3UVKA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll2
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
299
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLDNPPVSFVKFSPNGKYILAATLDNTLKLWDKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 104
structure length 299
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvkA00
4FA1D 4ERYA 3EI3A 2P9SC 5IJ7E 3I7HA 3ODTA 3CFVA 5CXBB 4MK0B 4X3EA 3AL9A 1YFQA 3EI4B 2IUPA 3RLMD 2Z2PA 4CY1A 3EU7A 5FXYA 4ESGA 3SCYA 4J87A 2B5MA 2I3SA 2XU7A 1P22A 3OKTA 5TF2A 1GP2B 2P9IC 3EI1A 4X61B 4A2LA 3SWSD 4A08B 3MKSB 4L3GD 4ES0A 5HE2B 5GMKn 2H9MA 4BL0A 2OJYA 4GGDA 4CY5A 3OW8A 4A09B 2CE8A 3SBRA 2P9KC 1MDAH 5GXHA 4A11A 5EAPA 3OKWA 5JWZA 2H13A 2J55H 3CFSB 3SXTD 2H9LA 3ORVD 5EM2B 4XEIC 4L3HD 2P9NC 4GGCA 4J78A 3RSEC 3FM0A 3MMYA 1TYQC 5IT9g 2HJBA 5CXBA 2HXCA 2J56H 2OIZA 3OTTA 1B9XA 4D0KA 2B5LA 2CN2A 3C5MA 5HE1B 2EBSA 3VGZA 2AGLA 2I0TA 5HE3B 5EAMA 2PM7B 3PXSD 2XL2A 2HKRA 4A0BB 1VYHC 3KRXB 4CI1A 3EI2B 4A08A 4QRJA 1R5MA 3EI1B 2XYIA 2H6QA 5THAA 3UVMA 2Z2NA 5FKSA 5IGQA 4O3TB 5C2VB 3EG6A 3MZKA 4J84A 2YNPA 3DXMC 1OLZA 5AJAA 4CZXA 3JZGA 2I0RA 4PSWB 4CZYA 4X63B 3UKUC 4A11B 3JPXA 2W18A 2HESX 2BCJB 4J86A 5EMMB 2CE9A 1N6FA 2XL3A 2YNOA 5EM2A 3A0FA 5TEFA 5FA5B 2H14A 3L4MD 5EMKB 3PXWD 3UR4A 5GXIA 4K3JB 3BG0A 4HDJA 4O9DA 4O45A 2AQ5A 1SHYB 5AMSA 1JMZB 5I5JA 4G56B 3F3FA 3PE7A 5H14A 2OVQB 4FA5D 4A0BA 2IAAA 4Y7RA 4CI3A 2AGZA 1PBYB 1B9YA 3HFQA 3I89A 3EI2A 3J81g 3JRPA 3AH8B 3V5WB 1N6EA 4PXWA 3UVLA 3BG1A 4JXMA 4ZOYA 4JD2C 3I7KA 2BBKH 4I79A 4ERQA 4FA9D 2QXVA 4E54B 3JZNA 4ZN4A 5I5IA 4O3UB 4GGAA 2CO0A 3L4OD 2GC7A 3N0EA 4LGNA 5IGOA 5FKQA 2IUVA 3SBPA 4ZOZA 2IUQA 4J77A 2YB8B 1TBGA 3GFCA 4J0WA 3IKOA 4YVDA 2YMUA 2YNNA 4JT5C 4J79A 3MKQA 3PSLA 4R7AB 1QNIA 2CNXA 1PI6A 3EMHA 3IJ1A 3VH0A 5CXCB 2Z2OA 4J8GA 1JOFA 2H47A 4XYHA 4O1QD 1XHMA 5FQDA 2TRCB 3UVOA 5H17A 3RRMC 1K8KC 4IMMA 4X60B 2O9KA 4EWRA 4J81A 4AOWA 4PNKB 4J73A 4U1EI 1MG2A 3DSMA 4H5IA 5CYKB 4A0AB 4J0XA 3RFGA 3K26A 3NVNA 3JZHA 2UZXB 4GM3A 4NSXA 3RN1D 2H9PA 4GZ8A 4E54A 4GMBA 1JMXB 2GC4A 3MXXA 3VA6A 5TDHB 2AH1A 2HKMA 5SXMA 1A0RB 1N6DA 3NVXA 4QQEA 2PM6B 2HJ4A 4N14A 5B4WA 1XKSA 5EALA 1MG3A 5GSAA 2H6NA 4U7AA 3BWSA 3AL8B 3I7NA 2UZYB 4CY2A 2CO0C 3DWLC 3ULEC 3J80g 3PSCB 4K3ID 1U2VC 4FHLA 2G9AA 5CXCA 2H3XA 3I8EA 2H6KA 5HYNB 4CC9A 4JT6C 4PBYA 3SHFA 3W15A 3ZWLB 4XYIA 3OL2A 1ERJA 3RN0D 4GQ2P 2YBAA 3I7PA 5TEEA 3I8CA 4E5ZB 1NEXB 5I5MA 3JAMg 4KFMB 2P9UC 3MZLA 4FWWA 5CYKA 4A0AA 3C99A 4BUJC 5K1CC 3E0CA 3OKYB 2AH0A 4IA9A 4AEZA 3IJCA 1U4CA 5C2WB 2G99A 1GOTB 3IIYA 5KDOB 1GG2B 2MTAH 4JSXC 1S4UX 3EWEA 3AFCA 2OK6A 3CIKB 4J8BA 3FRXA 4FAND 3C75H 4JSNC 3F3GA 3FGBA 3RFHA 3I2NA 3JB9L 2IWKA 5EMLB 3IJ0A 2QC5A 2OK4A 2OVPB 4FA4D 1OMWB 2IWFA 3PXTD 1SQJA 3AL8A 2PM9B 1RI6A 5IC7A 4A2MA 1Q47A 3SBQA 1SQ9A 4OWRA 3U4YA 4PC0A 3GREA 2AGXA 2B4EA 2J57G 3JROA 5FKRA 3SMRA 4Y5RD 2AGWA 4QT8A 3PVWB 3V9FA 2IURA 5EMJB 2H9NA 4PSXB 3UVKA 4QL1A 4PBZA 5K19A 4TZ4A 1JJUB 5C9ZB 2CN3A 2I3TA 4FB1D 3N0DA 1FWXA 4Z8LA 3OL2B 1PEVA 2AGYA 4CZVA 4E5ZA 4BH6A 3DXKC 3EI3B 3OKYA 3SN6B 4L1QD 4JSPC 3EI4A 1PGUA 4GM9A 5HE0B 3IIWA 3NVQA 2GNQA 5FLXg 3I7LA 4LG9A 5IJ8E 5EARA 3RMZD 3V7DB 4FAVD 1L0QA 1XIPA 4ZOVA 3P4FA 1K32A 4A7JA 2PBIB 3DM0A 3SLED 4D6VA 3F3PA 3B7FA 3SJLD 3SFZA 2P9LC 2PM9A 3SVWD 3UVNA 4CI2A 3KRWB 4J82A 3K27A 4ZOXA 2HYEA 4GQ1A 1GXRA 4CI8A 4A09A 2OVRB 2P9PC 3I7OA 4H5JA 5A2Qg 3UKRC 2B5NA 4JSVC 5H1MA 4GM8A 2Q7QA 5AFU3 4CY3A 5FKTA 4GQBB 4LG8A 4OZUA 4UI9R 3C9CA 4ERZA 4L9OA 5HQGA 3PVUB 1NR0A 2I0SA 2H68A
chains in the Genus database with same CATH superfamily
4FA1D 2EIEA 4ERYA 3ZDXA 4Z7QA 1VE7A 3EI3A 2P9SC 5IJ7E 1M1XA 1YR2A 3I7HA 5E6SA 3ODTA 3CFVA 5CXBB 2EIBA 4MK0B 4X3EA 3AL9A 1YFQA 3EI4B 2IUPA 3RLMD 2Z2PA 4BCBA 4CY1A 4JHPC 3EU7A 5FXYA 4ESGA 3SCYA 5M5RA 4J87A 2B5MA 2I3SA 2XU7A 1QFSA 1P22A 3OKTA 5TF2A 4BCDA 1GP2B 2P9IC 3EI1A 4X61B 4A2LA 3SWSD 4A08B 3MKSB 4L3GD 4ES0A 5HE2B 5GMKn 3EQ9A 3IUNA 2H9MA 4BL0A 3FCUA 2OJYA 4GGDA 4CY5A 3OW8A 1BPOA 4AMYA 4A09B 2CE8A 3SBRA 2P9KC 1MDAH 5GXHA 1UOOA 4A11A 5EAPA 3VI4A 4DNUA 3IJEA 3OKWA 5JWZA 2H13A 2WQ8A 2J55H 3CFSB 2VZ1A 3SXTD 2H9LA 3ORVD 5EM2B 4XEIC 4L3HD 2P9NC 4GGCA 4J78A 3ZDZA 3RSEC 3FM0A 3MMYA 1TYQC 5IT9g 4D9SA 3DDUA 2HJBA 4AN0A 5CXBA 2VDMA 4AMZA 2HXCA 2J56H 2OIZA 3K72A 3OTTA 1B9XA 4D0KA 2B5LA 2CN2A 4JHNA 3C5MA 4WJKA 5HE1B 5HDBA 2EBSA 3VGZA 2AGLA 3FCSA 2I0TA 5HE3B 5EAMA 2PM7B 3PXSD 2XL2A 5C92A 2HKRA 4A0BB 1VYHC 3KRXB 1E8NA 1L5GA 4CI1A 3QI0A 3EI2B 4A08A 4QRJA 1R5MA 3EI1B 2XYIA 2H6QA 4AN1A 2VDOA 5THAA 3UVMA 2Z2NA 2VDQA 5FKSA 5IGQA 4O3TB 5C2VB 3O4IA 3EG6A 3MZKA 4J84A 2YNPA 3DXMC 1OLZA 5AJAA 4CZXA 3JZGA 2I0RA 4PSWB 4BP8A 4CZYA 4X63B 3UKUC 4A11B 3JPXA 2W18A 2HESX 2BCJB 4J86A 5EMMB 1GOFA 2CE9A 1N6FA 2XL3A 2YNOA 1K3IA 3A0FA 4WK2A 5EM2A 5TEFA 3EQ7A 4UM9A 5FA5B 4QAMA 2H14A 3L4MD 4MMXA 5EMKB 3PXWD 3UR4A 5GXIA 4K3JB 5E6RA 3T3PA 3IURA 3BG0A 1QFMA 4HDJA 3VI3A 1O6FA 4O9DA 4O45A 2AQ5A 1SHYB 5AMSA 2EIDA 1JMZB 5I5JA 4G56B 3F3FA 3PE7A 5H14A 5M61A 2OVQB 4FA5D 4A0BA 3GC3B 2IAAA 4Y7RA 4CI3A 2AGZA 1PBYB 1C9LA 1B9YA 3HFQA 3I89A 3EI2A 3J81g 3JRPA 3AH8B 1JTDB 3V5WB 3GD1I 1N6EA 4PXWA 3UVLA 3BG1A 4JXMA 4ZOYA 4G1MA 4JD2C 4O02A 3I7KA 4Z7OA 2BBKH 4I79A 4ERQA 4FA9D 2QXVA 4E54B 3JZNA 1O6GA 4ZN4A 5I5IA 4O3UB 4AX4A 5E6UA 4GGAA 2CO0A 3L4OD 3N0EA 2GC7A 4LGNA 5IGOA 3T3MA 3K71A 2HU8A 5FKQA 2IUVA 3IUQA 3SBPA 4ZOZA 2IUQA 4J77A 2YB8B 4WK0A 1TBGA 3GFCA 4J0WA 3IKOA 4YVDA 4O2WA 2YMUA 2YNNA 4JT5C 4J79A 3MKQA 3PSLA 4R7AB 1QNIA 2CNXA 1PI6A 3EMHA 3IJ1A 3VH0A 5CXCB 2Z2OA 4J8GA 1JOFA 2H47A 1H2XA 4XYHA 3QHYB 4O1QD 1XHMA 5FQDA 2TRCB 4WK4A 4IRZA 3UVOA 5H17A 3RRMC 1K8KC 4IMMA 4X60B 2O9KA 4EWRA 4J81A 4AOWA 4PNKB 4J73A 2XDWA 4U1EI 1MG2A 3DSMA 4H5IA 5CYKB 4A0AB 4J0XA 3RFGA 3ZE0A 3K26A 2VZ3A 3NVNA 1E5TA 3JZHA 2UZXB 1E8MA 4GM3A 2XZGA 4NSXA 3RN1D 2H9PA 4GZ8A 3EQ8A 4E54A 4GMBA 1JMXB 2GC4A 3MXXA 2HU5A 3NIFA 3VA6A 5TDHB 2AH1A 2HKMA 5SXMA 1A0RB 1N6DA 3NVXA 4QQEA 2PM6B 3K6SA 2HJ4A 4N14A 5B4WA 1XKSA 2BKLA 5EALA 1MG3A 3IULA 2QR5A 2H6NA 5GSAA 4U7AA 3BWSA 5M5VA 3AL8B 3I7NA 4BP9A 2UZYB 4CY2A 2CO0C 3DWLC 3ULEC 3J80g 1UTCA 3IUJA 3PSCB 4MMZA 4K3ID 1U2VC 5M5TA 4FHLA 2G9AA 5CXCA 2H3XA 3I8EA 2H6KA 4NAAA 5HYNB 1UOQA 3IUMA 2XE4A 4NBMA 1JV2A 4CC9A 4JT6C 4PBYA 3SHFA 3W15A 3ZWLB 4XYIA 3OL2A 5C86A 1ERJA 3RN0D 4GQ2P 4DNWA 2YBAA 2VDNA 3I7PA 4RE6A 3NIGA 3I8CA 3IVMA 5TEEA 4E5ZB 1NEXB 5I5MA 3JAMg 4KFMB 2P9UC 3MZLA 4FWWA 5CYKA 4A0AA 3C99A 4BUJC 5K1CC 3E0CA 4G55A 3OKYB 2AH0A 4IA9A 4AEZA 3IJCA 1U4CA 5C2WB 2G99A 1GOTB 3IIYA 5KDOB 1GG2B 2MTAH 4JSXC 1S4UX 3EWEA 4L1MA 4RE5A 3AFCA 2OK6A 3CIKB 4J8BA 3FRXA 4FAND 3C75H 4NC4A 4JSNC 1H2YA 3F3GA 3FGBA 3RFHA 3I2NA 1VZ2A 3JB9L 2IWKA 5EMLB 3MUNA 3IJ0A 5FFGA 2QC5A 2OK4A 2OVPB 4Z7NA 4FA4D 1OMWB 2IWFA 3PXTD 1SQJA 4BCCA 3AL8A 2PM9B 1RI6A 5IC7A 4A2MA 1Q47A 3SBQA 1SQ9A 4OWRA 3U4YA 4PC0A 3GREA 2AGXA 2B4EA 2J57G 3JROA 5FKRA 3SMRA 4Y5RD 2AGWA 4QT8A 3PVWB 3V9FA 3ZE1A 2IURA 5EMJB 2H9NA 4PSXB 3UVKA 4QL1A 4PBZA 3NIDA 2EICA 3O4JA 5FFOA 4TZ4A 5K19A 1JJUB 5C9ZB 2CN3A 2I3TA 5M5SA 2VDPA 3OF7A 4FB1D 3N0DA 1FWXA 4Z8LA 3OL2B 2JKXA 3ZDYA 1PEVA 2AGYA 4CZVA 4E5ZA 4BH6A 3DXKC 3EI3B 1GOHA 3OKYA 3SN6B 4L1QD 2VDRA 3MUOA 4G1EA 3EI4A 4JSPC 3O4HA 4UM8A 1PGUA 4GM9A 1U8CA 1VE6A 5HE0B 3IIWA 3NVQA 2QZPA 2GNQA 5FLXg 3I7LA 4LG9A 5IJ8E 2VDLA 5EARA 3RMZD 3V7DB 4FAVD 1L0QA 1XIPA 4ZOVA 3P4FA 1K32A 4A7JA 1TYEA 2PBIB 2VC2A 1H2WA 3DM0A 3SLED 4D6VA 3F3PA 3B7FA 3SJLD 3SFZA 2P9LC 1T2XA 2PM9A 1I2MB 3SVWD 3UVNA 4CI2A 3KRWB 4J82A 3K27A 3V4PA 4ZOXA 1VZ3A 1C9IA 2HYEA 4NENA 4GQ1A 1GXRA 1H2ZA 4CI8A 4A09A 2VDKA 1GOGA 2OVRB 2P9PC 2HU7A 3I7OA 1A12A 4H5JA 3ZE2A 3O4GA 5A2Qg 4DNVA 3UKRC 2B5NA 4JSVC 5H1MA 3KCIA 4GM8A 2Q7QA 1UOPA 5AFU3 4CY3A 5FKTA 3V4VA 5M5UA 3MVDK 4GQBB 4LG8A 4OZUA 4UI9R 3C9CA 4ERZA 4L9OA 5HQGA 3PVUB 4MMYA 1NR0A 2I0SA 2H68A
chains in the Genus database with same CATH topology
4FA1D 4ERYA 3EI3A 2P9SC 5IJ7E 3I7HA 3ODTA 3CFVA 5CXBB 4MK0B 4X3EA 3AL9A 1YFQA 3EI4B 2IUPA 3RLMD 2Z2PA 4CY1A 3EU7A 5FXYA 4ESGA 3SCYA 4J87A 2B5MA 2I3SA 2XU7A 1P22A 3OKTA 5TF2A 1GP2B 2P9IC 3EI1A 4X61B 4A2LA 3SWSD 4A08B 3MKSB 4L3GD 4ES0A 5HE2B 5GMKn 2H9MA 4BL0A 2OJYA 4GGDA 4CY5A 3OW8A 4A09B 2CE8A 3SBRA 2P9KC 1MDAH 5GXHA 4A11A 5EAPA 3OKWA 5JWZA 2H13A 2J55H 3CFSB 3SXTD 2H9LA 3ORVD 5EM2B 4XEIC 4L3HD 2P9NC 4GGCA 4J78A 3RSEC 3FM0A 3MMYA 1TYQC 5IT9g 2HJBA 5CXBA 2HXCA 2J56H 2OIZA 3OTTA 1B9XA 4D0KA 2B5LA 2CN2A 3C5MA 5HE1B 2EBSA 3VGZA 2AGLA 2I0TA 5HE3B 5EAMA 2PM7B 3PXSD 2XL2A 2HKRA 4A0BB 1VYHC 3KRXB 4CI1A 3EI2B 4A08A 4QRJA 1R5MA 3EI1B 2XYIA 2H6QA 5THAA 3UVMA 2Z2NA 5FKSA 5IGQA 4O3TB 5C2VB 3EG6A 3MZKA 4J84A 2YNPA 3DXMC 1OLZA 5AJAA 4CZXA 3JZGA 2I0RA 4PSWB 4CZYA 4X63B 3UKUC 4A11B 3JPXA 2W18A 2HESX 2BCJB 4J86A 5EMMB 2CE9A 1N6FA 2XL3A 2YNOA 5EM2A 3A0FA 5TEFA 5FA5B 2H14A 3L4MD 5EMKB 3PXWD 3UR4A 5GXIA 4K3JB 3BG0A 4HDJA 4O9DA 4O45A 2AQ5A 1SHYB 5AMSA 1JMZB 5I5JA 4G56B 3F3FA 3PE7A 5H14A 2OVQB 4FA5D 4A0BA 2IAAA 4Y7RA 4CI3A 2AGZA 1PBYB 1B9YA 3HFQA 3I89A 3EI2A 3J81g 3JRPA 3AH8B 3V5WB 1N6EA 4PXWA 3UVLA 3BG1A 4JXMA 4ZOYA 4JD2C 3I7KA 2BBKH 4I79A 4ERQA 4FA9D 2QXVA 4E54B 3JZNA 4ZN4A 5I5IA 4O3UB 4GGAA 2CO0A 3L4OD 2GC7A 3N0EA 4LGNA 5IGOA 5FKQA 2IUVA 3SBPA 4ZOZA 2IUQA 4J77A 2YB8B 1TBGA 3GFCA 4J0WA 3IKOA 4YVDA 2YMUA 2YNNA 4JT5C 4J79A 3MKQA 3PSLA 4R7AB 1QNIA 2CNXA 1PI6A 3EMHA 3IJ1A 3VH0A 5CXCB 2Z2OA 4J8GA 1JOFA 2H47A 4XYHA 4O1QD 1XHMA 5FQDA 2TRCB 3UVOA 5H17A 3RRMC 1K8KC 4IMMA 4X60B 2O9KA 4EWRA 4J81A 4AOWA 4PNKB 4J73A 4U1EI 1MG2A 3DSMA 4H5IA 5CYKB 4A0AB 4J0XA 3RFGA 3K26A 3NVNA 3JZHA 2UZXB 4GM3A 4NSXA 3RN1D 2H9PA 4GZ8A 4E54A 4GMBA 1JMXB 2GC4A 3MXXA 3VA6A 5TDHB 2AH1A 2HKMA 5SXMA 1A0RB 1N6DA 3NVXA 4QQEA 2PM6B 2HJ4A 4N14A 5B4WA 1XKSA 5EALA 1MG3A 5GSAA 2H6NA 4U7AA 3BWSA 3AL8B 3I7NA 2UZYB 4CY2A 2CO0C 3DWLC 3ULEC 3J80g 3PSCB 4K3ID 1U2VC 4FHLA 2G9AA 5CXCA 2H3XA 3I8EA 2H6KA 5HYNB 4CC9A 4JT6C 4PBYA 3SHFA 3W15A 3ZWLB 4XYIA 3OL2A 1ERJA 3RN0D 4GQ2P 2YBAA 3I7PA 5TEEA 3I8CA 4E5ZB 1NEXB 5I5MA 3JAMg 4KFMB 2P9UC 3MZLA 4FWWA 5CYKA 4A0AA 3C99A 4BUJC 5K1CC 3E0CA 3OKYB 2AH0A 4IA9A 4AEZA 3IJCA 1U4CA 5C2WB 2G99A 1GOTB 3IIYA 5KDOB 1GG2B 2MTAH 4JSXC 1S4UX 3EWEA 3AFCA 2OK6A 3CIKB 4J8BA 3FRXA 4FAND 3C75H 4JSNC 3F3GA 3FGBA 3RFHA 3I2NA 3JB9L 2IWKA 5EMLB 3IJ0A 2QC5A 2OK4A 2OVPB 4FA4D 1OMWB 2IWFA 3PXTD 1SQJA 3AL8A 2PM9B 1RI6A 5IC7A 4A2MA 1Q47A 3SBQA 1SQ9A 4OWRA 3U4YA 4PC0A 3GREA 2AGXA 2B4EA 2J57G 3JROA 5FKRA 3SMRA 4Y5RD 2AGWA 4QT8A 3PVWB 3V9FA 2IURA 5EMJB 2H9NA 4PSXB 3UVKA 4QL1A 4PBZA 5K19A 4TZ4A 1JJUB 5C9ZB 2CN3A 2I3TA 4FB1D 3N0DA 1FWXA 4Z8LA 3OL2B 1PEVA 2AGYA 4CZVA 4E5ZA 4BH6A 3DXKC 3EI3B 3OKYA 3SN6B 4L1QD 4JSPC 3EI4A 1PGUA 4GM9A 5HE0B 3IIWA 3NVQA 2GNQA 5FLXg 3I7LA 4LG9A 5IJ8E 5EARA 3RMZD 3V7DB 4FAVD 1L0QA 1XIPA 4ZOVA 3P4FA 1K32A 4A7JA 2PBIB 3DM0A 3SLED 4D6VA 3F3PA 3B7FA 3SJLD 3SFZA 2P9LC 2PM9A 3SVWD 3UVNA 4CI2A 3KRWB 4J82A 3K27A 4ZOXA 2HYEA 4GQ1A 1GXRA 4CI8A 4A09A 2OVRB 2P9PC 3I7OA 4H5JA 5A2Qg 3UKRC 2B5NA 4JSVC 5H1MA 4GM8A 2Q7QA 5AFU3 4CY3A 5FKTA 4GQBB 4LG8A 4OZUA 4UI9R 3C9CA 4ERZA 4L9OA 5HQGA 3PVUB 1NR0A 2I0SA 2H68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA1 D;  4ERY A;  3EI3 A;  2P9S C;  5IJ7 E;  3I7H A;  3ODT A;  3CFV A;  5CXB B;  4MK0 B;  4X3E A;  3AL9 A;  1YFQ A;  3EI4 B;  2IUP A;  3RLM D;  2Z2P A;  4CY1 A;  3EU7 A;  5FXY A;  4ESG A;  3SCY A;  4J87 A;  2B5M A;  2I3S A;  2XU7 A;  1P22 A;  3OKT A;  5TF2 A;  1GP2 B;  2P9I C;  3EI1 A;  4X61 B;  4A2L A;  3SWS D;  4A08 B;  3MKS B;  4L3G D;  4ES0 A;  5HE2 B;  5GMK n;  2H9M A;  4BL0 A;  2OJY A;  4GGD A;  4CY5 A;  3OW8 A;  4A09 B;  2CE8 A;  3SBR A;  2P9K C;  1MDA H;  5GXH A;  4A11 A;  5EAP A;  3OKW A;  5JWZ A;  2H13 A;  2J55 H;  3CFS B;  3SXT D;  2H9L A;  3ORV D;  5EM2 B;  4XEI C;  4L3H D;  2P9N C;  4GGC A;  4J78 A;  3RSE C;  3FM0 A;  3MMY A;  1TYQ C;  5IT9 g;  2HJB A;  5CXB A;  2HXC A;  2J56 H;  2OIZ A;  3OTT A;  1B9X A;  4D0K A;  2B5L A;  2CN2 A;  3C5M A;  5HE1 B;  2EBS A;  3VGZ A;  2AGL A;  2I0T A;  5HE3 B;  5EAM A;  2PM7 B;  3PXS D;  2XL2 A;  2HKR A;  4A0B B;  1VYH C;  3KRX B;  4CI1 A;  3EI2 B;  4A08 A;  4QRJ A;  1R5M A;  3EI1 B;  2XYI A;  2H6Q A;  5THA A;  3UVM A;  2Z2N A;  5FKS A;  5IGQ A;  4O3T B;  5C2V B;  3EG6 A;  3MZK A;  4J84 A;  2YNP A;  3DXM C;  1OLZ A;  5AJA A;  4CZX A;  3JZG A;  2I0R A;  4PSW B;  4CZY A;  4X63 B;  3UKU C;  4A11 B;  3JPX A;  2W18 A;  2HES X;  2BCJ B;  4J86 A;  5EMM B;  2CE9 A;  1N6F A;  2XL3 A;  2YNO A;  5EM2 A;  3A0F A;  5TEF A;  5FA5 B;  2H14 A;  3L4M D;  5EMK B;  3PXW D;  3UR4 A;  5GXI A;  4K3J B;  3BG0 A;  4HDJ A;  4O9D A;  4O45 A;  2AQ5 A;  1SHY B;  5AMS A;  1JMZ B;  5I5J A;  4G56 B;  3F3F A;  3PE7 A;  5H14 A;  2OVQ B;  4FA5 D;  4A0B A;  2IAA A;  4Y7R A;  4CI3 A;  2AGZ A;  1PBY B;  1B9Y A;  3HFQ A;  3I89 A;  3EI2 A;  3J81 g;  3JRP A;  3AH8 B;  3V5W B;  1N6E A;  4PXW A;  3UVL A;  3BG1 A;  4JXM A;  4ZOY A;  4JD2 C;  3I7K A;  2BBK H;  4I79 A;  4ERQ A;  4FA9 D;  2QXV A;  4E54 B;  3JZN A;  4ZN4 A;  5I5I A;  4O3U B;  4GGA A;  2CO0 A;  3L4O D;  2GC7 A;  3N0E A;  4LGN A;  5IGO A;  5FKQ A;  2IUV A;  3SBP A;  4ZOZ A;  2IUQ A;  4J77 A;  2YB8 B;  1TBG A;  3GFC A;  4J0W A;  3IKO A;  4YVD A;  2YMU A;  2YNN A;  4JT5 C;  4J79 A;  3MKQ A;  3PSL A;  4R7A B;  1QNI A;  2CNX A;  1PI6 A;  3EMH A;  3IJ1 A;  3VH0 A;  5CXC B;  2Z2O A;  4J8G A;  1JOF A;  2H47 A;  4XYH A;  4O1Q D;  1XHM A;  5FQD A;  2TRC B;  3UVO A;  5H17 A;  3RRM C;  1K8K C;  4IMM A;  4X60 B;  2O9K A;  4EWR A;  4J81 A;  4AOW A;  4PNK B;  4J73 A;  4U1E I;  1MG2 A;  3DSM A;  4H5I A;  5CYK B;  4A0A B;  4J0X A;  3RFG A;  3K26 A;  3NVN A;  3JZH A;  2UZX B;  4GM3 A;  4NSX A;  3RN1 D;  2H9P A;  4GZ8 A;  4E54 A;  4GMB A;  1JMX B;  2GC4 A;  3MXX A;  3VA6 A;  5TDH B;  2AH1 A;  2HKM A;  5SXM A;  1A0R B;  1N6D A;  3NVX A;  4QQE A;  2PM6 B;  2HJ4 A;  4N14 A;  5B4W A;  1XKS A;  5EAL A;  1MG3 A;  5GSA A;  2H6N A;  4U7A A;  3BWS A;  3AL8 B;  3I7N A;  2UZY B;  4CY2 A;  2CO0 C;  3DWL C;  3ULE C;  3J80 g;  3PSC B;  4K3I D;  1U2V C;  4FHL A;  2G9A A;  5CXC A;  2H3X A;  3I8E A;  2H6K A;  5HYN B;  4CC9 A;  4JT6 C;  4PBY A;  3SHF A;  3W15 A;  3ZWL B;  4XYI A;  3OL2 A;  1ERJ A;  3RN0 D;  4GQ2 P;  2YBA A;  3I7P A;  5TEE A;  3I8C A;  4E5Z B;  1NEX B;  5I5M A;  3JAM g;  4KFM B;  2P9U C;  3MZL A;  4FWW A;  5CYK A;  4A0A A;  3C99 A;  4BUJ C;  5K1C C;  3E0C A;  3OKY B;  2AH0 A;  4IA9 A;  4AEZ A;  3IJC A;  1U4C A;  5C2W B;  2G99 A;  1GOT B;  3IIY A;  5KDO B;  1GG2 B;  2MTA H;  4JSX C;  1S4U X;  3EWE A;  3AFC A;  2OK6 A;  3CIK B;  4J8B A;  3FRX A;  4FAN D;  3C75 H;  4JSN C;  3F3G A;  3FGB A;  3RFH A;  3I2N A;  3JB9 L;  2IWK A;  5EML B;  3IJ0 A;  2QC5 A;  2OK4 A;  2OVP B;  4FA4 D;  1OMW B;  2IWF A;  3PXT D;  1SQJ A;  3AL8 A;  2PM9 B;  1RI6 A;  5IC7 A;  4A2M A;  1Q47 A;  3SBQ A;  1SQ9 A;  4OWR A;  3U4Y A;  4PC0 A;  3GRE A;  2AGX A;  2B4E A;  2J57 G;  3JRO A;  5FKR A;  3SMR A;  4Y5R D;  2AGW A;  4QT8 A;  3PVW B;  3V9F A;  2IUR A;  5EMJ B;  2H9N A;  4PSX B;  3UVK A;  4QL1 A;  4PBZ A;  5K19 A;  4TZ4 A;  1JJU B;  5C9Z B;  2CN3 A;  2I3T A;  4FB1 D;  3N0D A;  1FWX A;  4Z8L A;  3OL2 B;  1PEV A;  2AGY A;  4CZV A;  4E5Z A;  4BH6 A;  3DXK C;  3EI3 B;  3OKY A;  3SN6 B;  4L1Q D;  4JSP C;  3EI4 A;  1PGU A;  4GM9 A;  5HE0 B;  3IIW A;  3NVQ A;  2GNQ A;  5FLX g;  3I7L A;  4LG9 A;  5IJ8 E;  5EAR A;  3RMZ D;  3V7D B;  4FAV D;  1L0Q A;  1XIP A;  4ZOV A;  3P4F A;  1K32 A;  4A7J A;  2PBI B;  3DM0 A;  3SLE D;  4D6V A;  3F3P A;  3B7F A;  3SJL D;  3SFZ A;  2P9L C;  2PM9 A;  3SVW D;  3UVN A;  4CI2 A;  3KRW B;  4J82 A;  3K27 A;  4ZOX A;  2HYE A;  4GQ1 A;  1GXR A;  4CI8 A;  4A09 A;  2OVR B;  2P9P C;  3I7O A;  4H5J A;  5A2Q g;  3UKR C;  2B5N A;  4JSV C;  5H1M A;  4GM8 A;  2Q7Q A;  5AFU 3;  4CY3 A;  5FKT A;  4GQB B;  4LG8 A;  4OZU A;  4UI9 R;  3C9C A;  4ERZ A;  4L9O A;  5HQG A;  3PVU B;  1NR0 A;  2I0S A;  2H68 A; 
#chains in the Genus database with same CATH topology
 4FA1 D;  2EIE A;  4ERY A;  3ZDX A;  4Z7Q A;  1VE7 A;  3EI3 A;  2P9S C;  5IJ7 E;  1M1X A;  1YR2 A;  3I7H A;  5E6S A;  3ODT A;  3CFV A;  5CXB B;  2EIB A;  4MK0 B;  4X3E A;  3AL9 A;  1YFQ A;  3EI4 B;  2IUP A;  3RLM D;  2Z2P A;  4BCB A;  4CY1 A;  4JHP C;  3EU7 A;  5FXY A;  4ESG A;  3SCY A;  5M5R A;  4J87 A;  2B5M A;  2I3S A;  2XU7 A;  1QFS A;  1P22 A;  3OKT A;  5TF2 A;  4BCD A;  1GP2 B;  2P9I C;  3EI1 A;  4X61 B;  4A2L A;  3SWS D;  4A08 B;  3MKS B;  4L3G D;  4ES0 A;  5HE2 B;  5GMK n;  3EQ9 A;  3IUN A;  2H9M A;  4BL0 A;  3FCU A;  2OJY A;  4GGD A;  4CY5 A;  3OW8 A;  1BPO A;  4AMY A;  4A09 B;  2CE8 A;  3SBR A;  2P9K C;  1MDA H;  5GXH A;  1UOO A;  4A11 A;  5EAP A;  3VI4 A;  4DNU A;  3IJE A;  3OKW A;  5JWZ A;  2H13 A;  2WQ8 A;  2J55 H;  3CFS B;  2VZ1 A;  3SXT D;  2H9L A;  3ORV D;  5EM2 B;  4XEI C;  4L3H D;  2P9N C;  4GGC A;  4J78 A;  3ZDZ A;  3RSE C;  3FM0 A;  3MMY A;  1TYQ C;  5IT9 g;  4D9S A;  3DDU A;  2HJB A;  4AN0 A;  5CXB A;  2VDM A;  4AMZ A;  2HXC A;  2J56 H;  2OIZ A;  3K72 A;  3OTT A;  1B9X A;  4D0K A;  2B5L A;  2CN2 A;  4JHN A;  3C5M A;  4WJK A;  5HE1 B;  5HDB A;  2EBS A;  3VGZ A;  2AGL A;  3FCS A;  2I0T A;  5HE3 B;  5EAM A;  2PM7 B;  3PXS D;  2XL2 A;  5C92 A;  2HKR A;  4A0B B;  1VYH C;  3KRX B;  1E8N A;  1L5G A;  4CI1 A;  3QI0 A;  3EI2 B;  4A08 A;  4QRJ A;  1R5M A;  3EI1 B;  2XYI A;  2H6Q A;  4AN1 A;  2VDO A;  5THA A;  3UVM A;  2Z2N A;  2VDQ A;  5FKS A;  5IGQ A;  4O3T B;  5C2V B;  3O4I A;  3EG6 A;  3MZK A;  4J84 A;  2YNP A;  3DXM C;  1OLZ A;  5AJA A;  4CZX A;  3JZG A;  2I0R A;  4PSW B;  4BP8 A;  4CZY A;  4X63 B;  3UKU C;  4A11 B;  3JPX A;  2W18 A;  2HES X;  2BCJ B;  4J86 A;  5EMM B;  1GOF A;  2CE9 A;  1N6F A;  2XL3 A;  2YNO A;  1K3I A;  3A0F A;  4WK2 A;  5EM2 A;  5TEF A;  3EQ7 A;  4UM9 A;  5FA5 B;  4QAM A;  2H14 A;  3L4M D;  4MMX A;  5EMK B;  3PXW D;  3UR4 A;  5GXI A;  4K3J B;  5E6R A;  3T3P A;  3IUR A;  3BG0 A;  1QFM A;  4HDJ A;  3VI3 A;  1O6F A;  4O9D A;  4O45 A;  2AQ5 A;  1SHY B;  5AMS A;  2EID A;  1JMZ B;  5I5J A;  4G56 B;  3F3F A;  3PE7 A;  5H14 A;  5M61 A;  2OVQ B;  4FA5 D;  4A0B A;  3GC3 B;  2IAA A;  4Y7R A;  4CI3 A;  2AGZ A;  1PBY B;  1C9L A;  1B9Y A;  3HFQ A;  3I89 A;  3EI2 A;  3J81 g;  3JRP A;  3AH8 B;  1JTD B;  3V5W B;  3GD1 I;  1N6E A;  4PXW A;  3UVL A;  3BG1 A;  4JXM A;  4ZOY A;  4G1M A;  4JD2 C;  4O02 A;  3I7K A;  4Z7O A;  2BBK H;  4I79 A;  4ERQ A;  4FA9 D;  2QXV A;  4E54 B;  3JZN A;  1O6G A;  4ZN4 A;  5I5I A;  4O3U B;  4AX4 A;  5E6U A;  4GGA A;  2CO0 A;  3L4O D;  3N0E A;  2GC7 A;  4LGN A;  5IGO A;  3T3M A;  3K71 A;  2HU8 A;  5FKQ A;  2IUV A;  3IUQ A;  3SBP A;  4ZOZ A;  2IUQ A;  4J77 A;  2YB8 B;  4WK0 A;  1TBG A;  3GFC A;  4J0W A;  3IKO A;  4YVD A;  4O2W A;  2YMU A;  2YNN A;  4JT5 C;  4J79 A;  3MKQ A;  3PSL A;  4R7A B;  1QNI A;  2CNX A;  1PI6 A;  3EMH A;  3IJ1 A;  3VH0 A;  5CXC B;  2Z2O A;  4J8G A;  1JOF A;  2H47 A;  1H2X A;  4XYH A;  3QHY B;  4O1Q D;  1XHM A;  5FQD A;  2TRC B;  4WK4 A;  4IRZ A;  3UVO A;  5H17 A;  3RRM C;  1K8K C;  4IMM A;  4X60 B;  2O9K A;  4EWR A;  4J81 A;  4AOW A;  4PNK B;  4J73 A;  2XDW A;  4U1E I;  1MG2 A;  3DSM A;  4H5I A;  5CYK B;  4A0A B;  4J0X A;  3RFG A;  3ZE0 A;  3K26 A;  2VZ3 A;  3NVN A;  1E5T A;  3JZH A;  2UZX B;  1E8M A;  4GM3 A;  2XZG A;  4NSX A;  3RN1 D;  2H9P A;  4GZ8 A;  3EQ8 A;  4E54 A;  4GMB A;  1JMX B;  2GC4 A;  3MXX A;  2HU5 A;  3NIF A;  3VA6 A;  5TDH B;  2AH1 A;  2HKM A;  5SXM A;  1A0R B;  1N6D A;  3NVX A;  4QQE A;  2PM6 B;  3K6S A;  2HJ4 A;  4N14 A;  5B4W A;  1XKS A;  2BKL A;  5EAL A;  1MG3 A;  3IUL A;  2QR5 A;  2H6N A;  5GSA A;  4U7A A;  3BWS A;  5M5V A;  3AL8 B;  3I7N A;  4BP9 A;  2UZY B;  4CY2 A;  2CO0 C;  3DWL C;  3ULE C;  3J80 g;  1UTC A;  3IUJ A;  3PSC B;  4MMZ A;  4K3I D;  1U2V C;  5M5T A;  4FHL A;  2G9A A;  5CXC A;  2H3X A;  3I8E A;  2H6K A;  4NAA A;  5HYN B;  1UOQ A;  3IUM A;  2XE4 A;  4NBM A;  1JV2 A;  4CC9 A;  4JT6 C;  4PBY A;  3SHF A;  3W15 A;  3ZWL B;  4XYI A;  3OL2 A;  5C86 A;  1ERJ A;  3RN0 D;  4GQ2 P;  4DNW A;  2YBA A;  2VDN A;  3I7P A;  4RE6 A;  3NIG A;  3I8C A;  3IVM A;  5TEE A;  4E5Z B;  1NEX B;  5I5M A;  3JAM g;  4KFM B;  2P9U C;  3MZL A;  4FWW A;  5CYK A;  4A0A A;  3C99 A;  4BUJ C;  5K1C C;  3E0C A;  4G55 A;  3OKY B;  2AH0 A;  4IA9 A;  4AEZ A;  3IJC A;  1U4C A;  5C2W B;  2G99 A;  1GOT B;  3IIY A;  5KDO B;  1GG2 B;  2MTA H;  4JSX C;  1S4U X;  3EWE A;  4L1M A;  4RE5 A;  3AFC A;  2OK6 A;  3CIK B;  4J8B A;  3FRX A;  4FAN D;  3C75 H;  4NC4 A;  4JSN C;  1H2Y A;  3F3G A;  3FGB A;  3RFH A;  3I2N A;  1VZ2 A;  3JB9 L;  2IWK A;  5EML B;  3MUN A;  3IJ0 A;  5FFG A;  2QC5 A;  2OK4 A;  2OVP B;  4Z7N A;  4FA4 D;  1OMW B;  2IWF A;  3PXT D;  1SQJ A;  4BCC A;  3AL8 A;  2PM9 B;  1RI6 A;  5IC7 A;  4A2M A;  1Q47 A;  3SBQ A;  1SQ9 A;  4OWR A;  3U4Y A;  4PC0 A;  3GRE A;  2AGX A;  2B4E A;  2J57 G;  3JRO A;  5FKR A;  3SMR A;  4Y5R D;  2AGW A;  4QT8 A;  3PVW B;  3V9F A;  3ZE1 A;  2IUR A;  5EMJ B;  2H9N A;  4PSX B;  3UVK A;  4QL1 A;  4PBZ A;  3NID A;  2EIC A;  3O4J A;  5FFO A;  4TZ4 A;  5K19 A;  1JJU B;  5C9Z B;  2CN3 A;  2I3T A;  5M5S A;  2VDP A;  3OF7 A;  4FB1 D;  3N0D A;  1FWX A;  4Z8L A;  3OL2 B;  2JKX A;  3ZDY A;  1PEV A;  2AGY A;  4CZV A;  4E5Z A;  4BH6 A;  3DXK C;  3EI3 B;  1GOH A;  3OKY A;  3SN6 B;  4L1Q D;  2VDR A;  3MUO A;  4G1E A;  3EI4 A;  4JSP C;  3O4H A;  4UM8 A;  1PGU A;  4GM9 A;  1U8C A;  1VE6 A;  5HE0 B;  3IIW A;  3NVQ A;  2QZP A;  2GNQ A;  5FLX g;  3I7L A;  4LG9 A;  5IJ8 E;  2VDL A;  5EAR A;  3RMZ D;  3V7D B;  4FAV D;  1L0Q A;  1XIP A;  4ZOV A;  3P4F A;  1K32 A;  4A7J A;  1TYE A;  2PBI B;  2VC2 A;  1H2W A;  3DM0 A;  3SLE D;  4D6V A;  3F3P A;  3B7F A;  3SJL D;  3SFZ A;  2P9L C;  1T2X A;  2PM9 A;  1I2M B;  3SVW D;  3UVN A;  4CI2 A;  3KRW B;  4J82 A;  3K27 A;  3V4P A;  4ZOX A;  1VZ3 A;  1C9I A;  2HYE A;  4NEN A;  4GQ1 A;  1GXR A;  1H2Z A;  4CI8 A;  4A09 A;  2VDK A;  1GOG A;  2OVR B;  2P9P C;  2HU7 A;  3I7O A;  1A12 A;  4H5J A;  3ZE2 A;  3O4G A;  5A2Q g;  4DNV A;  3UKR C;  2B5N A;  4JSV C;  5H1M A;  3KCI A;  4GM8 A;  2Q7Q A;  1UOP A;  5AFU 3;  4CY3 A;  5FKT A;  3V4V A;  5M5U A;  3MVD K;  4GQB B;  4LG8 A;  4OZU A;  4UI9 R;  3C9C A;  4ERZ A;  4L9O A;  5HQG A;  3PVU B;  4MMY A;  1NR0 A;  2I0S A;  2H68 A; 
#chains in the Genus database with same CATH homology
 4FA1 D;  4ERY A;  3EI3 A;  2P9S C;  5IJ7 E;  3I7H A;  3ODT A;  3CFV A;  5CXB B;  4MK0 B;  4X3E A;  3AL9 A;  1YFQ A;  3EI4 B;  2IUP A;  3RLM D;  2Z2P A;  4CY1 A;  3EU7 A;  5FXY A;  4ESG A;  3SCY A;  4J87 A;  2B5M A;  2I3S A;  2XU7 A;  1P22 A;  3OKT A;  5TF2 A;  1GP2 B;  2P9I C;  3EI1 A;  4X61 B;  4A2L A;  3SWS D;  4A08 B;  3MKS B;  4L3G D;  4ES0 A;  5HE2 B;  5GMK n;  2H9M A;  4BL0 A;  2OJY A;  4GGD A;  4CY5 A;  3OW8 A;  4A09 B;  2CE8 A;  3SBR A;  2P9K C;  1MDA H;  5GXH A;  4A11 A;  5EAP A;  3OKW A;  5JWZ A;  2H13 A;  2J55 H;  3CFS B;  3SXT D;  2H9L A;  3ORV D;  5EM2 B;  4XEI C;  4L3H D;  2P9N C;  4GGC A;  4J78 A;  3RSE C;  3FM0 A;  3MMY A;  1TYQ C;  5IT9 g;  2HJB A;  5CXB A;  2HXC A;  2J56 H;  2OIZ A;  3OTT A;  1B9X A;  4D0K A;  2B5L A;  2CN2 A;  3C5M A;  5HE1 B;  2EBS A;  3VGZ A;  2AGL A;  2I0T A;  5HE3 B;  5EAM A;  2PM7 B;  3PXS D;  2XL2 A;  2HKR A;  4A0B B;  1VYH C;  3KRX B;  4CI1 A;  3EI2 B;  4A08 A;  4QRJ A;  1R5M A;  3EI1 B;  2XYI A;  2H6Q A;  5THA A;  3UVM A;  2Z2N A;  5FKS A;  5IGQ A;  4O3T B;  5C2V B;  3EG6 A;  3MZK A;  4J84 A;  2YNP A;  3DXM C;  1OLZ A;  5AJA A;  4CZX A;  3JZG A;  2I0R A;  4PSW B;  4CZY A;  4X63 B;  3UKU C;  4A11 B;  3JPX A;  2W18 A;  2HES X;  2BCJ B;  4J86 A;  5EMM B;  2CE9 A;  1N6F A;  2XL3 A;  2YNO A;  5EM2 A;  3A0F A;  5TEF A;  5FA5 B;  2H14 A;  3L4M D;  5EMK B;  3PXW D;  3UR4 A;  5GXI A;  4K3J B;  3BG0 A;  4HDJ A;  4O9D A;  4O45 A;  2AQ5 A;  1SHY B;  5AMS A;  1JMZ B;  5I5J A;  4G56 B;  3F3F A;  3PE7 A;  5H14 A;  2OVQ B;  4FA5 D;  4A0B A;  2IAA A;  4Y7R A;  4CI3 A;  2AGZ A;  1PBY B;  1B9Y A;  3HFQ A;  3I89 A;  3EI2 A;  3J81 g;  3JRP A;  3AH8 B;  3V5W B;  1N6E A;  4PXW A;  3UVL A;  3BG1 A;  4JXM A;  4ZOY A;  4JD2 C;  3I7K A;  2BBK H;  4I79 A;  4ERQ A;  4FA9 D;  2QXV A;  4E54 B;  3JZN A;  4ZN4 A;  5I5I A;  4O3U B;  4GGA A;  2CO0 A;  3L4O D;  2GC7 A;  3N0E A;  4LGN A;  5IGO A;  5FKQ A;  2IUV A;  3SBP A;  4ZOZ A;  2IUQ A;  4J77 A;  2YB8 B;  1TBG A;  3GFC A;  4J0W A;  3IKO A;  4YVD A;  2YMU A;  2YNN A;  4JT5 C;  4J79 A;  3MKQ A;  3PSL A;  4R7A B;  1QNI A;  2CNX A;  1PI6 A;  3EMH A;  3IJ1 A;  3VH0 A;  5CXC B;  2Z2O A;  4J8G A;  1JOF A;  2H47 A;  4XYH A;  4O1Q D;  1XHM A;  5FQD A;  2TRC B;  3UVO A;  5H17 A;  3RRM C;  1K8K C;  4IMM A;  4X60 B;  2O9K A;  4EWR A;  4J81 A;  4AOW A;  4PNK B;  4J73 A;  4U1E I;  1MG2 A;  3DSM A;  4H5I A;  5CYK B;  4A0A B;  4J0X A;  3RFG A;  3K26 A;  3NVN A;  3JZH A;  2UZX B;  4GM3 A;  4NSX A;  3RN1 D;  2H9P A;  4GZ8 A;  4E54 A;  4GMB A;  1JMX B;  2GC4 A;  3MXX A;  3VA6 A;  5TDH B;  2AH1 A;  2HKM A;  5SXM A;  1A0R B;  1N6D A;  3NVX A;  4QQE A;  2PM6 B;  2HJ4 A;  4N14 A;  5B4W A;  1XKS A;  5EAL A;  1MG3 A;  5GSA A;  2H6N A;  4U7A A;  3BWS A;  3AL8 B;  3I7N A;  2UZY B;  4CY2 A;  2CO0 C;  3DWL C;  3ULE C;  3J80 g;  3PSC B;  4K3I D;  1U2V C;  4FHL A;  2G9A A;  5CXC A;  2H3X A;  3I8E A;  2H6K A;  5HYN B;  4CC9 A;  4JT6 C;  4PBY A;  3SHF A;  3W15 A;  3ZWL B;  4XYI A;  3OL2 A;  1ERJ A;  3RN0 D;  4GQ2 P;  2YBA A;  3I7P A;  5TEE A;  3I8C A;  4E5Z B;  1NEX B;  5I5M A;  3JAM g;  4KFM B;  2P9U C;  3MZL A;  4FWW A;  5CYK A;  4A0A A;  3C99 A;  4BUJ C;  5K1C C;  3E0C A;  3OKY B;  2AH0 A;  4IA9 A;  4AEZ A;  3IJC A;  1U4C A;  5C2W B;  2G99 A;  1GOT B;  3IIY A;  5KDO B;  1GG2 B;  2MTA H;  4JSX C;  1S4U X;  3EWE A;  3AFC A;  2OK6 A;  3CIK B;  4J8B A;  3FRX A;  4FAN D;  3C75 H;  4JSN C;  3F3G A;  3FGB A;  3RFH A;  3I2N A;  3JB9 L;  2IWK A;  5EML B;  3IJ0 A;  2QC5 A;  2OK4 A;  2OVP B;  4FA4 D;  1OMW B;  2IWF A;  3PXT D;  1SQJ A;  3AL8 A;  2PM9 B;  1RI6 A;  5IC7 A;  4A2M A;  1Q47 A;  3SBQ A;  1SQ9 A;  4OWR A;  3U4Y A;  4PC0 A;  3GRE A;  2AGX A;  2B4E A;  2J57 G;  3JRO A;  5FKR A;  3SMR A;  4Y5R D;  2AGW A;  4QT8 A;  3PVW B;  3V9F A;  2IUR A;  5EMJ B;  2H9N A;  4PSX B;  3UVK A;  4QL1 A;  4PBZ A;  5K19 A;  4TZ4 A;  1JJU B;  5C9Z B;  2CN3 A;  2I3T A;  4FB1 D;  3N0D A;  1FWX A;  4Z8L A;  3OL2 B;  1PEV A;  2AGY A;  4CZV A;  4E5Z A;  4BH6 A;  3DXK C;  3EI3 B;  3OKY A;  3SN6 B;  4L1Q D;  4JSP C;  3EI4 A;  1PGU A;  4GM9 A;  5HE0 B;  3IIW A;  3NVQ A;  2GNQ A;  5FLX g;  3I7L A;  4LG9 A;  5IJ8 E;  5EAR A;  3RMZ D;  3V7D B;  4FAV D;  1L0Q A;  1XIP A;  4ZOV A;  3P4F A;  1K32 A;  4A7J A;  2PBI B;  3DM0 A;  3SLE D;  4D6V A;  3F3P A;  3B7F A;  3SJL D;  3SFZ A;  2P9L C;  2PM9 A;  3SVW D;  3UVN A;  4CI2 A;  3KRW B;  4J82 A;  3K27 A;  4ZOX A;  2HYE A;  4GQ1 A;  1GXR A;  4CI8 A;  4A09 A;  2OVR B;  2P9P C;  3I7O A;  4H5J A;  5A2Q g;  3UKR C;  2B5N A;  4JSV C;  5H1M A;  4GM8 A;  2Q7Q A;  5AFU 3;  4CY3 A;  5FKT A;  4GQB B;  4LG8 A;  4OZU A;  4UI9 R;  3C9C A;  4ERZ A;  4L9O A;  5HQG A;  3PVU B;  1NR0 A;  2I0S A;  2H68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...