3UVKA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll2
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
299
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLDNPPVSFVKFSPNGKYILAATLDNTLKLWDKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 104
structure length 299
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvkA00
4PSWB 3MZLA 5A2Qg 3VGZA 3RRMC 3MKSB 4GMBA 3I8CA 4ESGA 4FA1D 4JSXC 1P22A 4BUJC 4O3TB 2CNXA 1B9XA 4PXWA 1TBGA 3UKRC 2YB8B 2CO0C 4PBYA 4CY3A 4A2MA 3MKQA 3NVNA 2BCJB 5THAA 2HJ4A 4JSVC 2CE8A 5CYKB 5SXMA 4QRJA 3N0DA 4ES0A 5AMSA 3OKTA 5FKQA 5CXBB 1N6FA 4TZ4A 4BL0A 3I7NA 3C75H 3VA6A 3AL8A 1TYQC 4A0AB 2BBKH 3GFCA 4CY2A 2G99A 3I2NA 3AL9A 3EI3A 4N14A 4ZOYA 2B5NA 1U4CA 3ORVD 2P9IC 2P9KC 3DSMA 4J78A 2YNPA 3UVLA 3EI2B 5FKSA 2AGXA 4X63B 3SMRA 3JROA 4ZN4A 5CXCA 3SXTD 2HESX 3JAMg 5EM2B 4GM3A 3UVOA 2GC4A 3I8EA 5FQDA 3SCYA 2PM6B 4PNKB 3I89A 1FWXA 5HE1B 2J55H 4GM9A 1N6EA 4XYIA 4L3HD 5IJ7E 1PEVA 2GC7A 2Q7QA 4LG8A 1A0RB 4GQ2P 3SBRA 3I7OA 4D0KA 4O3UB 3EI1B 3PVUB 4GGDA 3NVXA 3SLED 5FLXg 3DXKC 3IJ1A 4J79A 5CYKA 3BG1A 2UZXB 5HYNB 4K3ID 2CO0A 4CI2A 3MZKA 3SN6B 3DXMC 4EWRA 2Z2NA 3V5WB 1SQJA 3SVWD 2OK6A 3RN0D 5K1CC 5HE0B 5FA5B 4A0AA 2H68A 2I3SA 2OK4A 3P4FA 3SBQA 2MTAH 2OIZA 4CI8A 1PI6A 2GNQA 3B7FA 5TEEA 5I5MA 4H5JA 2I3TA 4L1QD 3V9FA 5FKTA 2AGLA 2AGWA 2P9LC 3BWSA 2H9MA 3JB9L 1PBYB 3JRPA 1GP2B 4J82A 2I0TA 2AH0A 3K27A 4CY5A 5TF2A 3FM0A 4J8GA 3ODTA 2G9AA 2I0SA 4A2LA 5FKRA 3PSCB 5TDHB 4J0XA 4AEZA 3C99A 3UKUC 2XL2A 4A11B 3U4YA 2OVQB 4Y7RA 4Y5RD 4ERQA 3HFQA 3N0EA 3EI1A 3FGBA 4FAVD 4A09A 4Z8LA 4FA4D 2PBIB 3EI4A 4A0BA 3EG6A 1VYHC 2H13A 4J86A 1JMXB 3J81g 3C9CA 2HKRA 1GOTB 2XYIA 4GQ1A 4L3GD 3AH8B 4LG9A 2AGYA 5AJAA 3PXSD 3FRXA 4QL1A 3L4OD 2IURA 1PGUA 1OMWB 5HQGA 5AFU3 4NSXA 1NEXB 3L4MD 4I79A 2YMUA 2AGZA 4QQEA 1SQ9A 5KDOB 4PC0A 3DM0A 3OL2A 3NVQA 3PXWD 4IMMA 2H6KA 3IKOA 1ERJA 3ZWLB 4FA5D 3AFCA 4GQBB 5IC7A 5B4WA 4JSNC 3RN1D 5GXIA 3EU7A 3W15A 1XKSA 3MMYA 4E54B 3I7KA 4ZOZA 4A7JA 5IT9g 2IWKA 2Z2PA 4GGAA 3F3FA 4J84A 3ULEC 2B5MA 5EAPA 5EMKB 4QT8A 1GG2B 1B9YA 4CI3A 4FWWA 3UR4A 2P9PC 4A08B 3KRXB 5I5JA 5EALA 2YNOA 2CE9A 3JZNA 3PXTD 3CFVA 5GSAA 4A11A 4GGCA 5IGQA 3JZGA 1R5MA 3KRWB 3MXXA 5CXBA 2HJBA 1SHYB 3JPXA 3E0CA 4R7AB 4BH6A 3SJLD 4J77A 5IGOA 1L0QA 4J73A 4JT6C 1XHMA 2B4EA 3I7PA 2J56H 4X3EA 2OJYA 2QC5A 4UI9R 5H1MA 1RI6A 5C9ZB 2H3XA 5I5IA 2AQ5A 5EMLB 1MDAH 3EI2A 3F3GA 4H5IA 3UVNA 1S4UX 4L9OA 4J87A 4E5ZB 3DWLC 3OTTA 1OLZA 5EM2A 4FAND 4J8BA 4U1EI 5EARA 5H14A 3V7DB 4O9DA 1XIPA 2UZYB 2H9LA 2H6NA 5TEFA 2PM7B 3RFHA 2PM9B 4K3JB 3IJCA 4CZXA 3RSEC 3RFGA 4LGNA 5EMJB 2P9SC 4ERYA 4E54A 3OKWA 1NR0A 4XEIC 3SFZA 2EBSA 2O9KA 2CN3A 3OKYB 5HE3B 4GM8A 3EWEA 4FB1D 3PE7A 1QNIA 3EMHA 3CFSB 3SBPA 4A08A 4JSPC 1JMZB 3PSLA 4J81A 2IUQA 1K32A 4OZUA 3RLMD 4FA9D 5IJ8E 2P9NC 1N6DA 5K19A 3A0FA 2HXCA 5EMMB 4HDJA 2HKMA 3UVKA 5C2WB 1U2VC 5GXHA 4XYHA 4KFMB 4MK0B 1MG2A 2IAAA 4CI1A 1JJUB 1MG3A 2CN2A 4PBZA 4CZVA 4FHLA 4YVDA 2H6QA 5JWZA 3VH0A 3C5MA 4JT5C 2IWFA 2P9UC 2J57G 5C2VB 2OVRB 2Z2OA 4ZOXA 4J0WA 4OWRA 2IUVA 2H9PA 3SWSD 4E5ZA 1JOFA 3GREA 2B5LA 3IIWA 3K26A 2HYEA 3I7LA 1K8KC 4JD2C 4ERZA 2H9NA 2PM9A 3I7HA 2AH1A 4G56B 2QXVA 4GZ8A 2W18A 2XU7A 4X61B 2IUPA 3CIKB 4IA9A 1Q47A 3OW8A 2YNNA 3AL8B 2XL3A 4CZYA 4PSXB 4A09B 2OVPB 3UVMA 3SHFA 4D6VA 3EI4B 3OKYA 2H47A 3EI3B 2YBAA 4A0BB 2I0RA 5GMKn 3IIYA 1YFQA 5H17A 2TRCB 3JZHA 4CC9A 2H14A 5FXYA 4JXMA 4CY1A 5CXCB 3BG0A 3IJ0A 1GXRA 3F3PA 4ZOVA 3J80g 5HE2B 5EAMA 3OL2B 4AOWA 3PVWB 4U7AA 4O45A 4X60B 4O1QD 3RMZD
chains in the Genus database with same CATH superfamily
4PSWB 3EQ9A 3MZLA 1E8NA 5A2Qg 1VZ2A 3VGZA 3RRMC 3MKSB 4GMBA 4BCDA 3I8CA 4ESGA 4FA1D 4JSXC 1H2WA 1P22A 4BUJC 4O3TB 2CNXA 5C86A 1B9XA 4PXWA 1TBGA 3UKRC 2YB8B 2CO0C 4PBYA 4CY3A 4A2MA 4WK4A 4UM8A 3MKQA 3NVNA 2BCJB 5THAA 2HJ4A 4JSVC 2CE8A 5CYKB 5SXMA 4QRJA 3N0DA 4ES0A 5AMSA 3OKTA 5FKQA 5CXBB 2EIDA 1N6FA 4TZ4A 4BL0A 1O6FA 3I7NA 3C75H 3V4VA 3VA6A 3AL8A 1TYQC 4A0AB 2BBKH 3GFCA 4CY2A 2G99A 3I2NA 3AL9A 3EI3A 4N14A 4ZOYA 2B5NA 1U4CA 3IUMA 3ORVD 2P9IC 2P9KC 1VE7A 3DSMA 4QAMA 4J78A 4BP9A 2VDRA 2YNPA 3UVLA 3EI2B 4JHNA 4AMYA 5FKSA 2AGXA 4X63B 3SMRA 1YR2A 3JROA 4ZN4A 3EQ8A 4G1MA 5CXCA 3SXTD 2HESX 2VDLA 2WQ8A 5M5VA 3JAMg 1H2ZA 5EM2B 1VZ3A 4GM3A 3UVOA 2GC4A 3I8EA 5FQDA 3T3PA 3SCYA 2EIEA 2PM6B 4PNKB 4NAAA 3I89A 4AN0A 1FWXA 5HE1B 2J55H 3MUNA 2QZPA 4GM9A 1N6EA 1UOQA 4XYIA 4L3HD 5IJ7E 1PEVA 2GC7A 2Q7QA 4LG8A 1A0RB 4GQ2P 3SBRA 1JTDB 1C9IA 3I7OA 4D0KA 4O3UB 4AX4A 3EI1B 3PVUB 4O02A 3IJEA 4GGDA 3NVXA 3ZDZA 1UOPA 4IRZA 3SLED 5FLXg 3DXKC 1H2XA 3IJ1A 4J79A 5CYKA 3BG1A 1BPOA 2UZXB 5HYNB 4K3ID 2CO0A 4CI2A 3MZKA 1UTCA 3SN6B 1C9LA 3DXMC 4EWRA 2Z2NA 3IUQA 3NIDA 3V5WB 1SQJA 3SVWD 2OK6A 3RN0D 5K1CC 5HE0B 5FA5B 4A0AA 2H68A 2I3SA 2OK4A 3P4FA 3SBQA 2MTAH 2OIZA 3KCIA 5E6SA 4CI8A 3MVDK 1PI6A 2GNQA 3B7FA 5TEEA 5I5MA 3K71A 4H5JA 2I3TA 4L1QD 2QR5A 3O4JA 3V9FA 3FCUA 5FKTA 2AGLA 2AGWA 2P9LC 1E5TA 3BWSA 3IUNA 2H9MA 3JB9L 1PBYB 1GOHA 3JRPA 1GP2B 3K6SA 2EIBA 4J82A 2I0TA 2AH0A 4O2WA 3K27A 4CY5A 3IULA 4DNUA 2BKLA 3FM0A 5TF2A 1U8CA 4J8GA 3ODTA 2G9AA 1A12A 2I0SA 4A2LA 5FKRA 3PSCB 5TDHB 3O4HA 4J0XA 4AEZA 4BCCA 3C99A 3UKUC 4BP8A 3NIFA 4WK0A 2XL2A 4A11B 4Z7QA 3U4YA 1H2YA 2OVQB 4Y7RA 4Y5RD 4ERQA 3HFQA 3IURA 3ZE0A 3N0EA 3T3MA 2VDOA 3ZDYA 3EI1A 3FGBA 4FAVD 4A09A 4Z8LA 4FA4D 2PBIB 3EI4A 4A0BA 3EG6A 1VYHC 2H13A 4J86A 1JMXB 3J81g 3C9CA 2HKRA 1GOTB 2XYIA 4GQ1A 4L3GD 1TYEA 4WK2A 5M5UA 3AH8B 4LG9A 2AGYA 5AJAA 3PXSD 3FCSA 2EICA 3FRXA 2XZGA 3OF7A 4QL1A 3L4OD 2IURA 1PGUA 5M61A 1OMWB 5HQGA 5AFU3 4NSXA 1NEXB 3L4MD 4I79A 5M5TA 2YMUA 2XDWA 2AGZA 4QQEA 1SQ9A 2HU7A 4PC0A 5KDOB 3ZE1A 3DM0A 3OL2A 3NVQA 3PXWD 4IMMA 2H6KA 3IKOA 4RE5A 1O6GA 3ZE2A 3IUJA 1ERJA 3ZWLB 4FA5D 3AFCA 4GQBB 5IC7A 5B4WA 4DNWA 4JSNC 4DNVA 4NBMA 3RN1D 5GXIA 3EU7A 3NIGA 3W15A 1XKSA 3MMYA 4E54B 3K72A 4L1MA 3I7KA 4ZOZA 4A7JA 5IT9g 2IWKA 2Z2PA 4GGAA 3F3FA 4J84A 4WJKA 3ULEC 2B5MA 5EAPA 3GD1I 5EMKB 4QT8A 1GG2B 1UOOA 1B9YA 4CI3A 4FWWA 3UR4A 2P9PC 4A08B 3KRXB 5I5JA 5EALA 2YNOA 2CE9A 3GC3B 3QHYB 2VZ1A 2VDPA 3JZNA 3PXTD 3CFVA 5GSAA 4A11A 4GGCA 5IGQA 3JZGA 1R5MA 4BCBA 3KRWB 1QFMA 3MXXA 2HJBA 5CXBA 1SHYB 2VDMA 3JPXA 3E0CA 4R7AB 4BH6A 3SJLD 4J77A 5IGOA 1L0QA 4J73A 4JT6C 2HU8A 1XHMA 2B4EA 3I7PA 2J56H 4X3EA 2OJYA 2QC5A 4UI9R 5H1MA 1RI6A 5C9ZB 2H3XA 5I5IA 2AQ5A 5EMLB 4D9SA 1MDAH 5M5RA 3VI3A 3EI2A 2VDNA 3F3GA 4H5IA 5FFOA 3UVNA 1S4UX 4L9OA 4J87A 4E5ZB 3DWLC 5M5SA 3DDUA 3OTTA 1OLZA 1GOFA 5EM2A 4FAND 4J8BA 4U1EI 5EARA 5H14A 3V7DB 4O9DA 1XIPA 1VE6A 2UZYB 2H9LA 2H6NA 5TEFA 2PM7B 3RFHA 2PM9B 4K3JB 3IJCA 4CZXA 1M1XA 3RSEC 4MMXA 3RFGA 1T2XA 4LGNA 5EMJB 2P9SC 4ERYA 4E54A 4NENA 3OKWA 1NR0A 4XEIC 3SFZA 2EBSA 3IVMA 2O9KA 2CN3A 3OKYB 5HE3B 4GM8A 3EWEA 4MMZA 4FB1D 3PE7A 1QNIA 3EMHA 3CFSB 3SBPA 2VDKA 4A08A 4JSPC 1JMZB 3PSLA 4J81A 2IUQA 1K32A 4OZUA 3RLMD 4FA9D 5IJ8E 3QI0A 2P9NC 1N6DA 5K19A 3A0FA 2HXCA 5EMMB 2XE4A 4G55A 4HDJA 2HKMA 3UVKA 5C2WB 1U2VC 5GXHA 1QFSA 4RE6A 4XYHA 4KFMB 4MK0B 4JHPC 1MG2A 2IAAA 4CI1A 1JJUB 1MG3A 2CN2A 4PBZA 4CZVA 4FHLA 4YVDA 2H6QA 4UM9A 5JWZA 3VH0A 3C5MA 4JT5C 2IWFA 1I2MB 2P9UC 2J57G 5C2VB 2OVRB 1L5GA 2Z2OA 4ZOXA 4J0WA 4OWRA 2IUVA 2H9PA 3SWSD 4E5ZA 5FFGA 1JOFA 3GREA 2B5LA 3IIWA 3K26A 2HYEA 3MUOA 3ZDXA 3I7LA 4NC4A 1K8KC 4JD2C 4ERZA 2H9NA 2PM9A 3I7HA 2AH1A 4G56B 2QXVA 4GZ8A 2W18A 2XU7A 4X61B 2IUPA 3CIKB 4IA9A 1Q47A 4MMYA 3OW8A 2YNNA 3AL8B 4AN1A 2XL3A 4CZYA 4PSXB 4AMZA 4A09B 2OVPB 2VDQA 3SHFA 3UVMA 4D6VA 3EI4B 2HU5A 3OKYA 3O4GA 2H47A 5E6UA 3EI3B 2YBAA 4A0BB 2I0RA 3O4IA 2VZ3A 5GMKn 3IIYA 1YFQA 5E6RA 2TRCB 3JZHA 5H17A 2H14A 4CC9A 3EQ7A 5FXYA 4JXMA 4Z7NA 1K3IA 1E8MA 4CY1A 5C92A 5CXCB 3BG0A 4Z7OA 3IJ0A 1GXRA 3F3PA 4G1EA 4ZOVA 5HDBA 2JKXA 3J80g 5HE2B 3V4PA 5EAMA 2VC2A 3OL2B 4AOWA 3PVWB 4U7AA 1JV2A 1GOGA 4O45A 4X60B 3VI4A 4O1QD 3RMZD
chains in the Genus database with same CATH topology
4PSWB 3MZLA 5A2Qg 3VGZA 3RRMC 3MKSB 4GMBA 3I8CA 4ESGA 4FA1D 4JSXC 1P22A 4BUJC 4O3TB 2CNXA 1B9XA 4PXWA 1TBGA 3UKRC 2YB8B 2CO0C 4PBYA 4CY3A 4A2MA 3MKQA 3NVNA 2BCJB 5THAA 2HJ4A 4JSVC 2CE8A 5CYKB 5SXMA 4QRJA 3N0DA 4ES0A 5AMSA 3OKTA 5FKQA 5CXBB 1N6FA 4TZ4A 4BL0A 3I7NA 3C75H 3VA6A 3AL8A 1TYQC 4A0AB 2BBKH 3GFCA 4CY2A 2G99A 3I2NA 3AL9A 3EI3A 4N14A 4ZOYA 2B5NA 1U4CA 3ORVD 2P9IC 2P9KC 3DSMA 4J78A 2YNPA 3UVLA 3EI2B 5FKSA 2AGXA 4X63B 3SMRA 3JROA 4ZN4A 5CXCA 3SXTD 2HESX 3JAMg 5EM2B 4GM3A 3UVOA 2GC4A 3I8EA 5FQDA 3SCYA 2PM6B 4PNKB 3I89A 1FWXA 5HE1B 2J55H 4GM9A 1N6EA 4XYIA 4L3HD 5IJ7E 1PEVA 2GC7A 2Q7QA 4LG8A 1A0RB 4GQ2P 3SBRA 3I7OA 4D0KA 4O3UB 3EI1B 3PVUB 4GGDA 3NVXA 3SLED 5FLXg 3DXKC 3IJ1A 4J79A 5CYKA 3BG1A 2UZXB 5HYNB 4K3ID 2CO0A 4CI2A 3MZKA 3SN6B 3DXMC 4EWRA 2Z2NA 3V5WB 1SQJA 3SVWD 2OK6A 3RN0D 5K1CC 5HE0B 5FA5B 4A0AA 2H68A 2I3SA 2OK4A 3P4FA 3SBQA 2MTAH 2OIZA 4CI8A 1PI6A 2GNQA 3B7FA 5TEEA 5I5MA 4H5JA 2I3TA 4L1QD 3V9FA 5FKTA 2AGLA 2AGWA 2P9LC 3BWSA 2H9MA 3JB9L 1PBYB 3JRPA 1GP2B 4J82A 2I0TA 2AH0A 3K27A 4CY5A 5TF2A 3FM0A 4J8GA 3ODTA 2G9AA 2I0SA 4A2LA 5FKRA 3PSCB 5TDHB 4J0XA 4AEZA 3C99A 3UKUC 2XL2A 4A11B 3U4YA 2OVQB 4Y7RA 4Y5RD 4ERQA 3HFQA 3N0EA 3EI1A 3FGBA 4FAVD 4A09A 4Z8LA 4FA4D 2PBIB 3EI4A 4A0BA 3EG6A 1VYHC 2H13A 4J86A 1JMXB 3J81g 3C9CA 2HKRA 1GOTB 2XYIA 4GQ1A 4L3GD 3AH8B 4LG9A 2AGYA 5AJAA 3PXSD 3FRXA 4QL1A 3L4OD 2IURA 1PGUA 1OMWB 5HQGA 5AFU3 4NSXA 1NEXB 3L4MD 4I79A 2YMUA 2AGZA 4QQEA 1SQ9A 5KDOB 4PC0A 3DM0A 3OL2A 3NVQA 3PXWD 4IMMA 2H6KA 3IKOA 1ERJA 3ZWLB 4FA5D 3AFCA 4GQBB 5IC7A 5B4WA 4JSNC 3RN1D 5GXIA 3EU7A 3W15A 1XKSA 3MMYA 4E54B 3I7KA 4ZOZA 4A7JA 5IT9g 2IWKA 2Z2PA 4GGAA 3F3FA 4J84A 3ULEC 2B5MA 5EAPA 5EMKB 4QT8A 1GG2B 1B9YA 4CI3A 4FWWA 3UR4A 2P9PC 4A08B 3KRXB 5I5JA 5EALA 2YNOA 2CE9A 3JZNA 3PXTD 3CFVA 5GSAA 4A11A 4GGCA 5IGQA 3JZGA 1R5MA 3KRWB 3MXXA 5CXBA 2HJBA 1SHYB 3JPXA 3E0CA 4R7AB 4BH6A 3SJLD 4J77A 5IGOA 1L0QA 4J73A 4JT6C 1XHMA 2B4EA 3I7PA 2J56H 4X3EA 2OJYA 2QC5A 4UI9R 5H1MA 1RI6A 5C9ZB 2H3XA 5I5IA 2AQ5A 5EMLB 1MDAH 3EI2A 3F3GA 4H5IA 3UVNA 1S4UX 4L9OA 4J87A 4E5ZB 3DWLC 3OTTA 1OLZA 5EM2A 4FAND 4J8BA 4U1EI 5EARA 5H14A 3V7DB 4O9DA 1XIPA 2UZYB 2H9LA 2H6NA 5TEFA 2PM7B 3RFHA 2PM9B 4K3JB 3IJCA 4CZXA 3RSEC 3RFGA 4LGNA 5EMJB 2P9SC 4ERYA 4E54A 3OKWA 1NR0A 4XEIC 3SFZA 2EBSA 2O9KA 2CN3A 3OKYB 5HE3B 4GM8A 3EWEA 4FB1D 3PE7A 1QNIA 3EMHA 3CFSB 3SBPA 4A08A 4JSPC 1JMZB 3PSLA 4J81A 2IUQA 1K32A 4OZUA 3RLMD 4FA9D 5IJ8E 2P9NC 1N6DA 5K19A 3A0FA 2HXCA 5EMMB 4HDJA 2HKMA 3UVKA 5C2WB 1U2VC 5GXHA 4XYHA 4KFMB 4MK0B 1MG2A 2IAAA 4CI1A 1JJUB 1MG3A 2CN2A 4PBZA 4CZVA 4FHLA 4YVDA 2H6QA 5JWZA 3VH0A 3C5MA 4JT5C 2IWFA 2P9UC 2J57G 5C2VB 2OVRB 2Z2OA 4ZOXA 4J0WA 4OWRA 2IUVA 2H9PA 3SWSD 4E5ZA 1JOFA 3GREA 2B5LA 3IIWA 3K26A 2HYEA 3I7LA 1K8KC 4JD2C 4ERZA 2H9NA 2PM9A 3I7HA 2AH1A 4G56B 2QXVA 4GZ8A 2W18A 2XU7A 4X61B 2IUPA 3CIKB 4IA9A 1Q47A 3OW8A 2YNNA 3AL8B 2XL3A 4CZYA 4PSXB 4A09B 2OVPB 3UVMA 3SHFA 4D6VA 3EI4B 3OKYA 2H47A 3EI3B 2YBAA 4A0BB 2I0RA 5GMKn 3IIYA 1YFQA 5H17A 2TRCB 3JZHA 4CC9A 2H14A 5FXYA 4JXMA 4CY1A 5CXCB 3BG0A 3IJ0A 1GXRA 3F3PA 4ZOVA 3J80g 5HE2B 5EAMA 3OL2B 4AOWA 3PVWB 4U7AA 4O45A 4X60B 4O1QD 3RMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PSW B;  3MZL A;  5A2Q g;  3VGZ A;  3RRM C;  3MKS B;  4GMB A;  3I8C A;  4ESG A;  4FA1 D;  4JSX C;  1P22 A;  4BUJ C;  4O3T B;  2CNX A;  1B9X A;  4PXW A;  1TBG A;  3UKR C;  2YB8 B;  2CO0 C;  4PBY A;  4CY3 A;  4A2M A;  3MKQ A;  3NVN A;  2BCJ B;  5THA A;  2HJ4 A;  4JSV C;  2CE8 A;  5CYK B;  5SXM A;  4QRJ A;  3N0D A;  4ES0 A;  5AMS A;  3OKT A;  5FKQ A;  5CXB B;  1N6F A;  4TZ4 A;  4BL0 A;  3I7N A;  3C75 H;  3VA6 A;  3AL8 A;  1TYQ C;  4A0A B;  2BBK H;  3GFC A;  4CY2 A;  2G99 A;  3I2N A;  3AL9 A;  3EI3 A;  4N14 A;  4ZOY A;  2B5N A;  1U4C A;  3ORV D;  2P9I C;  2P9K C;  3DSM A;  4J78 A;  2YNP A;  3UVL A;  3EI2 B;  5FKS A;  2AGX A;  4X63 B;  3SMR A;  3JRO A;  4ZN4 A;  5CXC A;  3SXT D;  2HES X;  3JAM g;  5EM2 B;  4GM3 A;  3UVO A;  2GC4 A;  3I8E A;  5FQD A;  3SCY A;  2PM6 B;  4PNK B;  3I89 A;  1FWX A;  5HE1 B;  2J55 H;  4GM9 A;  1N6E A;  4XYI A;  4L3H D;  5IJ7 E;  1PEV A;  2GC7 A;  2Q7Q A;  4LG8 A;  1A0R B;  4GQ2 P;  3SBR A;  3I7O A;  4D0K A;  4O3U B;  3EI1 B;  3PVU B;  4GGD A;  3NVX A;  3SLE D;  5FLX g;  3DXK C;  3IJ1 A;  4J79 A;  5CYK A;  3BG1 A;  2UZX B;  5HYN B;  4K3I D;  2CO0 A;  4CI2 A;  3MZK A;  3SN6 B;  3DXM C;  4EWR A;  2Z2N A;  3V5W B;  1SQJ A;  3SVW D;  2OK6 A;  3RN0 D;  5K1C C;  5HE0 B;  5FA5 B;  4A0A A;  2H68 A;  2I3S A;  2OK4 A;  3P4F A;  3SBQ A;  2MTA H;  2OIZ A;  4CI8 A;  1PI6 A;  2GNQ A;  3B7F A;  5TEE A;  5I5M A;  4H5J A;  2I3T A;  4L1Q D;  3V9F A;  5FKT A;  2AGL A;  2AGW A;  2P9L C;  3BWS A;  2H9M A;  3JB9 L;  1PBY B;  3JRP A;  1GP2 B;  4J82 A;  2I0T A;  2AH0 A;  3K27 A;  4CY5 A;  5TF2 A;  3FM0 A;  4J8G A;  3ODT A;  2G9A A;  2I0S A;  4A2L A;  5FKR A;  3PSC B;  5TDH B;  4J0X A;  4AEZ A;  3C99 A;  3UKU C;  2XL2 A;  4A11 B;  3U4Y A;  2OVQ B;  4Y7R A;  4Y5R D;  4ERQ A;  3HFQ A;  3N0E A;  3EI1 A;  3FGB A;  4FAV D;  4A09 A;  4Z8L A;  4FA4 D;  2PBI B;  3EI4 A;  4A0B A;  3EG6 A;  1VYH C;  2H13 A;  4J86 A;  1JMX B;  3J81 g;  3C9C A;  2HKR A;  1GOT B;  2XYI A;  4GQ1 A;  4L3G D;  3AH8 B;  4LG9 A;  2AGY A;  5AJA A;  3PXS D;  3FRX A;  4QL1 A;  3L4O D;  2IUR A;  1PGU A;  1OMW B;  5HQG A;  5AFU 3;  4NSX A;  1NEX B;  3L4M D;  4I79 A;  2YMU A;  2AGZ A;  4QQE A;  1SQ9 A;  5KDO B;  4PC0 A;  3DM0 A;  3OL2 A;  3NVQ A;  3PXW D;  4IMM A;  2H6K A;  3IKO A;  1ERJ A;  3ZWL B;  4FA5 D;  3AFC A;  4GQB B;  5IC7 A;  5B4W A;  4JSN C;  3RN1 D;  5GXI A;  3EU7 A;  3W15 A;  1XKS A;  3MMY A;  4E54 B;  3I7K A;  4ZOZ A;  4A7J A;  5IT9 g;  2IWK A;  2Z2P A;  4GGA A;  3F3F A;  4J84 A;  3ULE C;  2B5M A;  5EAP A;  5EMK B;  4QT8 A;  1GG2 B;  1B9Y A;  4CI3 A;  4FWW A;  3UR4 A;  2P9P C;  4A08 B;  3KRX B;  5I5J A;  5EAL A;  2YNO A;  2CE9 A;  3JZN A;  3PXT D;  3CFV A;  5GSA A;  4A11 A;  4GGC A;  5IGQ A;  3JZG A;  1R5M A;  3KRW B;  3MXX A;  5CXB A;  2HJB A;  1SHY B;  3JPX A;  3E0C A;  4R7A B;  4BH6 A;  3SJL D;  4J77 A;  5IGO A;  1L0Q A;  4J73 A;  4JT6 C;  1XHM A;  2B4E A;  3I7P A;  2J56 H;  4X3E A;  2OJY A;  2QC5 A;  4UI9 R;  5H1M A;  1RI6 A;  5C9Z B;  2H3X A;  5I5I A;  2AQ5 A;  5EML B;  1MDA H;  3EI2 A;  3F3G A;  4H5I A;  3UVN A;  1S4U X;  4L9O A;  4J87 A;  4E5Z B;  3DWL C;  3OTT A;  1OLZ A;  5EM2 A;  4FAN D;  4J8B A;  4U1E I;  5EAR A;  5H14 A;  3V7D B;  4O9D A;  1XIP A;  2UZY B;  2H9L A;  2H6N A;  5TEF A;  2PM7 B;  3RFH A;  2PM9 B;  4K3J B;  3IJC A;  4CZX A;  3RSE C;  3RFG A;  4LGN A;  5EMJ B;  2P9S C;  4ERY A;  4E54 A;  3OKW A;  1NR0 A;  4XEI C;  3SFZ A;  2EBS A;  2O9K A;  2CN3 A;  3OKY B;  5HE3 B;  4GM8 A;  3EWE A;  4FB1 D;  3PE7 A;  1QNI A;  3EMH A;  3CFS B;  3SBP A;  4A08 A;  4JSP C;  1JMZ B;  3PSL A;  4J81 A;  2IUQ A;  1K32 A;  4OZU A;  3RLM D;  4FA9 D;  5IJ8 E;  2P9N C;  1N6D A;  5K19 A;  3A0F A;  2HXC A;  5EMM B;  4HDJ A;  2HKM A;  3UVK A;  5C2W B;  1U2V C;  5GXH A;  4XYH A;  4KFM B;  4MK0 B;  1MG2 A;  2IAA A;  4CI1 A;  1JJU B;  1MG3 A;  2CN2 A;  4PBZ A;  4CZV A;  4FHL A;  4YVD A;  2H6Q A;  5JWZ A;  3VH0 A;  3C5M A;  4JT5 C;  2IWF A;  2P9U C;  2J57 G;  5C2V B;  2OVR B;  2Z2O A;  4ZOX A;  4J0W A;  4OWR A;  2IUV A;  2H9P A;  3SWS D;  4E5Z A;  1JOF A;  3GRE A;  2B5L A;  3IIW A;  3K26 A;  2HYE A;  3I7L A;  1K8K C;  4JD2 C;  4ERZ A;  2H9N A;  2PM9 A;  3I7H A;  2AH1 A;  4G56 B;  2QXV A;  4GZ8 A;  2W18 A;  2XU7 A;  4X61 B;  2IUP A;  3CIK B;  4IA9 A;  1Q47 A;  3OW8 A;  2YNN A;  3AL8 B;  2XL3 A;  4CZY A;  4PSX B;  4A09 B;  2OVP B;  3UVM A;  3SHF A;  4D6V A;  3EI4 B;  3OKY A;  2H47 A;  3EI3 B;  2YBA A;  4A0B B;  2I0R A;  5GMK n;  3IIY A;  1YFQ A;  5H17 A;  2TRC B;  3JZH A;  4CC9 A;  2H14 A;  5FXY A;  4JXM A;  4CY1 A;  5CXC B;  3BG0 A;  3IJ0 A;  1GXR A;  3F3P A;  4ZOV A;  3J80 g;  5HE2 B;  5EAM A;  3OL2 B;  4AOW A;  3PVW B;  4U7A A;  4O45 A;  4X60 B;  4O1Q D;  3RMZ D; 
#chains in the Genus database with same CATH topology
 4PSW B;  3EQ9 A;  3MZL A;  1E8N A;  5A2Q g;  1VZ2 A;  3VGZ A;  3RRM C;  3MKS B;  4GMB A;  4BCD A;  3I8C A;  4ESG A;  4FA1 D;  4JSX C;  1H2W A;  1P22 A;  4BUJ C;  4O3T B;  2CNX A;  5C86 A;  1B9X A;  4PXW A;  1TBG A;  3UKR C;  2YB8 B;  2CO0 C;  4PBY A;  4CY3 A;  4A2M A;  4WK4 A;  4UM8 A;  3MKQ A;  3NVN A;  2BCJ B;  5THA A;  2HJ4 A;  4JSV C;  2CE8 A;  5CYK B;  5SXM A;  4QRJ A;  3N0D A;  4ES0 A;  5AMS A;  3OKT A;  5FKQ A;  5CXB B;  2EID A;  1N6F A;  4TZ4 A;  4BL0 A;  1O6F A;  3I7N A;  3C75 H;  3V4V A;  3VA6 A;  3AL8 A;  1TYQ C;  4A0A B;  2BBK H;  3GFC A;  4CY2 A;  2G99 A;  3I2N A;  3AL9 A;  3EI3 A;  4N14 A;  4ZOY A;  2B5N A;  1U4C A;  3IUM A;  3ORV D;  2P9I C;  2P9K C;  1VE7 A;  3DSM A;  4QAM A;  4J78 A;  4BP9 A;  2VDR A;  2YNP A;  3UVL A;  3EI2 B;  4JHN A;  4AMY A;  5FKS A;  2AGX A;  4X63 B;  3SMR A;  1YR2 A;  3JRO A;  4ZN4 A;  3EQ8 A;  4G1M A;  5CXC A;  3SXT D;  2HES X;  2VDL A;  2WQ8 A;  5M5V A;  3JAM g;  1H2Z A;  5EM2 B;  1VZ3 A;  4GM3 A;  3UVO A;  2GC4 A;  3I8E A;  5FQD A;  3T3P A;  3SCY A;  2EIE A;  2PM6 B;  4PNK B;  4NAA A;  3I89 A;  4AN0 A;  1FWX A;  5HE1 B;  2J55 H;  3MUN A;  2QZP A;  4GM9 A;  1N6E A;  1UOQ A;  4XYI A;  4L3H D;  5IJ7 E;  1PEV A;  2GC7 A;  2Q7Q A;  4LG8 A;  1A0R B;  4GQ2 P;  3SBR A;  1JTD B;  1C9I A;  3I7O A;  4D0K A;  4O3U B;  4AX4 A;  3EI1 B;  3PVU B;  4O02 A;  3IJE A;  4GGD A;  3NVX A;  3ZDZ A;  1UOP A;  4IRZ A;  3SLE D;  5FLX g;  3DXK C;  1H2X A;  3IJ1 A;  4J79 A;  5CYK A;  3BG1 A;  1BPO A;  2UZX B;  5HYN B;  4K3I D;  2CO0 A;  4CI2 A;  3MZK A;  1UTC A;  3SN6 B;  1C9L A;  3DXM C;  4EWR A;  2Z2N A;  3IUQ A;  3NID A;  3V5W B;  1SQJ A;  3SVW D;  2OK6 A;  3RN0 D;  5K1C C;  5HE0 B;  5FA5 B;  4A0A A;  2H68 A;  2I3S A;  2OK4 A;  3P4F A;  3SBQ A;  2MTA H;  2OIZ A;  3KCI A;  5E6S A;  4CI8 A;  3MVD K;  1PI6 A;  2GNQ A;  3B7F A;  5TEE A;  5I5M A;  3K71 A;  4H5J A;  2I3T A;  4L1Q D;  2QR5 A;  3O4J A;  3V9F A;  3FCU A;  5FKT A;  2AGL A;  2AGW A;  2P9L C;  1E5T A;  3BWS A;  3IUN A;  2H9M A;  3JB9 L;  1PBY B;  1GOH A;  3JRP A;  1GP2 B;  3K6S A;  2EIB A;  4J82 A;  2I0T A;  2AH0 A;  4O2W A;  3K27 A;  4CY5 A;  3IUL A;  4DNU A;  2BKL A;  3FM0 A;  5TF2 A;  1U8C A;  4J8G A;  3ODT A;  2G9A A;  1A12 A;  2I0S A;  4A2L A;  5FKR A;  3PSC B;  5TDH B;  3O4H A;  4J0X A;  4AEZ A;  4BCC A;  3C99 A;  3UKU C;  4BP8 A;  3NIF A;  4WK0 A;  2XL2 A;  4A11 B;  4Z7Q A;  3U4Y A;  1H2Y A;  2OVQ B;  4Y7R A;  4Y5R D;  4ERQ A;  3HFQ A;  3IUR A;  3ZE0 A;  3N0E A;  3T3M A;  2VDO A;  3ZDY A;  3EI1 A;  3FGB A;  4FAV D;  4A09 A;  4Z8L A;  4FA4 D;  2PBI B;  3EI4 A;  4A0B A;  3EG6 A;  1VYH C;  2H13 A;  4J86 A;  1JMX B;  3J81 g;  3C9C A;  2HKR A;  1GOT B;  2XYI A;  4GQ1 A;  4L3G D;  1TYE A;  4WK2 A;  5M5U A;  3AH8 B;  4LG9 A;  2AGY A;  5AJA A;  3PXS D;  3FCS A;  2EIC A;  3FRX A;  2XZG A;  3OF7 A;  4QL1 A;  3L4O D;  2IUR A;  1PGU A;  5M61 A;  1OMW B;  5HQG A;  5AFU 3;  4NSX A;  1NEX B;  3L4M D;  4I79 A;  5M5T A;  2YMU A;  2XDW A;  2AGZ A;  4QQE A;  1SQ9 A;  2HU7 A;  4PC0 A;  5KDO B;  3ZE1 A;  3DM0 A;  3OL2 A;  3NVQ A;  3PXW D;  4IMM A;  2H6K A;  3IKO A;  4RE5 A;  1O6G A;  3ZE2 A;  3IUJ A;  1ERJ A;  3ZWL B;  4FA5 D;  3AFC A;  4GQB B;  5IC7 A;  5B4W A;  4DNW A;  4JSN C;  4DNV A;  4NBM A;  3RN1 D;  5GXI A;  3EU7 A;  3NIG A;  3W15 A;  1XKS A;  3MMY A;  4E54 B;  3K72 A;  4L1M A;  3I7K A;  4ZOZ A;  4A7J A;  5IT9 g;  2IWK A;  2Z2P A;  4GGA A;  3F3F A;  4J84 A;  4WJK A;  3ULE C;  2B5M A;  5EAP A;  3GD1 I;  5EMK B;  4QT8 A;  1GG2 B;  1UOO A;  1B9Y A;  4CI3 A;  4FWW A;  3UR4 A;  2P9P C;  4A08 B;  3KRX B;  5I5J A;  5EAL A;  2YNO A;  2CE9 A;  3GC3 B;  3QHY B;  2VZ1 A;  2VDP A;  3JZN A;  3PXT D;  3CFV A;  5GSA A;  4A11 A;  4GGC A;  5IGQ A;  3JZG A;  1R5M A;  4BCB A;  3KRW B;  1QFM A;  3MXX A;  2HJB A;  5CXB A;  1SHY B;  2VDM A;  3JPX A;  3E0C A;  4R7A B;  4BH6 A;  3SJL D;  4J77 A;  5IGO A;  1L0Q A;  4J73 A;  4JT6 C;  2HU8 A;  1XHM A;  2B4E A;  3I7P A;  2J56 H;  4X3E A;  2OJY A;  2QC5 A;  4UI9 R;  5H1M A;  1RI6 A;  5C9Z B;  2H3X A;  5I5I A;  2AQ5 A;  5EML B;  4D9S A;  1MDA H;  5M5R A;  3VI3 A;  3EI2 A;  2VDN A;  3F3G A;  4H5I A;  5FFO A;  3UVN A;  1S4U X;  4L9O A;  4J87 A;  4E5Z B;  3DWL C;  5M5S A;  3DDU A;  3OTT A;  1OLZ A;  1GOF A;  5EM2 A;  4FAN D;  4J8B A;  4U1E I;  5EAR A;  5H14 A;  3V7D B;  4O9D A;  1XIP A;  1VE6 A;  2UZY B;  2H9L A;  2H6N A;  5TEF A;  2PM7 B;  3RFH A;  2PM9 B;  4K3J B;  3IJC A;  4CZX A;  1M1X A;  3RSE C;  4MMX A;  3RFG A;  1T2X A;  4LGN A;  5EMJ B;  2P9S C;  4ERY A;  4E54 A;  4NEN A;  3OKW A;  1NR0 A;  4XEI C;  3SFZ A;  2EBS A;  3IVM A;  2O9K A;  2CN3 A;  3OKY B;  5HE3 B;  4GM8 A;  3EWE A;  4MMZ A;  4FB1 D;  3PE7 A;  1QNI A;  3EMH A;  3CFS B;  3SBP A;  2VDK A;  4A08 A;  4JSP C;  1JMZ B;  3PSL A;  4J81 A;  2IUQ A;  1K32 A;  4OZU A;  3RLM D;  4FA9 D;  5IJ8 E;  3QI0 A;  2P9N C;  1N6D A;  5K19 A;  3A0F A;  2HXC A;  5EMM B;  2XE4 A;  4G55 A;  4HDJ A;  2HKM A;  3UVK A;  5C2W B;  1U2V C;  5GXH A;  1QFS A;  4RE6 A;  4XYH A;  4KFM B;  4MK0 B;  4JHP C;  1MG2 A;  2IAA A;  4CI1 A;  1JJU B;  1MG3 A;  2CN2 A;  4PBZ A;  4CZV A;  4FHL A;  4YVD A;  2H6Q A;  4UM9 A;  5JWZ A;  3VH0 A;  3C5M A;  4JT5 C;  2IWF A;  1I2M B;  2P9U C;  2J57 G;  5C2V B;  2OVR B;  1L5G A;  2Z2O A;  4ZOX A;  4J0W A;  4OWR A;  2IUV A;  2H9P A;  3SWS D;  4E5Z A;  5FFG A;  1JOF A;  3GRE A;  2B5L A;  3IIW A;  3K26 A;  2HYE A;  3MUO A;  3ZDX A;  3I7L A;  4NC4 A;  1K8K C;  4JD2 C;  4ERZ A;  2H9N A;  2PM9 A;  3I7H A;  2AH1 A;  4G56 B;  2QXV A;  4GZ8 A;  2W18 A;  2XU7 A;  4X61 B;  2IUP A;  3CIK B;  4IA9 A;  1Q47 A;  4MMY A;  3OW8 A;  2YNN A;  3AL8 B;  4AN1 A;  2XL3 A;  4CZY A;  4PSX B;  4AMZ A;  4A09 B;  2OVP B;  2VDQ A;  3SHF A;  3UVM A;  4D6V A;  3EI4 B;  2HU5 A;  3OKY A;  3O4G A;  2H47 A;  5E6U A;  3EI3 B;  2YBA A;  4A0B B;  2I0R A;  3O4I A;  2VZ3 A;  5GMK n;  3IIY A;  1YFQ A;  5E6R A;  2TRC B;  3JZH A;  5H17 A;  2H14 A;  4CC9 A;  3EQ7 A;  5FXY A;  4JXM A;  4Z7N A;  1K3I A;  1E8M A;  4CY1 A;  5C92 A;  5CXC B;  3BG0 A;  4Z7O A;  3IJ0 A;  1GXR A;  3F3P A;  4G1E A;  4ZOV A;  5HDB A;  2JKX A;  3J80 g;  5HE2 B;  3V4P A;  5EAM A;  2VC2 A;  3OL2 B;  4AOW A;  3PVW B;  4U7A A;  1JV2 A;  1GOG A;  4O45 A;  4X60 B;  3VI4 A;  4O1Q D;  3RMZ D; 
#chains in the Genus database with same CATH homology
 4PSW B;  3MZL A;  5A2Q g;  3VGZ A;  3RRM C;  3MKS B;  4GMB A;  3I8C A;  4ESG A;  4FA1 D;  4JSX C;  1P22 A;  4BUJ C;  4O3T B;  2CNX A;  1B9X A;  4PXW A;  1TBG A;  3UKR C;  2YB8 B;  2CO0 C;  4PBY A;  4CY3 A;  4A2M A;  3MKQ A;  3NVN A;  2BCJ B;  5THA A;  2HJ4 A;  4JSV C;  2CE8 A;  5CYK B;  5SXM A;  4QRJ A;  3N0D A;  4ES0 A;  5AMS A;  3OKT A;  5FKQ A;  5CXB B;  1N6F A;  4TZ4 A;  4BL0 A;  3I7N A;  3C75 H;  3VA6 A;  3AL8 A;  1TYQ C;  4A0A B;  2BBK H;  3GFC A;  4CY2 A;  2G99 A;  3I2N A;  3AL9 A;  3EI3 A;  4N14 A;  4ZOY A;  2B5N A;  1U4C A;  3ORV D;  2P9I C;  2P9K C;  3DSM A;  4J78 A;  2YNP A;  3UVL A;  3EI2 B;  5FKS A;  2AGX A;  4X63 B;  3SMR A;  3JRO A;  4ZN4 A;  5CXC A;  3SXT D;  2HES X;  3JAM g;  5EM2 B;  4GM3 A;  3UVO A;  2GC4 A;  3I8E A;  5FQD A;  3SCY A;  2PM6 B;  4PNK B;  3I89 A;  1FWX A;  5HE1 B;  2J55 H;  4GM9 A;  1N6E A;  4XYI A;  4L3H D;  5IJ7 E;  1PEV A;  2GC7 A;  2Q7Q A;  4LG8 A;  1A0R B;  4GQ2 P;  3SBR A;  3I7O A;  4D0K A;  4O3U B;  3EI1 B;  3PVU B;  4GGD A;  3NVX A;  3SLE D;  5FLX g;  3DXK C;  3IJ1 A;  4J79 A;  5CYK A;  3BG1 A;  2UZX B;  5HYN B;  4K3I D;  2CO0 A;  4CI2 A;  3MZK A;  3SN6 B;  3DXM C;  4EWR A;  2Z2N A;  3V5W B;  1SQJ A;  3SVW D;  2OK6 A;  3RN0 D;  5K1C C;  5HE0 B;  5FA5 B;  4A0A A;  2H68 A;  2I3S A;  2OK4 A;  3P4F A;  3SBQ A;  2MTA H;  2OIZ A;  4CI8 A;  1PI6 A;  2GNQ A;  3B7F A;  5TEE A;  5I5M A;  4H5J A;  2I3T A;  4L1Q D;  3V9F A;  5FKT A;  2AGL A;  2AGW A;  2P9L C;  3BWS A;  2H9M A;  3JB9 L;  1PBY B;  3JRP A;  1GP2 B;  4J82 A;  2I0T A;  2AH0 A;  3K27 A;  4CY5 A;  5TF2 A;  3FM0 A;  4J8G A;  3ODT A;  2G9A A;  2I0S A;  4A2L A;  5FKR A;  3PSC B;  5TDH B;  4J0X A;  4AEZ A;  3C99 A;  3UKU C;  2XL2 A;  4A11 B;  3U4Y A;  2OVQ B;  4Y7R A;  4Y5R D;  4ERQ A;  3HFQ A;  3N0E A;  3EI1 A;  3FGB A;  4FAV D;  4A09 A;  4Z8L A;  4FA4 D;  2PBI B;  3EI4 A;  4A0B A;  3EG6 A;  1VYH C;  2H13 A;  4J86 A;  1JMX B;  3J81 g;  3C9C A;  2HKR A;  1GOT B;  2XYI A;  4GQ1 A;  4L3G D;  3AH8 B;  4LG9 A;  2AGY A;  5AJA A;  3PXS D;  3FRX A;  4QL1 A;  3L4O D;  2IUR A;  1PGU A;  1OMW B;  5HQG A;  5AFU 3;  4NSX A;  1NEX B;  3L4M D;  4I79 A;  2YMU A;  2AGZ A;  4QQE A;  1SQ9 A;  5KDO B;  4PC0 A;  3DM0 A;  3OL2 A;  3NVQ A;  3PXW D;  4IMM A;  2H6K A;  3IKO A;  1ERJ A;  3ZWL B;  4FA5 D;  3AFC A;  4GQB B;  5IC7 A;  5B4W A;  4JSN C;  3RN1 D;  5GXI A;  3EU7 A;  3W15 A;  1XKS A;  3MMY A;  4E54 B;  3I7K A;  4ZOZ A;  4A7J A;  5IT9 g;  2IWK A;  2Z2P A;  4GGA A;  3F3F A;  4J84 A;  3ULE C;  2B5M A;  5EAP A;  5EMK B;  4QT8 A;  1GG2 B;  1B9Y A;  4CI3 A;  4FWW A;  3UR4 A;  2P9P C;  4A08 B;  3KRX B;  5I5J A;  5EAL A;  2YNO A;  2CE9 A;  3JZN A;  3PXT D;  3CFV A;  5GSA A;  4A11 A;  4GGC A;  5IGQ A;  3JZG A;  1R5M A;  3KRW B;  3MXX A;  5CXB A;  2HJB A;  1SHY B;  3JPX A;  3E0C A;  4R7A B;  4BH6 A;  3SJL D;  4J77 A;  5IGO A;  1L0Q A;  4J73 A;  4JT6 C;  1XHM A;  2B4E A;  3I7P A;  2J56 H;  4X3E A;  2OJY A;  2QC5 A;  4UI9 R;  5H1M A;  1RI6 A;  5C9Z B;  2H3X A;  5I5I A;  2AQ5 A;  5EML B;  1MDA H;  3EI2 A;  3F3G A;  4H5I A;  3UVN A;  1S4U X;  4L9O A;  4J87 A;  4E5Z B;  3DWL C;  3OTT A;  1OLZ A;  5EM2 A;  4FAN D;  4J8B A;  4U1E I;  5EAR A;  5H14 A;  3V7D B;  4O9D A;  1XIP A;  2UZY B;  2H9L A;  2H6N A;  5TEF A;  2PM7 B;  3RFH A;  2PM9 B;  4K3J B;  3IJC A;  4CZX A;  3RSE C;  3RFG A;  4LGN A;  5EMJ B;  2P9S C;  4ERY A;  4E54 A;  3OKW A;  1NR0 A;  4XEI C;  3SFZ A;  2EBS A;  2O9K A;  2CN3 A;  3OKY B;  5HE3 B;  4GM8 A;  3EWE A;  4FB1 D;  3PE7 A;  1QNI A;  3EMH A;  3CFS B;  3SBP A;  4A08 A;  4JSP C;  1JMZ B;  3PSL A;  4J81 A;  2IUQ A;  1K32 A;  4OZU A;  3RLM D;  4FA9 D;  5IJ8 E;  2P9N C;  1N6D A;  5K19 A;  3A0F A;  2HXC A;  5EMM B;  4HDJ A;  2HKM A;  3UVK A;  5C2W B;  1U2V C;  5GXH A;  4XYH A;  4KFM B;  4MK0 B;  1MG2 A;  2IAA A;  4CI1 A;  1JJU B;  1MG3 A;  2CN2 A;  4PBZ A;  4CZV A;  4FHL A;  4YVD A;  2H6Q A;  5JWZ A;  3VH0 A;  3C5M A;  4JT5 C;  2IWF A;  2P9U C;  2J57 G;  5C2V B;  2OVR B;  2Z2O A;  4ZOX A;  4J0W A;  4OWR A;  2IUV A;  2H9P A;  3SWS D;  4E5Z A;  1JOF A;  3GRE A;  2B5L A;  3IIW A;  3K26 A;  2HYE A;  3I7L A;  1K8K C;  4JD2 C;  4ERZ A;  2H9N A;  2PM9 A;  3I7H A;  2AH1 A;  4G56 B;  2QXV A;  4GZ8 A;  2W18 A;  2XU7 A;  4X61 B;  2IUP A;  3CIK B;  4IA9 A;  1Q47 A;  3OW8 A;  2YNN A;  3AL8 B;  2XL3 A;  4CZY A;  4PSX B;  4A09 B;  2OVP B;  3UVM A;  3SHF A;  4D6V A;  3EI4 B;  3OKY A;  2H47 A;  3EI3 B;  2YBA A;  4A0B B;  2I0R A;  5GMK n;  3IIY A;  1YFQ A;  5H17 A;  2TRC B;  3JZH A;  4CC9 A;  2H14 A;  5FXY A;  4JXM A;  4CY1 A;  5CXC B;  3BG0 A;  3IJ0 A;  1GXR A;  3F3P A;  4ZOV A;  3J80 g;  5HE2 B;  5EAM A;  3OL2 B;  4AOW A;  3PVW B;  4U7A A;  4O45 A;  4X60 B;  4O1Q D;  3RMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...