3UUNA

Crystal structure of n-terminal first spectrin repeat of dystrophin
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
116
structure length
116
Chain Sequence
EVNLDRYQTALEEVLSWLLSAEDTLQAQGEISNDVEVVKDQFHTHEGYMMDLTAHQGRVGNILQLGSKLIGTGKLSEDEETEVQEQMNLLNSRWECLRVASMEKQSNLHRVLMDLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structures of dystrophin and utrophin spectrin repeats: implications for domain boundaries
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Dystrophin
total genus 52
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3uunA00
1CUNA 2SPCA 3F31A 2ODUA 1S35A 3UUNA 1U5PA 3LBXB 1OWAA 2ODVA 3UULA 1AJ3A 3PE0A 1QUUA 3UUMA 3FB2A 1HCIA 3LBXA 3EDVA 1U4QA 1WLXA
chains in the Genus database with same CATH superfamily
5LGNB 4AQYT 4DVDA 4TWFA 5KXJA 4AIUA 3KINB 5FXZA 4QWNB 3NWIA 2XM2A 3BQIA 3MA9A 4YSYA 1D1AA 5LJNA 4QH1A 4UF0A 1WRDA 4X1KE 3AE5A 4OFZA 3UUNA 4YLHA 4ANJA 3VKHA 4JLEA 3AXJA 5HYAA 3KV6A 1XWMA 3QC9A 4PFPA 3LBXB 1FMWA 2J47A 4X66T 4TV8E 2JMKA 4J2CA 2H89A 3U78A 4AKGA 1YD8G 5F8PA 2KNDA 2WB5A 4JI0T 4G63A 4GYRA 3RRWA 4DV2T 3TKLB 2JMHA 3RI5A 2X51A 2Y48B 4IIJE 4I0UA 4TWDA 2WMOA 2XQYA 2UUCT 2X9WA 3UUMA 4DIDB 4PK4A 3PUVF 5LGUB 4X65T 3I0OA 2JJ9A 4CI3B 3NRXA 1NAFA 4U2ZA 4H9RC 1Y01A 4NPPA 3QB5K 4ISSA 4WYVA 5AQQB 3HA4A 3C98B 3C4XA 5A1LA 3ZMUB 4JI2T 4DV6T 2C0SA 3SWHA 3P4RA 3EABA 1MMGA 1DU2A 1UCUA 4FI5A 3P8CD 3KVAA 4MBQA 3E22E 1MIVA 3PU8A 5HWXA 5JDGA 5LHIB 1MMAA 4ZOLE 2D9DA 1IJ6A 2B1EA 2DHRA 3J9X1 5FMNA 3ZC0A 3Q5EA 5FKYA 2MBGA 4QH5A 5JDFA 3WAJA 1WYBA 3AECA 4DR1T 3ZCIA 4HWIB 2CE7A 3WAKA 4BJMA 3ESLA 3CQCB 5L2LA 3EUHA 4DV0T 3B57A 3ONJA 3Q9DA 5EK4A 4UV8B 2BG9A 3O1IA 1L0VA 2P9BA 4ILBA 2UXNB 3FB2A 2E9XC 2Q9QB 5CFBA 4JI6T 3DP7A 4ZHQE 2HN2A 1MIYA 2H3RA 3C51A 3ZYKA 5LGTB 1UX5A 4ILUA 3RIFA 2CA5A 4GIWA 1OEDB 5AQOB 4DR4T 1W0AA 5HWYA 2HHHT 3ZC1A 5AQHB 2LSGA 2XZEA 4HFIA 2BVMA 2CWYA 2V6YB 2NTXA 3OJAA 5FVKA 4HN9A 1M7KA 2CCQA 5HXRA 2X9XA 5JR9C 5J0ZA 2KXPB 1YQ4A 1FMVA 3PUYF 4DR6T 4YHHT 4YTPA 3UU5A 2B76A 3AE6A 3M3ZB 5LJMA 2XQ3A 4JI5T 3SOLA 4EZHA 1T7SA 5FVLA 2E2AA 1QSDA 4HWFA 2ZLYA 5JH7E 1UGOA 2LM2A 3EHZA 2JQKA 2X66A 5F5WA 2LJLA 5FXXA 3TLVA 5JDNA 4EEDA 3RF1A 2I6HA 4IT4A 4LMJA 1FJGT 3CX8B 2BS4A 1QUUA 1YW0A 2Y8DA 2PBIA 2WY2A 4X1IE 5HXCA 5LB7B 3M65A 5JDMA 1ZEEA 1HTJF 1HCIA 2CM0A 2VKOA 5AQPB 4LF9T 5ABEA 1XNQT 3LBXA 1XZYA 4HKAA 2CBIA 3TLUA 1OEDA 3K3QC 5ADXL 4DUYT 2DI4A 2C5KT 4QKNA 3GA8A 3F31A 1N36T 5HAXA 1BR0A 3K3OA 2FJEA 2QA7A 3AE9A 3LFMA 3LSVA 4P09A 3AAEB 1SA0E 2Q9QA 4OYKA 4I55E 4OK0A 3UTKA 4BAYB 1J1JA 3JAEA 1BR2A 4IDOA 1E1HB 2ZM6T 3D0TA 3JADA 2WP9A 2Y6XA 5FL1A 1CHUA 1N34T 2X9HA 2JQQA 3NKZA 3OPCA 2DWGA 2ZMAA 5HXSA 3ZMVB 3QK6A 2HN1A 3HKDE 2K48A 2LT3A 1S94A 1VCTA 4E7SA 5L3CB 2VASA 3PUSA 4PAGA 1KF6A 1XMOT 2XAJB 3GWHA 1WR0A 4KX6A 2N2NA 2M6IA 3AAAB 3MZKB 4AQFC 2JQ9A 2V7MA 2E9XB 3UU8A 2XQ6A 2BBHA 3UU6A 2FJAA 3ZJ1A 2WSSV 1U4QA 4DO0A 1X9BA 3TLTA 4JI3T 4CN1A 3R84B 4F8HA 3EI0A 1HFAA 3AA1B 4HFBA 3VR9A 2BBJA 3AE1A 4LFAT 1M62A 2DNXA 2L9QA 4U2YA 1D0YA 4IE4A 3P4WA 2XASB 5HCJA 2CMRA 5IUXA 4HWDA 3JCFA 2YEVC 2BKNA 4IDNA 5ABFB 3AE8A 3QB5A 4HFHA 3OTOT 4KBMB 4TZ4C 3RKOA 5LP6E 2WWVA 4Z91A 4NXNT 2ODVA 3I9WA 1V9DA 4L9IA 2K9AA 4X1YE 3RYIE 5HEHA 4TX5A 2V5CA 1JNZA 2M67A 3QOFA 4MFRA 4CXWA 2H88A 5CA1E 2KZ7B 1XNRT 4UF0B 4QXBB 3S4UA 2XAHB 3N9PA 1IBMT 3LK3B 4YHJA 3RC3A 2J1DG 2MTQA 2XAGB 5FXWA 2V7KA 1KNRA 3AE3A 4IE5A 2KSRA 4HFDA 4DUZT 2YDQA 4DR3T 1QLBA 3MXZA 2BS3A 3AEGA 5IWAT 2W2UA 1E2AA 3V5UA 4JI8T 3OYXA 2MOZA 3AVSA 4I50E 2PFVA 3FZFB 3LG7A 3NZQA 5L4HA 2V26A 2KLQA 3HKCE 2QVAA 5AQJB 2LKGA 4B6XA 3I9YA 4LF7T 1MNDA 1NWMX 2NOXA 1KK7A 3CQGB 3RLFF 3AXJB 2ACXA 3UFEA 5L3FB 3UU4A 2G0UA 4HFEA 4KUMB 1SUMB 5CJ5A 3AEEA 4UVAB 5JVDE 2HPJA 2I0MA 2CRBA 2J4GA 5HEGA 2JRKA 4LMKA 3SRZA 2JQHA 5L47A 2X0HA 4X62T 5LMUT 2W67A 1AJ3A 2FBWA 3RQWA 1VCSA 2VKHA 2CBJA 4WNKA 1WYCA 2IIUA 2XQ9A 2LHRA 4AQFA 3HR0A 2BS2A 5DJQC 1W0BA 4MHCA 2WBLA 2FJBA 2WU2A 4I4TE 4AISA 4DV1T 2X0LB 4ILAA 2LKHA 1D0XA 3OBVE 4UIGA 2HPLA 3C50A 3SS1A 1US7B 3ZPOA 3RQUA 4G2AA 1Y64B 2K3WA 4WW0A 5FP3A 3T8OA 4EV6A 4H9QC 5HCMA 3R6NA 5LHHB 2E9XA 4ZI2D 4CXYA 1Z8UA 1IBLT 5ABHA 4H9OC 3VKGA 2D0UA 2RPAA 2YDRA 5JRCB 4DBQA 1Z0PA 3UUXB 3X1DA 5LOVE 5L3DB 2VKDA 4TWHA 2W00A 2EHOC 4QX7B 4YTMA 4ZS3A 3V5SA 3ZYMA 5JDLA 5AQGB 3FZMB 3VHLA 4ZI2C 4U7YA 4DR2T 2KWHA 1OEDC 2BG9B 2M6BA 3C4WA 5AQUB 4DNDA 3SFEA 4LF6T 3PV0F 5J2TE 4GK0E 3A7MA 2Z6EA 4GKJT 2VWAA 3RYCE 3KVBA 5LBMA 1IAPA 2CPTA 3CMLA 5FY7A 3KFWX 5JR9B 5L3BB 1GQEA 5TAOA 5DQWA 1BR1A 3AEDA 4U72A 2UXXB 4CXXA 3CK6A 5M4YA 1J5ET 2UU9T 3OYZA 3VR8A 3F57A 4L5GA 3DTOA 3KV4A 2C5IT 3EDUA 2CWOA 2YDSA 5H6RB 3ABVA 3VRBA 3A8YC 2OLTA 3JC6C 2XPKA 2GK9A 1LVFA 4TV9E 4EYUA 3IBPA 2WZHA 4JUYA 3TLSA 5HEJA 3AEFA 3RC8A 1UK5A 2YOEA 3I0QA 2ZM0A 2I59A 3KV9A 4JEHB 3EVYA 2XAFB 3P50A 3KV5A 4YJ3E 2LLYA 4H63V 3GN5A 2CXLA 5C3JA 4PJNA 3C4ZA 4P0AA 2DWKA 3N2OA 1G73A 4Z8XA 5FYMA 3H37A 4ILCA 1HX1B 3GN5B 2Q9QC 5AFUL 4ZZBA 3PJAJ 3P4SA 4XBFB 1KEYA 4UELA 1SE7A 3O9XA 4EAHA 1YKEB 2YU2A 2XM1A 4IHJE 3CPZA 3IF8B 3N9NA 3ZMZB 4YXDA 5KDMC 2EHOD 4ERRA 4H9NC 4EEBA 2IC6A 3P4PA 3N2KE 2F4VT 2QRXA 2QYWA 2RP4A 4UXNB 2L8KA 5AQRB 5AQTB 4A56A 4YSZA 5JTGA 2W66A 3CX7B 5LG4A 5J2UE 4PW8A 4Z90A 4HFVA 4JV5T 3ETUA 4ZS2A 5DABA 2BDEA 2NW8A 2V1DB 3N9LA 3PU3A 3BK9A 4TUYE 3AA0B 3W15B 4IL4A 1UURA 4O2AE 4F6RC 4U74A 3RRCA 4AI6A 1R8IA 2WZIA 4LMLA 3MJXA 4PJLA 1IZNB 4YFSA 2E5LT 2ZM2A 1D1BA 3NBXX 4DMVA 2NTYA 2JPFA 3AAIA 4AQGA 2UXCT 2K5BB 2J62A 5LXTE 3N9OA 4B3ST 4IDQA 4A97A 2L3LA 3IEEA 3E0ZA 3FXEB 1UX4A 3CWZB 5C2TA 4HE8A 1VOMA 2LHNA 2ODUA 4H9SE 4TN7B 4V1Av 5HEOA 5FNVE 4WBNE 4YY3T 1UUSA 2WAUA 2XQ7A 4ZI3D 4IREA 3LK42 5DQVA 1EZ3A 2XY8B 3PUZF 4U31A 5FY0A 5LBQB 3PUAA 2XAQB 3J7Yq 4ASKA 1I94T 1OXZA 2NR4A 3FHNA 2AXDS 5C8YE 2N1GA 4KHPT 1D1CA 3LDQB 5EZYE 2UXDT 2YKSA 3SFDA 2KMFA 4EGWA 3PE0A 2WMNA 2YINA 2LRLA 3RHWA 2AE9A 2Q9QD 5IHYA 5LMNT 4PJJA 4LF5T 2D5UA 3ZCJA 3B5MA 2VVSA 5F3JA 2LRKA 2EHOB 2XQ8A 4P0BA 5JREA 3L8RA 2A9UA 2NWBA 4TNVA 3UT5E 4QH4A 2VQFT 3BQKA 2BG9C 2OA5A 4IDZA 4LFBT 4C90A 3U3IA 3AEAA 4H63H 2A2FX 1S35A 2V5DA 4QX8B 2CHOA 4DR5T 3RIAA 4L0RA 4PNIA 2W0GA 5J1GA 3MK7C 1KNZA 2LM9A 4JBWF 2IW5B 3JC6D 2DLRA 2V7JA 4U3CA 2DCFA 3PJAA 4N78D 3ZMTB 2VQET 2X68A 4CI1B 1T72A 3AE2A 2PG8A 3NZPA 4U33A 4X5TA 3ZMSB 4ZI7E 5HXEA 2OV9A 2WU5A 4KP3C 3O4XE 1BR4A 4K0UA 1T98A 2E5VA 2H7OA 3UU3A 3ZYLA 4O4HE 3CIRA 2JIWA 2XHEB 4ZXLA 3ZJ2A 4DMWA 1W9RA 5HEUA 1KFYA 4O8SA 1B7TA 2V6YA 1MNEA 3AA7B 3WI3A 2V7LA 5CA0E 4ZZCA 4DV5T 1IJ5A 1WCRA 1W09A 3C64A 3EDVA 2LOSA 3DJBA 3FZHB 2ZM8A 1YKHB 4M1PA 5AQSB 5BMVE 2XSAA 4U7IA 2K24A 4IE7A 4O4JE 4QXCB 3Q5DA 2CHNA 2FJDA 4O4IE 3RKGA 3ZT6A 1NENA 2XTLA 1X79A 2UUBT 3H3MA 3I1AA 5FY1A 1YQ3A 3N2GE 4TNWA 1MMNA 2IAKA 1LRZA 3AA6B 3BQLA 5GONE 1VRBA 5CB4E 3TLWA 4AKLA 5LNKA 2CEAA 1OWAA 3IHRA 4YTNA 3ONXA 4HTEA 1HNWT 1H7CA 5LG3A 2X67A 2XQAA 3VRAA 3ANWA 4MALA 2CXDA 3VU7H 4UEMA 3PUQA 4H9PC 4HWCA 2E9XD 1KNPA 3FXDB 4IE6A 1WFDA 4NIQA 4AKRB 3UQ4A 4CN6A 2MYSA 4JEUB 2WWUA 2LOPA 2WDVA 1MIWA 3N5LA 3QUJA 4PFOA 2WS3A 3K1SA 5L3EB 4KI0F 3RPUA 3KBUA 5L3GB 3FZLB 4IDPA 3RIUA 5JR9A 3UQ7A 4COFA 4CN4A 4AXPA 5HXHA 5LYJE 3L3PA 4GYSA 4HEAA 1HX8A 3AVRA 3OVUA 2UXBT 5IYZE 5JRCA 4QHOA 2KWIB 1U5PA 1ZKEA 2CLYC 2KINB 4A98A 1LKXA 3PUXF 5FXVA 4C91A 4B3TT 1N32T 2LSIA 3HI2A 4GOUA 4CQIA 2LSKA 1JNRA 3PTRB 4JYAT 3ZSTA 3FZKB 1IBKT 3EAMA 3L39A 3RIUC 4EZ4A 1N33T 5AQFB 2V8SV 1FIOA 1HG2A 4DV4T 4WZXA 3B13A 1HR0T 3ZSSA 2MPKA 2YU1A 4NXMT 4XZCA 4BJNA 1G8XA 3ZT7A 4EOZB 3NVOA 3IA3A 4DV7T 4KHZF 3CX6B 1XDPA 3Q2MA 2SPCA 3CKDA 4UR9A 3MKDA 3LK2B 5CGMA 5KMGP 4AKHA 2X0YA 2YN6A 3CVRA 3Q5WA 5BR8T 2DL1A 3MACA 3ETVA 5ABGA 4DBRA 1ZV4X 3ZN0B 3KDSE 4DV3T 3PUGA 3UUBA 5JDHA 2A3DA 4LF8T 2LSYA 4ZI3C 4PJMA 5L4EA 2PTFA 4KMCA 1ZP0A 5KX5E 3N9QA 4P1NA 3N9MA 1E7PA 1OEDE 3PURA 4IL9A 5EK2A 3QNUA 3Q5XA 2WM9A 4FJOA 2EHOA 3KBTA 3LJCA 2NP9A 3P7IA 4WBOA 3FBLA 4CZZB 3GMIA 2HH7A 5AQVB 2KT9A 4K0KT 2VVNA 3A5XA 5EK3A 4ISTA 3UFGA 4JI1T 2BVLA 2LSJA 3K8PC 1D0ZA 3ZN1B 4CI2B 2FUPA 1MMDA 5AQMB 1CUNA 2C5JA 1ZHCA 5E0OA 4A5XA 1YXRA 4EXTA 4LFCT 3ZT5A 3T1HT 5ETWA 3OKQA 4O2BE 1HNXT 2E8IA 2H7VC 2IUBA 5ABFA 2W62A 1XMQT 2MAWA 3AB3B 4Q25A 2CLYB 3AEBA 2IMLA 4ADZA 3T1YT 3ZKRA 3RYHE 2PJQA 1HF8A 2LEHA 1SHZC 2VK9A 2VL8A 4XAXB 4EYYR 2RA1A 4X64T 4HFCA 2D0TA 3O1JA 4JI7T 4GKKT 2BKOA 4QXHB 5JQGE 3ONLC 5LA6E 4PK6A 4O4LE 2XQ5A 3RH3A 2R6GF 4E7ZA 5LCYA 1ZOYA 2UUAT 3HL6A 3E08A 3RGLA 4AKIA 5AQLB 2V6XA 3PDYA 5AQNB 1FEWA 1HG5A 4HGAA 4HWHA 4OYJA 3F2EA 4IGUA 4UVCB 2XQ4A 3G06A 1XDOA 4IE0A 2X9YA 5FL0A 4OX9T 2BG9E 3JAFA 4JI4T 3AE4A 4EIWA 4DR7T 2VL0A 2BKPA 2VURA 3CQXC 2YK0A 2ES0A 3ANWB 4OHFA 5H6QB 3RX6A 2D2SA 3HKBE 2IDOB 4BA9A 2XSBA 4EB6E 3H3AA 4YSXA 4ZEYA 2WDQA 2IC9A 3K3NA 2QGSA 5JDQA 4B3RT 2VKJA 2ACZA 2W4XA 2XUEA 3O1HA 4LF4T 1T8BA 4X20E 3NRYA 2XJ7A 2A72A 2WQYA 1WR6A 4PK5A 2NW7A 4UVBB 3UULA 4YJ2E 2WCAA 1LVKA 2WDRA 4NUVA 4GK5E 2W61A 3AE7A 3PUWF 3L09A 1J5WA 2NW9A 3ZLIA 5LHGB 4NUUA 2V7IA 1O3XA 2N9DA 1HS7A 1HNZT 4B3MT 4I43B 2W63A 3HKEE 2IHR1 4UV9B 5AQKB 2CXFA 2BZBA 2LE8A 3RYFE 5AQIB 4MLKA 3FBZA 1NEKA 2VB6A 3ZEFB 1I6ZA 3P4QA 4YT0A 1WLXA
chains in the Genus database with same CATH topology
5LGNB 4DVDA 3KINB 5FXZA 4QWNB 3BQIA 3MA9A 1D1AA 5LJNA 4UF0A 1WRDA 4X1KE 4OFZA 3UUNA 3VKHA 4YLHA 4ANJA 4JLEA 5HYAA 3KV6A 3QC9A 4PFPA 3LBXB 1FMWA 4TV8E 2JMKA 4J2CA 3U78A 4AKGA 1YD8G 5F8PA 2KNDA 4G63A 4GYRA 3RRWA 3TKLB 2JMHA 2X51A 2Y48B 4IIJE 2WMOA 2XQYA 2X9WA 3UUMA 4PK4A 5LGUB 3I0OA 2JJ9A 4CI3B 3NRXA 1NAFA 4H9RC 4ISSA 3HA4A 3C98B 3C4XA 5A1LA 3ZMUB 2C0SA 3SWHA 1MMGA 1UCUA 4FI5A 3P8CD 3KVAA 4MBQA 3E22E 1MIVA 3PU8A 5HWXA 5JDGA 5LHIB 1MMAA 4ZOLE 1IJ6A 2B1EA 2DHRA 3J9X1 5FMNA 3ZC0A 2MBGA 5JDFA 3WAJA 1WYBA 3ZCIA 2CE7A 3WAKA 4BJMA 3ESLA 3CQCB 5L2LA 3EUHA 3B57A 3Q9DA 5EK4A 4UV8B 3O1IA 2P9BA 2UXNB 3FB2A 2E9XC 2Q9QB 3DP7A 4ZHQE 3ZYKA 1MIYA 2H3RA 3C51A 5LGTB 1UX5A 4ILUA 2CA5A 4GIWA 5HWYA 3ZC1A 2LSGA 2BVMA 2CWYA 2NTXA 3OJAA 5HXRA 4HN9A 2CCQA 2X9XA 5JR9C 2KXPB 1FMVA 5LJMA 3SOLA 4EZHA 1QSDA 2ZLYA 5JH7E 5FXXA 2X66A 2LJLA 5JDNA 3CX8B 1YW0A 1QUUA 2Y8DA 2PBIA 5HXCA 4X1IE 5JDMA 3M65A 1ZEEA 1HTJF 1HCIA 2CM0A 2VKOA 3LBXA 5ADXL 4HKAA 3K3QC 2DI4A 2C5KT 4QKNA 3GA8A 3F31A 5HAXA 1BR0A 3K3OA 3LFMA 2QA7A 4P09A 4WBNE 3AAEB 1SA0E 2Q9QA 4OYKA 4I55E 4OK0A 3UTKA 4BAYB 1BR2A 1E1HB 3D0TA 2Y6XA 2X9HA 2JQQA 2DWGA 2ZMAA 5HXSA 3ZMVB 3QK6A 3HKDE 2K48A 2LT3A 1S94A 4E7SA 5L3CB 2VASA 3PUSA 4PAGA 3GWHA 2XAJB 2N2NA 4AQFC 3AAAB 3MZKB 2V7MA 2E9XB 3ZJ1A 2WSSV 1U4QA 4DO0A 3R84B 1HFAA 3AA1B 2DNXA 2L9QA 3SS1A 1D0YA 4IE4A 2XASB 2CMRA 2YEVC 4KBMB 4TZ4C 3RKOA 5LP6E 2ODVA 3I9WA 1V9DA 4L9IA 2K9AA 4X1YE 3RYIE 4TX5A 2M67A 4MFRA 4CXWA 5CA1E 2KZ7B 4UF0B 4QXBB 3S4UA 2XAHB 3N9PA 3LK3B 4YHJA 3RC3A 2J1DG 2MTQA 2XAGB 5FXWA 2V7KA 4IE5A 3MXZA 3V5UA 3OYXA 2MOZA 3AVSA 4I50E 2PFVA 3LG7A 3NZQA 2V26A 2KLQA 3HKCE 4B6XA 3I9YA 1MNDA 1NWMX 2NOXA 1KK7A 3CQGB 5L3FB 2ACXA 3UFEA 2G0UA 4KUMB 4UVAB 5JVDE 2HPJA 3SRZA 2JRKA 2VKHA 4WNKA 1WYCA 4AQFA 2LHRA 3HR0A 5DJQC 4MHCA 2WBLA 4I4TE 2X0LB 1D0XA 3OBVE 4UIGA 2HPLA 3C50A 3ZPOA 1US7B 4G2AA 1Y64B 5FP3A 4WW0A 3T8OA 5LHHB 4H9QC 3R6NA 2E9XA 4ZI2D 4CXYA 3VKGA 4H9OC 2D0UA 5JRCB 4DBQA 1Z0PA 3UUXB 5LOVE 5L3DB 2VKDA 2W00A 2EHOC 4QX7B 4ZS3A 3V5SA 3ZYMA 5JDLA 3VHLA 4ZI2C 2KWHA 4DNDA 3C4WA 5J2TE 4GK0E 2Z6EA 2VWAA 3RYCE 3KVBA 5LBMA 3CMLA 1IAPA 5FY7A 5JR9B 3KFWX 5L3BB 5TAOA 5DQWA 1BR1A 4U72A 2UXXB 4CXXA 5M4YA 3OYZA 3F57A 4L5GA 3DTOA 3KV4A 2C5IT 3EDUA 2CWOA 5H6RB 3JC6C 2GK9A 1LVFA 4TV9E 4EYUA 3IBPA 4JUYA 3RC8A 3I0QA 2ZM0A 2I59A 3KV9A 4JEHB 3EVYA 2XAFB 4YJ3E 3KV5A 4H63V 3GN5A 2CXLA 4PJNA 3C4ZA 4P0AA 2DWKA 3N2OA 1G73A 4Z8XA 5FYMA 3H37A 3GN5B 2Q9QC 5AFUL 4XBFB 4UELA 3O9XA 4EAHA 1YKEB 2YU2A 4IHJE 3ZMZB 3CPZA 3IF8B 3N9NA 5KDMC 2EHOD 4ERRA 4H9NC 2IC6A 3N2KE 2RP4A 4A56A 4UXNB 2L8KA 5LG4A 3CX7B 5J2UE 4PW8A 4HFVA 3ETUA 4ZS2A 5DABA 2BDEA 2NW8A 2V1DB 3N9LA 3PU3A 3BK9A 4TUYE 3AA0B 3W15B 4F6RC 4AI6A 4O2AE 4U74A 3RRCA 3MJXA 4PJLA 1IZNB 4YFSA 2ZM2A 1D1BA 3NBXX 4DMVA 2NTYA 2JPFA 3AAIA 4AQGA 2K5BB 5LXTE 3N9OA 2L3LA 3IEEA 3E0ZA 3FXEB 1UX4A 3CWZB 4HE8A 1VOMA 2LHNA 2ODUA 4H9SE 4TN7B 4V1Av 5FNVE 2WAUA 4ZI3D 3LK42 5DQVA 1EZ3A 5FY0A 5LBQB 3PUAA 2XAQB 3J7Yq 4ASKA 1OXZA 3FHNA 5C8YE 2N1GA 1D1CA 5EZYE 2KMFA 3PE0A 2WMNA 2YINA 2Q9QD 5IHYA 4PJJA 2D5UA 3ZCJA 5F3JA 2EHOB 4P0BA 5JREA 2NWBA 3UT5E 3BQKA 2OA5A 4IDZA 4C90A 3U3IA 4H63H 2A2FX 1S35A 4QX8B 4L0RA 4PNIA 2W0GA 5J1GA 3MK7C 1KNZA 2LM9A 3JC6D 2DLRA 2V7JA 2DCFA 4N78D 3ZMTB 2X68A 4CI1B 3NZPA 2PG8A 4ZI7E 5HXEA 3ZMSB 4KP3C 3O4XE 1BR4A 4K0UA 1T98A 2H7OA 3ZYLA 4DMWA 4O4HE 2XHEB 3ZJ2A 4O8SA 1B7TA 1MNEA 3AA7B 3WI3A 2V7LA 5CA0E 1IJ5A 3C64A 4M1PA 3EDVA 2LOSA 3DJBA 2ZM8A 1YKHB 5BMVE 2K24A 4IE7A 4O4JE 4QXCB 4O4IE 2XTLA 1X79A 3I1AA 5FY1A 3N2GE 1MMNA 2IAKA 1LRZA 3AA6B 3BQLA 5GONE 1VRBA 5CB4E 4AKLA 5LNKA 2CEAA 1OWAA 3IHRA 3ONXA 4HTEA 1H7CA 2X67A 3ANWA 4MALA 2CXDA 3VU7H 4UEMA 3PUQA 4H9PC 2E9XD 3FXDB 4IE6A 4AKRB 2MYSA 4JEUB 2WWUA 2LOPA 3N5LA 1MIWA 3QUJA 4PFOA 2IW5B 5L3EB 3RPUA 3KBUA 5L3GB 5JR9A 5HXHA 4AXPA 5LYJE 3L3PA 4GYSA 4HEAA 1HX8A 3AVRA 5IYZE 5JRCA 4QHOA 2KWIB 1U5PA 1ZKEA 2CLYC 2KINB 1LKXA 5FXVA 4C91A 2LSIA 3HI2A 4GOUA 4CQIA 2LSKA 3PTRB 4EZ4A 1FIOA 1HG2A 3B13A 2YU1A 4XZCA 4BJNA 1G8XA 4EOZB 3CX6B 3Q2MA 2SPCA 3CKDA 4AKHA 3MKDA 3LK2B 5KMGP 3CVRA 3Q5WA 3MACA 3ETVA 4DBRA 1ZV4X 3ZN0B 3KDSE 3PUGA 5JDHA 2A3DA 2LSYA 4ZI3C 4PJMA 4KMCA 5KX5E 3N9QA 5EK2A 3N9MA 3PURA 3Q5XA 2WM9A 4FJOA 2EHOA 3KBTA 3LJCA 2NP9A 3P7IA 4WBOA 3FBLA 4CZZB 3GMIA 2HH7A 2KT9A 3A5XA 5EK3A 4ISTA 2BVLA 2LSJA 3K8PC 1D0ZA 3ZN1B 4CI2B 1MMDA 1CUNA 2C5JA 1ZHCA 5E0OA 4EXTA 5ETWA 3OKQA 4O2BE 2E8IA 2H7VC 2W62A 3AB3B 2CLYB 4ADZA 3RYHE 2PJQA 1HF8A 2LEHA 1SHZC 2VK9A 2VL8A 4XAXB 4EYYR 2RA1A 2D0TA 3O1JA 4QXHB 5JQGE 5LA6E 4PK6A 4O4LE 4E7ZA 3RH3A 5LCYA 4AKIA 3HL6A 3E08A 3PDYA 1FEWA 1HG5A 4HGAA 4OYJA 4UVCB 3F2EA 4IGUA 4IE0A 2X9YA 4EIWA 3CQXC 2YK0A 2ES0A 3ANWB 4OHFA 5H6QB 3RX6A 2D2SA 3HKBE 4BA9A 4EB6E 3H3AA 5JDQA 2IC9A 3K3NA 2QGSA 2VKJA 2XUEA 3O1HA 4X20E 3NRYA 2A72A 1WR6A 4PK5A 2NW7A 4UVBB 3UULA 4YJ2E 1AJ3A 1LVKA 4NUVA 2NW9A 4GK5E 2W61A 3ZLIA 3L09A 5LHGB 4NUUA 2V7IA 1O3XA 2N9DA 1HS7A 4I43B 2W63A 3HKEE 4UV9B 2CXFA 2BZBA 2LE8A 3RYFE 4MLKA 3FBZA 2VB6A 3ZEFB 1WLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CUN A;  2SPC A;  3F31 A;  2ODU A;  1S35 A;  3UUN A;  1U5P A;  3LBX B;  1OWA A;  2ODV A;  3UUL A;  1AJ3 A;  3PE0 A;  1QUU A;  3UUM A;  3FB2 A;  1HCI A;  3LBX A;  3EDV A;  1U4Q A;  1WLX A; 
#chains in the Genus database with same CATH topology
 5LGN B;  4AQY T;  4DVD A;  4TWF A;  5KXJ A;  4AIU A;  3KIN B;  5FXZ A;  4QWN B;  3NWI A;  2XM2 A;  3BQI A;  3MA9 A;  4YSY A;  1D1A A;  5LJN A;  4QH1 A;  4UF0 A;  1WRD A;  4X1K E;  3AE5 A;  4OFZ A;  3UUN A;  4YLH A;  4ANJ A;  3VKH A;  4JLE A;  3AXJ A;  5HYA A;  3KV6 A;  1XWM A;  3QC9 A;  4PFP A;  3LBX B;  1FMW A;  2J47 A;  4X66 T;  4TV8 E;  2JMK A;  4J2C A;  2H89 A;  3U78 A;  4AKG A;  1YD8 G;  5F8P A;  2KND A;  2WB5 A;  4JI0 T;  4G63 A;  4GYR A;  3RRW A;  4DV2 T;  3TKL B;  2JMH A;  3RI5 A;  2X51 A;  2Y48 B;  4IIJ E;  4I0U A;  4TWD A;  2WMO A;  2XQY A;  2UUC T;  2X9W A;  3UUM A;  4DID B;  4PK4 A;  3PUV F;  5LGU B;  4X65 T;  3I0O A;  2JJ9 A;  4CI3 B;  3NRX A;  1NAF A;  4U2Z A;  4H9R C;  1Y01 A;  4NPP A;  3QB5 K;  4ISS A;  4WYV A;  5AQQ B;  3HA4 A;  3C98 B;  3C4X A;  5A1L A;  3ZMU B;  4JI2 T;  4DV6 T;  2C0S A;  3SWH A;  3P4R A;  3EAB A;  1MMG A;  1DU2 A;  1UCU A;  4FI5 A;  3P8C D;  3KVA A;  4MBQ A;  3E22 E;  1MIV A;  3PU8 A;  5HWX A;  5JDG A;  5LHI B;  1MMA A;  4ZOL E;  2D9D A;  1IJ6 A;  2B1E A;  2DHR A;  3J9X 1;  5FMN A;  3ZC0 A;  3Q5E A;  5FKY A;  2MBG A;  4QH5 A;  5JDF A;  3WAJ A;  1WYB A;  3AEC A;  4DR1 T;  3ZCI A;  4HWI B;  2CE7 A;  3WAK A;  4BJM A;  3ESL A;  3CQC B;  5L2L A;  3EUH A;  4DV0 T;  3B57 A;  3ONJ A;  3Q9D A;  5EK4 A;  4UV8 B;  2BG9 A;  3O1I A;  1L0V A;  2P9B A;  4ILB A;  2UXN B;  3FB2 A;  2E9X C;  2Q9Q B;  5CFB A;  4JI6 T;  3DP7 A;  4ZHQ E;  2HN2 A;  1MIY A;  2H3R A;  3C51 A;  3ZYK A;  5LGT B;  1UX5 A;  4ILU A;  3RIF A;  2CA5 A;  4GIW A;  1OED B;  5AQO B;  4DR4 T;  1W0A A;  5HWY A;  2HHH T;  3ZC1 A;  5AQH B;  2LSG A;  2XZE A;  4HFI A;  2BVM A;  2CWY A;  2V6Y B;  2NTX A;  3OJA A;  5FVK A;  4HN9 A;  1M7K A;  2CCQ A;  5HXR A;  2X9X A;  5JR9 C;  5J0Z A;  2KXP B;  1YQ4 A;  1FMV A;  3PUY F;  4DR6 T;  4YHH T;  4YTP A;  3UU5 A;  2B76 A;  3AE6 A;  3M3Z B;  5LJM A;  2XQ3 A;  4JI5 T;  3SOL A;  4EZH A;  1T7S A;  5FVL A;  2E2A A;  1QSD A;  4HWF A;  2ZLY A;  5JH7 E;  1UGO A;  2LM2 A;  3EHZ A;  2JQK A;  2X66 A;  5F5W A;  2LJL A;  5FXX A;  3TLV A;  5JDN A;  4EED A;  3RF1 A;  2I6H A;  4IT4 A;  4LMJ A;  1FJG T;  3CX8 B;  2BS4 A;  1QUU A;  1YW0 A;  2Y8D A;  2PBI A;  2WY2 A;  4X1I E;  5HXC A;  5LB7 B;  3M65 A;  5JDM A;  1ZEE A;  1HTJ F;  1HCI A;  2CM0 A;  2VKO A;  5AQP B;  4LF9 T;  5ABE A;  1XNQ T;  3LBX A;  1XZY A;  4HKA A;  2CBI A;  3TLU A;  1OED A;  3K3Q C;  5ADX L;  4DUY T;  2DI4 A;  2C5K T;  4QKN A;  3GA8 A;  3F31 A;  1N36 T;  5HAX A;  1BR0 A;  3K3O A;  2FJE A;  2QA7 A;  3AE9 A;  3LFM A;  3LSV A;  4P09 A;  3AAE B;  1SA0 E;  2Q9Q A;  4OYK A;  4I55 E;  4OK0 A;  3UTK A;  4BAY B;  1J1J A;  3JAE A;  1BR2 A;  4IDO A;  1E1H B;  2ZM6 T;  3D0T A;  3JAD A;  2WP9 A;  2Y6X A;  5FL1 A;  1CHU A;  1N34 T;  2X9H A;  2JQQ A;  3NKZ A;  3OPC A;  2DWG A;  2ZMA A;  5HXS A;  3ZMV B;  3QK6 A;  2HN1 A;  3HKD E;  2K48 A;  2LT3 A;  1S94 A;  1VCT A;  4E7S A;  5L3C B;  2VAS A;  3PUS A;  4PAG A;  1KF6 A;  1XMO T;  2XAJ B;  3GWH A;  1WR0 A;  4KX6 A;  2N2N A;  2M6I A;  3AAA B;  3MZK B;  4AQF C;  2JQ9 A;  2V7M A;  2E9X B;  3UU8 A;  2XQ6 A;  2BBH A;  3UU6 A;  2FJA A;  3ZJ1 A;  2WSS V;  1U4Q A;  4DO0 A;  1X9B A;  3TLT A;  4JI3 T;  4CN1 A;  3R84 B;  4F8H A;  3EI0 A;  1HFA A;  3AA1 B;  4HFB A;  3VR9 A;  2BBJ A;  3AE1 A;  4LFA T;  1M62 A;  2DNX A;  2L9Q A;  4U2Y A;  1D0Y A;  4IE4 A;  3P4W A;  2XAS B;  5HCJ A;  2CMR A;  5IUX A;  4HWD A;  3JCF A;  2YEV C;  2BKN A;  4IDN A;  5ABF B;  3AE8 A;  3QB5 A;  4HFH A;  3OTO T;  4KBM B;  4TZ4 C;  3RKO A;  5LP6 E;  2WWV A;  4Z91 A;  4NXN T;  2ODV A;  3I9W A;  1V9D A;  4L9I A;  2K9A A;  4X1Y E;  3RYI E;  5HEH A;  4TX5 A;  2V5C A;  1JNZ A;  2M67 A;  3QOF A;  4MFR A;  4CXW A;  2H88 A;  5CA1 E;  2KZ7 B;  1XNR T;  4UF0 B;  4QXB B;  3S4U A;  2XAH B;  3N9P A;  1IBM T;  3LK3 B;  4YHJ A;  3RC3 A;  2J1D G;  2MTQ A;  2XAG B;  5FXW A;  2V7K A;  1KNR A;  3AE3 A;  4IE5 A;  2KSR A;  4HFD A;  4DUZ T;  2YDQ A;  4DR3 T;  1QLB A;  3MXZ A;  2BS3 A;  3AEG A;  5IWA T;  2W2U A;  1E2A A;  3V5U A;  4JI8 T;  3OYX A;  2MOZ A;  3AVS A;  4I50 E;  2PFV A;  3FZF B;  3LG7 A;  3NZQ A;  5L4H A;  2V26 A;  2KLQ A;  3HKC E;  2QVA A;  5AQJ B;  2LKG A;  4B6X A;  3I9Y A;  4LF7 T;  1MND A;  1NWM X;  2NOX A;  1KK7 A;  3CQG B;  3RLF F;  3AXJ B;  2ACX A;  3UFE A;  5L3F B;  3UU4 A;  2G0U A;  4HFE A;  4KUM B;  1SUM B;  5CJ5 A;  3AEE A;  4UVA B;  5JVD E;  2HPJ A;  2I0M A;  2CRB A;  2J4G A;  5HEG A;  2JRK A;  4LMK A;  3SRZ A;  2JQH A;  5L47 A;  2X0H A;  4X62 T;  5LMU T;  2W67 A;  1AJ3 A;  2FBW A;  3RQW A;  1VCS A;  2VKH A;  2CBJ A;  4WNK A;  1WYC A;  2IIU A;  2XQ9 A;  2LHR A;  4AQF A;  3HR0 A;  2BS2 A;  5DJQ C;  1W0B A;  4MHC A;  2WBL A;  2FJB A;  2WU2 A;  4I4T E;  4AIS A;  4DV1 T;  2X0L B;  4ILA A;  2LKH A;  1D0X A;  3OBV E;  4UIG A;  2HPL A;  3C50 A;  3SS1 A;  1US7 B;  3ZPO A;  3RQU A;  4G2A A;  1Y64 B;  2K3W A;  4WW0 A;  5FP3 A;  3T8O A;  4EV6 A;  4H9Q C;  5HCM A;  3R6N A;  5LHH B;  2E9X A;  4ZI2 D;  4CXY A;  1Z8U A;  1IBL T;  5ABH A;  4H9O C;  3VKG A;  2D0U A;  2RPA A;  2YDR A;  5JRC B;  4DBQ A;  1Z0P A;  3UUX B;  3X1D A;  5LOV E;  5L3D B;  2VKD A;  4TWH A;  2W00 A;  2EHO C;  4QX7 B;  4YTM A;  4ZS3 A;  3V5S A;  3ZYM A;  5JDL A;  5AQG B;  3FZM B;  3VHL A;  4ZI2 C;  4U7Y A;  4DR2 T;  2KWH A;  1OED C;  2BG9 B;  2M6B A;  3C4W A;  5AQU B;  4DND A;  3SFE A;  4LF6 T;  3PV0 F;  5J2T E;  4GK0 E;  3A7M A;  2Z6E A;  4GKJ T;  2VWA A;  3RYC E;  3KVB A;  5LBM A;  1IAP A;  2CPT A;  3CML A;  5FY7 A;  3KFW X;  5JR9 B;  5L3B B;  1GQE A;  5TAO A;  5DQW A;  1BR1 A;  3AED A;  4U72 A;  2UXX B;  4CXX A;  3CK6 A;  5M4Y A;  1J5E T;  2UU9 T;  3OYZ A;  3VR8 A;  3F57 A;  4L5G A;  3DTO A;  3KV4 A;  2C5I T;  3EDU A;  2CWO A;  2YDS A;  5H6R B;  3ABV A;  3VRB A;  3A8Y C;  2OLT A;  3JC6 C;  2XPK A;  2GK9 A;  1LVF A;  4TV9 E;  4EYU A;  3IBP A;  2WZH A;  4JUY A;  3TLS A;  5HEJ A;  3AEF A;  3RC8 A;  1UK5 A;  2YOE A;  3I0Q A;  2ZM0 A;  2I59 A;  3KV9 A;  4JEH B;  3EVY A;  2XAF B;  3P50 A;  3KV5 A;  4YJ3 E;  2LLY A;  4H63 V;  3GN5 A;  2CXL A;  5C3J A;  4PJN A;  3C4Z A;  4P0A A;  2DWK A;  3N2O A;  1G73 A;  4Z8X A;  5FYM A;  3H37 A;  4ILC A;  1HX1 B;  3GN5 B;  2Q9Q C;  5AFU L;  4ZZB A;  3PJA J;  3P4S A;  4XBF B;  1KEY A;  4UEL A;  1SE7 A;  3O9X A;  4EAH A;  1YKE B;  2YU2 A;  2XM1 A;  4IHJ E;  3CPZ A;  3IF8 B;  3N9N A;  3ZMZ B;  4YXD A;  5KDM C;  2EHO D;  4ERR A;  4H9N C;  4EEB A;  2IC6 A;  3P4P A;  3N2K E;  2F4V T;  2QRX A;  2QYW A;  2RP4 A;  4UXN B;  2L8K A;  5AQR B;  5AQT B;  4A56 A;  4YSZ A;  5JTG A;  2W66 A;  3CX7 B;  5LG4 A;  5J2U E;  4PW8 A;  4Z90 A;  4HFV A;  4JV5 T;  3ETU A;  4ZS2 A;  5DAB A;  2BDE A;  2NW8 A;  2V1D B;  3N9L A;  3PU3 A;  3BK9 A;  4TUY E;  3AA0 B;  3W15 B;  4IL4 A;  1UUR A;  4O2A E;  4F6R C;  4U74 A;  3RRC A;  4AI6 A;  1R8I A;  2WZI A;  4LML A;  3MJX A;  4PJL A;  1IZN B;  4YFS A;  2E5L T;  2ZM2 A;  1D1B A;  3NBX X;  4DMV A;  2NTY A;  2JPF A;  3AAI A;  4AQG A;  2UXC T;  2K5B B;  2J62 A;  5LXT E;  3N9O A;  4B3S T;  4IDQ A;  4A97 A;  2L3L A;  3IEE A;  3E0Z A;  3FXE B;  1UX4 A;  3CWZ B;  5C2T A;  4HE8 A;  1VOM A;  2LHN A;  2ODU A;  4H9S E;  4TN7 B;  4V1A v;  5HEO A;  5FNV E;  4WBN E;  4YY3 T;  1UUS A;  2WAU A;  2XQ7 A;  4ZI3 D;  4IRE A;  3LK4 2;  5DQV A;  1EZ3 A;  2XY8 B;  3PUZ F;  4U31 A;  5FY0 A;  5LBQ B;  3PUA A;  2XAQ B;  3J7Y q;  4ASK A;  1I94 T;  1OXZ A;  2NR4 A;  3FHN A;  2AXD S;  5C8Y E;  2N1G A;  4KHP T;  1D1C A;  3LDQ B;  5EZY E;  2UXD T;  2YKS A;  3SFD A;  2KMF A;  4EGW A;  3PE0 A;  2WMN A;  2YIN A;  2LRL A;  3RHW A;  2AE9 A;  2Q9Q D;  5IHY A;  5LMN T;  4PJJ A;  4LF5 T;  2D5U A;  3ZCJ A;  3B5M A;  2VVS A;  5F3J A;  2LRK A;  2EHO B;  2XQ8 A;  4P0B A;  5JRE A;  3L8R A;  2A9U A;  2NWB A;  4TNV A;  3UT5 E;  4QH4 A;  2VQF T;  3BQK A;  2BG9 C;  2OA5 A;  4IDZ A;  4LFB T;  4C90 A;  3U3I A;  3AEA A;  4H63 H;  2A2F X;  1S35 A;  2V5D A;  4QX8 B;  2CHO A;  4DR5 T;  3RIA A;  4L0R A;  4PNI A;  2W0G A;  5J1G A;  3MK7 C;  1KNZ A;  2LM9 A;  4JBW F;  2IW5 B;  3JC6 D;  2DLR A;  2V7J A;  4U3C A;  2DCF A;  3PJA A;  4N78 D;  3ZMT B;  2VQE T;  2X68 A;  4CI1 B;  1T72 A;  3AE2 A;  2PG8 A;  3NZP A;  4U33 A;  4X5T A;  3ZMS B;  4ZI7 E;  5HXE A;  2OV9 A;  2WU5 A;  4KP3 C;  3O4X E;  1BR4 A;  4K0U A;  1T98 A;  2E5V A;  2H7O A;  3UU3 A;  3ZYL A;  4O4H E;  3CIR A;  2JIW A;  2XHE B;  4ZXL A;  3ZJ2 A;  4DMW A;  1W9R A;  5HEU A;  1KFY A;  4O8S A;  1B7T A;  2V6Y A;  1MNE A;  3AA7 B;  3WI3 A;  2V7L A;  5CA0 E;  4ZZC A;  4DV5 T;  1IJ5 A;  1WCR A;  1W09 A;  3C64 A;  3EDV A;  2LOS A;  3DJB A;  3FZH B;  2ZM8 A;  1YKH B;  4M1P A;  5AQS B;  5BMV E;  2XSA A;  4U7I A;  2K24 A;  4IE7 A;  4O4J E;  4QXC B;  3Q5D A;  2CHN A;  2FJD A;  4O4I E;  3RKG A;  3ZT6 A;  1NEN A;  2XTL A;  1X79 A;  2UUB T;  3H3M A;  3I1A A;  5FY1 A;  1YQ3 A;  3N2G E;  4TNW A;  1MMN A;  2IAK A;  1LRZ A;  3AA6 B;  3BQL A;  5GON E;  1VRB A;  5CB4 E;  3TLW A;  4AKL A;  5LNK A;  2CEA A;  1OWA A;  3IHR A;  4YTN A;  3ONX A;  4HTE A;  1HNW T;  1H7C A;  5LG3 A;  2X67 A;  2XQA A;  3VRA A;  3ANW A;  4MAL A;  2CXD A;  3VU7 H;  4UEM A;  3PUQ A;  4H9P C;  4HWC A;  2E9X D;  1KNP A;  3FXD B;  4IE6 A;  1WFD A;  4NIQ A;  4AKR B;  3UQ4 A;  4CN6 A;  2MYS A;  4JEU B;  2WWU A;  2LOP A;  2WDV A;  1MIW A;  3N5L A;  3QUJ A;  4PFO A;  2WS3 A;  3K1S A;  5L3E B;  4KI0 F;  3RPU A;  3KBU A;  5L3G B;  3FZL B;  4IDP A;  3RIU A;  5JR9 A;  3UQ7 A;  4COF A;  4CN4 A;  4AXP A;  5HXH A;  5LYJ E;  3L3P A;  4GYS A;  4HEA A;  1HX8 A;  3AVR A;  3OVU A;  2UXB T;  5IYZ E;  5JRC A;  4QHO A;  2KWI B;  1U5P A;  1ZKE A;  2CLY C;  2KIN B;  4A98 A;  1LKX A;  3PUX F;  5FXV A;  4C91 A;  4B3T T;  1N32 T;  2LSI A;  3HI2 A;  4GOU A;  4CQI A;  2LSK A;  1JNR A;  3PTR B;  4JYA T;  3ZST A;  3FZK B;  1IBK T;  3EAM A;  3L39 A;  3RIU C;  4EZ4 A;  1N33 T;  5AQF B;  2V8S V;  1FIO A;  1HG2 A;  4DV4 T;  4WZX A;  3B13 A;  1HR0 T;  3ZSS A;  2MPK A;  2YU1 A;  4NXM T;  4XZC A;  4BJN A;  1G8X A;  3ZT7 A;  4EOZ B;  3NVO A;  3IA3 A;  4DV7 T;  4KHZ F;  3CX6 B;  1XDP A;  3Q2M A;  2SPC A;  3CKD A;  4UR9 A;  3MKD A;  3LK2 B;  5CGM A;  5KMG P;  4AKH A;  2X0Y A;  2YN6 A;  3CVR A;  3Q5W A;  5BR8 T;  2DL1 A;  3MAC A;  3ETV A;  5ABG A;  4DBR A;  1ZV4 X;  3ZN0 B;  3KDS E;  4DV3 T;  3PUG A;  3UUB A;  5JDH A;  2A3D A;  4LF8 T;  2LSY A;  4ZI3 C;  4PJM A;  5L4E A;  2PTF A;  4KMC A;  1ZP0 A;  5KX5 E;  3N9Q A;  4P1N A;  3N9M A;  1E7P A;  1OED E;  3PUR A;  4IL9 A;  5EK2 A;  3QNU A;  3Q5X A;  2WM9 A;  4FJO A;  2EHO A;  3KBT A;  3LJC A;  2NP9 A;  3P7I A;  4WBO A;  3FBL A;  4CZZ B;  3GMI A;  2HH7 A;  5AQV B;  2KT9 A;  4K0K T;  2VVN A;  3A5X A;  5EK3 A;  4IST A;  3UFG A;  4JI1 T;  2BVL A;  2LSJ A;  3K8P C;  1D0Z A;  3ZN1 B;  4CI2 B;  2FUP A;  1MMD A;  5AQM B;  1CUN A;  2C5J A;  1ZHC A;  5E0O A;  4A5X A;  1YXR A;  4EXT A;  4LFC T;  3ZT5 A;  3T1H T;  5ETW A;  3OKQ A;  4O2B E;  1HNX T;  2E8I A;  2H7V C;  2IUB A;  5ABF A;  2W62 A;  1XMQ T;  2MAW A;  3AB3 B;  4Q25 A;  2CLY B;  3AEB A;  2IML A;  4ADZ A;  3T1Y T;  3ZKR A;  3RYH E;  2PJQ A;  1HF8 A;  2LEH A;  1SHZ C;  2VK9 A;  2VL8 A;  4XAX B;  4EYY R;  2RA1 A;  4X64 T;  4HFC A;  2D0T A;  3O1J A;  4JI7 T;  4GKK T;  2BKO A;  4QXH B;  5JQG E;  3ONL C;  5LA6 E;  4PK6 A;  4O4L E;  2XQ5 A;  3RH3 A;  2R6G F;  4E7Z A;  5LCY A;  1ZOY A;  2UUA T;  3HL6 A;  3E08 A;  3RGL A;  4AKI A;  5AQL B;  2V6X A;  3PDY A;  5AQN B;  1FEW A;  1HG5 A;  4HGA A;  4HWH A;  4OYJ A;  3F2E A;  4IGU A;  4UVC B;  2XQ4 A;  3G06 A;  1XDO A;  4IE0 A;  2X9Y A;  5FL0 A;  4OX9 T;  2BG9 E;  3JAF A;  4JI4 T;  3AE4 A;  4EIW A;  4DR7 T;  2VL0 A;  2BKP A;  2VUR A;  3CQX C;  2YK0 A;  2ES0 A;  3ANW B;  4OHF A;  5H6Q B;  3RX6 A;  2D2S A;  3HKB E;  2IDO B;  4BA9 A;  2XSB A;  4EB6 E;  3H3A A;  4YSX A;  4ZEY A;  2WDQ A;  2IC9 A;  3K3N A;  2QGS A;  5JDQ A;  4B3R T;  2VKJ A;  2ACZ A;  2W4X A;  2XUE A;  3O1H A;  4LF4 T;  1T8B A;  4X20 E;  3NRY A;  2XJ7 A;  2A72 A;  2WQY A;  1WR6 A;  4PK5 A;  2NW7 A;  4UVB B;  3UUL A;  4YJ2 E;  2WCA A;  1LVK A;  2WDR A;  4NUV A;  4GK5 E;  2W61 A;  3AE7 A;  3PUW F;  3L09 A;  1J5W A;  2NW9 A;  3ZLI A;  5LHG B;  4NUU A;  2V7I A;  1O3X A;  2N9D A;  1HS7 A;  1HNZ T;  4B3M T;  4I43 B;  2W63 A;  3HKE E;  2IHR 1;  4UV9 B;  5AQK B;  2CXF A;  2BZB A;  2LE8 A;  3RYF E;  5AQI B;  4MLK A;  3FBZ A;  1NEK A;  2VB6 A;  3ZEF B;  1I6Z A;  3P4Q A;  4YT0 A;  1WLX A; 
#chains in the Genus database with same CATH homology
 5LGN B;  4DVD A;  3KIN B;  5FXZ A;  4QWN B;  3BQI A;  3MA9 A;  1D1A A;  5LJN A;  4UF0 A;  1WRD A;  4X1K E;  4OFZ A;  3UUN A;  3VKH A;  4YLH A;  4ANJ A;  4JLE A;  5HYA A;  3KV6 A;  3QC9 A;  4PFP A;  3LBX B;  1FMW A;  4TV8 E;  2JMK A;  4J2C A;  3U78 A;  4AKG A;  1YD8 G;  5F8P A;  2KND A;  4G63 A;  4GYR A;  3RRW A;  3TKL B;  2JMH A;  2X51 A;  2Y48 B;  4IIJ E;  2WMO A;  2XQY A;  2X9W A;  3UUM A;  4PK4 A;  5LGU B;  3I0O A;  2JJ9 A;  4CI3 B;  3NRX A;  1NAF A;  4H9R C;  4ISS A;  3HA4 A;  3C98 B;  3C4X A;  5A1L A;  3ZMU B;  2C0S A;  3SWH A;  1MMG A;  1UCU A;  4FI5 A;  3P8C D;  3KVA A;  4MBQ A;  3E22 E;  1MIV A;  3PU8 A;  5HWX A;  5JDG A;  5LHI B;  1MMA A;  4ZOL E;  1IJ6 A;  2B1E A;  2DHR A;  3J9X 1;  5FMN A;  3ZC0 A;  2MBG A;  5JDF A;  3WAJ A;  1WYB A;  3ZCI A;  2CE7 A;  3WAK A;  4BJM A;  3ESL A;  3CQC B;  5L2L A;  3EUH A;  3B57 A;  3Q9D A;  5EK4 A;  4UV8 B;  3O1I A;  2P9B A;  2UXN B;  3FB2 A;  2E9X C;  2Q9Q B;  3DP7 A;  4ZHQ E;  3ZYK A;  1MIY A;  2H3R A;  3C51 A;  5LGT B;  1UX5 A;  4ILU A;  2CA5 A;  4GIW A;  5HWY A;  3ZC1 A;  2LSG A;  2BVM A;  2CWY A;  2NTX A;  3OJA A;  5HXR A;  4HN9 A;  2CCQ A;  2X9X A;  5JR9 C;  2KXP B;  1FMV A;  5LJM A;  3SOL A;  4EZH A;  1QSD A;  2ZLY A;  5JH7 E;  5FXX A;  2X66 A;  2LJL A;  5JDN A;  3CX8 B;  1YW0 A;  1QUU A;  2Y8D A;  2PBI A;  5HXC A;  4X1I E;  5JDM A;  3M65 A;  1ZEE A;  1HTJ F;  1HCI A;  2CM0 A;  2VKO A;  3LBX A;  5ADX L;  4HKA A;  3K3Q C;  2DI4 A;  2C5K T;  4QKN A;  3GA8 A;  3F31 A;  5HAX A;  1BR0 A;  3K3O A;  3LFM A;  2QA7 A;  4P09 A;  4WBN E;  3AAE B;  1SA0 E;  2Q9Q A;  4OYK A;  4I55 E;  4OK0 A;  3UTK A;  4BAY B;  1BR2 A;  1E1H B;  3D0T A;  2Y6X A;  2X9H A;  2JQQ A;  2DWG A;  2ZMA A;  5HXS A;  3ZMV B;  3QK6 A;  3HKD E;  2K48 A;  2LT3 A;  1S94 A;  4E7S A;  5L3C B;  2VAS A;  3PUS A;  4PAG A;  3GWH A;  2XAJ B;  2N2N A;  4AQF C;  3AAA B;  3MZK B;  2V7M A;  2E9X B;  3ZJ1 A;  2WSS V;  1U4Q A;  4DO0 A;  3R84 B;  1HFA A;  3AA1 B;  2DNX A;  2L9Q A;  3SS1 A;  1D0Y A;  4IE4 A;  2XAS B;  2CMR A;  2YEV C;  4KBM B;  4TZ4 C;  3RKO A;  5LP6 E;  2ODV A;  3I9W A;  1V9D A;  4L9I A;  2K9A A;  4X1Y E;  3RYI E;  4TX5 A;  2M67 A;  4MFR A;  4CXW A;  5CA1 E;  2KZ7 B;  4UF0 B;  4QXB B;  3S4U A;  2XAH B;  3N9P A;  3LK3 B;  4YHJ A;  3RC3 A;  2J1D G;  2MTQ A;  2XAG B;  5FXW A;  2V7K A;  4IE5 A;  3MXZ A;  3V5U A;  3OYX A;  2MOZ A;  3AVS A;  4I50 E;  2PFV A;  3LG7 A;  3NZQ A;  2V26 A;  2KLQ A;  3HKC E;  4B6X A;  3I9Y A;  1MND A;  1NWM X;  2NOX A;  1KK7 A;  3CQG B;  5L3F B;  2ACX A;  3UFE A;  2G0U A;  4KUM B;  4UVA B;  5JVD E;  2HPJ A;  3SRZ A;  2JRK A;  2VKH A;  4WNK A;  1WYC A;  4AQF A;  2LHR A;  3HR0 A;  5DJQ C;  4MHC A;  2WBL A;  4I4T E;  2X0L B;  1D0X A;  3OBV E;  4UIG A;  2HPL A;  3C50 A;  3ZPO A;  1US7 B;  4G2A A;  1Y64 B;  5FP3 A;  4WW0 A;  3T8O A;  5LHH B;  4H9Q C;  3R6N A;  2E9X A;  4ZI2 D;  4CXY A;  3VKG A;  4H9O C;  2D0U A;  5JRC B;  4DBQ A;  1Z0P A;  3UUX B;  5LOV E;  5L3D B;  2VKD A;  2W00 A;  2EHO C;  4QX7 B;  4ZS3 A;  3V5S A;  3ZYM A;  5JDL A;  3VHL A;  4ZI2 C;  2KWH A;  4DND A;  3C4W A;  5J2T E;  4GK0 E;  2Z6E A;  2VWA A;  3RYC E;  3KVB A;  5LBM A;  3CML A;  1IAP A;  5FY7 A;  5JR9 B;  3KFW X;  5L3B B;  5TAO A;  5DQW A;  1BR1 A;  4U72 A;  2UXX B;  4CXX A;  5M4Y A;  3OYZ A;  3F57 A;  4L5G A;  3DTO A;  3KV4 A;  2C5I T;  3EDU A;  2CWO A;  5H6R B;  3JC6 C;  2GK9 A;  1LVF A;  4TV9 E;  4EYU A;  3IBP A;  4JUY A;  3RC8 A;  3I0Q A;  2ZM0 A;  2I59 A;  3KV9 A;  4JEH B;  3EVY A;  2XAF B;  4YJ3 E;  3KV5 A;  4H63 V;  3GN5 A;  2CXL A;  4PJN A;  3C4Z A;  4P0A A;  2DWK A;  3N2O A;  1G73 A;  4Z8X A;  5FYM A;  3H37 A;  3GN5 B;  2Q9Q C;  5AFU L;  4XBF B;  4UEL A;  3O9X A;  4EAH A;  1YKE B;  2YU2 A;  4IHJ E;  3ZMZ B;  3CPZ A;  3IF8 B;  3N9N A;  5KDM C;  2EHO D;  4ERR A;  4H9N C;  2IC6 A;  3N2K E;  2RP4 A;  4A56 A;  4UXN B;  2L8K A;  5LG4 A;  3CX7 B;  5J2U E;  4PW8 A;  4HFV A;  3ETU A;  4ZS2 A;  5DAB A;  2BDE A;  2NW8 A;  2V1D B;  3N9L A;  3PU3 A;  3BK9 A;  4TUY E;  3AA0 B;  3W15 B;  4F6R C;  4AI6 A;  4O2A E;  4U74 A;  3RRC A;  3MJX A;  4PJL A;  1IZN B;  4YFS A;  2ZM2 A;  1D1B A;  3NBX X;  4DMV A;  2NTY A;  2JPF A;  3AAI A;  4AQG A;  2K5B B;  5LXT E;  3N9O A;  2L3L A;  3IEE A;  3E0Z A;  3FXE B;  1UX4 A;  3CWZ B;  4HE8 A;  1VOM A;  2LHN A;  2ODU A;  4H9S E;  4TN7 B;  4V1A v;  5FNV E;  2WAU A;  4ZI3 D;  3LK4 2;  5DQV A;  1EZ3 A;  5FY0 A;  5LBQ B;  3PUA A;  2XAQ B;  3J7Y q;  4ASK A;  1OXZ A;  3FHN A;  5C8Y E;  2N1G A;  1D1C A;  5EZY E;  2KMF A;  3PE0 A;  2WMN A;  2YIN A;  2Q9Q D;  5IHY A;  4PJJ A;  2D5U A;  3ZCJ A;  5F3J A;  2EHO B;  4P0B A;  5JRE A;  2NWB A;  3UT5 E;  3BQK A;  2OA5 A;  4IDZ A;  4C90 A;  3U3I A;  4H63 H;  2A2F X;  1S35 A;  4QX8 B;  4L0R A;  4PNI A;  2W0G A;  5J1G A;  3MK7 C;  1KNZ A;  2LM9 A;  3JC6 D;  2DLR A;  2V7J A;  2DCF A;  4N78 D;  3ZMT B;  2X68 A;  4CI1 B;  3NZP A;  2PG8 A;  4ZI7 E;  5HXE A;  3ZMS B;  4KP3 C;  3O4X E;  1BR4 A;  4K0U A;  1T98 A;  2H7O A;  3ZYL A;  4DMW A;  4O4H E;  2XHE B;  3ZJ2 A;  4O8S A;  1B7T A;  1MNE A;  3AA7 B;  3WI3 A;  2V7L A;  5CA0 E;  1IJ5 A;  3C64 A;  4M1P A;  3EDV A;  2LOS A;  3DJB A;  2ZM8 A;  1YKH B;  5BMV E;  2K24 A;  4IE7 A;  4O4J E;  4QXC B;  4O4I E;  2XTL A;  1X79 A;  3I1A A;  5FY1 A;  3N2G E;  1MMN A;  2IAK A;  1LRZ A;  3AA6 B;  3BQL A;  5GON E;  1VRB A;  5CB4 E;  4AKL A;  5LNK A;  2CEA A;  1OWA A;  3IHR A;  3ONX A;  4HTE A;  1H7C A;  2X67 A;  3ANW A;  4MAL A;  2CXD A;  3VU7 H;  4UEM A;  3PUQ A;  4H9P C;  2E9X D;  3FXD B;  4IE6 A;  4AKR B;  2MYS A;  4JEU B;  2WWU A;  2LOP A;  3N5L A;  1MIW A;  3QUJ A;  4PFO A;  2IW5 B;  5L3E B;  3RPU A;  3KBU A;  5L3G B;  5JR9 A;  5HXH A;  4AXP A;  5LYJ E;  3L3P A;  4GYS A;  4HEA A;  1HX8 A;  3AVR A;  5IYZ E;  5JRC A;  4QHO A;  2KWI B;  1U5P A;  1ZKE A;  2CLY C;  2KIN B;  1LKX A;  5FXV A;  4C91 A;  2LSI A;  3HI2 A;  4GOU A;  4CQI A;  2LSK A;  3PTR B;  4EZ4 A;  1FIO A;  1HG2 A;  3B13 A;  2YU1 A;  4XZC A;  4BJN A;  1G8X A;  4EOZ B;  3CX6 B;  3Q2M A;  2SPC A;  3CKD A;  4AKH A;  3MKD A;  3LK2 B;  5KMG P;  3CVR A;  3Q5W A;  3MAC A;  3ETV A;  4DBR A;  1ZV4 X;  3ZN0 B;  3KDS E;  3PUG A;  5JDH A;  2A3D A;  2LSY A;  4ZI3 C;  4PJM A;  4KMC A;  5KX5 E;  3N9Q A;  5EK2 A;  3N9M A;  3PUR A;  3Q5X A;  2WM9 A;  4FJO A;  2EHO A;  3KBT A;  3LJC A;  2NP9 A;  3P7I A;  4WBO A;  3FBL A;  4CZZ B;  3GMI A;  2HH7 A;  2KT9 A;  3A5X A;  5EK3 A;  4IST A;  2BVL A;  2LSJ A;  3K8P C;  1D0Z A;  3ZN1 B;  4CI2 B;  1MMD A;  1CUN A;  2C5J A;  1ZHC A;  5E0O A;  4EXT A;  5ETW A;  3OKQ A;  4O2B E;  2E8I A;  2H7V C;  2W62 A;  3AB3 B;  2CLY B;  4ADZ A;  3RYH E;  2PJQ A;  1HF8 A;  2LEH A;  1SHZ C;  2VK9 A;  2VL8 A;  4XAX B;  4EYY R;  2RA1 A;  2D0T A;  3O1J A;  4QXH B;  5JQG E;  5LA6 E;  4PK6 A;  4O4L E;  4E7Z A;  3RH3 A;  5LCY A;  4AKI A;  3HL6 A;  3E08 A;  3PDY A;  1FEW A;  1HG5 A;  4HGA A;  4OYJ A;  4UVC B;  3F2E A;  4IGU A;  4IE0 A;  2X9Y A;  4EIW A;  3CQX C;  2YK0 A;  2ES0 A;  3ANW B;  4OHF A;  5H6Q B;  3RX6 A;  2D2S A;  3HKB E;  4BA9 A;  4EB6 E;  3H3A A;  5JDQ A;  2IC9 A;  3K3N A;  2QGS A;  2VKJ A;  2XUE A;  3O1H A;  4X20 E;  3NRY A;  2A72 A;  1WR6 A;  4PK5 A;  2NW7 A;  4UVB B;  3UUL A;  4YJ2 E;  1AJ3 A;  1LVK A;  4NUV A;  2NW9 A;  4GK5 E;  2W61 A;  3ZLI A;  3L09 A;  5LHG B;  4NUU A;  2V7I A;  1O3X A;  2N9D A;  1HS7 A;  4I43 B;  2W63 A;  3HKE E;  4UV9 B;  2CXF A;  2BZB A;  2LE8 A;  3RYF E;  4MLK A;  3FBZ A;  2VB6 A;  3ZEF B;  1WLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...