;  3C4W A;  4AQG A;  1DU2 A;  5KXJ A;  5CB4 E;  4PW8 A;  1HS7 A;  5HXH A;  2W67 A;  2KMF A;  4H9P C;  4H9N C;  2JPF A;  4UVC B;  2VL0 A;  3PUS A;  2LSK A;  2K24 A;  4L5G A;  3AA0 B;  4FI5 A;  4U33 A;  4TNW A;  2CHO A;  2XAQ B;  5M4Y A;  4I0U A;  2YKS A;  4ILB A;  3CQC B;  1KNP A;  2KZ7 B;  2D9D A;  3RKG A;  5F8P A;  5FYM A;  1FMV A;  2W0G A;  4X62 T;  4X5T A;  3I1A A;  4ILC A;  5CJ5 A;  1OED B;  3FZH B;  3EAB A;  4EGW A;  4AKR B;  4X66 T;  3BQL A;  5J1G A;  5FNV E;  3UUX B;  3E22 E;  2IAK A;  4QH4 A;  4IST A;  1W9R A;  4JI8 T;  4AKI A;  4ADZ A;  3O9X A;  2WDQ A;  4TZ4 C;  2XAJ B;  2X9X A;  1ZEE A;  3MA9 A;  5HEG A;  5L3E B;  1MIW A;  3LG7 A;  3ZCI A;  2WB5 A;  3ZEF B;  4IE4 A;  1D1B A;  2NW8 A;  3RIA A;  2R6G F;  1I94 T;  4ISS A;  2W2U A;  1E7P A;  4YY3 T;  3AE2 A;  5AQN B;  3UU4 A;  4EXT A;  4ZXL A;  3HA4 A;  3P8C D;  4ZI2 C;  2WU5 A;  2E5V A;  4BA9 A;  1HF8 A;  3RF1 A;  1HFA A;  1OXZ A;  1US7 B;  2NWB A;  4DMW A;  3AA6 B;  1HX1 B;  4IDQ A;  1WCR A;  5LBQ B;  3N2K E;  3CML A;  3FZL B;  2XTL A;  2X0Y A;  5LJN A;  2CPT A;  1MMG A;  5FXV A;  3MAC A;  3DTO A;  2NW7 A;  1OED A;  2NR4 A;  3QB5 K;  4IL9 A;  4OHF A;  3OYX A;  1B7T A;  2KIN B;  4DR6 T;  3VKH A;  4IIJ E;  1ZOY A;  3ZLI A;  4OK0 A;  4PJN A;  4YSZ A;  2DWK A;  4I4T E;  4LFA T;  2VWA A;  1MNE A;  4H9S E;  4WW0 A;  3EHZ A;  5AQS B;  2H3R A;  5FXX A;  1H7C A;  2UXD T;  4LML A;  4EV6 A;  5JDM A;  3P4Q A;  4DO0 A;  3RX6 A;  4HFC A;  5AQI B;  2ZM2 A;  2YDS A;  1LRZ A;  3AE6 A;  2H7V C;  4OFZ A;  2ZM6 T;  4YXD A;  1M7K A;  3ZC1 A;  3KBT A;  2W66 A;  2IUB A;  3RQU A;  2LEH A;  3ZMS B;  4G2A A;  3K8P C;  2NW9 A;  1M62 A;  5AQK B;  2DWG A;  2LKG A;  4GK0 E;  2ES0 A;  3OJA A;  5FVL A;  3LK2 B;  2PBI A;  2KT9 A;  2Y48 B;  3KDS E;  2E5L T;  3TLS A;  3N9Q A;  2A3D A;  3OVU A;  4AQF A;  4LF9 T;  5J2U E;  3VR8 A;  2CXL A;  2UXC T;  1U4Q A;  5LGN B;  2K3W A;  3Q5X A;  3EDU A;  3A8Y C;  4BJN A;  4MHC A;  4O2A E;  3E0Z A;  4LFB T;  1FEW A;  3I0O A;  3PUW F;  2EHO B;  3AAE B;  2V5D A;  4CN1 A;  5F5W A;  4CN6 A;  5F3J A;  1XZY A;  4NXN T;  3MKD A;  3R6N A;  2V7I A;  4GIW A;  3NZP A;  4KP3 C;  4V1A v;  2XAF B;  3MK7 C;  3AEA A;  3ZT5 A;  1YKH B;  2LSY A;  2X0L B;  3RC3 A;  3C64 A;  5H6Q B;  5L3F B;  5HEU A;  2ACX A;  2QA7 A;  5LGU B;  4H9R C;  3RYF E;  2CBI A;  1VCS A;  4YLH A;  3MXZ A;  1QUU A;  3CX6 B;  4ANJ A;  3RYC E;  4E7S A;  2LE8 A;  3AEE A;  1OWA A;  5HWX A;  1MIY A;  3ONL C;  3EDV A;  4ZI7 E;  2BS2 A;  5EK3 A;  1WR0 A;  1HX8 A;  2MYS A;  2UXX B;  4IE5 A;  5GON E;  2N9D A;  1LKX A;  4LF4 T;  4UVA B;  4HFI A;  2KWH A;  3KV5 A;  1D0Y A;  2K5B B;  4MLK A;  3PUX F;  2LSI A;  2Y8D A;  4WYV A;  2CLY B;  5LP6 E;  2FBW A;  1YKE B;  3N9O A;  2I0M A;  3ZT7 A;  5LG3 A;  3OBV E;  2V6Y B;  4HTE A;  3PUR A;  3SFD A;  2EHO D;  3JAE A;  2XPK A;  3AXJ A;  5LBM A;  4WBN E;  2J62 A;  3N2O A;  4HN9 A;  3PUZ F;  3FBL A;  1G8X A;  4PK4 A;  1HNW T;  3AE5 A;  2Q9Q B;  4F6R C;  2E9X A;  1WYB A;  3L09 A;  1HTJ F;  2MPK A;  4AQY T;  2YK0 A;  5ABG A;  3ZMU B;  4H63 V;  4EIW A;  3AE9 A;  4ZEY A;  2YDQ A;  2H7O A;  3M3Z B;  4HGA A;  4IHJ E;  4OYK A;  3Q9D A;  3HL6 A;  2BG9 B;  1ZHC A;  3ESL A;  2UUB T;  5FY1 A;  3FB2 A;  3CVR A;  5AQT B;  3ANW B;  1KK7 A;  2X66 A;  4EAH A;  3DJB A;  4Z8X A;  4HFE A;  5IUX A;  3RPU A;  4B3T T;  3AA7 B;  2JMH A;  1YXR A;  2W62 A;  4QXB B;  5AQP B;  2ZMA A;  4A56 A;  3K3N A;  3AVR A;  2ZLY A;  2W00 A;  3FHN A;  4UV9 B;  3FZF B;  2VK9 A;  3K1S A;  2BVM A;  5AQM B;  4YSX A;  4UR9 A;  2LKH A;  4DBR A;  2DLR A;  2V5C A;  3N5L A; 
#chains in the Genus database with same CATH homology
 2X68 A;  4QXH B;  1WLX A;  2Y6X A;  3BK9 A;  4QKN A;  2IAK A;  4IST A;  4EB6 E;  3UUM A;  1MMA A;  4B6X A;  2X9H A;  3WAJ A;  4ADZ A;  4AKI A;  3PUA A;  2JJ9 A;  4UEL A;  1HG5 A;  3K3O A;  3O9X A;  3VU7 H;  2VAS A;  4TZ4 C;  2X9W A;  2XAJ B;  1VOM A;  2X9X A;  4UVB B;  1ZEE A;  3MA9 A;  5FY7 A;  2X51 A;  5L3E B;  2VKJ A;  4MAL A;  2MTQ A;  1T98 A;  4M1P A;  5ETW A;  3J9X 1;  4ILU A;  4HKA A;  4U74 A;  3SRZ A;  2YU1 A;  1MIW A;  2LHN A;  2Q9Q D;  2V7M A;  2VL8 A;  3LG7 A;  4PK6 A;  3ZCI A;  4ZI2 D;  1G73 A;  3A5X A;  4PFO A;  4BAY B;  3RH3 A;  3ZEF B;  3KV9 A;  2LSG A;  4IE4 A;  1D1B A;  2NW8 A;  2LJL A;  3VHL A;  1ZV4 X;  3U3I A;  3AB3 B;  2L9Q A;  4QXC B;  3ANW A;  1FIO A;  1LVF A;  4ISS A;  2BDE A;  4OYJ A;  3GA8 A;  3FBZ A;  4ZS3 A;  4JLE A;  5DAB A;  4EXT A;  4PNI A;  3HA4 A;  3I9Y A;  3P8C D;  4ZI2 C;  5L3B B;  3HKC E;  3K3Q C;  4BA9 A;  1BR1 A;  1HF8 A;  2JRK A;  3CKD A;  3HI2 A;  1HFA A;  1OXZ A;  5LA6 E;  1US7 B;  2ZM8 A;  1WYC A;  2NWB A;  5H6R B;  2V7J A;  3KFW X;  3LK3 B;  4KMC A;  4DMW A;  3L3P A;  5DQW A;  4HE8 A;  1ZKE A;  3FXD B;  5LOV E;  3AA6 B;  2LT3 A;  2DNX A;  3NBX X;  3IBP A;  4O4H E;  5LBQ B;  3ZN0 B;  4EOZ B;  5LG4 A;  3N2K E;  3CML A;  3ZYM A;  2XTL A;  3V5S A;  4UF0 A;  5LJN A;  1MMG A;  5FXV A;  3MAC A;  3DTO A;  2DCF A;  2NW7 A;  5LHH B;  4E7Z A;  5JRC B;  2B1E A;  5JDH A;  4TUY E;  4OHF A;  4AQF C;  3OYX A;  1B7T A;  2KIN B;  3NZQ A;  1BR2 A;  4IIJ E;  3ZLI A;  2PJQ A;  4OK0 A;  3VKH A;  4PJN A;  3LFM A;  2DWK A;  2PFV A;  1Z0P A;  4HFV A;  5LHI B;  3LJC A;  3LK4 2;  4I4T E;  2VWA A;  3QC9 A;  2CE7 A;  5KMG P;  1MNE A;  3RRW A;  5HXC A;  3Q2M A;  4H9S E;  2LOP A;  4WW0 A;  4O8S A;  4L0R A;  3HKE E;  2KWI B;  4UV8 B;  2H3R A;  5LJM A;  4AKG A;  4ZI3 C;  3QUJ A;  1H7C A;  5FXX A;  4AKL A;  2A2F X;  2E9X B;  4TV9 E;  2UXN B;  2VKD A;  3CQG B;  5JDM A;  4FJO A;  3CX8 B;  4U72 A;  3EVY A;  4IE6 A;  3KVA A;  3RX6 A;  4DO0 A;  4EYY R;  3ZPO A;  4P0B A;  3N9L A;  2ZM2 A;  2V7K A;  4JUY A;  4WBO A;  1LRZ A;  2WM9 A;  2N2N A;  2E9X C;  2X67 A;  3PE0 A;  4EZH A;  3OKQ A;  3AAI A;  2WSS V;  2H7V C;  2HH7 A;  5LYJ E;  3ZYK A;  4OFZ A;  3PTR B;  5FMN A;  3ZYL A;  4ZOL E;  4DND A;  5IHY A;  1D1A A;  3ZC1 A;  3IHR A;  2NOX A;  2XAS B;  3KBT A;  2Q9Q A;  1YW0 A;  4IDZ A;  5L2L A;  4AKH A;  1MIV A;  3B13 A;  2LEH A;  3ZMS B;  3J7Y q;  5EK4 A;  5JVD E;  4G2A A;  3K8P C;  5A1L A;  2NW9 A;  5LNK A;  4XAX B;  5E0O A;  3ONX A;  4GYS A;  2K9A A;  4JEU B;  5JDG A;  1UX5 A;  4DBQ A;  2DWG A;  3W15 B;  4GK0 E;  2ES0 A;  4QX7 B;  3OJA A;  2M67 A;  5FXW A;  3LK2 B;  2PBI A;  3JC6 C;  3ZC0 A;  2KT9 A;  3WAK A;  4EZ4 A;  2Y48 B;  4I50 E;  5BMV E;  1O3X A;  5J2T E;  3PU3 A;  4ZS2 A;  3KDS E;  1UX4 A;  3P7I A;  4CZZ B;  4NUU A;  2ODV A;  2IC9 A;  1FMW A;  3N9Q A;  5FP3 A;  2WMN A;  2A3D A;  1NAF A;  1E1H B;  1CUN A;  2SPC A;  4AQF A;  4H9O C;  2CWY A;  4UXN B;  4ERR A;  3C98 B;  5J2U E;  1IJ6 A;  4PJL A;  3UFE A;  4JEH B;  5JRE A;  2CXL A;  4YFS A;  2NP9 A;  1UCU A;  5TAO A;  4C91 A;  1U4Q A;  3C4X A;  5LGN B;  2J1D G;  3N2G E;  3UT5 E;  5JDL A;  2RA1 A;  2W61 A;  3Q5X A;  3KVB A;  4MFR A;  3EDU A;  3MJX A;  4BJN A;  4MHC A;  3PUG A;  3AAA B;  4O2A E;  3D0T A;  3E0Z A;  1FEW A;  3IEE A;  3I0O A;  2EHO B;  3ZMZ B;  3AAE B;  2LHR A;  3I9W A;  5IYZ E;  5KX5 E;  2A72 A;  3ZMT B;  5F3J A;  5CA0 E;  3PUQ A;  2C5K T;  3KBU A;  3O4X E;  3C4Z A;  4YJ3 E;  3LBX B;  2XHE B;  5JDN A;  3MKD A;  5DJQ C;  5JH7 E;  3R6N A;  2V7I A;  1YD8 G;  3SWH A;  2CWO A;  2EHO C;  4GIW A;  4UIG A;  3ZN1 B;  3NZP A;  1D1C A;  4KP3 C;  3PDY A;  4V1A v;  3N9N A;  3HKB E;  4ZI3 D;  4C90 A;  2XAF B;  3MK7 C;  5HXE A;  4TN7 B;  3VKG A;  3NRY A;  1YKH B;  3GWH A;  4IE0 A;  3RYI E;  4CI3 B;  2LSY A;  3OYZ A;  2X0L B;  5L3D B;  3RC3 A;  4J2C A;  3C64 A;  1IJ5 A;  2V26 A;  4CXW A;  2CEA A;  2OA5 A;  5H6Q B;  5L3F B;  1BR0 A;  2ACX A;  2VB6 A;  3ZJ1 A;  2E9X D;  4CQI A;  2QA7 A;  5AFU L;  4TV8 E;  1WRD A;  2L8K A;  3N9M A;  5LGU B;  2IC6 A;  3E08 A;  4H9R C;  3HR0 A;  5LHG B;  1KNZ A;  3CPZ A;  3RYF E;  2Z6E A;  2KND A;  3O1I A;  2JQQ A;  1D0Z A;  2KXP B;  1U5P A;  3GMI A;  3CWZ B;  3MXZ A;  4YLH A;  4AI6 A;  1IZN B;  1QUU A;  3CX6 B;  2KLQ A;  3RRC A;  3KIN B;  3SOL A;  4YJ2 E;  2D0U A;  2BZB A;  4ANJ A;  3RYC E;  3RC8 A;  4QHO A;  2D0T A;  3F31 A;  1D0X A;  4E7S A;  3JC6 D;  2LE8 A;  3C51 A;  2V1D B;  2CXF A;  1NWM X;  3O1H A;  5LGT B;  1OWA A;  5HWX A;  1MIY A;  2CM0 A;  5HYA A;  5HXS A;  2CCQ A;  4WNK A;  2N1G A;  3EDV A;  2XUE A;  2VKH A;  4X20 E;  4X1Y E;  3ZCJ A;  4ZI7 E;  3N9P A;  1LVK A;  3B57 A;  1VRB A;  2E8I A;  2UXX B;  1HX8 A;  2MYS A;  4IE5 A;  1EZ3 A;  5EK3 A;  4UF0 B;  4BJM A;  3I0Q A;  5KDM C;  5GON E;  5C8Y E;  1X79 A;  2V7L A;  3PU8 A;  2N9D A;  1LKX A;  5JR9 B;  4O4L E;  3C50 A;  4UVA B;  4KUM B;  2K48 A;  5FXZ A;  3R84 B;  3GN5 B;  4GK5 E;  2KWH A;  4N78 D;  3U78 A;  3UUL A;  3KV5 A;  1D0Y A;  3UTK A;  4IE7 A;  3M65 A;  4ASK A;  2ODU A;  5EK2 A;  2C0S A;  1MND A;  2K5B B;  2VKO A;  2YIN A;  4MLK A;  2LSI A;  1MMD A;  4QX8 B;  1AJ3 A;  2Y8D A;  5HWY A;  2CLY B;  4KBM B;  4DVD A;  3HKD E;  3Q5W A;  3AA1 B;  5JR9 C;  2CMR A;  5LP6 E;  1YKE B;  1V9D A;  4XZC A;  3BQK A;  1HG2 A;  3N9O A;  5JDQ A;  3IF8 B;  4CXY A;  3OBV E;  2W63 A;  5ADX L;  1MMN A;  3V5U A;  5JDF A;  4HTE A;  2LSJ A;  3PUR A;  3RKO A;  3T8O A;  2CLY C;  5LCY A;  2LOS A;  2EHO D;  3EUH A;  1QSD A;  5JRC A;  2DHR A;  4MBQ A;  3SS1 A;  4TX5 A;  2HPL A;  5LBM A;  4CI1 B;  2RP4 A;  5HAX A;  3RYH E;  2D5U A;  3CQX C;  2WBL A;  3KV6 A;  4WBN E;  4NUV A;  3N2O A;  2ZM0 A;  4HN9 A;  4P0A A;  2CA5 A;  2WWU A;  4G63 A;  3FBL A;  1G8X A;  2XAH B;  4PK4 A;  5EZY E;  4H63 H;  3TKL B;  2Q9Q B;  2NTY A;  2DI4 A;  3ETU A;  5LXT E;  4CXX A;  4F6R C;  3ETV A;  4PJM A;  4XBF B;  2QGS A;  2E9X A;  5L3C B;  1WYB A;  3L09 A;  4GYR A;  4UEM A;  1WR6 A;  2IW5 B;  3S4U A;  4QWN B;  2C5J A;  1HCI A;  1HTJ F;  4PFP A;  2Q9Q C;  5FY0 A;  2YK0 A;  1IAP A;  4X1K E;  3ZMU B;  4H63 V;  5HXR A;  4EIW A;  2NTX A;  4P09 A;  4CI2 B;  1SA0 E;  2PG8 A;  1Y64 B;  3F57 A;  4K0U A;  2CXD A;  3O1J A;  2XAG B;  2LM9 A;  5CA1 E;  2H7O A;  3BQI A;  3ZJ2 A;  4HGA A;  4O2B E;  4IHJ E;  4OYK A;  4HEA A;  1SHZ C;  4I55 E;  3KV4 A;  3Q9D A;  3HL6 A;  3F2E A;  2WAU A;  1BR4 A;  5DQV A;  1ZHC A;  3ESL A;  2L3L A;  4L9I A;  5FY1 A;  3FB2 A;  3H3A A;  3C4W A;  3CVR A;  4AQG A;  5CB4 E;  5JQG E;  4O4I E;  2X9Y A;  4PW8 A;  3ANW B;  1HS7 A;  2P9B A;  1KK7 A;  2X66 A;  4EAH A;  3DJB A;  2YEV C;  5HXH A;  4ZHQ E;  5JR9 A;  5L3G B;  2KMF A;  2JMK A;  4H9N C;  4H9P C;  3GN5 A;  4Z8X A;  2JPF A;  4GOU A;  3FXE B;  4UVC B;  4X1I E;  2GK9 A;  4PJJ A;  2WMO A;  3RPU A;  3AA7 B;  3NRX A;  2HPJ A;  2JMH A;  3PUS A;  2LSK A;  2K24 A;  4L5G A;  3AA0 B;  2W62 A;  4FI5 A;  4QXB B;  2ZMA A;  4A56 A;  3K3N A;  3AVR A;  2ZLY A;  2W00 A;  2XAQ B;  3FHN A;  3MZK B;  5M4Y A;  3CQC B;  3UUN A;  2I59 A;  4YHJ A;  3WI3 A;  4UV9 B;  2KZ7 B;  2VK9 A;  2XQY A;  2BVL A;  3ZMV B;  5F8P A;  5FYM A;  2MBG A;  2BVM A;  1FMV A;  4H9Q C;  2W0G A;  4AXP A;  2YU2 A;  1S94 A;  3CX7 B;  3I1A A;  1S35 A;  4IGU A;  4O4J E;  3AVS A;  3DP7 A;  2EHO A;  4AKR B;  4PK5 A;  2MOZ A;  3H37 A;  3BQL A;  2D2S A;  2DLR A;  4I43 B;  4DBR A;  5J1G A;  4EYU A;  4DMV A;  3QK6 A;  5FNV E;  3N5L A;  4PAG A;  2G0U A;  3LBX A;  3UUX B;  3E22 E;  2C5I T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...