3UVOA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of set1b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
300
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 99
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvoA00
2B4EA 2CN3A 5KDOB 4QT8A 1XKSA 3PVUB 4A11A 3CIKB 4U7AA 4PBZA 2UZYB 4L3GD 4A0BB 3RN1D 5TDHB 5FKTA 1QNIA 2HESX 3B7FA 4J0WA 4PXWA 3UR4A 4ZOVA 3JRPA 2OIZA 2G99A 4IMMA 4A11B 4A2LA 2J57G 3DM0A 2AQ5A 5C2WB 4GM3A 3SFZA 3U4YA 3BG1A 5JWZA 3JB9L 4D0KA 4JSVC 4PBYA 5EAPA 1N6EA 4J81A 5C2VB 2TRCB 4PC0A 4BUJC 4BH6A 4U1EI 2J56H 1PEVA 3K27A 4OWRA 1OLZA 4J87A 3V5WB 2OK4A 4H5JA 4AOWA 3JROA 3MZKA 3KRXB 4J82A 1U4CA 4Z8LA 3L4OD 5IGOA 1GXRA 4CY1A 3J81g 2I0SA 3OKTA 5K19A 3AL8A 3V9FA 4FA9D 2GC4A 4J78A 3W15A 4ERZA 5HE2B 4J8GA 2J55H 5GXIA 3C9CA 3KRWB 3RRMC 4G56B 3AH8B 5K1CC 4J73A 3SWSD 3EI2B 3I7LA 3EMHA 2PM9A 2I3SA 2CO0C 4GQ1A 2B5LA 4O45A 3GREA 3EG6A 4O3TB 2QXVA 2H13A 3OW8A 5H17A 3RFHA 3JZHA 4CZXA 4JD2C 4L1QD 3NVQA 2H3XA 3EWEA 4PSXB 2YNNA 5AJAA 4FHLA 3BG0A 1MG3A 4ZOYA 1SHYB 3K26A 3RLMD 3EI4B 4ZOZA 5HYNB 1NR0A 4XEIC 4A0AA 4K3ID 3AL9A 1N6FA 4FA4D 3MXXA 3RMZD 3UVLA 1GOTB 4CC9A 2H68A 4L9OA 4H5IA 2XL2A 2Z2OA 4J79A 1B9YA 2B5MA 3ORVD 5IT9g 3N0DA 3PXSD 4ESGA 3SCYA 2H9MA 3JPXA 4CZYA 1S4UX 4PSWB 3SJLD 3AFCA 2IWKA 1TYQC 2AH1A 3MMYA 2GNQA 2CO0A 3SBRA 3BWSA 1MDAH 4J84A 2HJ4A 2HKMA 3SMRA 4UI9R 3I7HA 5EAMA 5IJ8E 3RN0D 2OK6A 3OL2A 5EMLB 3SBQA 4FAND 2P9UC 1JOFA 3SXTD 2H9PA 2P9LC 4E5ZA 4CY2A 2UZXB 5EARA 3I7NA 4A09A 2IUPA 4FA1D 4Y7RA 1GG2B 2H6QA 3V7DB 5H14A 3I8CA 1PBYB 4FB1D 2AH0A 4JSPC 1JMXB 4CY3A 3NVXA 3C75H 3PVWB 2W18A 4ERYA 4E5ZB 5AFU3 5HE0B 4A2MA 5CYKA 5I5JA 4A09B 2MTAH 4E54A 4ES0A 5TEEA 5GMKn 3F3PA 4X63B 3IJ0A 2YB8B 1P22A 3A0FA 1JJUB 2HYEA 3MKSB 2PM6B 2Z2NA 5B4WA 3VA6A 5CXBA 5FKQA 1XIPA 5CYKB 3NVNA 4HDJA 2I0RA 4E54B 3AL8B 4GGCA 3SBPA 4O1QD 2CN2A 5SXMA 2AGYA 3FM0A 5IC7A 2IAAA 4KFMB 2QC5A 1ERJA 5CXBB 3JAMg 3MZLA 4CI2A 5A2Qg 3FGBA 3PE7A 1YFQA 1NEXB 4GGAA 3RSEC 5IJ7E 4JT5C 4IA9A 2PM9B 3EI3A 2O9KA 5FQDA 1GP2B 4X3EA 2GC7A 3UVKA 4AEZA 4Y5RD 4OZUA 1U2VC 3IJCA 3PSCB 3DWLC 2BBKH 2IURA 3C99A 3VGZA 2Z2PA 3EI3B 3EI1A 3DXMC 4EWRA 3CFSB 3I89A 4NSXA 3PSLA 2OVQB 3UVNA 5TEFA 4A0AB 2B5NA 4N14A 4J0XA 2YMUA 2PM7B 3EI1B 2P9NC 4J77A 2IUVA 3I2NA 4GZ8A 4FAVD 3JZNA 4A0BA 3F3GA 1A0RB 3SLED 4GM9A 2P9KC 5CXCA 3DXKC 5FKSA 3PXTD 3J80g 1OMWB 2P9SC 3IIWA 2XYIA 2OJYA 2H14A 3C5MA 1R5MA 3ZWLB 5EM2A 2OVRB 4A7JA 2BCJB 3F3FA 4GM8A 2AGLA 3VH0A 5CXCB 1XHMA 1TBGA 2H6NA 3SVWD 4CY5A 1SQ9A 4J86A 4YVDA 1B9XA 3OKYA 4PNKB 4LGNA 4L3HD 5HQGA 1PI6A 4TZ4A 3OL2B 4JT6C 2IWFA 2H6KA 5GXHA 4QRJA 4R7AB 3FRXA 4BL0A 5EM2B 3I7KA 2AGZA 2AGXA 4JXMA 3IIYA 2H47A 2CE9A 2I0TA 2PBIB 4J8BA 1Q47A 3OKYB 1JMZB 1K8KC 3ULEC 2YNOA 4FWWA 3SHFA 3SN6B 3RFGA 1K32A 4ZN4A 2P9PC 5I5MA 2HXCA 2EBSA 2OVPB 3PXWD 2HKRA 1N6DA 4CI3A 4A08A 5GSAA 3JZGA 5FLXg 5HE3B 3CFVA 4QQEA 3EI2A 5C9ZB 3E0CA 4X61B 3I8EA 3I7PA 5EMKB 2H9NA 4A08B 3UVOA 2AGWA 2CNXA 5EMJB 5AMSA 2H9LA 3DSMA 4GQ2P 3P4FA 5TF2A 2I3TA 5THAA 2Q7QA 4XYHA 4QL1A 3EU7A 5EALA 1SQJA 4O9DA 1L0QA 3HFQA 2YNPA 3EI4A 3OKWA 4GMBA 4ZOXA 4CZVA 3L4MD 4I79A 5EMMB 3IKOA 4LG9A 2CE8A 4LG8A 4O3UB 1VYHC 4FA5D 3OTTA 2IUQA 2YBAA 1PGUA 2HJBA 4CI8A 3GFCA 5FKRA 4GQBB 3UKUC 2G9AA 4JSXC 4ERQA 3N0EA 2XL3A 3IJ1A 5IGQA 2P9IC 5I5IA 4X60B 4MK0B 3UKRC 4JSNC 5FXYA 3UVMA 5HE1B 5FA5B 3I7OA 1RI6A 5H1MA 2XU7A 3ODTA 4CI1A 1FWXA 4XYIA 3MKQA 4GGDA 1MG2A 4K3JB 4D6VA
chains in the Genus database with same CATH superfamily
2B4EA 2CN3A 5KDOB 4QT8A 1XKSA 3PVUB 4A11A 3CIKB 1GOFA 4U7AA 4PBZA 4UM8A 2UZYB 4L3GD 4A0BB 3RN1D 5TDHB 5FKTA 1QNIA 4WK0A 1C9LA 4O2WA 2HESX 3B7FA 4J0WA 4PXWA 3UR4A 4AX4A 3IVMA 4ZOVA 3JRPA 3ZE0A 2OIZA 2G99A 4IMMA 4A11B 4A2LA 2J57G 3DM0A 2AQ5A 1UTCA 5C2WB 4GM3A 3SFZA 3U4YA 1YR2A 3BG1A 5JWZA 3JB9L 4D0KA 4JSVC 4WJKA 4PBYA 5EAPA 1N6EA 4J81A 5C2VB 2TRCB 4PC0A 4BUJC 4BH6A 3MVDK 2VDQA 4U1EI 2J56H 1PEVA 3K27A 4OWRA 1OLZA 4J87A 3V5WB 5E6RA 2OK4A 3NIGA 4H5JA 2HU8A 4AOWA 3JROA 4UM9A 3MZKA 3KRXB 4J82A 1GOHA 1U4CA 4Z8LA 3L4OD 5IGOA 1JTDB 1GXRA 4CY1A 3MUNA 3J81g 2I0SA 3OKTA 3T3MA 5K19A 1QFMA 3AL8A 3V9FA 4Z7NA 4DNWA 4JHPC 4FA9D 2GC4A 4J78A 3W15A 4ERZA 5HE2B 4J8GA 2J55H 5GXIA 3C9CA 3KRWB 3RRMC 4G56B 3AH8B 1H2YA 5K1CC 4J73A 3SWSD 3EI2B 3I7LA 1VZ3A 3IUMA 1GOGA 3EMHA 2EICA 2PM9A 2I3SA 2CO0C 4GQ1A 2B5LA 4O45A 1JV2A 3GREA 3EG6A 3K71A 4O3TB 2QXVA 3ZDZA 2H13A 3T3PA 3EQ9A 3OW8A 5H17A 3GC3B 3RFHA 3JZHA 4CZXA 4JD2C 4L1QD 3EQ7A 3NVQA 3V4VA 3ZE1A 2H3XA 3EWEA 2VDPA 4PSXB 2YNNA 5AJAA 4FHLA 3BG0A 5M5RA 1MG3A 4ZOYA 1T2XA 1SHYB 3K26A 4RE6A 3RLMD 3EI4B 4ZOZA 5HYNB 1NR0A 4XEIC 1M1XA 5HDBA 4A0AA 3OF7A 4K3ID 3AL9A 1N6FA 4FA4D 3MXXA 3O4HA 3RMZD 3UVLA 1GOTB 4CC9A 2H68A 4L9OA 4AN1A 4H5IA 2XL2A 2Z2OA 4J79A 1B9YA 2B5MA 3ORVD 3O4JA 3IUJA 5IT9g 4BCBA 3N0DA 3KCIA 3PXSD 4ESGA 1A12A 3SCYA 2H9MA 3JPXA 4CZYA 5M5UA 1S4UX 1QFSA 4PSWB 3SJLD 1BPOA 2XE4A 3AFCA 2IWKA 3DDUA 1TYQC 2AH1A 2JKXA 4AN0A 1TYEA 3ZDXA 5M5TA 3MMYA 4IRZA 2GNQA 2CO0A 2EIEA 3SBRA 3BWSA 1MDAH 4J84A 2HJ4A 2HKMA 3SMRA 4UI9R 3I7HA 5EAMA 5IJ8E 4BCCA 3RN0D 2OK6A 3OL2A 5EMLB 3SBQA 4L1MA 4FAND 2P9UC 1JOFA 3SXTD 4WK2A 1E8NA 2H9PA 1C9IA 3IULA 2P9LC 4E5ZA 4CY2A 2UZXB 3O4GA 5EARA 3I7NA 3IUQA 4A09A 2IUPA 4FA1D 4Y7RA 1GG2B 2H6QA 3V7DB 5H14A 3I8CA 3VI3A 1PBYB 4FB1D 2AH0A 4JSPC 1JMXB 4CY3A 3NVXA 3C75H 3PVWB 2W18A 4ERYA 4E5ZB 5AFU3 5HE0B 5M61A 4A2MA 5CYKA 1K3IA 5I5JA 4A09B 2MTAH 4JHNA 4ES0A 5TEEA 4E54A 5GMKn 3F3PA 4X63B 1O6GA 3IJ0A 2YB8B 1P22A 3A0FA 1JJUB 2HYEA 2HU7A 3MKSB 2PM6B 2Z2NA 5B4WA 3VA6A 1H2WA 5CXBA 5FKQA 1XIPA 2VDRA 5CYKB 3NVNA 4HDJA 2VDKA 1UOPA 2I0RA 4E54B 3AL8B 4GGCA 3SBPA 4O1QD 1E8MA 2CN2A 5SXMA 2AGYA 3FM0A 5IC7A 1E5TA 2IAAA 4KFMB 4NENA 5M5VA 2QC5A 1ERJA 5CXBB 2BKLA 3JAMg 3ZE2A 3MZLA 4CI2A 5A2Qg 3FGBA 1L5GA 4G1EA 3PE7A 1YFQA 1NEXB 4GGAA 3RSEC 4NAAA 5IJ7E 4JT5C 4IA9A 2PM9B 3EI3A 2O9KA 5FQDA 1GP2B 4X3EA 2GC7A 3UVKA 1VE7A 4AEZA 4Y5RD 3O4IA 2WQ8A 4OZUA 1U2VC 2VDOA 5FFGA 3IJCA 5FFOA 3PSCB 3DWLC 2BBKH 2IURA 4NC4A 3C99A 3VGZA 4DNUA 2VDMA 2Z2PA 3EI3B 3EI1A 3IJEA 3DXMC 4DNVA 4EWRA 3CFSB 3IURA 3I89A 4NSXA 1O6FA 1UOQA 3PSLA 2OVQB 3UVNA 5TEFA 5C92A 4A0AB 3VI4A 2B5NA 4N14A 4J0XA 2YMUA 2PM7B 3MUOA 4WK4A 2P9NC 4NBMA 3EI1B 4J77A 2IUVA 3I2NA 4GZ8A 4QAMA 4FAVD 3JZNA 1VZ2A 4A0BA 3F3GA 1A0RB 3SLED 4GM9A 4Z7OA 2P9KC 5CXCA 3DXKC 3V4PA 3K6SA 5FKSA 3PXTD 3J80g 1OMWB 2P9SC 4Z7QA 3IIWA 2VZ3A 2XYIA 4O02A 4MMXA 2OJYA 2H14A 3ZDYA 3C5MA 1R5MA 3ZWLB 1H2ZA 5EM2A 2OVRB 3NIFA 5E6UA 4A7JA 2BCJB 3F3FA 4GM8A 5E6SA 2AGLA 3VH0A 5CXCB 1XHMA 1TBGA 2H6NA 3SVWD 4CY5A 1SQ9A 2VDNA 4J86A 4YVDA 1B9XA 3OKYA 4PNKB 4LGNA 4L3HD 5HQGA 1PI6A 2VZ1A 4TZ4A 3EQ8A 3OL2B 4JT6C 2IWFA 2H6KA 5GXHA 4BP9A 4QRJA 4R7AB 3FRXA 4BL0A 5EM2B 2HU5A 4AMZA 3I7KA 2AGZA 4D9SA 2AGXA 4JXMA 3IIYA 2H47A 2CE9A 2I0TA 2PBIB 4J8BA 1Q47A 3IUNA 3OKYB 1JMZB 1K8KC 3ULEC 2YNOA 4FWWA 2QR5A 3SHFA 3SN6B 3RFGA 1K32A 4ZN4A 2P9PC 5I5MA 3FCUA 2HXCA 2EBSA 4AMYA 2OVPB 3PXWD 2HKRA 1N6DA 4CI3A 4A08A 5GSAA 3JZGA 5FLXg 5HE3B 3CFVA 4QQEA 3EI2A 1H2XA 5C9ZB 3E0CA 4MMYA 3FCSA 4X61B 1I2MB 3I8EA 4RE5A 4G1MA 3I7PA 5EMKB 4MMZA 2H9NA 4A08B 2EIBA 2EIDA 3UVOA 2AGWA 2CNXA 5EMJB 5AMSA 2H9LA 3DSMA 4GQ2P 3QI0A 3P4FA 5TF2A 2I3TA 3NIDA 5M5SA 5THAA 2Q7QA 4XYHA 4QL1A 3EU7A 5EALA 1SQJA 4O9DA 1L0QA 3HFQA 2YNPA 3EI4A 3OKWA 4GMBA 4ZOXA 3K72A 4CZVA 3L4MD 4I79A 5EMMB 3IKOA 4LG9A 2CE8A 3QHYB 4LG8A 4G55A 4O3UB 1U8CA 1VYHC 4FA5D 3OTTA 2IUQA 2YBAA 1PGUA 2HJBA 2VC2A 4CI8A 3GFCA 2XDWA 5FKRA 4GQBB 3UKUC 2G9AA 4JSXC 4ERQA 3N0EA 2XL3A 3IJ1A 5IGQA 3GD1I 2P9IC 5I5IA 4X60B 4BCDA 2QZPA 4MK0B 3UKRC 5C86A 4JSNC 5FXYA 3UVMA 5HE1B 5FA5B 3I7OA 1RI6A 2VDLA 5H1MA 2XU7A 2XZGA 3ODTA 1UOOA 4CI1A 1VE6A 1FWXA 4XYIA 3MKQA 4GGDA 1MG2A 4K3JB 4D6VA 4BP8A
chains in the Genus database with same CATH topology
2B4EA 2CN3A 5KDOB 4QT8A 1XKSA 3PVUB 4A11A 3CIKB 4U7AA 4PBZA 2UZYB 4L3GD 4A0BB 3RN1D 5TDHB 5FKTA 1QNIA 2HESX 3B7FA 4J0WA 4PXWA 3UR4A 4ZOVA 3JRPA 2OIZA 2G99A 4IMMA 4A11B 4A2LA 2J57G 3DM0A 2AQ5A 5C2WB 4GM3A 3SFZA 3U4YA 3BG1A 5JWZA 3JB9L 4D0KA 4JSVC 4PBYA 5EAPA 1N6EA 4J81A 5C2VB 2TRCB 4PC0A 4BUJC 4BH6A 4U1EI 2J56H 1PEVA 3K27A 4OWRA 1OLZA 4J87A 3V5WB 2OK4A 4H5JA 4AOWA 3JROA 3MZKA 3KRXB 4J82A 1U4CA 4Z8LA 3L4OD 5IGOA 1GXRA 4CY1A 3J81g 2I0SA 3OKTA 5K19A 3AL8A 3V9FA 4FA9D 2GC4A 4J78A 3W15A 4ERZA 5HE2B 4J8GA 2J55H 5GXIA 3C9CA 3KRWB 3RRMC 4G56B 3AH8B 5K1CC 4J73A 3SWSD 3EI2B 3I7LA 3EMHA 2PM9A 2I3SA 2CO0C 4GQ1A 2B5LA 4O45A 3GREA 3EG6A 4O3TB 2QXVA 2H13A 3OW8A 5H17A 3RFHA 3JZHA 4CZXA 4JD2C 4L1QD 3NVQA 2H3XA 3EWEA 4PSXB 2YNNA 5AJAA 4FHLA 3BG0A 1MG3A 4ZOYA 1SHYB 3K26A 3RLMD 3EI4B 4ZOZA 5HYNB 1NR0A 4XEIC 4A0AA 4K3ID 3AL9A 1N6FA 4FA4D 3MXXA 3RMZD 3UVLA 1GOTB 4CC9A 2H68A 4L9OA 4H5IA 2XL2A 2Z2OA 4J79A 1B9YA 2B5MA 3ORVD 5IT9g 3N0DA 3PXSD 4ESGA 3SCYA 2H9MA 3JPXA 4CZYA 1S4UX 4PSWB 3SJLD 3AFCA 2IWKA 1TYQC 2AH1A 3MMYA 2GNQA 2CO0A 3SBRA 3BWSA 1MDAH 4J84A 2HJ4A 2HKMA 3SMRA 4UI9R 3I7HA 5EAMA 5IJ8E 3RN0D 2OK6A 3OL2A 5EMLB 3SBQA 4FAND 2P9UC 1JOFA 3SXTD 2H9PA 2P9LC 4E5ZA 4CY2A 2UZXB 5EARA 3I7NA 4A09A 2IUPA 4FA1D 4Y7RA 1GG2B 2H6QA 3V7DB 5H14A 3I8CA 1PBYB 4FB1D 2AH0A 4JSPC 1JMXB 4CY3A 3NVXA 3C75H 3PVWB 2W18A 4ERYA 4E5ZB 5AFU3 5HE0B 4A2MA 5CYKA 5I5JA 4A09B 2MTAH 4E54A 4ES0A 5TEEA 5GMKn 3F3PA 4X63B 3IJ0A 2YB8B 1P22A 3A0FA 1JJUB 2HYEA 3MKSB 2PM6B 2Z2NA 5B4WA 3VA6A 5CXBA 5FKQA 1XIPA 5CYKB 3NVNA 4HDJA 2I0RA 4E54B 3AL8B 4GGCA 3SBPA 4O1QD 2CN2A 5SXMA 2AGYA 3FM0A 5IC7A 2IAAA 4KFMB 2QC5A 1ERJA 5CXBB 3JAMg 3MZLA 4CI2A 5A2Qg 3FGBA 3PE7A 1YFQA 1NEXB 4GGAA 3RSEC 5IJ7E 4JT5C 4IA9A 2PM9B 3EI3A 2O9KA 5FQDA 1GP2B 4X3EA 2GC7A 3UVKA 4AEZA 4Y5RD 4OZUA 1U2VC 3IJCA 3PSCB 3DWLC 2BBKH 2IURA 3C99A 3VGZA 2Z2PA 3EI3B 3EI1A 3DXMC 4EWRA 3CFSB 3I89A 4NSXA 3PSLA 2OVQB 3UVNA 5TEFA 4A0AB 2B5NA 4N14A 4J0XA 2YMUA 2PM7B 3EI1B 2P9NC 4J77A 2IUVA 3I2NA 4GZ8A 4FAVD 3JZNA 4A0BA 3F3GA 1A0RB 3SLED 4GM9A 2P9KC 5CXCA 3DXKC 5FKSA 3PXTD 3J80g 1OMWB 2P9SC 3IIWA 2XYIA 2OJYA 2H14A 3C5MA 1R5MA 3ZWLB 5EM2A 2OVRB 4A7JA 2BCJB 3F3FA 4GM8A 2AGLA 3VH0A 5CXCB 1XHMA 1TBGA 2H6NA 3SVWD 4CY5A 1SQ9A 4J86A 4YVDA 1B9XA 3OKYA 4PNKB 4LGNA 4L3HD 5HQGA 1PI6A 4TZ4A 3OL2B 4JT6C 2IWFA 2H6KA 5GXHA 4QRJA 4R7AB 3FRXA 4BL0A 5EM2B 3I7KA 2AGZA 2AGXA 4JXMA 3IIYA 2H47A 2CE9A 2I0TA 2PBIB 4J8BA 1Q47A 3OKYB 1JMZB 1K8KC 3ULEC 2YNOA 4FWWA 3SHFA 3SN6B 3RFGA 1K32A 4ZN4A 2P9PC 5I5MA 2HXCA 2EBSA 2OVPB 3PXWD 2HKRA 1N6DA 4CI3A 4A08A 5GSAA 3JZGA 5FLXg 5HE3B 3CFVA 4QQEA 3EI2A 5C9ZB 3E0CA 4X61B 3I8EA 3I7PA 5EMKB 2H9NA 4A08B 3UVOA 2AGWA 2CNXA 5EMJB 5AMSA 2H9LA 3DSMA 4GQ2P 3P4FA 5TF2A 2I3TA 5THAA 2Q7QA 4XYHA 4QL1A 3EU7A 5EALA 1SQJA 4O9DA 1L0QA 3HFQA 2YNPA 3EI4A 3OKWA 4GMBA 4ZOXA 4CZVA 3L4MD 4I79A 5EMMB 3IKOA 4LG9A 2CE8A 4LG8A 4O3UB 1VYHC 4FA5D 3OTTA 2IUQA 2YBAA 1PGUA 2HJBA 4CI8A 3GFCA 5FKRA 4GQBB 3UKUC 2G9AA 4JSXC 4ERQA 3N0EA 2XL3A 3IJ1A 5IGQA 2P9IC 5I5IA 4X60B 4MK0B 3UKRC 4JSNC 5FXYA 3UVMA 5HE1B 5FA5B 3I7OA 1RI6A 5H1MA 2XU7A 3ODTA 4CI1A 1FWXA 4XYIA 3MKQA 4GGDA 1MG2A 4K3JB 4D6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  2CN3 A;  5KDO B;  4QT8 A;  1XKS A;  3PVU B;  4A11 A;  3CIK B;  4U7A A;  4PBZ A;  2UZY B;  4L3G D;  4A0B B;  3RN1 D;  5TDH B;  5FKT A;  1QNI A;  2HES X;  3B7F A;  4J0W A;  4PXW A;  3UR4 A;  4ZOV A;  3JRP A;  2OIZ A;  2G99 A;  4IMM A;  4A11 B;  4A2L A;  2J57 G;  3DM0 A;  2AQ5 A;  5C2W B;  4GM3 A;  3SFZ A;  3U4Y A;  3BG1 A;  5JWZ A;  3JB9 L;  4D0K A;  4JSV C;  4PBY A;  5EAP A;  1N6E A;  4J81 A;  5C2V B;  2TRC B;  4PC0 A;  4BUJ C;  4BH6 A;  4U1E I;  2J56 H;  1PEV A;  3K27 A;  4OWR A;  1OLZ A;  4J87 A;  3V5W B;  2OK4 A;  4H5J A;  4AOW A;  3JRO A;  3MZK A;  3KRX B;  4J82 A;  1U4C A;  4Z8L A;  3L4O D;  5IGO A;  1GXR A;  4CY1 A;  3J81 g;  2I0S A;  3OKT A;  5K19 A;  3AL8 A;  3V9F A;  4FA9 D;  2GC4 A;  4J78 A;  3W15 A;  4ERZ A;  5HE2 B;  4J8G A;  2J55 H;  5GXI A;  3C9C A;  3KRW B;  3RRM C;  4G56 B;  3AH8 B;  5K1C C;  4J73 A;  3SWS D;  3EI2 B;  3I7L A;  3EMH A;  2PM9 A;  2I3S A;  2CO0 C;  4GQ1 A;  2B5L A;  4O45 A;  3GRE A;  3EG6 A;  4O3T B;  2QXV A;  2H13 A;  3OW8 A;  5H17 A;  3RFH A;  3JZH A;  4CZX A;  4JD2 C;  4L1Q D;  3NVQ A;  2H3X A;  3EWE A;  4PSX B;  2YNN A;  5AJA A;  4FHL A;  3BG0 A;  1MG3 A;  4ZOY A;  1SHY B;  3K26 A;  3RLM D;  3EI4 B;  4ZOZ A;  5HYN B;  1NR0 A;  4XEI C;  4A0A A;  4K3I D;  3AL9 A;  1N6F A;  4FA4 D;  3MXX A;  3RMZ D;  3UVL A;  1GOT B;  4CC9 A;  2H68 A;  4L9O A;  4H5I A;  2XL2 A;  2Z2O A;  4J79 A;  1B9Y A;  2B5M A;  3ORV D;  5IT9 g;  3N0D A;  3PXS D;  4ESG A;  3SCY A;  2H9M A;  3JPX A;  4CZY A;  1S4U X;  4PSW B;  3SJL D;  3AFC A;  2IWK A;  1TYQ C;  2AH1 A;  3MMY A;  2GNQ A;  2CO0 A;  3SBR A;  3BWS A;  1MDA H;  4J84 A;  2HJ4 A;  2HKM A;  3SMR A;  4UI9 R;  3I7H A;  5EAM A;  5IJ8 E;  3RN0 D;  2OK6 A;  3OL2 A;  5EML B;  3SBQ A;  4FAN D;  2P9U C;  1JOF A;  3SXT D;  2H9P A;  2P9L C;  4E5Z A;  4CY2 A;  2UZX B;  5EAR A;  3I7N A;  4A09 A;  2IUP A;  4FA1 D;  4Y7R A;  1GG2 B;  2H6Q A;  3V7D B;  5H14 A;  3I8C A;  1PBY B;  4FB1 D;  2AH0 A;  4JSP C;  1JMX B;  4CY3 A;  3NVX A;  3C75 H;  3PVW B;  2W18 A;  4ERY A;  4E5Z B;  5AFU 3;  5HE0 B;  4A2M A;  5CYK A;  5I5J A;  4A09 B;  2MTA H;  4E54 A;  4ES0 A;  5TEE A;  5GMK n;  3F3P A;  4X63 B;  3IJ0 A;  2YB8 B;  1P22 A;  3A0F A;  1JJU B;  2HYE A;  3MKS B;  2PM6 B;  2Z2N A;  5B4W A;  3VA6 A;  5CXB A;  5FKQ A;  1XIP A;  5CYK B;  3NVN A;  4HDJ A;  2I0R A;  4E54 B;  3AL8 B;  4GGC A;  3SBP A;  4O1Q D;  2CN2 A;  5SXM A;  2AGY A;  3FM0 A;  5IC7 A;  2IAA A;  4KFM B;  2QC5 A;  1ERJ A;  5CXB B;  3JAM g;  3MZL A;  4CI2 A;  5A2Q g;  3FGB A;  3PE7 A;  1YFQ A;  1NEX B;  4GGA A;  3RSE C;  5IJ7 E;  4JT5 C;  4IA9 A;  2PM9 B;  3EI3 A;  2O9K A;  5FQD A;  1GP2 B;  4X3E A;  2GC7 A;  3UVK A;  4AEZ A;  4Y5R D;  4OZU A;  1U2V C;  3IJC A;  3PSC B;  3DWL C;  2BBK H;  2IUR A;  3C99 A;  3VGZ A;  2Z2P A;  3EI3 B;  3EI1 A;  3DXM C;  4EWR A;  3CFS B;  3I89 A;  4NSX A;  3PSL A;  2OVQ B;  3UVN A;  5TEF A;  4A0A B;  2B5N A;  4N14 A;  4J0X A;  2YMU A;  2PM7 B;  3EI1 B;  2P9N C;  4J77 A;  2IUV A;  3I2N A;  4GZ8 A;  4FAV D;  3JZN A;  4A0B A;  3F3G A;  1A0R B;  3SLE D;  4GM9 A;  2P9K C;  5CXC A;  3DXK C;  5FKS A;  3PXT D;  3J80 g;  1OMW B;  2P9S C;  3IIW A;  2XYI A;  2OJY A;  2H14 A;  3C5M A;  1R5M A;  3ZWL B;  5EM2 A;  2OVR B;  4A7J A;  2BCJ B;  3F3F A;  4GM8 A;  2AGL A;  3VH0 A;  5CXC B;  1XHM A;  1TBG A;  2H6N A;  3SVW D;  4CY5 A;  1SQ9 A;  4J86 A;  4YVD A;  1B9X A;  3OKY A;  4PNK B;  4LGN A;  4L3H D;  5HQG A;  1PI6 A;  4TZ4 A;  3OL2 B;  4JT6 C;  2IWF A;  2H6K A;  5GXH A;  4QRJ A;  4R7A B;  3FRX A;  4BL0 A;  5EM2 B;  3I7K A;  2AGZ A;  2AGX A;  4JXM A;  3IIY A;  2H47 A;  2CE9 A;  2I0T A;  2PBI B;  4J8B A;  1Q47 A;  3OKY B;  1JMZ B;  1K8K C;  3ULE C;  2YNO A;  4FWW A;  3SHF A;  3SN6 B;  3RFG A;  1K32 A;  4ZN4 A;  2P9P C;  5I5M A;  2HXC A;  2EBS A;  2OVP B;  3PXW D;  2HKR A;  1N6D A;  4CI3 A;  4A08 A;  5GSA A;  3JZG A;  5FLX g;  5HE3 B;  3CFV A;  4QQE A;  3EI2 A;  5C9Z B;  3E0C A;  4X61 B;  3I8E A;  3I7P A;  5EMK B;  2H9N A;  4A08 B;  3UVO A;  2AGW A;  2CNX A;  5EMJ B;  5AMS A;  2H9L A;  3DSM A;  4GQ2 P;  3P4F A;  5TF2 A;  2I3T A;  5THA A;  2Q7Q A;  4XYH A;  4QL1 A;  3EU7 A;  5EAL A;  1SQJ A;  4O9D A;  1L0Q A;  3HFQ A;  2YNP A;  3EI4 A;  3OKW A;  4GMB A;  4ZOX A;  4CZV A;  3L4M D;  4I79 A;  5EMM B;  3IKO A;  4LG9 A;  2CE8 A;  4LG8 A;  4O3U B;  1VYH C;  4FA5 D;  3OTT A;  2IUQ A;  2YBA A;  1PGU A;  2HJB A;  4CI8 A;  3GFC A;  5FKR A;  4GQB B;  3UKU C;  2G9A A;  4JSX C;  4ERQ A;  3N0E A;  2XL3 A;  3IJ1 A;  5IGQ A;  2P9I C;  5I5I A;  4X60 B;  4MK0 B;  3UKR C;  4JSN C;  5FXY A;  3UVM A;  5HE1 B;  5FA5 B;  3I7O A;  1RI6 A;  5H1M A;  2XU7 A;  3ODT A;  4CI1 A;  1FWX A;  4XYI A;  3MKQ A;  4GGD A;  1MG2 A;  4K3J B;  4D6V A; 
#chains in the Genus database with same CATH topology
 2B4E A;  2CN3 A;  5KDO B;  4QT8 A;  1XKS A;  3PVU B;  4A11 A;  3CIK B;  1GOF A;  4U7A A;  4PBZ A;  4UM8 A;  2UZY B;  4L3G D;  4A0B B;  3RN1 D;  5TDH B;  5FKT A;  1QNI A;  4WK0 A;  1C9L A;  4O2W A;  2HES X;  3B7F A;  4J0W A;  4PXW A;  3UR4 A;  4AX4 A;  3IVM A;  4ZOV A;  3JRP A;  3ZE0 A;  2OIZ A;  2G99 A;  4IMM A;  4A11 B;  4A2L A;  2J57 G;  3DM0 A;  2AQ5 A;  1UTC A;  5C2W B;  4GM3 A;  3SFZ A;  3U4Y A;  1YR2 A;  3BG1 A;  5JWZ A;  3JB9 L;  4D0K A;  4JSV C;  4WJK A;  4PBY A;  5EAP A;  1N6E A;  4J81 A;  5C2V B;  2TRC B;  4PC0 A;  4BUJ C;  4BH6 A;  3MVD K;  2VDQ A;  4U1E I;  2J56 H;  1PEV A;  3K27 A;  4OWR A;  1OLZ A;  4J87 A;  3V5W B;  5E6R A;  2OK4 A;  3NIG A;  4H5J A;  2HU8 A;  4AOW A;  3JRO A;  4UM9 A;  3MZK A;  3KRX B;  4J82 A;  1GOH A;  1U4C A;  4Z8L A;  3L4O D;  5IGO A;  1JTD B;  1GXR A;  4CY1 A;  3MUN A;  3J81 g;  2I0S A;  3OKT A;  3T3M A;  5K19 A;  1QFM A;  3AL8 A;  3V9F A;  4Z7N A;  4DNW A;  4JHP C;  4FA9 D;  2GC4 A;  4J78 A;  3W15 A;  4ERZ A;  5HE2 B;  4J8G A;  2J55 H;  5GXI A;  3C9C A;  3KRW B;  3RRM C;  4G56 B;  3AH8 B;  1H2Y A;  5K1C C;  4J73 A;  3SWS D;  3EI2 B;  3I7L A;  1VZ3 A;  3IUM A;  1GOG A;  3EMH A;  2EIC A;  2PM9 A;  2I3S A;  2CO0 C;  4GQ1 A;  2B5L A;  4O45 A;  1JV2 A;  3GRE A;  3EG6 A;  3K71 A;  4O3T B;  2QXV A;  3ZDZ A;  2H13 A;  3T3P A;  3EQ9 A;  3OW8 A;  5H17 A;  3GC3 B;  3RFH A;  3JZH A;  4CZX A;  4JD2 C;  4L1Q D;  3EQ7 A;  3NVQ A;  3V4V A;  3ZE1 A;  2H3X A;  3EWE A;  2VDP A;  4PSX B;  2YNN A;  5AJA A;  4FHL A;  3BG0 A;  5M5R A;  1MG3 A;  4ZOY A;  1T2X A;  1SHY B;  3K26 A;  4RE6 A;  3RLM D;  3EI4 B;  4ZOZ A;  5HYN B;  1NR0 A;  4XEI C;  1M1X A;  5HDB A;  4A0A A;  3OF7 A;  4K3I D;  3AL9 A;  1N6F A;  4FA4 D;  3MXX A;  3O4H A;  3RMZ D;  3UVL A;  1GOT B;  4CC9 A;  2H68 A;  4L9O A;  4AN1 A;  4H5I A;  2XL2 A;  2Z2O A;  4J79 A;  1B9Y A;  2B5M A;  3ORV D;  3O4J A;  3IUJ A;  5IT9 g;  4BCB A;  3N0D A;  3KCI A;  3PXS D;  4ESG A;  1A12 A;  3SCY A;  2H9M A;  3JPX A;  4CZY A;  5M5U A;  1S4U X;  1QFS A;  4PSW B;  3SJL D;  1BPO A;  2XE4 A;  3AFC A;  2IWK A;  3DDU A;  1TYQ C;  2AH1 A;  2JKX A;  4AN0 A;  1TYE A;  3ZDX A;  5M5T A;  3MMY A;  4IRZ A;  2GNQ A;  2CO0 A;  2EIE A;  3SBR A;  3BWS A;  1MDA H;  4J84 A;  2HJ4 A;  2HKM A;  3SMR A;  4UI9 R;  3I7H A;  5EAM A;  5IJ8 E;  4BCC A;  3RN0 D;  2OK6 A;  3OL2 A;  5EML B;  3SBQ A;  4L1M A;  4FAN D;  2P9U C;  1JOF A;  3SXT D;  4WK2 A;  1E8N A;  2H9P A;  1C9I A;  3IUL A;  2P9L C;  4E5Z A;  4CY2 A;  2UZX B;  3O4G A;  5EAR A;  3I7N A;  3IUQ A;  4A09 A;  2IUP A;  4FA1 D;  4Y7R A;  1GG2 B;  2H6Q A;  3V7D B;  5H14 A;  3I8C A;  3VI3 A;  1PBY B;  4FB1 D;  2AH0 A;  4JSP C;  1JMX B;  4CY3 A;  3NVX A;  3C75 H;  3PVW B;  2W18 A;  4ERY A;  4E5Z B;  5AFU 3;  5HE0 B;  5M61 A;  4A2M A;  5CYK A;  1K3I A;  5I5J A;  4A09 B;  2MTA H;  4JHN A;  4ES0 A;  5TEE A;  4E54 A;  5GMK n;  3F3P A;  4X63 B;  1O6G A;  3IJ0 A;  2YB8 B;  1P22 A;  3A0F A;  1JJU B;  2HYE A;  2HU7 A;  3MKS B;  2PM6 B;  2Z2N A;  5B4W A;  3VA6 A;  1H2W A;  5CXB A;  5FKQ A;  1XIP A;  2VDR A;  5CYK B;  3NVN A;  4HDJ A;  2VDK A;  1UOP A;  2I0R A;  4E54 B;  3AL8 B;  4GGC A;  3SBP A;  4O1Q D;  1E8M A;  2CN2 A;  5SXM A;  2AGY A;  3FM0 A;  5IC7 A;  1E5T A;  2IAA A;  4KFM B;  4NEN A;  5M5V A;  2QC5 A;  1ERJ A;  5CXB B;  2BKL A;  3JAM g;  3ZE2 A;  3MZL A;  4CI2 A;  5A2Q g;  3FGB A;  1L5G A;  4G1E A;  3PE7 A;  1YFQ A;  1NEX B;  4GGA A;  3RSE C;  4NAA A;  5IJ7 E;  4JT5 C;  4IA9 A;  2PM9 B;  3EI3 A;  2O9K A;  5FQD A;  1GP2 B;  4X3E A;  2GC7 A;  3UVK A;  1VE7 A;  4AEZ A;  4Y5R D;  3O4I A;  2WQ8 A;  4OZU A;  1U2V C;  2VDO A;  5FFG A;  3IJC A;  5FFO A;  3PSC B;  3DWL C;  2BBK H;  2IUR A;  4NC4 A;  3C99 A;  3VGZ A;  4DNU A;  2VDM A;  2Z2P A;  3EI3 B;  3EI1 A;  3IJE A;  3DXM C;  4DNV A;  4EWR A;  3CFS B;  3IUR A;  3I89 A;  4NSX A;  1O6F A;  1UOQ A;  3PSL A;  2OVQ B;  3UVN A;  5TEF A;  5C92 A;  4A0A B;  3VI4 A;  2B5N A;  4N14 A;  4J0X A;  2YMU A;  2PM7 B;  3MUO A;  4WK4 A;  2P9N C;  4NBM A;  3EI1 B;  4J77 A;  2IUV A;  3I2N A;  4GZ8 A;  4QAM A;  4FAV D;  3JZN A;  1VZ2 A;  4A0B A;  3F3G A;  1A0R B;  3SLE D;  4GM9 A;  4Z7O A;  2P9K C;  5CXC A;  3DXK C;  3V4P A;  3K6S A;  5FKS A;  3PXT D;  3J80 g;  1OMW B;  2P9S C;  4Z7Q A;  3IIW A;  2VZ3 A;  2XYI A;  4O02 A;  4MMX A;  2OJY A;  2H14 A;  3ZDY A;  3C5M A;  1R5M A;  3ZWL B;  1H2Z A;  5EM2 A;  2OVR B;  3NIF A;  5E6U A;  4A7J A;  2BCJ B;  3F3F A;  4GM8 A;  5E6S A;  2AGL A;  3VH0 A;  5CXC B;  1XHM A;  1TBG A;  2H6N A;  3SVW D;  4CY5 A;  1SQ9 A;  2VDN A;  4J86 A;  4YVD A;  1B9X A;  3OKY A;  4PNK B;  4LGN A;  4L3H D;  5HQG A;  1PI6 A;  2VZ1 A;  4TZ4 A;  3EQ8 A;  3OL2 B;  4JT6 C;  2IWF A;  2H6K A;  5GXH A;  4BP9 A;  4QRJ A;  4R7A B;  3FRX A;  4BL0 A;  5EM2 B;  2HU5 A;  4AMZ A;  3I7K A;  2AGZ A;  4D9S A;  2AGX A;  4JXM A;  3IIY A;  2H47 A;  2CE9 A;  2I0T A;  2PBI B;  4J8B A;  1Q47 A;  3IUN A;  3OKY B;  1JMZ B;  1K8K C;  3ULE C;  2YNO A;  4FWW A;  2QR5 A;  3SHF A;  3SN6 B;  3RFG A;  1K32 A;  4ZN4 A;  2P9P C;  5I5M A;  3FCU A;  2HXC A;  2EBS A;  4AMY A;  2OVP B;  3PXW D;  2HKR A;  1N6D A;  4CI3 A;  4A08 A;  5GSA A;  3JZG A;  5FLX g;  5HE3 B;  3CFV A;  4QQE A;  3EI2 A;  1H2X A;  5C9Z B;  3E0C A;  4MMY A;  3FCS A;  4X61 B;  1I2M B;  3I8E A;  4RE5 A;  4G1M A;  3I7P A;  5EMK B;  4MMZ A;  2H9N A;  4A08 B;  2EIB A;  2EID A;  3UVO A;  2AGW A;  2CNX A;  5EMJ B;  5AMS A;  2H9L A;  3DSM A;  4GQ2 P;  3QI0 A;  3P4F A;  5TF2 A;  2I3T A;  3NID A;  5M5S A;  5THA A;  2Q7Q A;  4XYH A;  4QL1 A;  3EU7 A;  5EAL A;  1SQJ A;  4O9D A;  1L0Q A;  3HFQ A;  2YNP A;  3EI4 A;  3OKW A;  4GMB A;  4ZOX A;  3K72 A;  4CZV A;  3L4M D;  4I79 A;  5EMM B;  3IKO A;  4LG9 A;  2CE8 A;  3QHY B;  4LG8 A;  4G55 A;  4O3U B;  1U8C A;  1VYH C;  4FA5 D;  3OTT A;  2IUQ A;  2YBA A;  1PGU A;  2HJB A;  2VC2 A;  4CI8 A;  3GFC A;  2XDW A;  5FKR A;  4GQB B;  3UKU C;  2G9A A;  4JSX C;  4ERQ A;  3N0E A;  2XL3 A;  3IJ1 A;  5IGQ A;  3GD1 I;  2P9I C;  5I5I A;  4X60 B;  4BCD A;  2QZP A;  4MK0 B;  3UKR C;  5C86 A;  4JSN C;  5FXY A;  3UVM A;  5HE1 B;  5FA5 B;  3I7O A;  1RI6 A;  2VDL A;  5H1M A;  2XU7 A;  2XZG A;  3ODT A;  1UOO A;  4CI1 A;  1VE6 A;  1FWX A;  4XYI A;  3MKQ A;  4GGD A;  1MG2 A;  4K3J B;  4D6V A;  4BP8 A; 
#chains in the Genus database with same CATH homology
 2B4E A;  2CN3 A;  5KDO B;  4QT8 A;  1XKS A;  3PVU B;  4A11 A;  3CIK B;  4U7A A;  4PBZ A;  2UZY B;  4L3G D;  4A0B B;  3RN1 D;  5TDH B;  5FKT A;  1QNI A;  2HES X;  3B7F A;  4J0W A;  4PXW A;  3UR4 A;  4ZOV A;  3JRP A;  2OIZ A;  2G99 A;  4IMM A;  4A11 B;  4A2L A;  2J57 G;  3DM0 A;  2AQ5 A;  5C2W B;  4GM3 A;  3SFZ A;  3U4Y A;  3BG1 A;  5JWZ A;  3JB9 L;  4D0K A;  4JSV C;  4PBY A;  5EAP A;  1N6E A;  4J81 A;  5C2V B;  2TRC B;  4PC0 A;  4BUJ C;  4BH6 A;  4U1E I;  2J56 H;  1PEV A;  3K27 A;  4OWR A;  1OLZ A;  4J87 A;  3V5W B;  2OK4 A;  4H5J A;  4AOW A;  3JRO A;  3MZK A;  3KRX B;  4J82 A;  1U4C A;  4Z8L A;  3L4O D;  5IGO A;  1GXR A;  4CY1 A;  3J81 g;  2I0S A;  3OKT A;  5K19 A;  3AL8 A;  3V9F A;  4FA9 D;  2GC4 A;  4J78 A;  3W15 A;  4ERZ A;  5HE2 B;  4J8G A;  2J55 H;  5GXI A;  3C9C A;  3KRW B;  3RRM C;  4G56 B;  3AH8 B;  5K1C C;  4J73 A;  3SWS D;  3EI2 B;  3I7L A;  3EMH A;  2PM9 A;  2I3S A;  2CO0 C;  4GQ1 A;  2B5L A;  4O45 A;  3GRE A;  3EG6 A;  4O3T B;  2QXV A;  2H13 A;  3OW8 A;  5H17 A;  3RFH A;  3JZH A;  4CZX A;  4JD2 C;  4L1Q D;  3NVQ A;  2H3X A;  3EWE A;  4PSX B;  2YNN A;  5AJA A;  4FHL A;  3BG0 A;  1MG3 A;  4ZOY A;  1SHY B;  3K26 A;  3RLM D;  3EI4 B;  4ZOZ A;  5HYN B;  1NR0 A;  4XEI C;  4A0A A;  4K3I D;  3AL9 A;  1N6F A;  4FA4 D;  3MXX A;  3RMZ D;  3UVL A;  1GOT B;  4CC9 A;  2H68 A;  4L9O A;  4H5I A;  2XL2 A;  2Z2O A;  4J79 A;  1B9Y A;  2B5M A;  3ORV D;  5IT9 g;  3N0D A;  3PXS D;  4ESG A;  3SCY A;  2H9M A;  3JPX A;  4CZY A;  1S4U X;  4PSW B;  3SJL D;  3AFC A;  2IWK A;  1TYQ C;  2AH1 A;  3MMY A;  2GNQ A;  2CO0 A;  3SBR A;  3BWS A;  1MDA H;  4J84 A;  2HJ4 A;  2HKM A;  3SMR A;  4UI9 R;  3I7H A;  5EAM A;  5IJ8 E;  3RN0 D;  2OK6 A;  3OL2 A;  5EML B;  3SBQ A;  4FAN D;  2P9U C;  1JOF A;  3SXT D;  2H9P A;  2P9L C;  4E5Z A;  4CY2 A;  2UZX B;  5EAR A;  3I7N A;  4A09 A;  2IUP A;  4FA1 D;  4Y7R A;  1GG2 B;  2H6Q A;  3V7D B;  5H14 A;  3I8C A;  1PBY B;  4FB1 D;  2AH0 A;  4JSP C;  1JMX B;  4CY3 A;  3NVX A;  3C75 H;  3PVW B;  2W18 A;  4ERY A;  4E5Z B;  5AFU 3;  5HE0 B;  4A2M A;  5CYK A;  5I5J A;  4A09 B;  2MTA H;  4E54 A;  4ES0 A;  5TEE A;  5GMK n;  3F3P A;  4X63 B;  3IJ0 A;  2YB8 B;  1P22 A;  3A0F A;  1JJU B;  2HYE A;  3MKS B;  2PM6 B;  2Z2N A;  5B4W A;  3VA6 A;  5CXB A;  5FKQ A;  1XIP A;  5CYK B;  3NVN A;  4HDJ A;  2I0R A;  4E54 B;  3AL8 B;  4GGC A;  3SBP A;  4O1Q D;  2CN2 A;  5SXM A;  2AGY A;  3FM0 A;  5IC7 A;  2IAA A;  4KFM B;  2QC5 A;  1ERJ A;  5CXB B;  3JAM g;  3MZL A;  4CI2 A;  5A2Q g;  3FGB A;  3PE7 A;  1YFQ A;  1NEX B;  4GGA A;  3RSE C;  5IJ7 E;  4JT5 C;  4IA9 A;  2PM9 B;  3EI3 A;  2O9K A;  5FQD A;  1GP2 B;  4X3E A;  2GC7 A;  3UVK A;  4AEZ A;  4Y5R D;  4OZU A;  1U2V C;  3IJC A;  3PSC B;  3DWL C;  2BBK H;  2IUR A;  3C99 A;  3VGZ A;  2Z2P A;  3EI3 B;  3EI1 A;  3DXM C;  4EWR A;  3CFS B;  3I89 A;  4NSX A;  3PSL A;  2OVQ B;  3UVN A;  5TEF A;  4A0A B;  2B5N A;  4N14 A;  4J0X A;  2YMU A;  2PM7 B;  3EI1 B;  2P9N C;  4J77 A;  2IUV A;  3I2N A;  4GZ8 A;  4FAV D;  3JZN A;  4A0B A;  3F3G A;  1A0R B;  3SLE D;  4GM9 A;  2P9K C;  5CXC A;  3DXK C;  5FKS A;  3PXT D;  3J80 g;  1OMW B;  2P9S C;  3IIW A;  2XYI A;  2OJY A;  2H14 A;  3C5M A;  1R5M A;  3ZWL B;  5EM2 A;  2OVR B;  4A7J A;  2BCJ B;  3F3F A;  4GM8 A;  2AGL A;  3VH0 A;  5CXC B;  1XHM A;  1TBG A;  2H6N A;  3SVW D;  4CY5 A;  1SQ9 A;  4J86 A;  4YVD A;  1B9X A;  3OKY A;  4PNK B;  4LGN A;  4L3H D;  5HQG A;  1PI6 A;  4TZ4 A;  3OL2 B;  4JT6 C;  2IWF A;  2H6K A;  5GXH A;  4QRJ A;  4R7A B;  3FRX A;  4BL0 A;  5EM2 B;  3I7K A;  2AGZ A;  2AGX A;  4JXM A;  3IIY A;  2H47 A;  2CE9 A;  2I0T A;  2PBI B;  4J8B A;  1Q47 A;  3OKY B;  1JMZ B;  1K8K C;  3ULE C;  2YNO A;  4FWW A;  3SHF A;  3SN6 B;  3RFG A;  1K32 A;  4ZN4 A;  2P9P C;  5I5M A;  2HXC A;  2EBS A;  2OVP B;  3PXW D;  2HKR A;  1N6D A;  4CI3 A;  4A08 A;  5GSA A;  3JZG A;  5FLX g;  5HE3 B;  3CFV A;  4QQE A;  3EI2 A;  5C9Z B;  3E0C A;  4X61 B;  3I8E A;  3I7P A;  5EMK B;  2H9N A;  4A08 B;  3UVO A;  2AGW A;  2CNX A;  5EMJ B;  5AMS A;  2H9L A;  3DSM A;  4GQ2 P;  3P4F A;  5TF2 A;  2I3T A;  5THA A;  2Q7Q A;  4XYH A;  4QL1 A;  3EU7 A;  5EAL A;  1SQJ A;  4O9D A;  1L0Q A;  3HFQ A;  2YNP A;  3EI4 A;  3OKW A;  4GMB A;  4ZOX A;  4CZV A;  3L4M D;  4I79 A;  5EMM B;  3IKO A;  4LG9 A;  2CE8 A;  4LG8 A;  4O3U B;  1VYH C;  4FA5 D;  3OTT A;  2IUQ A;  2YBA A;  1PGU A;  2HJB A;  4CI8 A;  3GFC A;  5FKR A;  4GQB B;  3UKU C;  2G9A A;  4JSX C;  4ERQ A;  3N0E A;  2XL3 A;  3IJ1 A;  5IGQ A;  2P9I C;  5I5I A;  4X60 B;  4MK0 B;  3UKR C;  4JSN C;  5FXY A;  3UVM A;  5HE1 B;  5FA5 B;  3I7O A;  1RI6 A;  5H1M A;  2XU7 A;  3ODT A;  4CI1 A;  1FWX A;  4XYI A;  3MKQ A;  4GGD A;  1MG2 A;  4K3J B;  4D6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...