3UV9A

Structure of the rhesus monkey trim5alpha deltav1 pryspry domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
183
structure length
183
Chain Sequence
TELTDARRYWVDVTLATNNISHAVIAEDKRQVSSRAGTGVLGSQSITSGKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDGSSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPYLNPRKCTVPMTLCSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the rhesus monkey TRIM5alpha PRYSPRY domain, the HIV capsid recognition module.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Ligase
molecule keywords Tripartite motif-containing protein 5
total genus 41
structure length 183
sequence length 183
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00622 SPRY SPRY domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.920 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3uv9A00
5JI7A 4KG0A 3UV9A 4WVMB 4XW3A 4V1PA 4B3NA 5C33A 4P9LA 3KB5A 4N7UA 4WVMA 5JIAA 3ZO0B 5F6LB 4P9IA 2IWGB 3TOJA 2E63A 2YYOA 4N7IA 5F6KA 4B8EA 4QT6A 4P9JA 2LM3A 5JI9A 2VOKA 2WL1A 4X8PA 2FBEA 2YUEA 4X8NA 5JIUA
chains in the Genus database with same CATH superfamily
5TSWA 3E6DA 4RFRB 3ZR5A 4R8HA 4NIGA 1OOPC 3LPFA 3AKPA 1UZWA 1YUDA 4L2NA 1VBA3 2HJIA 4CP1A 2UWCA 2GH2A 2WQZC 3B00A 3ZYPA 4XVHA 4Q27A 1SG3A 1CZTA 1U5ZA 5EZWA 4ZZ8A 3RFRA 1L3JA 2QQUA 4AZZA 3T2TA 3WQ1A 4FFHA 4RSUA 3VZLA 1JS9A 3MDPA 4AL9A 2ZEYA 1VMHA 5GLWA 1W8FA 3LEKA 2WNUC 2O0OA 1IS6A 3PU8A 1VB2A 5GM0A 1LCLA 5C8CC 3JD73 4LBKA 3MIBA 1IKQA 1JBCA 3THCA 1KJLA 3JB4C 5HCBA 5A7PA 1FXZA 2E32A 3ZYIB 1H30A 3IMNA 2JIGA 1ZNPA 4NHXA 3BPZA 2EAKA 4LA3A 3LB9A 5FYVA 1BHGA 4TSVA 4UT5A 5C4WA 4Q4Y3 4WVVA 3VL8A 1GZ9A 1I5ZA 1FMD3 2ZGOA 2BNMA 2VMIA 5B2GB 4E2QA 1DZQA 3UNPA 4OQ9A 3GBWA 1RYYA 5FXVA 5KC5A 1MEC1 1DYPA 1QJX3 3VKMA 4R9AA 4HMZA 4D8MA 4N90A 1AR73 1OQEA 1K3IA 1AL21 5I0SA 3ZFFA 2AC1A 4QXBA 4ZS2A 5F3GA 2HLEA 4AEDA 4DXZA 5CKNA 3T3YA 5FBZA 3NRUA 4WBBA 5LRRA 2TNFA 3WNMA 1GP5A 1N1TA 3UJQA 4LO6B 2LRPA 2HWB2 5F5QA 4FP3A 2B4KA 5T5LA 3VDCA 5EJZB 5A1LA 1NA1C 5FP4A 3S7EA 3WG4A 1RUJ2 3U78A 1KITA 2BFUS 4JGYB 2BV4A 4M0HA 3FMGA 4H55A 3RZGA 2J1EA 2YMZA 1QJU2 2D40A 2D7FA 2QE3A 3UESA 3W59A 3MPBA 2Q0AA 3GBFA 4AEDB 2A70A 4GH4C 3WUDA 4QQLA 4LORA 4D6RA 2XWJB 5FZAA 5DG1A 5CKQA 2KD7A 1S4CA 3JU9A 1D4M1 4HKWA 4YW5A 3SLIA 4PIZA 4WM8C 5JPMB 4IV3B 4TN7A 4JTOA 4A2UA 5T50A 1ZBE1 4WM7B 1UOBA 2XVKA 3VGIA 1GP6A 2ZZJA 3AXEA 1DQ4A 3E5XA 5FPLA 4NROA 4OLLA 2RS12 3PJQA 4XQWA 3B69A 1VBB2 2X5IA 5E16A 1GWLA 1D7PM 2XKOA 3WCRA 3WZ1A 4EWEA 4FAHA 1AR72 2VM9A 3AKSA 3AP6A 3AFKA 3I2IA 3PURA 4HPKB 3O5SA 4RHV1 4YGCA 1Q8SA 5FZ4A 4B1MA 1UU5A 4HN0A 3VD9A 3FWEA 1UY2A 1I1EA 2RR11 3MHZA 3THDA 5FKCA 4CDUC 3ILFA 1N3PA 1YRZA 1GZCA 3I3EA 4FCAA 3GALA 5FMOL 4IW3A 1VP6A 4Y5Z0 3AZZA 4AR2A 5B4NA 5F3EA 1E5IA 1AYN2 4JZRA 4A7YA 2PFWA 5JZGC 1JZ8A 2VTXJ 4DO0A 3USUB 3DYOA 2X53S 4MGTA 4K21A 4Q4Y1 1UMZA 1KGYA 1S0CA 2OYZA 1VMFA 4P9YA 1QDOA 2Y60A 4RGAA 3POBA 1K45A 1LEMA 4NRMA 2FDHA 4K6BA 2BGCA 5IK4A 1SDDB 2I07B 4R4XA 5BYNA 1COV3 2IZWA 3DPRA 3FL7A 1DQ0A 4R52A 4XFHA 2VULA 5FZKA 2A71A 4COVA 5KXCA 3ZMOA 4CU6A 5KWRA 4Q8KA 1GUIA 1C3HA 3VKFC 3H8RA 1YIPA 3CJIB 1PX4A 2YV8A 4BQ2A 1R083 1JZ6A 3VDDA 4CA9A 4GJYA 1GWKA 2R16A 2WUHA 2ZS6B 4QD2A 3FZ3A 4CUGA 3ZYGA 2OUHA 4YRDA 1S0FA 3T0DA 1LU1A 4NOTA 1ND3A 4YARA 4YWAA 3H3UA 3VDDB 1TNFA 3VKNA 1JYNA 3ZM8A 4HSLA 1C1LA 1OXCA 4M3CA 5ABJC 1QMJA 4IXLA 3AP9A 4G9SB 5A3NA 3A7QA 3FE5A 2WRAA 3WP3A 3DPRB 3JBG3 1ND2B 2A3WA 1UY3A 3ZYBA 3AK0A 4AI2A 2C0ZA 3F2ZA 1J83A 2WS91 3KCYA 4N43C 1W6MB 4QKBA 5C3OA 4QQ2A 1TZOA 1X8EA 1Y9GA 1ND2C 4FVVA 3AP7A 3USUA 5CBLA 1NA1A 3T1LA 3J7HA 2V4VA 1AR83 5SV5A 3DGTA 5JSOA 1ZRRA 5C6CA 2F17A 2PYTA 3D5OA 3K4AA 1JYCA 3U1XA 1HDKA 5I8YA 3ZSEA 4UF0B 3N9PA 1JZ5A 2VUDA 2HWC2 4NIAA 1HJFA 2CSGA 2CDPA 2PN5A 1REFA 2X09A 2W94A 1D4VB 2RVAA 3J7LA 1CR7A 2BEOA 2HWE3 2R32A 3I59B 2OKXA 3TBDA 5C5TA 1AX2A 2RJKA 1ODMA 4OHVA 4Y22B 2FZ1A 1LOFA 4IDZA 1RMU2 4L8QA 1GANA 1ENSA 4QPIB 4AVTA 5FOBB 4XZUG 2XJSA 4O9EA 3LD8A 3M3IA 4CVUA 2VMHA 1B35A 1AR81 1J1TA 1W05A 3WG2A 1MVEA 3R4SA 1W0OA 4M3CE 1Z7S1 1CAUB 2B46X 3IAQA 5JWPA 2BUKA 3UKVA 1DZTA 5JXHA 4ISQA 1W28A 2P2KA 3CLPA 5A3TA 2MEV2 3POGA 1H9PA 5FREA 2LALA 4B8EA 1W2NA 4O61A 5EWSA 4MGZE 3KM5A 2XDVA 2WQ4A 3R0RA 4R4ZA 5CA6A 3RJ2X 3LE0A 1E5HA 1Q8QA 4R9DA 4PF5A 2WJSA 1HXS2 2XQRA 1NCQB 3FLRA 1XNDA 4GIQA 1M06G 4CUCA 4A4AA 4OI1A 4WZFA 2P6HA 4K1YA 1RUF2 3OGJA 1N1VA 3B01A 3M4FA 1GZWB 1TNRA 4EQVA 1KDMA 5DUUA 1OKQA 4DOUA 5LY2A 1CIWA 1O59A 2R071 5CAZA 1X7NA 2DUQA 1W39A 3POIA 1S0EA 2PXJA 4KGGA 4DRVA 5ANNA 3T2OA 3PVOA 4ARYA 5LBEA 1W9SA 3H42B 2D6MA 2FMDA 3GCXA 3ZN5A 2VH9A 4M4RA 3SH3A 4AEMA 2WQ8A 3KD4A 4M00A 4HBNA 2QNKA 3ATGA 4NJ4A 3AVRA 3KMHA 3I7DA 3LFIA 4LLFA 5CIRA 5ACA3 4QMAA 5IJRA 1US3A 1US2A 5FZ3A 4CCCA 4JGZA 3PMSA 5FMBA 4ASKA 1W9TA 4KG0A 4AAXA 2JE9A 1W6PB 4OMDA 4DUWA 3BI3A 1GV9A 4YM0A 3U0ZA 3J7NA 2JB4A 1TME2 4QM9A 2W52A 4KU7A 4QPIA 4XF4A 1W3VA 4CDWA 2C9AA 2XHKA 1GNHA 1GWMA 2P4EA 4LHLA 5FYYA 3V64A 2YROA 5LEJA 3HEIA 4LQRA 4RN5A 5J1XA 5CG8A 3FUOA 1RUD2 4I01A 4ASMB 3CMGA 2Q4SA 1YEWA 1KFXL 5K4LA 5LK5A 1Q8PA 2JX9A 1G86A 1UOJA 3M3CA 1JH5A 1T6BX 3AMNA 4JRAA 1WD3A 2G4IA 4GWMA 5FJHA 3VHNA 4DEQA 1NE6A 4QKFA 2Q1FA 4BE3A 5A7QA 5LWBA 4PLOA 1BBT1 1OA2A 5BPXA 3AYDA 2HWD3 3AJYA 5DG2A 5I8TA 4Q5OA 1HW5A 3BALA 1EYBA 1V0AA 3Q8CA 4GWJA 1OSGA 2B42B 4HFSA 4QHOA 2I2SA 5I8SA 3N9MA 3JQXA 1LU2A 4LOTA 5A33A 5J37A 1C8M3 4IQPA 1UZZA 5L9BA 4D94A 3SEPA 4UW3A 3BYWA 2ET7A 1A34A 1RL3A 3WCSA 2VTXA 3CNAA 5EHDA 5C3SA 1QDCA 2DU0A 2YPDA 2D3SA 2EVXA 4CEYB 2J7MA 5FYCA 2JDZA 5A33B 4CU8A 1T2XA 4PLMA 3OBTA 4COWA 1U5IA 1EAH1 4KL1A 1HQNA 2GC2A 4BM8A 2F4PA 3QACA 3B9IA 3G6JB 4AI0A 4Q0QA 1UY0A 1SZBA 3ASIA 3VBFA 4PQ9A 1YIFA 3HOBA 4XHXA 1FOD2 1DZRA 4UBHA 1HV0A 2ZZQA 3C8XA 2VNVA 4C1WA 2GN3A 2E7TA 5ANQA 2YY1A 4S2FA 1RHI1 1WZXA 1G9CA 4NWVA 1ZRCA 1D2QA 1Q8VA 2EICA 1NCQA 2GALA 4RS5A 3SQOA 4LBQD 4MZUA 3IIIA 1CN1A 1H4GA 5AVAA 3DYPA 2VUJA 2R072 4C91A 5F32A 1IS5A 3ZXKA 4XURA 5A32B 4W6XA 4NUBA 4BK4A 3PUIA 4QHBA 2PA7A 1QHDA 2WABA 4QWNA 5EPAA 3AKTA 2BDRA 4WVMB 1ACCA 4FTBA 2BNOA 3MPPG 2Y64A 4BQ3A 1LENA 2R0FA 2FHRA 4QPYA 5T55A 3ZIWA 3GDBA 4OQ8A 4LOSA 1ZZ7A 5CVRA 4AXOA 5CISA 1U5YA 3J26N 1HN1A 5IVVA 2ENRA 5D8AA 3PVEA 1PIV1 1H6XA 4DUXA 1CZSA 1A78A 1IOAA 4BCUA 5HI0A 2BFUL 4LBJA 1LTEA 4YSFA 2EA7A 2XL7A 2DU1A 2Y8KA 2C5DA 3D0JA 2PQSA 1B35B 2R1BA 5FPZA 1IZ3A 1PVXA 2PHXA 2VOXA 4YG0A 4CDWC 5AC91 3RJRA 3I3MA 1MS0A 2N7GA 1PGW1 1RMU1 2JDMA 2DUPA 1LOGA 2JG8C 2HWB3 3C7EA 1OFSA 2DVBA 2XR4A 1HB4A 4M01A 1POQA 4P9XA 4MHRA 4LE3A 3ROUA 4LBQA 2VOVA 3AMPA 3I8TA 3IMMA 5A6ZA 1AXKA 4LBNA 4RQPC 1AL23 1VRH3 5FOJB 1TE1B 2HWC3 4Z2WA 4PI2A 5FWEA 1MZFA 3HNBM 4HANA 1RUD3 4IEUA 3D6EA 4EN8B 4AFDA 2E7AA 2H6BA 3RWNA 3VZJA 3NAPC 4GAZA 3P6BA 2ZHLA 3S5QA 4LEJA 3NJZA 1DLCA 3AFGA 3RZKA 2LUWA 3FBYA 1OH4A 4INDA 1CWPA 1RVF3 4B4PA 5T5OA 4JVAA 4LHSA 5F2WA 5IK5A 2RS13 4HONA 1G9AA 3U14A 1F35A 1LNSA 1SLIA 2XMLA 3KGLA 1KD7A 4FOYA 2P3KA 4UOJA 4YGBA 2VCMA 4D6QA 4WVMA 4C1XA 5FUIA 1GBGA 2WZR2 1E5SA 4HG6B 4JGYC 1HRV3 5BNQA 3H3ZA 4LA2A 2CDOA 4NE9A 3TWIA 2XLGA 2P3JA 2R043 3K3NA 4XTMA 1HQWA 1KFUL 4I2OA 4BJ0A 3OTFA 4UFMA 5JI9A 2E51A 2Y6HA 5C70A 1AR63 1NLSA 3DKQA 3VD4A 3PU3A 1JW6A 3ZFFB 3O1RA 2BBAA 1WCSA 4OHWA 3GHMA 3OPZA 4BHPA 3FHIB 3MF6A 3H3LA 4XYXA 3OG2A 2VPVA 5FRAA 4XDOA 1QJU3 1WMEA 1VBA1 3ZFGB 4GQ7A 3NMBA 5IK7A 3O0WA 1OLME 1QQP1 4UW4A 1W8WA 3FFZA 5A1AA 4RA0A 2QQPA 3BCWA 3IAPA 1ULPA 2PQQA 4H7LA 2CGOA 2QJVA 4AYUA 2R041 2Q30A 3I2OA 4J1WA 1CPMA 4TWTA 1Y9QA 2AEZA 3I3BA 4Q4X2 2PELA 3DPRC 4F7ZA 2DTYA 5FYUA 3VL9A 4B7KA 4AF9A 2W1WA 2W0XA 1O8PA 1YI7A 3IIAA 4GMP0 4XJ8A 4LPLA 1BXHA 1O91A 4BMEA 5FY9A 4JGZB 2DWRA 2AACA 2YFUA 1WBLA 2Y6JA 4JQRA 2RR12 2FDIA 5KR7A 3ELNA 1XC6A 1VALA 2Q8DA 3FHQA 2Y38A 3VDAA 2C26A 3KB5A 5K7PA 2Y26A 4RHV2 4YVWB 2X10A 1ZZBA 4AGRA 1VBE2 2D44A 1RUH3 3H8UA 4YM3A 5JLVA 1PMIA 4AVAA 3WINE 4J6GA 4WVZA 1GNZA 5FCCA 1EV11 2WO1A 1V9U1 1LHUA 2QQVA 3BUCA 2UYBA 1FNZA 2WAAA 2B9UA 5I0RA 5IVEA 1OD3A 2H0VA 5IW0A 4P02B 3ZFFC 4XMIA 2F6BA 2QZ3A 4GXLA 4XJWA 4XUTA 3VHPA 3IDBB 5A6XA 2E6VA 3D0SA 2VU9A 1N3QA 3E5QA 4L97A 2WC2A 1XNKA 2ARBA 3LFMA 2JJ6A 3PUSA 1NQJA 1D4M2 3OB8A 2ZEZA 4P5YA 2PHFA 1U12A 5GZCA 5FZ7A 1Y3TA 1BVP1 2D6PA 1ZVFA 5FUPA 3WF0A 4DS0A 1RUE2 5FLHA 3H7YA 1I3HA 4CE8A 5K9YA 4A41A 1PHMA 4AHXA 5F6LB 5FP7A 1MZEA 3GYDA 1ENXA 1RUI2 4GH4A 1HRV1 2WT0A 4MXVA 2RS51 3V0BA 2QQMA 3OEAA 2P3IA 3MYXA 3VBHA 3SCFA 2ZXQA 1PZ9A 3R6SA 3JQWA 2HWB1 4AGGA 5L7OA 3S57A 4PDWB 1WMFA 2QTWB 5A3OA 5FZ0A 1X33A 1RIRA 2OPKA 4AI8A 4IEYA 2ZBJA 1AJOA 2GMPA 4BQ1A 1HV1A 1MACA 1RJ7A 3GNEA 4GB31 3ZFEB 3ZYJB 1SQ4A 3HD8B 3T0AA 3RVHA 1S0GA 4IGPA 4KWKA 1WW4A 4YFWA 3NWKA 4GB32 2CAUA 1DGLA 2VQUA 1UL9A 2E33A 2K46A 4Q26A 3WF4A 1V6MA 2YC2A 1MEC2 2JG9B 2ZABA 2VQAA 4Q4W2 5CFDB 2WAOA 1D4M3 2FDJA 2G19A 4BQXA 1K5MB 1LOAA 4Q1RA 1GOHA 1HRV2 3J4UH 5A7NA 1QWRA 1RUI1 4UAPA 5FXWA 1H0BA 2D98A 2IXHA 5FZGA 3VKLA 2XUEA 4KNCA 4EWAA 1VRH2 2ZGNA 4PIXA 2WWSA 5FP8A 3WQ7A 1XPWA 5L7OB 4A3ZA 2ORXA 1NXD1 1RITA 5A80A 2HYXA 3H8OA 3HBKA 3POSA 1C57A 4XF0A 2EIDA 4XJ9A 5A7WB 2OUJA 3UL2A 2AEYA 1A6CA 1QH6A 2OW4A 5IWFA 3GXUA 2DYCA 1U0AA 2VCAA 1H2LA 1SBFA 5EYYA 4S2GA 4ZHNA 2XQXA 3NJVA 3SCGA 5DQ0A 4XAAA 3KT7A 3FHAA 4CCOA 5FYSA 5C9AB 1NG0A 4Q4W3 1PO23 4QB6A 5CFCC 3UYJA 2IFWA 4QX1A 1OLRA 1SPPA 3LGRA 2VAUA 5CG9A 1LOCA 1F5FA 2W1QA 1GMMA 2QFEA 2JDPA 5IHRA 2YYOA 3QBQA 1BJQA 5J3UA 1JUHA 3LOBA 2B5HA 4XQDA 2FD8A 1SBEA 3C7OA 4MO3M 1DIWA 2PTMA 3HQUA 3G7DA 2YPJA 3KLSA 4QQHA 2ARCA 4CEWB 3CZUA 1UYZA 3OOXA 4Q4X3 3Q8AA 2FDFA 2O8OA 1OH3A 3U07A 4FPFA 2CV6A 3LA2A 4JGZC 5DABA 1DFQA 4XXAA 1N3OA 2WO7A 2XJQA 2P1BA 2WR9A 4YW1A 1QF3A 1OI6A 4EN0A 2BOJA 2VOTA 4IV1A 2JECA 2JE7A 4XDQA 4NR1A 4BLJA 4XF3A 1UYYA 1PNFA 4A3XA 5FY1A 1XNTA 5IFTA 4Q4X1 4WM8A 5K8SA 5FZLA 2FCUA 3NNFA 3WDYA 2RJ2A 2PAEA 3ON7A 5JXGA 3Q9OA 2R042 1JYVA 2WSVA 4XJZA 1Q8OA 4AW7A 2W39A 5C3PA 1QQP2 5FZHA 5C7GA 1RXGA 2W08A 3S30A 1AF9A 4JQTA 1VBA2 2QDRA 4QX5A 4UBGA 1CONA 1VBC3 1JODA 2RM22 3QCWA 3OGSA 4GKXA 4CZSA 3B94A 2HWF1 1F15A 1DLLA 3IN9A 3HNYM 2DCJA 1W9YA 4N8MA 1LULA 3THTA 4UFIA 3WDWA 4JAAA 3QLQA 5FY8A 1FOD3 3LSDA 1KDKA 2JKXA 3ACGA 5IAVA 5FYIA 4IE6A 4Y20A 4ZS3A 2E26A 3UT0A 2W9XA 3AP4A 3ZDSA 2ORZA 3E6BA 2YBSA 2DFBA 4NRPA 2BNNA 1DU3D 2C6SA 3MIDA 4OULA 4MX3A 4U2AA 3GZTB 1D2SA 3AKRA 3KCXA 1LB2A 2JG8A 3H1MA 1FAYA 4HN1A 4FQ4A 5H9SA 1LHVA 1W0PA 4UFLA 5FY7A 1RUG1 3A4UA 4TXWA 4UXAA 3KHCA 1XRUA 2VZQA 3ILNA 5G04L 4AQ6A 1BQPA 1OT5A 3MICA 5FZOB 2HWF3 1CX4A 1UYXA 5CKMA 4XILA 1QOTA 4HKLA 4FPOB 3AVSA 3DEMA 3MIFA 4Z07A 5FQ0A 5LRSA 1O3RA 1RGSA 5FFOC 4R9CA 1MEC3 3BVCA 1NCRC 1VRBA 4PCRA 3RYRA 1C5IA 4LLOA 1WW5A 4YM1A 1XJAA 3E1F1 2HBUA 5JMOA 3N7MA 3P5BA 1WA4A 2VZPA 3RI8A 5JR2A 1H8TB 1UZVA 3TEXA 4FXGB 3WG3A 2FBEA 5FXXA 1XNAA 1NKGA 1STMA 2W46A 4S2HA 4XEZA 2BBVA 4DZGA 1A3KA 1ASJ3 1GLHA 2OS2A 5AC92 4RGGA 3TN91 3MBWA 3L2HA 1HJGA 3I2JA 4AGVA 4DPNA 2DCZA 5CFCA 2VVDA 2RHPA 2RS31 3OD4A 2X05A 2JDYA 5JSRA 2GAUA 1APNA 2VJXA 2NP0A 4DUVA 3CHXA 5LW9A 4HKOA 4PDWC 4C8DA 3NNLA 4FOQA 2BWCA 5DXDA 1JZ3A 1YXWA 1G9BA 1S0DA 3NKGA 3OCPA 1ZZ9A 1WMDA 2HBTA 4LBOA 4D3WA 3RZMA 3LSEA 4PIYA 2YGMA 4L0PA 5FLJA 2ZGRA 3U75A 4ITCA 2A6YA 2R073 3D8CA 2DUOA 1GOGA 1PGL1 1AUYA 3KF3A 2UY9A 4CCJA 5LA1A 2XVLA 2FDKA 3WT3A 1JXNA 1VR3A 2VR4A 3THPA 3WW4A 2VUAA 1Z7S3 4RR3A 3S6PA 4IE7A 3T09A 5ACA1 1PK6C 3S7IA 2C1FA 3DCQA 4BLIA 4PI0A 1VE0A 3PLQA 4QHZA 5IVJA 4IUGA 3CIHA 1RTVA 2JDAA 4AVBA 1ODNA 3HQXA 2ID4A 4LR4A 3T4HB 1OHFA 4OCTA 4Q4V3 2Q8EA 4XCAA 4EZHA 3KV4A 3SCHA 2IVJA 2RR13 3JXSA 1ASJ2 1WLTA 5DAXA 1O5UA 2W1UA 5F6KA 4MHUA 2MEV3 3CJIC 2VO5A 1LODA 1RHI2 1BYHA 5BNOB 1Q3EA 4QQOA 3APBA 4YM2A 3M7AA 4PLNA 1BEV1 1PVC1 3CZJA 1H1MA 4J1XA 2Q5TA 4H2AA 2DCYA 3MUZ1 3H7JA 5H9PA 3FLTA 3SKVA 1B09A 5C71A 3N7LA 4META 3MGUA 2WNUA 3W21A 5L7OC 3LIGA 4LT5A 3F95A 4CEYC 3K46A 3H1YA 3OGRA 4O65A 3ZXAC 4YZ1A 4V2WA 4YGEA 3M3EA 2ZEXA 1W90A 1G6NA 3OJBA 2CU5A 2BERA 1CIYA 1TMF2 4JKLA 4PBOA 4OI4A 5JOWA 4YFZA 4CSWA 2IFRA 3NV2A 4GJZA 3GHNA 1HLCA 4FPGA 5HCAA 1I6XA 3R4UA 2WINB 3V0BB 1C5HA 2W3JA 1W3XA 1TME3 2ARXA 3M2MA 3NW4A 4DY3A 4NIIA 3TN92 3USSA 1IQAA 3OF1A 1ZA4A 2YFZA 4AQ2A 3EB7A 5ERLA 3VV1A 1L7QA 3HN1A 2O8QA 3ZFEA 3GBGA 1OFNA 5FP9A 3EYPA 3K2OA 2CGPA 4QDSA 3BB6A 1W99A 2ZGUA 3I2KA 1YQCA 4XXPA 1RVF2 2XKPA 1RUD1 1JI6A 2IUWA 4MSVA 1RB8G 3VBOB 3MV01 4YGDA 2UU8A 5J7MA 2X8KA 1NYWA 2ARAA 2WFF2 4P9JA 2XGXA 3ZXEA 1DQ2A 2CY6A 2E7QA 2PHRA 2VXRA 4QPGB 4AWDA 1TME1 2XL9A 3WDVA 5FTTC 1RUC1 2ZCWA 5JOYA 1TMF3 2WNVC 4QB1A 1HIXA 3VN4A 1DBNA 4Q0VA 3LDRA 2V4AA 2BOIA 3JCIA 1W06A 1GZTA 4A7KA 2WDBA 3MLJA 4OHXA 4E4DX 2VC9A 3DL3A 1W6NA 1X9PA 4LULA 1NUKA 1U5XA 3UKTA 3WP4A 4QX0A 5F5IA 4QDQA 2XVGA 3NNJA 2XH6A 4ZU5A 5FPAA 4HK9A 3A22A 1ULDA 1G8WA 1COV2 4GZ9A 4ISRA 5JIUA 1LOFC 1PNGA 2VZSA 1O8SA 4XFGA 5JI7A 5JOZA 1NX9A 3K75B 3WDUA 5CADA 2ZGQA 1ZBA3 2GNDA 3ZDVA 1S55A 3KV9A 4N53B 5C33A 5KHJA 1B35C 1R1ZA 3AL5A 3CQOA 2DTWA 4NWWA 1HXS1 3EQEA 3O1UA 1WW6A 2WNVA 1PO11 3J8F3 3VD3A 5D8AB 1XXNA 3WV6A 2FQPA 4LK7A 3SHRA 2ZGPA 1RJ8A 2B8MA 4LITA 2IXJA 1SBDA 1R093 2UURA 3ZPOA 1Z7S2 4DINB 5JZGA 5KC6A 1LR5A 3D82A 1XU1A 1AR82 1ENQA 4X8PA 4ZY9A 4NO4A 4Y1XA 3WNKA 5BNOC 3S0MA 4UFJA 3W5MA 4F8AA 3KHBA 2W91A 1VBB3 2BGOA 1BK0A 3OBRA 1CJDA 3RWKX 4LHNA 4XACA 2AUYA 1S0BA 1G7YA 2QZ2A 3R4DB 1R64A 4XJUA 4NHMA 1NA1B 2J1TA 5JCTA 4EROA 2VL4A 2IXLA 5GLUA 5FZIA 5LATA 4FPKA 2RJLA 2W95A 2TUNA 1O3TA 4RS5B 5D1IA 4CDXC 3DXUA 1O4ZA 4HVOA 3T30A 1OBNA 5C4WC 4XQ4A 4IV1B 1PIV3 5A7OA 4B7EA 2NMNA 5T3NA 1ND2A 1OURA 4BH9A 2W92A 3WEZA 1OD5A 4IL7A 2LW8A 3NVCA 2GC1A 5FY4A 1OQDA 5IYYA 3MO4A 2H6CA 2WL1A 4QM8A 2Q8OA 5FYMA 1L7LA 1ND3C 4QAWA 2WZ8A 4PJYA 3HIFA 2WA4A 3VBUB 5AC93 1RUI3 4BMBA 4AHZA 2QQLA 2R061 3DKWA 1IGOA 1QKQA 4AAPA 1ZA7A 3D4KA 4W65A 4B3NA 2DURA 4ZU4A 1LGBA 3O0VA 3NAPB 2VNRA 1XYOA 1C8M2 3I4IA 1UOGA 4HSJA 2PHTA 1HRI2 1SPPB 5DPNA 5FZCA 5JVVA 4DNYA 4P08A 1JHJA 2IWGB 3EHKA 5ABJB 4BU2A 4PQQA 3E6CC 5C9AA 2JD9A 2QQIA 2RS53 4L11A 4GALA 2A75A 3QOPA 4IETA 2JXAA 2BWAA 1SFYA 2VTFA 1FMD2 1AR91 1PO21 2HKXA 2ZMLA 4Q4V2 5C3RA 5GLZA 3VZNA 1V00A 4MYEA 1LAJA 2WNUB 4MOAA 3KT1A 2R063 4OFGA 4JCKA 5LY1A 5L9VA 1R1A3 4UW5A 4E4HA 3M70A 2DVGA 1XQNA 4E2SA 4LO4B 1Q56A 4K20A 4N53A 1UYPA 1YJLA 1X9TA 5KHHA 5M0TA 1G9DA 2GMEA 3KT4A 5J36A 4CU7A 3HVDA 3VBRA 2QBXA 2WSUA 3C7GA 1NE4A 4CP0A 1YI9A 2RS52 3NSTA 4LKEA 1PZ8A 3HNMA 1X50A 2A3YA 3ME2A 4MGIE 4UYBA 3WD5A 5E6HA 2VY0A 1LECA 3AP5A 1MQTC 2ZMKA 1CJPA 1H4HA 2O1QA 3WP5A 1F4AA 1F5JA 1QXRA 2QKDA 1RUE1 1ULOA 3DECA 5I93A 4BQ5A 2ZACA 3ETPA 4XAEA 4I0WB 1AYM3 1N47A 3AYAA 1VLNA 4PDWA 5FY0A 1GKBA 4BOWA 3LOIA 2VCBA 2J1SA 1AX1A 3B5LB 1W6OB 2NLRA 4WM7A 3NNGA 3I54A 3WY6A 2V5YA 1H2NA 4GKYA 5T5JA 1CAVA 5LK7B 4OHZA 1X82A 5GLVA 1URXA 2EF6A 2ZGLA 1HB1A 1XB9A 1ZZ6A 3KV5A 4ONUA 4OZXA 3UK9A 5JR7B 1V9U2 1O3QA 4Y4RA 4MGYE 5KXDA 4LUMA 5BXXA 5KXEA 4QB2A 1SLTA 1VB4A 1QU0A 4P5HA 2BVVA 3GZUC 3UGHA 4IEZA 1H6YA 5DN2A 3ITQA 2P6CA 4AHWA 2AGSA 1J84A 2B39A 3HBZA 5FDBA 3GZEA 1QJX1 1MZ6A 5SV8A 2VNGA 3CEWA 4DEVA 3OPTA 4XBQA 2JD4A 2RDRA 1LGCA 2PAMA 3CBNA 3VBSB 2BU9A 3MW3A 4QX2A 4XFFA 2UWAA 2RE9A 1DGRN 4MLOA 5JDBA 4JKKA 2XG3A 5FMOS 3W9AA 1UU6A 1QJFA 2DBIA 2JWPA 1NCRB 4Q0SA 3BIEA 5KHIA 1UKRA 2OZ6A 4RS5C 1AYN3 1H9WA 1UN1A 4EV0A 2ZKNA 3HWJA 1MS8A 5L19A 3OBAA 2VW0A 1UWWA 2QQWA 2VMFA 3QH6A 3P3NA 4D7SA 4JC1A 4ZXKA 4AG4A 1FX5A 4K7JA 1IPKA 4YVSB 3O1VA 1CGPA 1FT9A 3U10A 3T0BA 2XLAA 1K5JA 2D3RA 5A6YA 2IXCA 3WNPA 1FNYA 1AL22 5IUQA 3OPWA 2VD7A 2VXJA 4ZXEA 1OPMA 4OZOA 4AEKA 3A23A 2VZOA 4L92A 5HCHA 1IQDC 2R30A 2GN7A 3NKTA 1IHMA 1FMD1 4Y4YA 4CU9A 2WN2A 4YVSA 3POJA 3NJXA 2XUMA 1VAMA 3PMEA 3CO2A 3HJRA 2YG0A 2FZ2A 2I74A 3POEA 5LA9A 1JU3A 4IEWA 1G9FA 1V70A 3W5NA 4C0HA 1CD3G 4GB33 3NJYA 1FV2A 4LMFA 5FYTA 1IS3A 5GZFA 3U11A 2NQYA 3RZHA 3N9OA 3UV9A 2VMCA 4JDNA 4CP2A 3EO6A 4P14A 5GLTA 1DYOA 2BVBA 2ADEA 2Z42A 1O3SA 2B7YA 1QY4A 3H1WA 3MIEA 2Z4FA 1GSLA 2GZWA 5DAPA 3WNXA 4EN7B 2XJPA 4M3CB 4JKMA 4XUQA 4AVSA 3KV6A 3DN7A 4DB5A 5FZFA 5A1FA 2VW2A 2GP5A 4Y1YA 5CFDA 1DQ1A 4CDQA 2JKBA 2XHNA 4FI9A 4Y1ZA 4OUMA 2ETEA 5J48A 1EPWA 2GH8A 2SLIA 4E2GA 2RG4A 1ENRA 5BY5A 4XZPA 2ZX4A 2MHFA 3I3QA 3SMHA 3UKNA 2AZ5A 4AFCA 1J3PA 1BMV2 4LXLA 1PGW2 5LBCA 2VZ3A 4YZ2A 1CAUA 4EYUA 2QQJA 4ZZ5A 1CVNA 4MGQA 1YYNA 5FK8A 1NCQC 4AEJA 1XE8A 4QU1A 5AVPA 1BEV3 1PVC3 2D93A 4NAOA 4NPMA 1R092 2JB8A 5F39A 3ZLIA 1Z78A 2GNTA 5KXBA 4MUVA 1SEFA 5IVCA 4HPKA 2J1VA 4C0BA 4N7IA 3I49A 2K2SA 1RUF3 1RUH2 2YHJA 4V2VA 3M3OA 2VUCA 3C7HA 4XF9A 3WLUA 4CUAA 5F1RA 4EN6B 3URFA 5IT6A 2JDKA 2RDSA 1GICA 2WT2A 1YWKA 2P5BA 2YXSA 3CL1A 1RUG3 4RQPA 4XCBA 5L9RA 4ASLA 1RUNA 1XE7A 1LGNA 2YGLA 3VBOC 2Z79A 3V65A 5E1RA 1UZ0A 1W2UA 1K5MC 3B7MA 2KXLA 4DQAA 1COV1 1YQ2A 4Y1UA 1FYUA 4Y20B 1VAVA 1F9KA 4CTEA 5HV4A 1NZCA 4QX8A 5CEHA 5BNNC 2XB6C 2X5IB 3FFQA 5CU1A 4QPWA 3HN3A 1FPN1 4G4FA 4F83A 1R081 3LCPA 4HVQA 1CAXB 5DMYA 4EJRA 3J9SA 2ET1A 2DFCA 4M4PA 2QQKA 5FV3A 3TNPB 3NV1A 4Q8LA 1TG7A 1VBC1 2ZOEB 1S2BA 1YLLA 1SHWB 4XFCA 3CJXA 4YW6A 3GJAA 1C8NA 3WDTA 5CYYA 1IKPA 3KQ4B 3OY8B 4BB3A 5GZEA 3I59A 1LOBA 4SLIA 1RUC2 4NAMA 4NN0A 1EAH2 2WFF3 5CB7A 4D6SA 1VMJA 2TEPA 4N7UA 5FZEA 2A6ZA 1NLRA 1XNCA 5DUXA 4AFMA 4CYDA 3H0OA 1WLCA 5FO7B 1QJY1 4AHYA 2ADDA 4YZ4A 5EQUA 4YG3A 4FT8A 5D2AA 4XC9A 2RS33 3BOPA 3VBHC 2EALA 1YCIA 1LEDA 3LF7A 2NN8A 2DVDA 3A0NA 1EPZA 2XPJA 4RL7A 1XBFA 1WCKA 3AZXA 3RI9A 3OSDA 4X8NA 2XBO3 4LK6A 4B4RA 4ES8A 2EAAA 1XE0A 1BBT2 2XONA 4NMIA 5FO8B 4QGNA 3AB0A 2CGNA 1QJY3 3IDEA 4JV4A 3J8F2 3HT1A 4BQ4A 1UXZA 3OGVA 5B4XA 1O4TA 5HXMA 2E31A 2HWE1 2WYFA 3U37A 2WZEA 1L7RA 4Z92B 5KHGA 5FPVA 5LZ6A 3SH4A 1CESA 2BJSA 3KSCA 1BCXA 1W8UA 3TNQA 3A21A 2AYHA 4LKSA 3VZOA 2FMYA 2OPWA 4FTEA 4COYA 1WCDJ 4IEPA 1YFWA 1J59A 5LA0A 5LCWL 3UGGA 1MS3A 1YFUA 4QKNA 1LKNA 3AX4A 4YPJA 1EUUA 2XJTA 3IWZA 5FKBA 1QJEA 1QXJA 2WLQA 2D5FA 2RMU2 1DF0A 3POYA 5FAXA 3N9QA 1ZRFA 1XU2A 3LEIA 1BEV2 1PVC2 4CP9A 3VZMA 4H7MA 3GF6A 4IV3A 3LEGA 2Q8CA 3ZYFA 4FFGA 4LBLA 3TOJA 3RNSA 4CDWB 1GOFA 3O0XA 3LDKA 1OUSA 2Y6LA 5T5PA 1OKOA 2ZPXA 2XBO2 2JDNA 3AL6A 3ZXFA 4C90A 3OBZA 1UX6A 2JEMA 4FPYA 4LUKA 1BVVA 1WUVA 2X29A 2VOKA 4WM7C 3T2QA 2R6QA 3VLBB 3Q8FA 4TZDA 1MVQA 1OUXA 1ULGA 1BLZA 2XOMA 3ZFGA 1NAEA 1J58A 3KVBA 1W8OA 2WFPA 3W58A 1IG3A 4QPGC 5ACA2 2WBKA 3PVNA 4KWLA 2WLPA 3LEMA 2Z5WA 4RR3C 5DDJ2 3RG0A 1PGL2 1YHFA 2V73A 5FZDA 1W6PA 3EXUA 5I0UA 3MI8A 5A3WA 4I02A 1MR5A 1ONAA 4A42A 2D97A 2CHHA 1REDA 2D6OX 3VBSA 2L9LA 3WR0A 3MFAA 4IEQA 2VBDA 3ZYHA 4UFKA 4YG6A 5FY5A 4FOWA 4BQYA 4GWIA 4IE4A 1OLMA 3I2DA 5H9RA 4X6QB 1UZYA 2OQ7A 3OY8A 3PL0A 5EJ3A 3RMXA 3ZN6A 4EN9B 1UF2C 2YDEA 1SMVA 1HRI3 3DUIA 2ZAAA 4YVWA 1JU4A 3V0AB 4IEOA 3UGFA 2HH9A 3N3HA 1N1YA 3LIHA 4UWDA 4IERA 3WW3A 2ZHMA 2JG8B 1UXXX 3VBHB 3ZOIA 2W68A 2A6VA 5FMCA 1ALYA 1F4HA 2UY8A 3PIGA 1UCXA 4DMIA 5EP9A 4R9BA 1QGLA 1VIWB 4HK8A 2KA3A 1I9RA 3BU7A 1LHOA 3ACFA 4ET7A 1TQ5A 2ZGSA 3BPSA 2WT1A 2ZEWA 4MV2A 3ZN4A 3VBSC 4BDVB 1BBT3 2UWBA 2WS92 3VBRB 1H2MA 1UIKA 2VZ1A 3JUUA 1LHNA 4XIOA 1UAIA 3K48A 2RM23 5FYBA 5A3PA 2NPIA 1NXMA 5C8CB 5F3CA 1CAXA 3FLPA 3O1SA 4I0AA 3NO8A 2LROA 2HEYF 2RV9A 4B29A 2VZTA 2R0HA 3RQ0A 1ZBA1 5BNOA 3TRSB 4E8CA 3O1PA 4CPBD 3N7JA 4ARXA 1W04A 3M3QA 3VHRA 3N4MA 4AVCA 4NIDA 1RXFA 4XTPA 5HBAA 4COUA 1MQTA 1GFF2 3LA3A 1JZ4A 1KXGA 4EE2A 3KVAA 1V9U3 2EIEA 3IDAA 2WWJA 1UO9A 2O14A 4ATEA 5FWJA 1IG0A 5C5UA 5CFDC 2RM21 3SC7X 4HETA 1BZWA 5FZMA 3GJBA 4RR3B 2QUOA 5A6QA 4AFAA 4ZPIA 4HXCA 3FN9A 2D3PA 5FZ9A 3NL1A 3PTRB 1QXPA 1W6MA 4NPLA 3C7FA 4BXSV 2K9ZA 2WYSA 4D7YA 1Y43B 2GC0A 1MPXA 2A3XA 2BRTA 4KI5M 1E5RA 2WO3A 4KQ7A 1HN0A 3I2FA 4CDQB 1K42A 1XOYA 3ENRA 2Y6KA 1YC61 5BV6A 3WG1A 1GR3A 1YFYA 1LOEA 5BNNA 4PHZA 5T54A 1O5LA 4AFBA 1AYM1 1UMHA 3LPGA 2Z2SB 4CPBA 3VZKA 1KS5A 5DAWA 2J22A 5IVYA 2DCTA 1MS4A 2Y6GA 4XW3A 4KG8A 2FCTA 4Q2FA 4FTSA 4D69A 1H8TC 4CUBA 2OXBA 2C9KA 4WV8A 3WW2A 2JG9C 1V6JA 1AJKA 3AXDA 1KS4A 1REEA 2VECA 2E63A 4ES9A 4BXFA 4XMAA 4LHKA 1QJY2 3CJIA 1DQ5A 4LO7A 3AZYA 1W0NA 2VGDA 1SCRA 5A3MA 4NRQA 3AYEA 3I2HA 5DUWA 4GD4A 2B9VA 1ZBE2 2YUEA 2ZHNA 1DCSA 2DVAA 4Q0UA 5DDJ3 1WLWA 4JHTA 2YU1A 1WCUA 1CQ9A 1RMU3 3OUIA 4WM8B 2WNVB 1ZX5A 4DRRA 3HPNA 4V1PA 1Y7BA 3O1TA 1VBC2 3B9CA 2DF7A 2WA3A 4MXWB 4AEDC 4F3JA 2ZTNA 2IVIB 2KR2A 1VRH1 1CX1A 5FZ6A 2ZX3A 4I30A 2VOWA 3WHTA 1R1A1 1SDWA 3IDCB 5FP3A 5L73A 5BNPC 2VZRA 1FPN2 3WNLA 2PLV3 3ZSLA 1TEIA 3AMMA 3BN6A 5IVFA 5JSPA 2VZUA 4TYSA 4Q4W1 3IB3A 4AI3A 2YC0A 2XXZA 5G05L 3POWA 4QGLA 4QXHA 3ZXLA 4MG2A 4IGOA 2OZJA 5KBFA 2Y34A 4N9HA 4Z8BA 2ZX2A 2JDHA 3OEBA 2IXIA 2VW1A 4BIFA 3ZIXA 3KWVA 4OUEA 1TVGA 1AXYA 2G9GA 1ZZ8A 1KEXA 1QNWA 2GMMA 2UYAA 5JUVA 2NYYA 2RDQA 3AZWA 4JRLA 1QOSA 1P8JA 2GP3A 3MF9A 3ZMNA 1RUE3 1JZ2A 2ZGTA 3EJKA 1OQ1A 2D43A 5T52A 4LO5B 1J3QA 1O4YA 3V56A 2PLV1 3OGGA 1XSRA 5A7WA 4AQSA 3KF5A 5FLIA 5GZGA 5IK8A 4CXXA 1NQDA 4GMP3 3H8XA 3WF1A 1JMUB 1MZ5A 3JD71 4GWNA 3HAGA 4JGYA 2ZGMA 4W8JA 1JYWA 1OVPA 5A3LA 1ULFA 4LO8A 1QNYA 3RDIA 4JHZA 1W6OA 1M4WA 4RQPB 5FMDA 1VBE3 1SLLA 3VDDC 5BNNB 1WW7A 2ZKLA 2W87A 3PUHA 3T1MA 3ZPYA 3ZN6B 4GMP1 4MH0E 1FATA 3PVBB 3WNOA 4KWUA 3D3AA 5LASA 5LA2A 4XIKA 1EV12 3FC0A 4ZONA 1SLCA 2XJRA 2FDGA 2JENA 2W2IA 3BTAA 5DAVA 3W20A 4QPIC 5FYZA 4RHV3 1VBE1 4TTGA 2VMDA 4K8RB 2WO2A 4D0QA 4KBZA 4FPLA 1UD1A 3RSJA 2VQ0A 3ACHA 1KQRA 4COZA 1IS4A 3JB8A 1GYKA 2P37A 2R49A 4YZ3A 2WIIB 2A1XA 1S0JA 4NHLA 2A7AA 1ULEA 5LBFA 4A6SA 2MNGA 4CEWA 1W8TA 3X29B 1WBFA 2J1UA 3ZSMA 2YC4A 1EP0A 4L99A 2BP6A 1NCRA 1PM7A 3QH7A 4Y26A 1OF3A 2XWBB 3SISA 1WA6X 2CL2A 3WX5A 5FPUA 4I0BA 3K51A 2PHLA 1DDLA 4XJAA 1UPSA 1RUJ3 3FBMA 4N43B 1AR62 5FZ1A 2WKKA 2ZHKA 1ZM1A 3OUJA 3M8LA 4FSJA 3B02A 5HPOA 1W8NA 1DG6A 1JOBA 2E9QA 2VMGA 4X6RB 4GA9A 5A7SA 3CDZB 5JMCA 3OYWA 4FQZA 1DP0A 3PJYA 1PX3A 2PHUA 5F7UA 3KS7A 1UY4A 2Y0OA 3J7MA 3PUQA 5EJ1B 2X5IC 3ZXGA 2EXIA 2D6KA 1SFPA 1D0HA 3VBUA 5L36A 1YQ8A 2Z69A 2WNOA 4Y3OA 4Q0PA 5JIAA 4FFIA 4LKFA 3VD5A 3LA7A 1LJ7A 2CNAA 2R1DA 4BA6A 4KMQA 4HOOA 3ZKYA 3EBRA 2GDFA 1E57A 2OIIA 3ZSJA 4A7ZA 1VAKA 2WZR1 3VUOA 1ZBE3 4GH4B 1W03A 4P9GA 1YFXA 2LM3A 3MFCA 3UJOA 5JXIA 5KHKA 4WZCA 5AFEA 2XJUA 4P00B 3IKWA 3K4DA 4MVTA 3IZOA 1H1IA 1W2TA 2ILMA 2VNOA 3DF0A 3SNMA 4IESA 4YNIA 4AI1A 5JPNB 4XDPA 4NHYA 3O7OA 3O1OA 1JHNA 4ZKTB 1YO8A 4I09A 2A73B 3KCCA 2A6XA 2EXJA 4URTA 2GSYA 1QJX2 2LTNA 3ZSKA 4AK3A 1ZRIA 1DYKA 1GZWA 3BTYA 1WMXA 3O12A 4KH9A 1PGSA 5JZGB 2OVUA 3HT2A 4BK5A 2YB7A 2HYKA 1UKGA 2VCCA 5I0DA 4YW3A 4CDUB 4LBQB 2ES3A 4LE4A 4CDXB 1S0IA 4NVPA 4Y22A 2GNBA 4YVSC 3K4ZA 3LAGA 1OOPA 4QDRA 4QGMA 4Y5SA 4JDMA 1OLQA 1GQPA 1QQP3 2VZVA 3Q8EA 5JAXA 1AX0A 3B3QE 4B4QA 1RUOA 1QEXA 3VDBA 3IM0A 2EIBA 1CAWA 1PK6A 1AHSA 1S1AA 1W9FA 1YQ6A 2W1SA 3JD72 1Y4WA 5ABJA 1H1AA 4XBLA 4MXWA 3R05A 3RMYA 5FQ0B 3A0KA 3WF3A 5C8WA 4FPCA 3ETQA 1PIV2 3WSOA 3WUCA 5F3IA 4QXKA 4IV3C 1BK1A 2PLV2 2Y6FA 1NY71 1O6UA 2VMEA 1W6QB 3PTYA 4QT6A 3MW2A 1CAVB 4XABA 5F5CA 3RYPA 1JYTA 4K40A 4W6WA 3SITA 1GP4A 1C4RA 4FFFA 2HEVF 5FJKA 3ZR6A 4KU8A 4BPZA 1VBD1 2J1RA 3AC0A 3NQHA 4YW2A 4CXWA 1HB3A 1CPNA 4E4SA 1I5PA 4YLZA 4DIQA 4CXYA 3RZJA 1JTZX 2WS93 1EV13 4CCMA 3MZHA 3ACIA 3AYCA 3QD6A 1WD4A 3NAPA 4GULA 4JTNA 3CU7A 2BYVE 3LDBA 5JOXA 5BUVA 2DCKA 2NM1A 4KBBA 4Q4V1 4ATFA 4Z1VA 1PO22 1VBD3 3BTZA 1AR92 5I0TA 1JUIA 3ZVXA 3S5AA 3FX3A 2E53A 1X36A 3TYJA 3PHMA 1UNBA 1A8MA 1ULCA 1XYNA 3WXPA 1R1A2 4OMCA 3SXWA 4CEYA 3WQBA 5IVBA 5F8PA 4A44A 1OMIA 4FO9A 1HRI1 2D6NA 1WKYA 2MPFA 1C8M1 2SBAA 2Y33A 1JYXA 3GGLA 1DQ6A 4E27A 5J96B 1EUTA 2V5DA 4CCEA 1FOD1 3ACLA 3RPQA 5C9AC 3O1MA 5FK7A 4PBPA 2EXHA 4FOVA 2HWD2 2BTVC 4NPRA 4CDXA 2R062 3FUQA 4CCDA 2JICA 3VBFC 3WW1A 3AMHA 4XUPA 4DXRA 4N9IA 2QCSB 3MUY1 1HB2A 3M1HA 3AZVA 2P34A 5J09A 3LZZA 4JDOA 4QXCA 4OYUA 5HXVA 3DXTA 2ERFA 2CAVA 3KGZA 4HVRA 4P9WA 1WGPA 4K3UA 3HR9A 1NLQA 3K3OA 3MLKA 4Y33A 2VG9A 4E9KA 1W8HA 4XBNA 4URAA 4NIHA 3JBG1 3KQRA 2VBBA 4XETA 1AZDA 1AL0G 1W6QA 3MEPA 5IFPA 2FCVA 4DFSA 5IATA 3BU0A 1V6LA 4MGKE 5CNAA 1V6NA 3MLLA 4XHBA 1AYM2 2WZR3 4AVVA 3I2GA 1N1SA 3WVJA 4Z2AA 4YZ5A 1GU3A 4WVWA 2AH2A 3VHOA 3MV11 4BWOA 1UQXA 4CDQC 3LKJA 3ZO0B 4P9IA 4QU2A 1Q43A 2OX0A 1UW8A 1Z0HA 1PMHX 2BPA2 5K0UC 2C24A 3N35A 1YNAA 4BYYA 1OOPB 4PT6A 1HX6A 4LIVA 4RFT0 5A3UA 5F9TA 1PO12 1HQLA 4PF1A 5ISLA 1EAH3 4UI9L 2ZJCA 4CDUA 4QPGA 3TB0A 3RRDA 3N36A 4AE2A 1RINA 4BQWA 4IV1C 3TN93 4TLGA 1W6NB 4Y24A 3N7KA 4U36A 5EV7A 2GNMA 1UIJA 5C8CA 1BMV1 2OT7A 2WWUA 3RS6A 2WNEA 2ZX0A 3SKJE 2DDUA 3IPVB 2QQNA 4NHKA 4A45A 3IT8A 1H8VA 1PM4A 2JG9A 1SFNA 3DV8A 5F2SA 4DY5A 2ZX1A 4UFHA 3EMRA 1UX7A 4KWJA 1ZBA2 2C4XA 2P17A 4YW7A 5FPBA 3AJZA 1A8DA 2LS6A 4IGQA 4CCLA 2V09A 3P1IA 4LJHA 1WCQA 2XJVA 3VBOA 2G9ZA 5A70A 3C3VA 5K0UA 3ES4A 2RMU3 4H3WA 3PNAA 4RYDA 4ORFA 2QVSB 4FPHA 4L9BA 2OQ6A 3VB9A 2VE1A 3VKOA 3WNNA 1RUF1 3H9AA 5E88A 2RDNA 5EIYB 2PAKA 2YBPA 1HXS3 3BGAA 3B93A 1Y9MA 1LESA 1UY1A 2D6LX 2IC1A 5F5AA 2WFF1 1JYIA 4YYOA 1H8TA 3U4SA 4AI9A 4B1LA 1RVF1 3ECQA 4Q1PA 2MEV1 3OD0A 3POFA 5GZDA 1IPJA 1DGWA 1UOFA 4LBMA 5C3QA 5K0UB 2AR6A 1PZ7A 1T6GC 2W5FA 3L9JT 1UMIA 1SACA 2CYFA 4UF0A 3VBUC 2YZ4A 4N43A 3GCWA 3Q8BA 3VD7A 1POV1 3PDQA 1W8ZA 1VPHA 2DVFA 4D7TA 5LBBA 1D0GA 4I3GA 2HEWF 1FPN3 3T4VA 2V72A 3C2UA 4S2DA 1AR93 2H0BA 2Q1ZB 2YU2A 1W9WA 3IPVA 4XFAA 3OYWB 5C4WB 4XFBA 3N9LA 1UU4A 1KJRA 4P9LA 4FP2A 1FV3A 3H50A 4OVEA 4QKDA 2ZA9A 1CZVA 3JBG2 4FPEA 1K12A 3ES1A 5FPXA 3MW4A 5IAXA 1TMF1 3E5UA 1QIQA 2BZDA 2HWC1 1OVSA 2JDUA 3ZYRA 5D21A 1KRIA 1JN2P 2ATFA 3UETA 4CCNA 4OUSA 4FAGA 3BKZA 3N9NA 3O14A 5DDJ1 3ILRA 1RC6A 3JZVA 2I45A 2F4LA 4H14A 4MGSA 4XOGA 2JIJA 2HWD1 3ZXJA 3LWCA 1W2OA 4CP9B 2QDNA 2CWSA 5EXOA 1C28A 1VJ2A 2EXKA 3PUAA 4LKDA 4W50A 5D8AC 5APAA 1ZZCA 4HL0A 4QQPA 3WF2A 5AFBA 1FI2A 3AM2A 2VQTA 3WDXA 3SEEA 5DZGA 2XLFA 4N53C 2XBO1 1V6IA 1WLDA 4HT1T 1ASJ1 5GJ6A 5FXZA 4W6YA 1JOJA 4YVWC 3U4XA 1QOOA 4LIUA 1GNYA 4EWDA 4FXKB 2BW8A 5GALA 4IEVA 1XSQA 2RMU1 2DV9A 1NT0A 1F8VA 3MIHA 3HMYA 3I97A 3RZZA 3BIWE 1SLAA 2VVEA 2NMOA 3L2YA 5HV0A 4JX0A 4AQTA 3CKHA 1V6OA 2J1AA 3OUHA 4BIOA 1F2NA 4DXTA 3TEYA 3ABZA 5FBJA 2PMWB 5DUVA 1MS1A 3RZLA 2ZMNA 1VBD2 1JOPA 2OA2A 4G3YC 5DZFA 3TEWA 4Y5TA 2WZPP 3TEZA 2J42A 1NOVA 2YBKA 3NV4A 3LQCA 1NY72 3WP6A 4ZU7A 4Q29A 1NZIA 3P3PA 2GU9A 5E8AA 4K8FA 2HWE2 1W2AX 4Q4Y2 5FUNA 3DYMA 4OI0A 3ZFGC 4RGKA 4E4ZA 5FR3A 3PIJA 3T08A 1F31A 1AYN1 3ORJA 2CTVA 2GC3A 2RS32 1PO13 3J8F1 2IXKA 2WN3A 3ST7A 1POV3 3IBMA 4OHYA 4FPJA 1GQGA 4O7XA 4XPVA 5HCFA 4QX3A 5E89A 4O9GA 3ZXDA 4A6OA 5EYXA 5BNPA 4DXSA 1Q5OA 3E97A 1ZYBA 3I3DA 3AMQA 1EY2A 5DAQA 4CEWC 1AR71 4XUNA 4TLFA 5H9QA 5BNPB 1VBB1 1PK6B 3FJSA 4W4ZA 3T2PA 4EZ4A 3BODA 1GQHA 2R7EB 4XFIA 3ZX7A 2RS11 1BKZA 1OPOA 1AXZA 1K5MA 4XE9A 1O7FA 1S2KA 2NZ9A 3K77A 4IE5A 1OA3A 3AKQA 5CFCB 4BZ4A 1MQTB 1MS5A 1XNBA 5DZEA 4AOCA 2A6WA 4QX7A 3NV3A 4I3PA 2Y0IA 5FZ8A 3VBRC 5JXJA 2DBNA 2B45X 2VBPA 3RYKA 1WWYA 1QH7A 1DGRA 1SLBA 2BGPA 1LRHA 4IEXA 4LNVA 1RUG2 4RD7A 1CAWB 1QJU1 1PMJX 4HLTA 5F37A 1AVBA 4SBVA 1IPSA 3ALQA 2JE8A 1RHI3 3KZ4C 1R082 2TBVA 1DHKB 1RUJ1 3NNMA 4IE0A 4UW6A 5J98B 3WQ0A 4KGQA 1LHWA 3INAA 4CCKA 1JZ7A 5LEKA 4MADA 2K0GA 5EFUA 1HKDA 1ZRDA 1DGWX 2QQOA 2AREA 5FZBA 4M0NA 2VVFA 2CWMA 2P3YA 4BISA 4CRQA 5A32A 1YQ5A 2PHDA 3HQRA 1C1FA 4HZFA 4Z82A 3RGBA 5FZOA 2HWF2 3TAYA 1POV0 2G1MA 4K1ZA 1OA4A 5GKAC 1ST8A 2D5HA 1OC1A 2ZAHA 3ZFEC 1XYPA 2Q1MA 5CZKA 3ZKUA 4XF1A 3SH5A 1V6KA 4YW4A 5I91A 3BTXA 1H2KA 3BOWA 5FYHA 1QJZA 2BQPA 1OF4A 4XUOA 3VBFB 2EIGA 3V0AA 1AR61 2A5ZA 4Y1VA 5LB6A 3WHUA 3MIGA 1RUH1 3GZAA 1RUC3 4E8DA 1UPIA 2AENA 1ZREA 1X8MA 2G9FA 3WOGA 5FO9B 1ND3B 3GM8A 1YJKA 1J3RA 4J25A 1SCSA 4OI2A 1MS9A 4FBFA 1J1LA 1R091 2PHWA 3CF6E 2ZGKA 4LTAA 4M3CF 1S2EA 2W47A 5FIXA 2KM2A 4K9SA
chains in the Genus database with same CATH topology
5TSWA 3E6DA 4R8HA 1OOPC 3AKPA 1YUDA 4L2NA 1VBA3 2HJIA 4CP1A 2UWCA 2GH2A 2WQZC 3B00A 3ZYPA 4Q27A 1U5ZA 5EZWA 1L3JA 3T2TA 3WQ1A 4RSUA 3VZLA 3MDPA 5GLWA 5GM0A 2WNUC 2O0OA 1IS6A 5L7OA 1VB2A 5C8CC 1LCLA 3JD73 4LBKA 3MIBA 1IKQA 1JBCA 1KJLA 3JB4C 5HCBA 1FXZA 3ZYIB 1H30A 3IMNA 1ZNPA 3BPZA 2EAKA 4LA3A 3LB9A 4TSVA 5C4WA 4Q4Y3 4WVVA 3VL8A 1GZ9A 1I5ZA 1FMD3 2ZGOA 2BNMA 2VMIA 5B2GB 4E2QA 1DZQA 3GBWA 5KC5A 1MEC1 1DYPA 1QJX3 3VKMA 4R9AA 4HMZA 4N90A 1AR73 1OQEA 1AL21 5I0SA 3ZFFA 4AEDA 4DXZA 5FBZA 4WBBA 5LRRA 2TNFA 1N1TA 3UJQA 4LO6B 2HWB2 5F5QA 4FP3A 5T5LA 1NA1C 3S7EA 3WG4A 1RUJ2 1KITA 2BFUS 4JGYB 4M0HA 3FMGA 4H55A 2YMZA 1QJU2 2D40A 2D7FA 2QE3A 3W59A 3MPBA 2Q0AA 3GBFA 4AEDB 2A70A 4GH4C 3WUDA 4QQLA 2XWJB 5DG1A 4HKWA 3JU9A 1D4M1 4YW5A 3SLIA 4PIZA 4WM8C 5JPMB 4IV3B 4JTOA 4A2UA 5T50A 1ZBE1 4WM7B 2XVKA 3VGIA 2ZZJA 3AXEA 1DQ4A 3E5XA 4OLLA 2RS12 3PJQA 4XQWA 3B69A 1VBB2 2X5IA 5E16A 2XKOA 3WCRA 3WZ1A 4EWEA 4FAHA 1AR72 3AKSA 3AP6A 3AFKA 4RHV1 4HPKB 3O5SA 4YGCA 1Q8SA 1UU5A 4HN0A 3FWEA 1I1EA 2RR11 4CDUC 3ILFA 1N3PA 1YRZA 1GZCA 4FCAA 5FMOL 3GALA 1VP6A 4Y5Z0 3AZZA 5JZGC 1AYN2 4A7YA 2PFWA 3USUB 2X53S 4K21A 4Q4Y1 1UMZA 2OYZA 1S0CA 4P9YA 1QDOA 4RGAA 1LEMA 4K6BA 2BGCA 5IK4A 2I07B 4R4XA 5BYNA 1COV3 2IZWA 3DPRA 4R52A 1DQ0A 4XFHA 2VULA 2A71A 4COVA 5KXCA 3ZMOA 5KWRA 4Q8KA 1C3HA 3VKFC 1YIPA 3CJIB 2YV8A 1R083 3VDDA 2R16A 2ZS6B 4QD2A 3FZ3A 3ZYGA 2OUHA 4YRDA 1S0FA 1LU1A 4NOTA 1ND3A 4YARA 3H3UA 3VDDB 1TNFA 3VKNA 4HSLA 1C1LA 4M3CA 5ABJC 1QMJA 4IXLA 3AP9A 4G9SB 3FE5A 3WP3A 3DPRB 3JBG3 1ND2B 2A3WA 3AK0A 4AI2A 2C0ZA 2WS91 3KCYA 4N43C 1W6MB 4QQ2A 1X8EA 3USUA 1ND2C 4FVVA 3AP7A 5CBLA 1NA1A 3T1LA 1AR83 5SV5A 3DGTA 5JSOA 1ZRRA 5C6CA 2PYTA 3D5OA 1JYCA 1HDKA 5I8YA 3ZSEA 2HWC2 2PN5A 1REFA 1D4VB 1CR7A 2BEOA 2HWE3 2R32A 3I59B 3TBDA 1AX2A 2RJKA 4Y22B 4OHVA 2FZ1A 1LOFA 1RMU2 4L8QA 1GANA 1ENSA 4QPIB 4AVTA 5FOBB 2XJSA 4O9EA 3M3IA 2VMHA 1B35A 1AR81 1J1TA 3WG2A 1MVEA 3R4SA 1W0OA 4M3CE 1Z7S1 1CAUB 2B46X 5JWPA 2BUKA 3UKVA 1DZTA 4ISQA 2P2KA 3CLPA 2MEV2 4B8EA 1H9PA 5FREA 2LALA 5EWSA 4MGZE 3KM5A 4R4ZA 2WQ4A 3R0RA 5CA6A 3RJ2X 1Q8QA 4R9DA 4PF5A 2WJSA 1HXS2 1NCQB 3FLRA 1XNDA 4GIQA 1M06G 4OI1A 4WZFA 4K1YA 1RUF2 3OGJA 1N1VA 3B01A 3M4FA 1GZWB 1TNRA 1KDMA 5DUUA 1OKQA 4DOUA 1CIWA 2R071 5CAZA 1X7NA 2DUQA 1W39A 4KGGA 1S0EA 4DRVA 3PVOA 2D6MA 2FMDA 3ZN5A 2VH9A 3SH3A 4AEMA 3KD4A 4M00A 4HBNA 2QNKA 3ATGA 3KMHA 3I7DA 4LLFA 5CIRA 5ACA3 4QMAA 4JGZA 3PMSA 4KG0A 2JE9A 1W6PB 1GV9A 4YM0A 3U0ZA 1TME2 4QM9A 2W52A 4KU7A 4QPIA 4XF4A 4CDWA 2C9AA 2XHKA 1GNHA 4LHLA 3V64A 2YROA 5LEJA 5CG8A 3FUOA 1RUD2 4I01A 4ASMB 2Q4SA 1KFXL 5LK5A 1Q8PA 2JX9A 1G86A 3M3CA 1JH5A 3AMNA 4JRAA 1WD3A 2G4IA 4GWMA 3VHNA 1NE6A 4BE3A 4PLOA 1BBT1 1OA2A 5BPXA 3AYDA 2HWD3 3AJYA 5DG2A 5I8TA 1HW5A 3BALA 1EYBA 4HFSA 5I8SA 5GZGA 1OSGA 2B42B 2I2SA 5J37A 3JQXA 1LU2A 5A33A 1C8M3 4IQPA 1UZZA 4D94A 4UW3A 2ET7A 1RL3A 3WCSA 3CNAA 1QDCA 2DU0A 2D3SA 2EVXA 4CEYB 5A33B 2JDZA 4PLMA 3OBTA 4COWA 1U5IA 1EAH1 4KL1A 1HQNA 2GC2A 4BM8A 2F4PA 3QACA 3B9IA 3G6JB 4AI0A 4Q0QA 3ASIA 3VBFA 4PQ9A 1YIFA 4XHXA 1FOD2 1DZRA 4UBHA 1HV0A 2ZZQA 4C1WA 2GN3A 2E7TA 2YY1A 4S2FA 1RHI1 1G9CA 4NWVA 1ZRCA 1D2QA 1Q8VA 1NCQA 2GALA 4RS5A 4LBQD 4MZUA 1CN1A 1H4GA 5AVAA 2VUJA 2R072 4C91A 1IS5A 3ZXKA 5A32B 4W6XA 4QHBA 2PA7A 1QHDA 3AKTA 4WVMB 4FTBA 2BNOA 3MPPG 1LENA 2R0FA 2FHRA 4QPYA 5T55A 3ZIWA 1ZZ7A 5CVRA 4AXOA 1U5YA 3J26N 2ENRA 5D8AA 3PVEA 1PIV1 1A78A 1IOAA 4BCUA 5HI0A 2BFUL 4LBJA 1LTEA 4YSFA 2EA7A 2XL7A 2DU1A 3D0JA 2C5DA 1B35B 2R1BA 5FPZA 1IZ3A 1PVXA 2PHXA 2VOXA 4YG0A 4CDWC 5AC91 3RJRA 1MS0A 2N7GA 1PGW1 1RMU1 4AVBA 2DUPA 1LOGA 2JG8C 2HWB3 4M01A 1OFSA 2DVBA 4MH0E 4P9XA 4LE3A 3ROUA 4LBQA 2VOVA 3AMPA 3I8TA 1AXKA 4LBNA 4RQPC 1AL23 1VRH3 5FOJB 1TE1B 2HWC3 4Z2WA 1MZFA 4HANA 4IEUA 1RUD3 3D6EA 4EN8B 4AFDA 2E7AA 2H6BA 3RWNA 3VZJA 3NAPC 2ZHLA 4LEJA 3NJZA 3AFGA 2LUWA 3FBYA 4INDA 1RVF3 4B4PA 5T5OA 4JVAA 5IK5A 2RS13 1G9AA 4FOYA 1SLIA 3KGLA 1KD7A 4YGBA 2P3KA 4WVMA 4C1XA 1GBGA 2WZR2 4JGYC 1HRV3 5BNQA 3H3ZA 4LA2A 3TWIA 2XLGA 2P3JA 2R043 4XTMA 1HQWA 1KFUL 4I2OA 3OTFA 5JI9A 2E51A 1AR63 1NLSA 1JW6A 3ZFFB 1WCSA 4OHWA 3GHMA 3OPZA 4BHPA 3FHIB 3MF6A 4XYXA 2VPVA 5FRAA 1QJU3 1WMEA 1VBA1 3ZFGB 4GQ7A 5IK7A 3O0WA 1QQP1 4UW4A 3FFZA 4RA0A 2QQPA 3BCWA 4AYUA 2PQQA 4H7LA 2CGOA 2QJVA 2R041 2Q30A 4J1WA 1CPMA 4TWTA 1Y9QA 4F7ZA 4Q4X2 2PELA 3DPRC 2DTYA 4B7KA 3VL9A 4AF9A 2W0XA 1YI7A 3IIAA 4GMP0 4XJ8A 1BXHA 1O91A 4BMEA 4JGZB 2DWRA 1WBLA 4JQRA 2RR12 3ELNA 1VALA 2Y38A 3KB5A 5K7PA 2Y26A 4RHV2 4YVWB 1ZZBA 4AGRA 1VBE2 2D44A 1RUH3 3H8UA 4YM3A 5JLVA 1PMIA 4AVAA 3WINE 4J6GA 4WVZA 1GNZA 5FCCA 1EV11 1V9U1 1LHUA 2UYBA 1FNZA 5I0RA 2B9UA 2H0VA 3ZFFC 4XMIA 2F6BA 2QZ3A 4GXLA 4XJWA 3VHPA 3IDBB 2E6VA 3D0SA 2VU9A 1N3QA 3E5QA 4L97A 2WC2A 1XNKA 2ARBA 2JJ6A 1NQJA 1D4M2 5GZCA 2PHFA 1U12A 1Y3TA 1BVP1 2D6PA 1ZVFA 4DS0A 1RUE2 5FLHA 3H7YA 1I3HA 5K9YA 1PHMA 4AHXA 5F6LB 1MZEA 3GYDA 1ENXA 1RUI2 4GH4A 1HRV1 2WT0A 4MXVA 2RS51 3V0BA 2P3IA 3MYXA 3VBHA 3SCFA 1PZ9A 3R6SA 3JQWA 2HWB1 4AGGA 4PDWB 1WMFA 1X33A 1RIRA 2OPKA 4AI8A 4IEYA 2ZBJA 1AJOA 2GMPA 4BQ1A 1HV1A 1MACA 1RJ7A 3GNEA 4GB31 3ZFEB 3ZYJB 1SQ4A 3HD8B 1S0GA 4KWKA 1WW4A 4YFWA 3NWKA 4GB32 2CAUA 1DGLA 1UL9A 4Q26A 1V6MA 1MEC2 2JG9B 2ZABA 2VQAA 4Q4W2 1D4M3 1K5MB 1LOAA 4Q1RA 1HRV2 3J4UH 1QWRA 1RUI1 1H0BA 2D98A 2IXHA 3VKLA 4KNCA 4EWAA 1VRH2 2ZGNA 4PIXA 2WWSA 3WQ7A 5L7OB 1NXD1 1RITA 3POSA 1C57A 4XF0A 4XJ9A 2OUJA 3UL2A 1A6CA 1QH6A 2OW4A 2DYCA 1U0AA 5EYYA 1H2LA 1SBFA 4S2GA 3SCGA 3KT7A 5C9AB 1NG0A 4Q4W3 1PO23 5CFCC 2IFWA 1OLRA 3LGRA 1LOCA 1F5FA 2QFEA 2YYOA 3QBQA 1BJQA 5J3UA 1JUHA 3LOBA 2B5HA 4XQDA 1SBEA 1DIWA 2PTMA 3G7DA 2YPJA 3KLSA 4QQHA 4CEWB 4Q4X3 2O8OA 3U07A 4FPFA 2CV6A 3LA2A 4JGZC 1DFQA 4XXAA 1N3OA 2XJQA 4YW1A 1QF3A 1OI6A 4EN0A 4XDQA 4IV1A 2JECA 2JE7A 4NR1A 4BLJA 4XF3A 1PNFA 4A3XA 4Q4X1 4WM8A 5K8SA 3WDYA 2PAEA 3Q9OA 2R042 2WSVA 4XJZA 1Q8OA 4AW7A 2W39A 1QQP2 2W08A 3S30A 1AF9A 1VBA2 2QDRA 4QX5A 4UBGA 1CONA 1VBC3 4GKXA 2RM22 3QCWA 4CZSA 3B94A 2HWF1 1DLLA 3IN9A 2DCJA 3THTA 1LULA 3WDWA 4JAAA 3QLQA 1FOD3 3LSDA 1KDKA 4Y20A 3AP4A 3ZDSA 3E6BA 2DFBA 2BNNA 1DU3D 3MIDA 4OULA 4MX3A 4U2AA 3GZTB 1D2SA 3AKRA 3KCXA 1LB2A 2JG8A 3H1MA 1FAYA 4HN1A 4FQ4A 5H9SA 1LHVA 1W0PA 1RUG1 3A4UA 4UXAA 1XRUA 3ILNA 4AQ6A 1BQPA 3MICA 2HWF3 1CX4A 4XILA 1QOTA 4HKLA 4FPOB 3MIFA 4Z07A 5FQ0A 5LRSA 1O3RA 1RGSA 5FFOC 4R9CA 1MEC3 1NCRC 4PCRA 3RYRA 1C5IA 4LLOA 1WW5A 4YM1A 3N7MA 1WA4A 3RI8A 1H8TB 3WG3A 4FXGB 2FBEA 4S2HA 4XEZA 2BBVA 4DZGA 1A3KA 1ASJ3 1GLHA 5AC92 4RGGA 3TN91 4AGVA 3L2HA 5CFCA 4DPNA 2DCZA 2VVDA 2RHPA 2RS31 3OD4A 5JSRA 2GAUA 1APNA 2NP0A 4HKOA 4PDWC 1G9BA 4FOQA 2BWCA 5DXDA 1YXWA 1S0DA 3NKGA 3OCPA 1ZZ9A 1WMDA 4LBOA 4D3WA 3LSEA 4PIYA 2YGMA 5FLJA 2ZGRA 4ITCA 2A6YA 2R073 3D8CA 2DUOA 1PGL1 1AUYA 2UY9A 2XVLA 3WT3A 1JXNA 1VR3A 3THPA 3WW4A 5CFDB 2VUAA 1Z7S3 4RR3A 3S6PA 5ACA1 1PK6C 3S7IA 2C1FA 4BLIA 3PLQA 1RTVA 3HQXA 4LR4A 1OHFA 4Q4V3 3SCHA 2RR13 1ASJ2 1WLTA 1O5UA 5F6KA 2MEV3 3CJIC 1LODA 1RHI2 1BYHA 5BNOB 1Q3EA 4QQOA 3APBA 4YM2A 3M7AA 4PLNA 1BEV1 1PVC1 1H1MA 4J1XA 2Q5TA 2DCYA 3H7JA 5H9PA 3FLTA 1B09A 3N7LA 4META 3MGUA 2WNUA 5L7OC 4LT5A 4CEYC 3H1YA 3ZXAC 4YZ1A 4YGEA 3M3EA 4PBOA 1G6NA 3OJBA 1TMF2 4OI4A 5JOWA 4YFZA 2IFRA 3NV2A 3GHNA 1HLCA 4FPGA 5HCAA 1I6XA 3R4UA 2WINB 3V0BB 1C5HA 3M2MA 1TME3 2ARXA 3NW4A 4DY3A 3TN92 3USSA 1IQAA 3OF1A 1ZA4A 4AQ2A 3VV1A 3HN1A 2O8QA 3ZFEA 3GBGA 1OFNA 2CGPA 3BB6A 2ZGUA 4XXPA 1RVF2 2XKPA 1RUD1 4MSVA 1RB8G 3VBOB 4YGDA 2UU8A 5J7MA 2X8KA 1NYWA 4P9JA 2WFF2 2XGXA 3ZXEA 1DQ2A 2CY6A 2PHRA 2E7QA 2VXRA 4QPGB 4AWDA 1TME1 2XL9A 3WDVA 5FTTC 1RUC1 2ZCWA 5JOYA 1TMF3 2WNVC 1HIXA 3VN4A 1DBNA 4Q0VA 3JCIA 4A7KA 3MLJA 4OHXA 4E4DX 3DL3A 1W6NA 4LULA 1U5XA 3UKTA 3WP4A 2XVGA 2XH6A 4ZU5A 4HK9A 1ULDA 1G8WA 1COV2 5JIUA 4ISRA 1LOFC 1PNGA 4XFGA 5JI7A 5JOZA 3WDUA 5CADA 2ZGQA 1ZBA3 2GNDA 1S55A 4N53B 5C33A 5KHJA 1B35C 1R1ZA 4NWWA 2DTWA 1HXS1 3EQEA 1WW6A 2WNVA 1PO11 3J8F3 5D8AB 1XXNA 3WV6A 2FQPA 3SHRA 2ZGPA 1RJ8A 2B8MA 2IXJA 1SBDA 1R093 2UURA 1Z7S2 4DINB 5JZGA 5KC6A 1LR5A 3D82A 1XU1A 1AR82 1ENQA 4X8PA 4NO4A 4Y1XA 5BNOC 3S0MA 4F8AA 1VBB3 3OBRA 1CJDA 4LHNA 2AUYA 1S0BA 2QZ2A 1G7YA 3R4DB 4XJUA 4NHMA 1NA1B 5JCTA 4EROA 2IXLA 5GLUA 4FPKA 2RJLA 2TUNA 1O3TA 4RS5B 5D1IA 4CDXC 1O4ZA 4HVOA 5C4WC 4XQ4A 4IV1B 1PIV3 4B7EA 2NMNA 5T3NA 1ND2A 4BH9A 1OD5A 4IL7A 3NVCA 2GC1A 1OQDA 2H6CA 2WL1A 4QM8A 2Q8OA 1ND3C 4PJYA 3HIFA 2WA4A 3VBUB 5AC93 1RUI3 4BMBA 4AHZA 2R061 3DKWA 1IGOA 1QKQA 3D4KA 4W65A 4B3NA 2DURA 4ZU4A 1LGBA 3O0VA 3NAPB 2VNRA 1XYOA 1C8M2 3I4IA 4HSJA 5JVVA 2PHTA 1HRI2 4DNYA 3EHKA 2IWGB 5ABJB 3E6CC 5C9AA 2RS53 4L11A 4GALA 2A75A 3QOPA 4IETA 2JXAA 2BWAA 1SFYA 1FMD2 1AR91 1PO21 2HKXA 2ZMLA 4Q4V2 5GLZA 3VZNA 1V00A 4MYEA 2WNUB 3KT1A 2R063 4OFGA 4JCKA 1R1A3 4UW5A 3M70A 2DVGA 1XQNA 4E2SA 4LO4B 1Q56A 4K20A 4N53A 5KHHA 1YJLA 1G9DA 2GMEA 3KT4A 5J36A 3VBRA 2WSUA 1NE4A 4CP0A 2RS52 1YI9A 3NSTA 1PZ8A 3ME2A 1X50A 2A3YA 4MGIE 3WD5A 2VY0A 1LECA 3AP5A 1MQTC 2ZMKA 1CJPA 1H4HA 2O1QA 3WP5A 1F5JA 1QXRA 2QKDA 1RUE1 5I93A 2ZACA 4I0WB 1AYM3 1N47A 3AYAA 1VLNA 4PDWA 4BOWA 1GKBA 3LOIA 1AX1A 3B5LB 1W6OB 2NLRA 4WM7A 3I54A 3WY6A 2V5YA 1H2NA 4GKYA 5T5JA 1CAVA 5LK7B 4OHZA 1X82A 5GLVA 1URXA 2EF6A 2ZGLA 1ZZ6A 3UK9A 4ONUA 4OZXA 5JR7B 1V9U2 1O3QA 5KXDA 4MGYE 4LUMA 5BXXA 5KXEA 1SLTA 1VB4A 1QU0A 4P5HA 2BVVA 3GZUC 4IEZA 4AHWA 2AGSA 3HBZA 2B39A 5FDBA 1QJX1 1MZ6A 5SV8A 2VNGA 3CEWA 4XBQA 2JD4A 1LGCA 2PAMA 3VBSB 3MW3A 4XFFA 2UWAA 2RE9A 1DGRN 4MLOA 5JDBA 5FMOS 2XG3A 1UU6A 1NCRB 4Q0SA 5KHIA 1UKRA 2OZ6A 1AYN3 1H9WA 1UN1A 4EV0A 2ZKNA 3HWJA 1MS8A 5L19A 2VW0A 3QH6A 4D7SA 3P3NA 4JC1A 4ZXKA 4AG4A 1FX5A 4K7JA 1IPKA 4YVSB 1CGPA 1FT9A 3U10A 2XLAA 2D3RA 2IXCA 1FNYA 1AL22 5IUQA 1OPMA 4AEKA 4L92A 2R30A 2GN7A 3NKTA 1IHMA 1FMD1 4Y4YA 4YVSA 2XUMA 1VAMA 3PMEA 3CO2A 2FZ2A 2I74A 4IEWA 1G9FA 1V70A 4C0HA 1CD3G 4GB33 1FV2A 1IS3A 5GZFA 3U11A 2NQYA 3UV9A 4JDNA 4CP2A 3EO6A 4P14A 5GLTA 2BVBA 2Z42A 1O3SA 2B7YA 1QY4A 3H1WA 3MIEA 3WNXA 1GSLA 2GZWA 4EN7B 2XJPA 4M3CB 4AVSA 3DN7A 4DB5A 2VW2A 4Y1YA 5CFDA 1DQ1A 4CDQA 2JKBA 4Y1ZA 4OUMA 2ETEA 5J48A 1EPWA 2GH8A 2SLIA 4E2GA 1ENRA 5BY5A 4XZPA 2ZX4A 2MHFA 3SMHA 3UKNA 2AZ5A 4AFCA 1J3PA 1BMV2 1PGW2 4YZ2A 1CAUA 1CVNA 1YYNA 1NCQC 4AEJA 1XE8A 5AVPA 1BEV3 1PVC3 2D93A 1R092 1Z78A 2GNTA 5KXBA 4MUVA 1SEFA 4HPKA 4C0BA 4N7IA 2K2SA 1RUF3 1RUH2 2YHJA 3M3OA 4XF9A 3WLUA 5F1RA 4EN6B 3URFA 5IT6A 2YXSA 5CG9A 1GICA 2WT2A 1YWKA 4RQPA 4ASLA 3CL1A 1RUG3 1RUNA 1XE7A 1LGNA 2YGLA 3VBOC 2Z79A 3V65A 5E1RA 1W2UA 1K5MC 3B7MA 2KXLA 4DQAA 1COV1 4Y1UA 1FYUA 4Y20B 1VAVA 1F9KA 4CTEA 1NZCA 5BNNC 2XB6C 2X5IB 3FFQA 5CU1A 4F83A 1FPN1 4G4FA 1R081 3LCPA 4HVQA 1CAXB 4EJRA 3J9SA 2ET1A 2DFCA 3TNPB 3NV1A 4Q8LA 1VBC1 2ZOEB 1S2BA 1YLLA 4XFCA 3CJXA 1C8NA 3WDTA 1IKPA 3OY8B 5GZEA 3I59A 1LOBA 4SLIA 1RUC2 4NN0A 1EAH2 2WFF3 5CB7A 2TEPA 4N7UA 2A6ZA 1NLRA 1XNCA 5DUXA 4AFMA 4CYDA 3H0OA 1WLCA 5FO7B 1QJY1 4AHYA 4YZ4A 4YG3A 4FT8A 2RS33 3BOPA 3VBHC 2EALA 1YCIA 1LEDA 2NN8A 2DVDA 3A0NA 1EPZA 2XPJA 4RL7A 1WCKA 3AZXA 3RI9A 4X8NA 2XBO3 4B4RA 4ES8A 2EAAA 1BBT2 5FO8B 4QGNA 3AB0A 2CGNA 1QJY3 3IDEA 4JV4A 3J8F2 3HT1A 1O4TA 2HWE1 4Z92B 5KHGA 3SH4A 1CESA 3KSCA 1BCXA 4FTEA 3TNQA 2AYHA 3VZOA 2FMYA 4COYA 1WCDJ 4IEPA 1YFWA 1J59A 1MS3A 1YFUA 1LKNA 3AX4A 2XJTA 3IWZA 1QXJA 2WLQA 2D5FA 2RMU2 1DF0A 3POYA 5FAXA 1ZRFA 1XU2A 1BEV2 1PVC2 3VZMA 4H7MA 3GF6A 4IV3A 4LBLA 3TOJA 3RNSA 4CDWB 3O0XA 5T5PA 2ZPXA 3ZXFA 2XBO2 4C90A 1UX6A 2JEMA 4FPYA 4LUKA 1BVVA 1WUVA 2X29A 2VOKA 4WM7C 2R6QA 3VLBB 4TZDA 1MVQA 1ULGA 3ZFGA 1J58A 2WFPA 3W58A 4QPGC 5ACA2 3PVNA 4KWLA 2WLPA 2Z5WA 4RR3C 5DDJ2 3RG0A 1PGL2 1YHFA 2V73A 1W6PA 3EXUA 5I0UA 3MI8A 4I02A 1MR5A 1ONAA 2D97A 1REDA 2D6OX 3VBSA 3WR0A 3MFAA 4IEQA 4YG6A 4FOWA 3I2DA 5H9RA 4X6QB 1UZYA 3OY8A 3RMXA 5EJ3A 4EN9B 3ZN6A 1UF2C 2YDEA 1SMVA 1HRI3 3DUIA 2ZAAA 4YVWA 3V0AB 4IEOA 3N3HA 1N1YA 4IERA 3WW3A 2ZHMA 2JG8B 3VBHB 2W68A 2A6VA 1ALYA 2UY8A 1UCXA 4DMIA 4R9BA 1QGLA 1VIWB 4HK8A 2KA3A 1I9RA 3BU7A 1LHOA 1TQ5A 2ZGSA 2WT1A 4MV2A 3ZN4A 3VBSC 1BBT3 2UWBA 2WS92 3VBRB 1H2MA 1UIKA 3JUUA 1LHNA 4XIOA 1UAIA 3K48A 2RM23 2NPIA 1NXMA 5C8CB 1CAXA 3FLPA 4I0AA 3NO8A 2HEYF 4B29A 2R0HA 3RQ0A 1ZBA1 5BNOA 3TRSB 3N7JA 3M3QA 3VHRA 3N4MA 4AVCA 5HBAA 4XTPA 4COUA 1MQTA 1GFF2 3LA3A 1KXGA 1V9U3 4ATEA 5CFDC 2RM21 4HETA 1BZWA 4RR3B 2QUOA 4AFAA 2D3PA 3NL1A 1QXPA 1W6MA 2K9ZA 4D7YA 1Y43B 2GC0A 2A3XA 4KQ7A 4CDQB 3ENRA 5BV6A 3WG1A 1GR3A 1YFYA 1LOEA 5BNNA 5T54A 1O5LA 4AFBA 1AYM1 2Z2SB 3VZKA 1KS5A 2DCTA 1MS4A 4XW3A 4KG8A 4Q2FA 4FTSA 4D69A 1H8TC 3WW2A 4WV8A 2JG9C 1V6JA 1AJKA 3AXDA 1KS4A 1REEA 2VECA 2E63A 4ES9A 4XMAA 4LHKA 1QJY2 3CJIA 1DQ5A 4LO7A 3AZYA 2VGDA 1SCRA 5A3MA 3AYEA 5DUWA 1ZBE2 2YUEA 2ZHNA 2DVAA 5DDJ3 4Q0UA 1WLWA 1CQ9A 1RMU3 4WM8B 2WNVB 1ZX5A 4DRRA 4V1PA 1Y7BA 1VBC2 3B9CA 2DF7A 2WA3A 4MXWB 4AEDC 4F3JA 2ZTNA 1VRH1 2ZX3A 4I30A 2VOWA 3WHTA 1R1A1 1SDWA 3IDCB 5L73A 5BNPC 1FPN2 2PLV3 3ZSLA 1TEIA 3AMMA 5JSPA 4TYSA 4Q4W1 4AI3A 2YC0A 3POWA 4QGLA 3ZXLA 5KBFA 2OZJA 4N9HA 4Z8BA 2ZX2A 4BIFA 2IXIA 2VW1A 3ZIXA 1AXYA 2G9GA 1ZZ8A 2GMMA 1QNWA 2UYAA 2NYYA 3AZWA 4JRLA 1QOSA 3ZMNA 3MF9A 1RUE3 2ZGTA 3EJKA 1OQ1A 2D43A 5T52A 4LO5B 1J3QA 1O4YA 3V56A 2PLV1 3OGGA 4AQSA 5FLIA 5IK8A 1NQDA 4GMP3 1MZ5A 3JD71 4GWNA 3HAGA 4JGYA 2ZGMA 5A3LA 1ULFA 4LO8A 1QNYA 3RDIA 1W6OA 1M4WA 4RQPB 1VBE3 1SLLA 3VDDC 5BNNB 1WW7A 2ZKLA 3T1MA 3ZPYA 3ZN6B 4GMP1 1FATA 3PVBB 4XIKA 1EV12 3FC0A 1SLCA 2XJRA 2JENA 3BTAA 4QPIC 4RHV3 1VBE1 4FPLA 1UD1A 3RSJA 2VQ0A 1KQRA 4COZA 1IS4A 3JB8A 1GYKA 2P37A 2R49A 4YZ3A 2WIIB 1S0JA 4NHLA 2A7AA 1ULEA 4CEWA 2MNGA 3X29B 1WBFA 3ZSMA 1EP0A 4L99A 1NCRA 1PM7A 3QH7A 4Y26A 3SISA 2XWBB 3WX5A 2CL2A 4I0BA 3K51A 2PHLA 1DDLA 4XJAA 1UPSA 1RUJ3 3FBMA 4N43B 1AR62 2WKKA 2ZHKA 1ZM1A 3M8LA 4FSJA 3B02A 1DG6A 2E9QA 2VMGA 4X6RB 4GA9A 5JMCA 3OYWA 4FQZA 3PJYA 2PHUA 3KS7A 2Y0OA 2X5IC 3ZXGA 2EXIA 2D6KA