3UVFA

Expanding lagalidadg endonuclease scaffold diversity by rapidly surveying evolutionary sequence space
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
255
structure length
255
Chain Sequence
SHMDLTYAYLVGLFEGDGYFSITKKGKYLTYELGIELSIKDVQLIYKIKDILGVGKVSFRKRNEIEMVSLRIRDKNHLKNFILPIFDKYPMLSNKQYDYLRFKDALLSNIIYSDDLPEYARSNESINSVDSIINTSYFSAWLVGFIEAEGCFSTYKLNKDDDYLIASFDIAQKDGDILISAIHKYLSFTTKIYLDKTNCSRLKVTGVRSVKNVVKFIQGAPVKLLGNKKLQYKLWIKQLRKISRYSEKIQLPSNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intron-encoded DNA endonuclease I-HjeMI
publication title Expanding LAGLIDADG endonuclease scaffold diversity by rapidly surveying evolutionary sequence space.
pubmed doi rcsb
source organism Trichoderma reesei
molecule tags Hydrolase/dna
total genus 77
structure length 255
sequence length 255
chains with identical sequence B
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 3uvfA01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 3uvfA02
4Z1XA 5AKFA 1M5XA 4UT0A 1R7MA 4AADA 1N3FA 1LWSA 2CW7A 1P8KZ 3HYIA 5E5OA 2VS7A 4AQXA 2CW8A 1MOWA 1U0CA 3MX9A 2VBNA 4YITA 5A0WA 2DCHX 3OOLA 2FLDA 5A72A 1JVAA 4UNBA 5A0MA 3OORA 5E67A 2VBOA 4Z1ZA 4AAEA 1U0DA 1T9IA 1BP7A 2VBNB 5E5SA 1G9YA 2I3PA 2XE0A 4UNCA 3KO2A 5E63A 2QOJZ 1DFAA 2VS8A 2EX5A 4AAGA 2I3QA 2VBLB 5A0MB 2VBOB 2XE0B 3HYJA 4LOXA 4YHXA 2O7MA 4AABA 2VBLA 2AB5A 3MISA 3C0XA 5AKNA 4D6OA 3MXAA 1B24A 3EH8A 4UN9G 2VBJA 4UN8A 5AKMA 1EF0A 4UN8G 5AK9A 4LQ0A 1T9JA 4YISA 3C0WA 4UN7G 1LWTA 2VBJB 5A78A 5A77A 1N3EA 4AAFA 4UN9A 3QQYA 4D6NA 1G9ZA 1VDEA 1AF5A 4UNAA 3FD2A 5A74A 3MXBB 3R7PA 4UN7A 3E54A 3MIPA 4EFJA 3UVFA 4AQUA 1UM2A 4Z20A 3MXBA 1DQ3A
chains in the Genus database with same CATH superfamily
4Z1XA 5AKFA 1M5XA 4UT0A 1R7MA 4AADA 1N3FA 1LWSA 2CW7A 1P8KZ 3HYIA 5E5OA 2VS7A 4AQXA 2CW8A 1MOWA 1U0CA 3MX9A 2VBNA 4YITA 5A0WA 2DCHX 3OOLA 2FLDA 5A72A 1JVAA 4UNBA 5A0MA 3OORA 5E67A 2VBOA 4Z1ZA 4AAEA 1U0DA 1T9IA 1BP7A 2VBNB 5E5SA 1G9YA 2I3PA 2XE0A 4UNCA 3KO2A 5E63A 2QOJZ 1DFAA 2VS8A 2EX5A 4AAGA 2I3QA 2VBLB 5A0MB 2VBOB 2F4LA 2XE0B 3HYJA 4LOXA 4YHXA 2O7MA 4AABA 2VBLA 2AB5A 3MISA 3C0XA 5AKNA 4D6OA 3MXAA 1B24A 3EH8A 4UN9G 2VBJA 4UN8A 5AKMA 1EF0A 4UN8G 5AK9A 4LQ0A 1T9JA 4YISA 3C0WA 4UN7G 1LWTA 2VBJB 5A78A 5A77A 1N3EA 4AAFA 4UN9A 3QQYA 4D6NA 1G9ZA 1VDEA 1AF5A 4UNAA 3FD2A 5A74A 3MXBB 3R7PA 4UN7A 3E54A 3MIPA 4EFJA 4KZSA 3UVFA 4AQUA 1UM2A 4Z20A 3MXBA 1DQ3A
chains in the Genus database with same CATH topology
4Z1XA 5AKFA 1M5XA 4UT0A 1R7MA 4AADA 1N3FA 1LWSA 2CW7A 1P8KZ 3HYIA 5E5OA 2VS7A 4AQXA 2CW8A 1MOWA 1U0CA 3MX9A 2VBNA 4YITA 5A0WA 2DCHX 3OOLA 2FLDA 5A72A 1JVAA 4UNBA 5A0MA 3OORA 5E67A 2VBOA 4Z1ZA 4AAEA 1U0DA 1T9IA 1BP7A 2VBNB 5E5SA 1G9YA 2I3PA 2XE0A 4UNCA 3KO2A 5E63A 2QOJZ 1DFAA 2VS8A 2EX5A 4AAGA 2I3QA 2VBLB 5A0MB 2VBOB 2XE0B 3HYJA 4LOXA 4YHXA 2O7MA 4AABA 2VBLA 2AB5A 3MISA 3C0XA 5AKNA 4D6OA 3MXAA 1B24A 3EH8A 4UN9G 2VBJA 4UN8A 5AKMA 1EF0A 4UN8G 5AK9A 4LQ0A 1T9JA 4YISA 3C0WA 4UN7G 1LWTA 2VBJB 5A78A 5A77A 1N3EA 4AAFA 4UN9A 3QQYA 4D6NA 1G9ZA 1VDEA 1AF5A 4UNAA 3FD2A 5A74A 3MXBB 3R7PA 4UN7A 3E54A 3MIPA 4EFJA 3UVFA 4AQUA 1UM2A 4Z20A 3MXBA 1DQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z1X A;  5AKF A;  1M5X A;  4UT0 A;  1R7M A;  4AAD A;  1N3F A;  1LWS A;  2CW7 A;  1P8K Z;  3HYI A;  5E5O A;  2VS7 A;  4AQX A;  2CW8 A;  1MOW A;  1U0C A;  3MX9 A;  2VBN A;  4YIT A;  5A0W A;  2DCH X;  3OOL A;  2FLD A;  5A72 A;  1JVA A;  4UNB A;  5A0M A;  3OOR A;  5E67 A;  2VBO A;  4Z1Z A;  4AAE A;  1U0D A;  1T9I A;  1BP7 A;  2VBN B;  5E5S A;  1G9Y A;  2I3P A;  2XE0 A;  4UNC A;  3KO2 A;  5E63 A;  2QOJ Z;  1DFA A;  2VS8 A;  2EX5 A;  4AAG A;  2I3Q A;  2VBL B;  5A0M B;  2VBO B;  2XE0 B;  3HYJ A;  4LOX A;  4YHX A;  2O7M A;  4AAB A;  2VBL A;  2AB5 A;  3MIS A;  3C0X A;  5AKN A;  4D6O A;  3MXA A;  1B24 A;  3EH8 A;  4UN9 G;  2VBJ A;  4UN8 A;  5AKM A;  1EF0 A;  4UN8 G;  5AK9 A;  4LQ0 A;  1T9J A;  4YIS A;  3C0W A;  4UN7 G;  1LWT A;  2VBJ B;  5A78 A;  5A77 A;  1N3E A;  4AAF A;  4UN9 A;  3QQY A;  4D6N A;  1G9Z A;  1VDE A;  1AF5 A;  4UNA A;  3FD2 A;  5A74 A;  3MXB B;  3R7P A;  4UN7 A;  3E54 A;  3MIP A;  4EFJ A;  3UVF A;  4AQU A;  1UM2 A;  4Z20 A;  3MXB A;  1DQ3 A; 
#chains in the Genus database with same CATH topology
 4Z1X A;  5AKF A;  1M5X A;  4UT0 A;  1R7M A;  4AAD A;  1N3F A;  1LWS A;  2CW7 A;  1P8K Z;  3HYI A;  5E5O A;  2VS7 A;  4AQX A;  2CW8 A;  1MOW A;  1U0C A;  3MX9 A;  2VBN A;  4YIT A;  5A0W A;  2DCH X;  3OOL A;  2FLD A;  5A72 A;  1JVA A;  4UNB A;  5A0M A;  3OOR A;  5E67 A;  2VBO A;  4Z1Z A;  4AAE A;  1U0D A;  1T9I A;  1BP7 A;  2VBN B;  5E5S A;  1G9Y A;  2I3P A;  2XE0 A;  4UNC A;  3KO2 A;  5E63 A;  2QOJ Z;  1DFA A;  2VS8 A;  2EX5 A;  4AAG A;  2I3Q A;  2VBL B;  5A0M B;  2VBO B;  2F4L A;  2XE0 B;  3HYJ A;  4LOX A;  4YHX A;  2O7M A;  4AAB A;  2VBL A;  2AB5 A;  3MIS A;  3C0X A;  5AKN A;  4D6O A;  3MXA A;  1B24 A;  3EH8 A;  4UN9 G;  2VBJ A;  4UN8 A;  5AKM A;  1EF0 A;  4UN8 G;  5AK9 A;  4LQ0 A;  1T9J A;  4YIS A;  3C0W A;  4UN7 G;  1LWT A;  2VBJ B;  5A78 A;  5A77 A;  1N3E A;  4AAF A;  4UN9 A;  3QQY A;  4D6N A;  1G9Z A;  1VDE A;  1AF5 A;  4UNA A;  3FD2 A;  5A74 A;  3MXB B;  3R7P A;  4UN7 A;  3E54 A;  3MIP A;  4EFJ A;  4KZS A;  3UVF A;  4AQU A;  1UM2 A;  4Z20 A;  3MXB A;  1DQ3 A; 
#chains in the Genus database with same CATH homology
 4Z1X A;  5AKF A;  1M5X A;  4UT0 A;  1R7M A;  4AAD A;  1N3F A;  1LWS A;  2CW7 A;  1P8K Z;  3HYI A;  5E5O A;  2VS7 A;  4AQX A;  2CW8 A;  1MOW A;  1U0C A;  3MX9 A;  2VBN A;  4YIT A;  5A0W A;  2DCH X;  3OOL A;  2FLD A;  5A72 A;  1JVA A;  4UNB A;  5A0M A;  3OOR A;  5E67 A;  2VBO A;  4Z1Z A;  4AAE A;  1U0D A;  1T9I A;  1BP7 A;  2VBN B;  5E5S A;  1G9Y A;  2I3P A;  2XE0 A;  4UNC A;  3KO2 A;  5E63 A;  2QOJ Z;  1DFA A;  2VS8 A;  2EX5 A;  4AAG A;  2I3Q A;  2VBL B;  5A0M B;  2VBO B;  2XE0 B;  3HYJ A;  4LOX A;  4YHX A;  2O7M A;  4AAB A;  2VBL A;  2AB5 A;  3MIS A;  3C0X A;  5AKN A;  4D6O A;  3MXA A;  1B24 A;  3EH8 A;  4UN9 G;  2VBJ A;  4UN8 A;  5AKM A;  1EF0 A;  4UN8 G;  5AK9 A;  4LQ0 A;  1T9J A;  4YIS A;  3C0W A;  4UN7 G;  1LWT A;  2VBJ B;  5A78 A;  5A77 A;  1N3E A;  4AAF A;  4UN9 A;  3QQY A;  4D6N A;  1G9Z A;  1VDE A;  1AF5 A;  4UNA A;  3FD2 A;  5A74 A;  3MXB B;  3R7P A;  4UN7 A;  3E54 A;  3MIP A;  4EFJ A;  3UVF A;  4AQU A;  1UM2 A;  4Z20 A;  3MXB A;  1DQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...