3UVCA

Mmp12 in a complex with the dimeric adduct: 5-(5-phenylhydantoin)-5-phenylhydantoin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHAIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Characterization of fragments interacting with MMP-12
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 49
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2011-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3uvcA00
3K7LA 4H2EA 3F15A 1JKYA 1FM1A 3AIGA 2POJA 1CQRA 3LK8A 3OHLA 1K7IA 2L0RA 3KECA 1XFZA 4ILWD 4XM6A 1GE6A 3RTSA 2X3AA 2AIGP 2W0DA 4DPEA 4H49A 5L79A 1XFWA 2RJQA 3DSLA 4PKWA 4GR0A 1BIWA 1Q3AA 2OW2A 2MZEA 4JP4A 2Z2DA 5BOYA 1Y8JA 2K2GA 4H1QA 3VTGA 4XCTA 5JMYA 3I7GA 3WV1A 1BQOA 3HY7A 3LQ0A 3LJTA 1CGEA 1WNIA 2D1OA 3UVCA 1GXDA 1MMBA 4FVLA 1HOVA 2TCLA 1UEAA 3HDBA 2OW9A 1QUAA 1R55A 3LJZA 1BKCA 1GKCA 1KAPP 2ERPA 4IJOA 4DF9A 4FXYP 5D1SA 1QIAA 3Q2HA 3RTTA 1XUCA 2J0TA 1D8FA 3MA2A 1EB6A 3O2XA 4JQGA 1IACA 1ZXCA 1A86A 3LUNA 3DL1A 3LQBA 4GQLA 4WK7A 3USNA 1RM8A 4ZR5A 4HMAA 1BKCI 1GO8P 3L0VA 5H8XA 1JAPA 1A85A 830CA 5D1TA 5CZMA 4DV8A 1G49A 2SRTA 1MMPA 3LEAA 2KRJA 4GF1A 4PKUA 1BKCE 1XURA 1Y0VA 3EDHA 1I73A 2N8RA 1MNCA 3N2VA 2XS3A 3EWJA 1OS9A 2X3CA 4G9LA 5I0LA 1R1HA 3B92A 3I7IA 4PKTA 1ND1A 1XFUA 4QKZA 4XBHA 3E8RA 4I03A 1DMTA 1PWQA 1B3DA 2AYKA 3U1RA 1HTDA 3HBVP 3SHIA 5I43A 4J4MA 3LUMA 2USNA 1YCMA 4GR3A 2OXUA 1KBCA 1IADA 2OXWA 1L6JA 3N2UA 1CGFA 3LIRA 1FBLA 3K7NA 3DNGA 2OVXA 1GKDA 2WO9A 2PJTA 1R1IA 4H76A 1SRPA 3P1VA 4WF6A 3F16A 2FV9A 2CLTA 1JJ9A 1ATLA 1R54A 2OI0A 1GE5A 1SLNA 1D7XA 1QICA 2DW1A 4L63A 4GUYA 4EFSA 4PKRA 1SLMA 2OW0A 4H84A 3TVCA 5I4OA 3EHYA 1BM6A 4IUWA 2DDYA 5CXAA 3P24A 3B2ZA 1BUVM 2EROA 1AYKA 1UTZA 4WKEA 5D3CA 2W15A 3F19A 3TT4A 2D1NA 1C8TA 1JAOA 1HV5A 2WO8A 1BZSA 1YP1A 1ZVXA 4AUOA 2OW1A 1CK7A 1SMPA 1EUBA 3F18A 1SATA 2DW0A 2X3BA 1GE7A 1Y93A 4A3WA 1G9KA 1QIBA 5BOTA 4A7BA 1S4BP 1KUIA 1YOUA 1PWWA 3AYUA 1IAEA 1R1JA 5LABA 3V96B 5D1UA 1O0TA 1PWPA 2MLRA 4FXQA 1XFVA 3LGPA 4FU4A 1Z3JA 4XM8A 1JIWP 4AXQA 4L6TA 3AYKA 3LILA 5D7WA 4WZVA 1CAQA 2A8HA 2W13A 5CUHA 1UTTA 1KUFA 3EDZA 3O64A 1IABA 5I2ZA 2JNPA 1FLSA 3LJGA 3EDIA 4CTHA 4H30A 4AYKA 1G4KA 2W12A 966CA 5I12A 3HY9A 3KEJA 2DW2A 3KWVC 4JA1A 1IAGA 3DWBA 2OVZA 3EDGA 1PWUA 1G05A 2JT6A 1BSWA 1O0QA 2JSDA 5B5PA 1OMJA 3OHOA 1UMSA 1OM8A 1CGLA 2FV5A 2WOAA 1D8MA 2JIHA 1MMQA 2E3XA 5B5OA 1K7GA 3KHIA 2MZHA 1KUKA 1ZP5A 4IN9A 2YIGA 3F1AA 4GWMA 2I47A 2Y6CA 1H71P 2YB9A 2K9CA 1BQQM 4ON1A 4H3XA 1OM6A 4DD8A 1J7NA 1ZTQA 1EAKA 4HX3A 1I1IP 3LMCA 2W14A 3HB2P 3LIKA 3F17A 1USNA 1GO7P 4H82A 1I76A 3KMEA 1B8YA 3HYGA 2CKIA 1C3IA 3LE9A 3DPFA 1KUGA 1XFXA 3TSKA 2J83A 4JPAA 3EHXA 4XM7A 1QJIA 1ROSA 4G0DA 3KMCA 2OXZA 1HY7A 3KEKA 1JANA 1UMTA 5I3MA 2MZIA 3HDAP 1C7KA 3ZXHA 1OM7A 1ZS0A 2RJPA 4PKVA 1HFCA 3CKIA 3DPEA 2ERQA 2DDFA 2V4BA 3VI1A 5D2BA 2XS4A 1IAAA 3BA0A 2JT5A 3WV3A 2O36A 2Y6DA 4JIJA 1KUHA 3GBOA 1MMRA 3G42A 4PKSA 1AKLA 3KRYA 4AIGA 3TS4A 1YQYA 3G5CA 4Q1LA 1PWVA 3LKAA 2OY4A 2O3EA 3HBUP 4I35A 1OS2A 3B8ZA 1XFYA 1CIZA 3L0TA 1XUDA 2E2DA 1CXVA 1QJJA 4L19A 5BPAA 1AF0A 2OZRA 456CA 3ZUKA 1BUDA 2X7MA 2OY2A 1SU3A 1JK3A 5L7FA 4WKIA 1DTHA 1G12A 3ELMA 1RMZA 4GWNA 3WV2A 1HFSA 4PKQA 1ZXVA 4R3VA 1JH1A 3NX7A 1ASTA 3Q2GA 2MLSA 1JIZA 2QPJA 1JAQA 4GR8A 1D5JA 2HU6A 3ZVSA 1OO9A 1K7QA
chains in the Genus database with same CATH superfamily
3K7LA 4H2EA 3F15A 1JKYA 1FM1A 3AIGA 2POJA 1CQRA 3LK8A 3OHLA 1K7IA 2L0RA 3KECA 1XFZA 4ILWD 4XM6A 1GE6A 3RTSA 2X3AA 2AIGP 2W0DA 4DPEA 4H49A 5L79A 1XFWA 2RJQA 3DSLA 4PKWA 4GR0A 1BIWA 1Q3AA 2OW2A 2MZEA 4JP4A 2Z2DA 5BOYA 1Y8JA 2K2GA 4H1QA 3VTGA 4XCTA 5JMYA 3I7GA 3WV1A 1BQOA 3HY7A 3LQ0A 3LJTA 1CGEA 1WNIA 2D1OA 3UVCA 1GXDA 1MMBA 4FVLA 1HOVA 2TCLA 1UEAA 3HDBA 2OW9A 1QUAA 1R55A 3LJZA 1BKCA 1GKCA 1KAPP 2ERPA 4IJOA 4DF9A 4FXYP 5D1SA 1QIAA 3Q2HA 3RTTA 2YUFA 1XUCA 2J0TA 1D8FA 3MA2A 1EB6A 3O2XA 4JQGA 1IACA 1ZXCA 1A86A 3LUNA 3DL1A 3LQBA 4GQLA 4WK7A 3USNA 1RM8A 4ZR5A 4HMAA 1BKCI 1GO8P 3L0VA 5H8XA 1JAPA 1A85A 830CA 5D1TA 5CZMA 4DV8A 1G49A 2SRTA 1MMPA 3LEAA 3DTIA 2KRJA 4GF1A 4PKUA 1BKCE 1XURA 1Y0VA 3EDHA 1I73A 2N8RA 1MNCA 3N2VA 2XS3A 3EWJA 1OS9A 2X3CA 4G9LA 5I0LA 1R1HA 3B92A 3I7IA 4PKTA 1ND1A 1XFUA 4QKZA 4XBHA 3E8RA 4I03A 1DMTA 1PWQA 4L7AA 1B3DA 2AYKA 3U1RA 1HTDA 3HBVP 3SHIA 5I43A 4J4MA 3LUMA 2USNA 1YCMA 4GR3A 2OXUA 1KBCA 1IADA 2OXWA 1L6JA 3N2UA 1CGFA 3LIRA 1FBLA 3K7NA 3DNGA 2OVXA 1GKDA 1XM5A 2WO9A 2PJTA 1R1IA 4H76A 1SRPA 3P1VA 4WF6A 3F16A 2FV9A 2CLTA 1JJ9A 1ATLA 1R54A 1XAXA 1GE5A 1SLNA 2OI0A 1D7XA 1QICA 2DW1A 4L63A 4GUYA 4EFSA 4PKRA 1SLMA 2OW0A 4H84A 3TVCA 5I4OA 3EHYA 1BM6A 4IUWA 2DDYA 5CXAA 3P24A 3B2ZA 1BUVM 2EROA 1AYKA 1UTZA 4WKEA 5D3CA 2W15A 3F19A 3TT4A 2D1NA 1C8TA 1JAOA 1HV5A 2WO8A 1BZSA 1YP1A 1ZVXA 4AUOA 2OW1A 1CK7A 1SMPA 1EUBA 3F18A 1SATA 2DW0A 2X3BA 1GE7A 1Y93A 4A3WA 1G9KA 1QIBA 5BOTA 4A7BA 1S4BP 1KUIA 1YOUA 1PWWA 3AYUA 1IAEA 1R1JA 5LABA 3V96B 5D1UA 1O0TA 1PWPA 2MLRA 4FXQA 1XFVA 3LGPA 4FU4A 1Z3JA 4XM8A 1JIWP 4AXQA 4L6TA 3DTEA 3AYKA 3LILA 5D7WA 4WZVA 1CAQA 2A8HA 2W13A 5CUHA 1UTTA 1KUFA 3EDZA 3O64A 1IABA 5I2ZA 2JNPA 1FLSA 3LJGA 3EDIA 1OZ9A 4CTHA 4H30A 4AYKA 1G4KA 2W12A 966CA 5I12A 3HY9A 3KEJA 2DW2A 3KWVC 4JA1A 1IAGA 3DWBA 2OVZA 3EDGA 1PWUA 1G05A 2JT6A 1BSWA 1O0QA 2JSDA 5B5PA 1OMJA 3OHOA 1UMSA 1OM8A 1CGLA 2FV5A 2WOAA 1D8MA 2JIHA 1MMQA 2E3XA 5B5OA 1K7GA 3KHIA 2MZHA 1KUKA 1ZP5A 4IN9A 2YIGA 3F1AA 4GWMA 2I47A 2Y6CA 1H71P 2YB9A 2K9CA 1BQQM 4ON1A 4H3XA 1OM6A 4DD8A 1J7NA 1ZTQA 1EAKA 4HX3A 1I1IP 3LMCA 2W14A 3HB2P 3LIKA 3F17A 1USNA 1GO7P 4H82A 1I76A 3KMEA 1B8YA 3HYGA 2CKIA 1C3IA 3LE9A 3DPFA 1KUGA 1XFXA 1TVIA 3TSKA 2J83A 4JPAA 3EHXA 4XM7A 1QJIA 1ROSA 4G0DA 3KMCA 2OXZA 1HY7A 3KEKA 1JANA 1UMTA 5I3MA 2MZIA 3HDAP 1C7KA 3ZXHA 1OM7A 1ZS0A 2RJPA 4PKVA 1HFCA 3CKIA 3DPEA 2ERQA 2DDFA 2V4BA 3VI1A 5D2BA 2XS4A 1IAAA 3BA0A 2JT5A 3WV3A 2O36A 2Y6DA 4JIJA 1KUHA 3GBOA 1MMRA 3G42A 4PKSA 1AKLA 3KRYA 4AIGA 3TS4A 1YQYA 3G5CA 4Q1LA 1PWVA 3LKAA 2OY4A 2O3EA 3HBUP 4I35A 1OS2A 3B8ZA 1XFYA 1CIZA 3L0TA 1XUDA 2E2DA 1CXVA 1QJJA 4L19A 5BPAA 1AF0A 2OZRA 456CA 3ZUKA 1BUDA 2X7MA 2OY2A 1SU3A 1JK3A 5L7FA 4WKIA 1DTHA 1G12A 3ELMA 1RMZA 4GWNA 3WV2A 1HFSA 4PKQA 1ZXVA 4R3VA 1JH1A 3NX7A 1ASTA 3Q2GA 2MLSA 1JIZA 2QPJA 1JAQA 4GR8A 1D5JA 2HU6A 3ZVSA 1OO9A 3DTKA 1K7QA
chains in the Genus database with same CATH topology
3K7LA 4H2EA 3F15A 1JKYA 1FM1A 3AIGA 2POJA 1CQRA 3LK8A 3OHLA 1K7IA 2L0RA 3KECA 1XFZA 4ILWD 4XM6A 1GE6A 3RTSA 2X3AA 2AIGP 2W0DA 4DPEA 4H49A 5L79A 1XFWA 2RJQA 3DSLA 4PKWA 4GR0A 1BIWA 1Q3AA 2OW2A 2MZEA 4JP4A 2Z2DA 5BOYA 1Y8JA 2K2GA 4H1QA 3VTGA 4XCTA 5JMYA 3I7GA 3WV1A 1BQOA 3HY7A 3LQ0A 3LJTA 1CGEA 1WNIA 2D1OA 3UVCA 1GXDA 1MMBA 4FVLA 1HOVA 2TCLA 1UEAA 3HDBA 2OW9A 1QUAA 1R55A 3LJZA 1BKCA 1GKCA 1KAPP 2ERPA 4IJOA 4DF9A 4FXYP 5D1SA 1QIAA 3Q2HA 3RTTA 2YUFA 1XUCA 2J0TA 1D8FA 3MA2A 1EB6A 3O2XA 4JQGA 1IACA 1ZXCA 1A86A 3LUNA 3DL1A 3LQBA 4GQLA 4WK7A 3USNA 1RM8A 4ZR5A 4HMAA 1BKCI 1GO8P 3L0VA 5H8XA 1JAPA 1A85A 830CA 5D1TA 5CZMA 4DV8A 1G49A 2SRTA 1MMPA 3LEAA 3DTIA 2KRJA 4GF1A 4PKUA 1BKCE 1XURA 1Y0VA 3EDHA 1I73A 2N8RA 1MNCA 3N2VA 2XS3A 3EWJA 1OS9A 2X3CA 4G9LA 5I0LA 1R1HA 3B92A 3I7IA 4PKTA 1ND1A 1XFUA 4QKZA 4XBHA 3E8RA 4I03A 1DMTA 1PWQA 4L7AA 1B3DA 2AYKA 3U1RA 1HTDA 3HBVP 3SHIA 5I43A 4J4MA 3LUMA 2USNA 1YCMA 4GR3A 2OXUA 1KBCA 1IADA 2OXWA 1L6JA 3N2UA 1CGFA 3LIRA 1FBLA 3K7NA 3DNGA 2OVXA 1GKDA 2WO9A 2PJTA 1R1IA 4H76A 1SRPA 3P1VA 4WF6A 3F16A 2FV9A 2CLTA 1JJ9A 1ATLA 1R54A 2OI0A 1GE5A 1SLNA 1D7XA 1QICA 2DW1A 4L63A 4GUYA 4EFSA 4PKRA 1SLMA 2OW0A 4H84A 3TVCA 5I4OA 3EHYA 1BM6A 4IUWA 2DDYA 5CXAA 3P24A 3B2ZA 1BUVM 2EROA 1AYKA 1UTZA 4WKEA 5D3CA 2W15A 3F19A 3TT4A 2D1NA 1C8TA 1JAOA 1HV5A 2WO8A 1BZSA 1YP1A 1ZVXA 4AUOA 2OW1A 1CK7A 1SMPA 1EUBA 3F18A 1SATA 2DW0A 2X3BA 1GE7A 1Y93A 4A3WA 1G9KA 1QIBA 5BOTA 4A7BA 1S4BP 1KUIA 1YOUA 1PWWA 3AYUA 1IAEA 1R1JA 5LABA 3V96B 5D1UA 1O0TA 1PWPA 2MLRA 4FXQA 1XFVA 3LGPA 4FU4A 1Z3JA 4XM8A 1JIWP 4AXQA 4L6TA 3DTEA 3AYKA 3LILA 5D7WA 4WZVA 1CAQA 2A8HA 2W13A 5CUHA 1UTTA 1KUFA 3EDZA 3O64A 1IABA 5I2ZA 2JNPA 1FLSA 3LJGA 3EDIA 4CTHA 4H30A 4AYKA 1G4KA 2W12A 966CA 5I12A 3HY9A 3KEJA 2DW2A 3KWVC 4JA1A 1IAGA 3DWBA 2OVZA 3EDGA 1PWUA 1G05A 2JT6A 1BSWA 1O0QA 2JSDA 5B5PA 1OMJA 3OHOA 1UMSA 1OM8A 1CGLA 2FV5A 2WOAA 1D8MA 2JIHA 1MMQA 2E3XA 5B5OA 1K7GA 3KHIA 2MZHA 1KUKA 1ZP5A 4IN9A 2YIGA 3F1AA 4GWMA 2I47A 2Y6CA 1H71P 2YB9A 2K9CA 1BQQM 4ON1A 4H3XA 1OM6A 4DD8A 1J7NA 1ZTQA 1EAKA 4HX3A 1I1IP 3LMCA 2W14A 3HB2P 3LIKA 3F17A 1USNA 1GO7P 4H82A 1I76A 3KMEA 1B8YA 3HYGA 2CKIA 1C3IA 3LE9A 3DPFA 1KUGA 1XFXA 3TSKA 2J83A 4JPAA 3EHXA 4XM7A 1QJIA 1ROSA 4G0DA 3KMCA 2OXZA 1HY7A 3KEKA 1JANA 1UMTA 5I3MA 2MZIA 3HDAP 1C7KA 3ZXHA 1OM7A 1ZS0A 2RJPA 4PKVA 1HFCA 3CKIA 3DPEA 2ERQA 2DDFA 2V4BA 3VI1A 5D2BA 2XS4A 1IAAA 3BA0A 2JT5A 3WV3A 2O36A 2Y6DA 4JIJA 1KUHA 3GBOA 1MMRA 3G42A 4PKSA 1AKLA 3KRYA 4AIGA 3TS4A 1YQYA 3G5CA 4Q1LA 1PWVA 3LKAA 2OY4A 2O3EA 3HBUP 4I35A 1OS2A 3B8ZA 1XFYA 1CIZA 3L0TA 1XUDA 2E2DA 1CXVA 1QJJA 4L19A 5BPAA 1AF0A 2OZRA 456CA 3ZUKA 1BUDA 2X7MA 2OY2A 1SU3A 1JK3A 5L7FA 4WKIA 1DTHA 1G12A 3ELMA 1RMZA 4GWNA 3WV2A 1HFSA 4PKQA 1ZXVA 4R3VA 1JH1A 3NX7A 1ASTA 3Q2GA 2MLSA 1JIZA 2QPJA 1JAQA 4GR8A 1D5JA 2HU6A 3ZVSA 1OO9A 3DTKA 1K7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7L A;  4H2E A;  3F15 A;  1JKY A;  1FM1 A;  3AIG A;  2POJ A;  1CQR A;  3LK8 A;  3OHL A;  1K7I A;  2L0R A;  3KEC A;  1XFZ A;  4ILW D;  4XM6 A;  1GE6 A;  3RTS A;  2X3A A;  2AIG P;  2W0D A;  4DPE A;  4H49 A;  5L79 A;  1XFW A;  2RJQ A;  3DSL A;  4PKW A;  4GR0 A;  1BIW A;  1Q3A A;  2OW2 A;  2MZE A;  4JP4 A;  2Z2D A;  5BOY A;  1Y8J A;  2K2G A;  4H1Q A;  3VTG A;  4XCT A;  5JMY A;  3I7G A;  3WV1 A;  1BQO A;  3HY7 A;  3LQ0 A;  3LJT A;  1CGE A;  1WNI A;  2D1O A;  3UVC A;  1GXD A;  1MMB A;  4FVL A;  1HOV A;  2TCL A;  1UEA A;  3HDB A;  2OW9 A;  1QUA A;  1R55 A;  3LJZ A;  1BKC A;  1GKC A;  1KAP P;  2ERP A;  4IJO A;  4DF9 A;  4FXY P;  5D1S A;  1QIA A;  3Q2H A;  3RTT A;  1XUC A;  2J0T A;  1D8F A;  3MA2 A;  1EB6 A;  3O2X A;  4JQG A;  1IAC A;  1ZXC A;  1A86 A;  3LUN A;  3DL1 A;  3LQB A;  4GQL A;  4WK7 A;  3USN A;  1RM8 A;  4ZR5 A;  4HMA A;  1BKC I;  1GO8 P;  3L0V A;  5H8X A;  1JAP A;  1A85 A;  830C A;  5D1T A;  5CZM A;  4DV8 A;  1G49 A;  2SRT A;  1MMP A;  3LEA A;  2KRJ A;  4GF1 A;  4PKU A;  1BKC E;  1XUR A;  1Y0V A;  3EDH A;  1I73 A;  2N8R A;  1MNC A;  3N2V A;  2XS3 A;  3EWJ A;  1OS9 A;  2X3C A;  4G9L A;  5I0L A;  1R1H A;  3B92 A;  3I7I A;  4PKT A;  1ND1 A;  1XFU A;  4QKZ A;  4XBH A;  3E8R A;  4I03 A;  1DMT A;  1PWQ A;  1B3D A;  2AYK A;  3U1R A;  1HTD A;  3HBV P;  3SHI A;  5I43 A;  4J4M A;  3LUM A;  2USN A;  1YCM A;  4GR3 A;  2OXU A;  1KBC A;  1IAD A;  2OXW A;  1L6J A;  3N2U A;  1CGF A;  3LIR A;  1FBL A;  3K7N A;  3DNG A;  2OVX A;  1GKD A;  2WO9 A;  2PJT A;  1R1I A;  4H76 A;  1SRP A;  3P1V A;  4WF6 A;  3F16 A;  2FV9 A;  2CLT A;  1JJ9 A;  1ATL A;  1R54 A;  2OI0 A;  1GE5 A;  1SLN A;  1D7X A;  1QIC A;  2DW1 A;  4L63 A;  4GUY A;  4EFS A;  4PKR A;  1SLM A;  2OW0 A;  4H84 A;  3TVC A;  5I4O A;  3EHY A;  1BM6 A;  4IUW A;  2DDY A;  5CXA A;  3P24 A;  3B2Z A;  1BUV M;  2ERO A;  1AYK A;  1UTZ A;  4WKE A;  5D3C A;  2W15 A;  3F19 A;  3TT4 A;  2D1N A;  1C8T A;  1JAO A;  1HV5 A;  2WO8 A;  1BZS A;  1YP1 A;  1ZVX A;  4AUO A;  2OW1 A;  1CK7 A;  1SMP A;  1EUB A;  3F18 A;  1SAT A;  2DW0 A;  2X3B A;  1GE7 A;  1Y93 A;  4A3W A;  1G9K A;  1QIB A;  5BOT A;  4A7B A;  1S4B P;  1KUI A;  1YOU A;  1PWW A;  3AYU A;  1IAE A;  1R1J A;  5LAB A;  3V96 B;  5D1U A;  1O0T A;  1PWP A;  2MLR A;  4FXQ A;  1XFV A;  3LGP A;  4FU4 A;  1Z3J A;  4XM8 A;  1JIW P;  4AXQ A;  4L6T A;  3AYK A;  3LIL A;  5D7W A;  4WZV A;  1CAQ A;  2A8H A;  2W13 A;  5CUH A;  1UTT A;  1KUF A;  3EDZ A;  3O64 A;  1IAB A;  5I2Z A;  2JNP A;  1FLS A;  3LJG A;  3EDI A;  4CTH A;  4H30 A;  4AYK A;  1G4K A;  2W12 A;  966C A;  5I12 A;  3HY9 A;  3KEJ A;  2DW2 A;  3KWV C;  4JA1 A;  1IAG A;  3DWB A;  2OVZ A;  3EDG A;  1PWU A;  1G05 A;  2JT6 A;  1BSW A;  1O0Q A;  2JSD A;  5B5P A;  1OMJ A;  3OHO A;  1UMS A;  1OM8 A;  1CGL A;  2FV5 A;  2WOA A;  1D8M A;  2JIH A;  1MMQ A;  2E3X A;  5B5O A;  1K7G A;  3KHI A;  2MZH A;  1KUK A;  1ZP5 A;  4IN9 A;  2YIG A;  3F1A A;  4GWM A;  2I47 A;  2Y6C A;  1H71 P;  2YB9 A;  2K9C A;  1BQQ M;  4ON1 A;  4H3X A;  1OM6 A;  4DD8 A;  1J7N A;  1ZTQ A;  1EAK A;  4HX3 A;  1I1I P;  3LMC A;  2W14 A;  3HB2 P;  3LIK A;  3F17 A;  1USN A;  1GO7 P;  4H82 A;  1I76 A;  3KME A;  1B8Y A;  3HYG A;  2CKI A;  1C3I A;  3LE9 A;  3DPF A;  1KUG A;  1XFX A;  3TSK A;  2J83 A;  4JPA A;  3EHX A;  4XM7 A;  1QJI A;  1ROS A;  4G0D A;  3KMC A;  2OXZ A;  1HY7 A;  3KEK A;  1JAN A;  1UMT A;  5I3M A;  2MZI A;  3HDA P;  1C7K A;  3ZXH A;  1OM7 A;  1ZS0 A;  2RJP A;  4PKV A;  1HFC A;  3CKI A;  3DPE A;  2ERQ A;  2DDF A;  2V4B A;  3VI1 A;  5D2B A;  2XS4 A;  1IAA A;  3BA0 A;  2JT5 A;  3WV3 A;  2O36 A;  2Y6D A;  4JIJ A;  1KUH A;  3GBO A;  1MMR A;  3G42 A;  4PKS A;  1AKL A;  3KRY A;  4AIG A;  3TS4 A;  1YQY A;  3G5C A;  4Q1L A;  1PWV A;  3LKA A;  2OY4 A;  2O3E A;  3HBU P;  4I35 A;  1OS2 A;  3B8Z A;  1XFY A;  1CIZ A;  3L0T A;  1XUD A;  2E2D A;  1CXV A;  1QJJ A;  4L19 A;  5BPA A;  1AF0 A;  2OZR A;  456C A;  3ZUK A;  1BUD A;  2X7M A;  2OY2 A;  1SU3 A;  1JK3 A;  5L7F A;  4WKI A;  1DTH A;  1G12 A;  3ELM A;  1RMZ A;  4GWN A;  3WV2 A;  1HFS A;  4PKQ A;  1ZXV A;  4R3V A;  1JH1 A;  3NX7 A;  1AST A;  3Q2G A;  2MLS A;  1JIZ A;  2QPJ A;  1JAQ A;  4GR8 A;  1D5J A;  2HU6 A;  3ZVS A;  1OO9 A;  1K7Q A; 
#chains in the Genus database with same CATH topology
 3K7L A;  4H2E A;  3F15 A;  1JKY A;  1FM1 A;  3AIG A;  2POJ A;  1CQR A;  3LK8 A;  3OHL A;  1K7I A;  2L0R A;  3KEC A;  1XFZ A;  4ILW D;  4XM6 A;  1GE6 A;  3RTS A;  2X3A A;  2AIG P;  2W0D A;  4DPE A;  4H49 A;  5L79 A;  1XFW A;  2RJQ A;  3DSL A;  4PKW A;  4GR0 A;  1BIW A;  1Q3A A;  2OW2 A;  2MZE A;  4JP4 A;  2Z2D A;  5BOY A;  1Y8J A;  2K2G A;  4H1Q A;  3VTG A;  4XCT A;  5JMY A;  3I7G A;  3WV1 A;  1BQO A;  3HY7 A;  3LQ0 A;  3LJT A;  1CGE A;  1WNI A;  2D1O A;  3UVC A;  1GXD A;  1MMB A;  4FVL A;  1HOV A;  2TCL A;  1UEA A;  3HDB A;  2OW9 A;  1QUA A;  1R55 A;  3LJZ A;  1BKC A;  1GKC A;  1KAP P;  2ERP A;  4IJO A;  4DF9 A;  4FXY P;  5D1S A;  1QIA A;  3Q2H A;  3RTT A;  2YUF A;  1XUC A;  2J0T A;  1D8F A;  3MA2 A;  1EB6 A;  3O2X A;  4JQG A;  1IAC A;  1ZXC A;  1A86 A;  3LUN A;  3DL1 A;  3LQB A;  4GQL A;  4WK7 A;  3USN A;  1RM8 A;  4ZR5 A;  4HMA A;  1BKC I;  1GO8 P;  3L0V A;  5H8X A;  1JAP A;  1A85 A;  830C A;  5D1T A;  5CZM A;  4DV8 A;  1G49 A;  2SRT A;  1MMP A;  3LEA A;  3DTI A;  2KRJ A;  4GF1 A;  4PKU A;  1BKC E;  1XUR A;  1Y0V A;  3EDH A;  1I73 A;  2N8R A;  1MNC A;  3N2V A;  2XS3 A;  3EWJ A;  1OS9 A;  2X3C A;  4G9L A;  5I0L A;  1R1H A;  3B92 A;  3I7I A;  4PKT A;  1ND1 A;  1XFU A;  4QKZ A;  4XBH A;  3E8R A;  4I03 A;  1DMT A;  1PWQ A;  4L7A A;  1B3D A;  2AYK A;  3U1R A;  1HTD A;  3HBV P;  3SHI A;  5I43 A;  4J4M A;  3LUM A;  2USN A;  1YCM A;  4GR3 A;  2OXU A;  1KBC A;  1IAD A;  2OXW A;  1L6J A;  3N2U A;  1CGF A;  3LIR A;  1FBL A;  3K7N A;  3DNG A;  2OVX A;  1GKD A;  1XM5 A;  2WO9 A;  2PJT A;  1R1I A;  4H76 A;  1SRP A;  3P1V A;  4WF6 A;  3F16 A;  2FV9 A;  2CLT A;  1JJ9 A;  1ATL A;  1R54 A;  1XAX A;  1GE5 A;  1SLN A;  2OI0 A;  1D7X A;  1QIC A;  2DW1 A;  4L63 A;  4GUY A;  4EFS A;  4PKR A;  1SLM A;  2OW0 A;  4H84 A;  3TVC A;  5I4O A;  3EHY A;  1BM6 A;  4IUW A;  2DDY A;  5CXA A;  3P24 A;  3B2Z A;  1BUV M;  2ERO A;  1AYK A;  1UTZ A;  4WKE A;  5D3C A;  2W15 A;  3F19 A;  3TT4 A;  2D1N A;  1C8T A;  1JAO A;  1HV5 A;  2WO8 A;  1BZS A;  1YP1 A;  1ZVX A;  4AUO A;  2OW1 A;  1CK7 A;  1SMP A;  1EUB A;  3F18 A;  1SAT A;  2DW0 A;  2X3B A;  1GE7 A;  1Y93 A;  4A3W A;  1G9K A;  1QIB A;  5BOT A;  4A7B A;  1S4B P;  1KUI A;  1YOU A;  1PWW A;  3AYU A;  1IAE A;  1R1J A;  5LAB A;  3V96 B;  5D1U A;  1O0T A;  1PWP A;  2MLR A;  4FXQ A;  1XFV A;  3LGP A;  4FU4 A;  1Z3J A;  4XM8 A;  1JIW P;  4AXQ A;  4L6T A;  3DTE A;  3AYK A;  3LIL A;  5D7W A;  4WZV A;  1CAQ A;  2A8H A;  2W13 A;  5CUH A;  1UTT A;  1KUF A;  3EDZ A;  3O64 A;  1IAB A;  5I2Z A;  2JNP A;  1FLS A;  3LJG A;  3EDI A;  1OZ9 A;  4CTH A;  4H30 A;  4AYK A;  1G4K A;  2W12 A;  966C A;  5I12 A;  3HY9 A;  3KEJ A;  2DW2 A;  3KWV C;  4JA1 A;  1IAG A;  3DWB A;  2OVZ A;  3EDG A;  1PWU A;  1G05 A;  2JT6 A;  1BSW A;  1O0Q A;  2JSD A;  5B5P A;  1OMJ A;  3OHO A;  1UMS A;  1OM8 A;  1CGL A;  2FV5 A;  2WOA A;  1D8M A;  2JIH A;  1MMQ A;  2E3X A;  5B5O A;  1K7G A;  3KHI A;  2MZH A;  1KUK A;  1ZP5 A;  4IN9 A;  2YIG A;  3F1A A;  4GWM A;  2I47 A;  2Y6C A;  1H71 P;  2YB9 A;  2K9C A;  1BQQ M;  4ON1 A;  4H3X A;  1OM6 A;  4DD8 A;  1J7N A;  1ZTQ A;  1EAK A;  4HX3 A;  1I1I P;  3LMC A;  2W14 A;  3HB2 P;  3LIK A;  3F17 A;  1USN A;  1GO7 P;  4H82 A;  1I76 A;  3KME A;  1B8Y A;  3HYG A;  2CKI A;  1C3I A;  3LE9 A;  3DPF A;  1KUG A;  1XFX A;  1TVI A;  3TSK A;  2J83 A;  4JPA A;  3EHX A;  4XM7 A;  1QJI A;  1ROS A;  4G0D A;  3KMC A;  2OXZ A;  1HY7 A;  3KEK A;  1JAN A;  1UMT A;  5I3M A;  2MZI A;  3HDA P;  1C7K A;  3ZXH A;  1OM7 A;  1ZS0 A;  2RJP A;  4PKV A;  1HFC A;  3CKI A;  3DPE A;  2ERQ A;  2DDF A;  2V4B A;  3VI1 A;  5D2B A;  2XS4 A;  1IAA A;  3BA0 A;  2JT5 A;  3WV3 A;  2O36 A;  2Y6D A;  4JIJ A;  1KUH A;  3GBO A;  1MMR A;  3G42 A;  4PKS A;  1AKL A;  3KRY A;  4AIG A;  3TS4 A;  1YQY A;  3G5C A;  4Q1L A;  1PWV A;  3LKA A;  2OY4 A;  2O3E A;  3HBU P;  4I35 A;  1OS2 A;  3B8Z A;  1XFY A;  1CIZ A;  3L0T A;  1XUD A;  2E2D A;  1CXV A;  1QJJ A;  4L19 A;  5BPA A;  1AF0 A;  2OZR A;  456C A;  3ZUK A;  1BUD A;  2X7M A;  2OY2 A;  1SU3 A;  1JK3 A;  5L7F A;  4WKI A;  1DTH A;  1G12 A;  3ELM A;  1RMZ A;  4GWN A;  3WV2 A;  1HFS A;  4PKQ A;  1ZXV A;  4R3V A;  1JH1 A;  3NX7 A;  1AST A;  3Q2G A;  2MLS A;  1JIZ A;  2QPJ A;  1JAQ A;  4GR8 A;  1D5J A;  2HU6 A;  3ZVS A;  1OO9 A;  3DTK A;  1K7Q A; 
#chains in the Genus database with same CATH homology
 3K7L A;  4H2E A;  3F15 A;  1JKY A;  1FM1 A;  3AIG A;  2POJ A;  1CQR A;  3LK8 A;  3OHL A;  1K7I A;  2L0R A;  3KEC A;  1XFZ A;  4ILW D;  4XM6 A;  1GE6 A;  3RTS A;  2X3A A;  2AIG P;  2W0D A;  4DPE A;  4H49 A;  5L79 A;  1XFW A;  2RJQ A;  3DSL A;  4PKW A;  4GR0 A;  1BIW A;  1Q3A A;  2OW2 A;  2MZE A;  4JP4 A;  2Z2D A;  5BOY A;  1Y8J A;  2K2G A;  4H1Q A;  3VTG A;  4XCT A;  5JMY A;  3I7G A;  3WV1 A;  1BQO A;  3HY7 A;  3LQ0 A;  3LJT A;  1CGE A;  1WNI A;  2D1O A;  3UVC A;  1GXD A;  1MMB A;  4FVL A;  1HOV A;  2TCL A;  1UEA A;  3HDB A;  2OW9 A;  1QUA A;  1R55 A;  3LJZ A;  1BKC A;  1GKC A;  1KAP P;  2ERP A;  4IJO A;  4DF9 A;  4FXY P;  5D1S A;  1QIA A;  3Q2H A;  3RTT A;  2YUF A;  1XUC A;  2J0T A;  1D8F A;  3MA2 A;  1EB6 A;  3O2X A;  4JQG A;  1IAC A;  1ZXC A;  1A86 A;  3LUN A;  3DL1 A;  3LQB A;  4GQL A;  4WK7 A;  3USN A;  1RM8 A;  4ZR5 A;  4HMA A;  1BKC I;  1GO8 P;  3L0V A;  5H8X A;  1JAP A;  1A85 A;  830C A;  5D1T A;  5CZM A;  4DV8 A;  1G49 A;  2SRT A;  1MMP A;  3LEA A;  3DTI A;  2KRJ A;  4GF1 A;  4PKU A;  1BKC E;  1XUR A;  1Y0V A;  3EDH A;  1I73 A;  2N8R A;  1MNC A;  3N2V A;  2XS3 A;  3EWJ A;  1OS9 A;  2X3C A;  4G9L A;  5I0L A;  1R1H A;  3B92 A;  3I7I A;  4PKT A;  1ND1 A;  1XFU A;  4QKZ A;  4XBH A;  3E8R A;  4I03 A;  1DMT A;  1PWQ A;  4L7A A;  1B3D A;  2AYK A;  3U1R A;  1HTD A;  3HBV P;  3SHI A;  5I43 A;  4J4M A;  3LUM A;  2USN A;  1YCM A;  4GR3 A;  2OXU A;  1KBC A;  1IAD A;  2OXW A;  1L6J A;  3N2U A;  1CGF A;  3LIR A;  1FBL A;  3K7N A;  3DNG A;  2OVX A;  1GKD A;  2WO9 A;  2PJT A;  1R1I A;  4H76 A;  1SRP A;  3P1V A;  4WF6 A;  3F16 A;  2FV9 A;  2CLT A;  1JJ9 A;  1ATL A;  1R54 A;  2OI0 A;  1GE5 A;  1SLN A;  1D7X A;  1QIC A;  2DW1 A;  4L63 A;  4GUY A;  4EFS A;  4PKR A;  1SLM A;  2OW0 A;  4H84 A;  3TVC A;  5I4O A;  3EHY A;  1BM6 A;  4IUW A;  2DDY A;  5CXA A;  3P24 A;  3B2Z A;  1BUV M;  2ERO A;  1AYK A;  1UTZ A;  4WKE A;  5D3C A;  2W15 A;  3F19 A;  3TT4 A;  2D1N A;  1C8T A;  1JAO A;  1HV5 A;  2WO8 A;  1BZS A;  1YP1 A;  1ZVX A;  4AUO A;  2OW1 A;  1CK7 A;  1SMP A;  1EUB A;  3F18 A;  1SAT A;  2DW0 A;  2X3B A;  1GE7 A;  1Y93 A;  4A3W A;  1G9K A;  1QIB A;  5BOT A;  4A7B A;  1S4B P;  1KUI A;  1YOU A;  1PWW A;  3AYU A;  1IAE A;  1R1J A;  5LAB A;  3V96 B;  5D1U A;  1O0T A;  1PWP A;  2MLR A;  4FXQ A;  1XFV A;  3LGP A;  4FU4 A;  1Z3J A;  4XM8 A;  1JIW P;  4AXQ A;  4L6T A;  3DTE A;  3AYK A;  3LIL A;  5D7W A;  4WZV A;  1CAQ A;  2A8H A;  2W13 A;  5CUH A;  1UTT A;  1KUF A;  3EDZ A;  3O64 A;  1IAB A;  5I2Z A;  2JNP A;  1FLS A;  3LJG A;  3EDI A;  4CTH A;  4H30 A;  4AYK A;  1G4K A;  2W12 A;  966C A;  5I12 A;  3HY9 A;  3KEJ A;  2DW2 A;  3KWV C;  4JA1 A;  1IAG A;  3DWB A;  2OVZ A;  3EDG A;  1PWU A;  1G05 A;  2JT6 A;  1BSW A;  1O0Q A;  2JSD A;  5B5P A;  1OMJ A;  3OHO A;  1UMS A;  1OM8 A;  1CGL A;  2FV5 A;  2WOA A;  1D8M A;  2JIH A;  1MMQ A;  2E3X A;  5B5O A;  1K7G A;  3KHI A;  2MZH A;  1KUK A;  1ZP5 A;  4IN9 A;  2YIG A;  3F1A A;  4GWM A;  2I47 A;  2Y6C A;  1H71 P;  2YB9 A;  2K9C A;  1BQQ M;  4ON1 A;  4H3X A;  1OM6 A;  4DD8 A;  1J7N A;  1ZTQ A;  1EAK A;  4HX3 A;  1I1I P;  3LMC A;  2W14 A;  3HB2 P;  3LIK A;  3F17 A;  1USN A;  1GO7 P;  4H82 A;  1I76 A;  3KME A;  1B8Y A;  3HYG A;  2CKI A;  1C3I A;  3LE9 A;  3DPF A;  1KUG A;  1XFX A;  3TSK A;  2J83 A;  4JPA A;  3EHX A;  4XM7 A;  1QJI A;  1ROS A;  4G0D A;  3KMC A;  2OXZ A;  1HY7 A;  3KEK A;  1JAN A;  1UMT A;  5I3M A;  2MZI A;  3HDA P;  1C7K A;  3ZXH A;  1OM7 A;  1ZS0 A;  2RJP A;  4PKV A;  1HFC A;  3CKI A;  3DPE A;  2ERQ A;  2DDF A;  2V4B A;  3VI1 A;  5D2B A;  2XS4 A;  1IAA A;  3BA0 A;  2JT5 A;  3WV3 A;  2O36 A;  2Y6D A;  4JIJ A;  1KUH A;  3GBO A;  1MMR A;  3G42 A;  4PKS A;  1AKL A;  3KRY A;  4AIG A;  3TS4 A;  1YQY A;  3G5C A;  4Q1L A;  1PWV A;  3LKA A;  2OY4 A;  2O3E A;  3HBU P;  4I35 A;  1OS2 A;  3B8Z A;  1XFY A;  1CIZ A;  3L0T A;  1XUD A;  2E2D A;  1CXV A;  1QJJ A;  4L19 A;  5BPA A;  1AF0 A;  2OZR A;  456C A;  3ZUK A;  1BUD A;  2X7M A;  2OY2 A;  1SU3 A;  1JK3 A;  5L7F A;  4WKI A;  1DTH A;  1G12 A;  3ELM A;  1RMZ A;  4GWN A;  3WV2 A;  1HFS A;  4PKQ A;  1ZXV A;  4R3V A;  1JH1 A;  3NX7 A;  1AST A;  3Q2G A;  2MLS A;  1JIZ A;  2QPJ A;  1JAQ A;  4GR8 A;  1D5J A;  2HU6 A;  3ZVS A;  1OO9 A;  3DTK A;  1K7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...