3UVOA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of set1b
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
304
structure length
300
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 99
structure length 300
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvoA00
5FQDA 2AH1A 4U7AA 2H6KA 2AGXA 4O3UB 2HKRA 2J55H 4FAND 2H9LA 4ESGA 4XYHA 4J73A 4A09A 4JSXC 3SWSD 1GG2B 2Z2OA 4GQ1A 3EU7A 1OLZA 3MKQA 5FKQA 4K3ID 3OKTA 4CI2A 5GSAA 3ODTA 1N6DA 5C2VB 5EMKB 4OZUA 3FM0A 3J80g 1JOFA 2UZXB 5EMLB 5CYKA 3I2NA 3SJLD 3N0EA 4R7AB 3SBPA 3ZWLB 3DWLC 2H6QA 5IJ7E 4PC0A 1XKSA 4E54B 2IUPA 3IKOA 5H1MA 4N14A 5IJ8E 4A0BA 5EAPA 3CFSB 4J0XA 3CIKB 2H3XA 4GQ2P 1RI6A 1XIPA 3UKUC 2YNPA 1N6FA 3JPXA 1Q47A 2GC4A 3IJCA 4A2MA 5EMMB 5I5IA 4A11A 5FKTA 1U4CA 4O1QD 4A2LA 4E5ZB 3PE7A 1GXRA 2G9AA 5TEEA 3EWEA 4XYIA 3MZKA 1YFQA 4JD2C 5A2Qg 3UVNA 3I7KA 3OKYB 3RN0D 4FA1D 3EI1B 3ORVD 2H6NA 3BG1A 5TEFA 3RN1D 4JT5C 4L3GD 4ERQA 2HJ4A 3DM0A 5B4WA 4ES0A 2W18A 5TDHB 5FXYA 2PBIB 4O45A 3UR4A 1L0QA 1GP2B 2G99A 4J84A 3SLED 4A08A 2YNOA 3JB9L 5K19A 4L3HD 3SCYA 1MG3A 2XU7A 5C9ZB 4CC9A 4CZYA 1PI6A 2XL3A 4JSPC 5I5MA 2BCJB 2XL2A 3EI3A 3UVMA 1JJUB 3F3PA 4OWRA 1OMWB 3EI2B 5K1CC 4BUJC 5KDOB 3P4FA 2UZYB 2HKMA 5AFU3 2P9IC 4QL1A 3SBRA 3GREA 4PBYA 4IMMA 5EARA 4GM9A 3JZGA 2CNXA 4J77A 2QC5A 4K3JB 5IC7A 3K26A 2HYEA 5FLXg 4J81A 2Z2NA 3IIWA 2HJBA 3RRMC 2H13A 4L1QD 4BH6A 2I0TA 4J86A 1R5MA 2H68A 4TZ4A 1JMXB 3DXMC 4GGAA 4ZN4A 1TBGA 4J79A 4GQBB 4H5JA 2I3SA 5IGOA 3RFGA 5FA5B 4CY5A 3KRXB 4PSWB 3OL2B 2EBSA 4QQEA 4H5IA 4X61B 2B5MA 4D6VA 2OK6A 2YNNA 2H9PA 2J56H 1VYHC 3JRPA 2AGLA 4CY2A 2YMUA 4X63B 3UVLA 2PM7B 3VH0A 4A0AA 4YVDA 5JWZA 3EI4B 2PM9B 5EAMA 4HDJA 3GFCA 4LG8A 3FGBA 2I0RA 4Z8LA 2IUVA 3EMHA 2IUQA 3VGZA 4J82A 1P22A 2H47A 2GC7A 2P9UC 4GGDA 4G56B 4J87A 4GMBA 3RSEC 3U4YA 2P9NC 5FKSA 4QRJA 4JSNC 4J8BA 4XEIC 3MZLA 4CY1A 5SXMA 3L4OD 5CXCB 5EM2B 1MDAH 1PGUA 3JZHA 5H14A 3RFHA 4IA9A 3PXSD 4I79A 3AH8B 3AL8B 4FA4D 5HQGA 4LGNA 5CXBB 3IIYA 3SFZA 2HXCA 4FA9D 2J57G 2CO0C 4FWWA 4X60B 3NVXA 2O9KA 3JZNA 2AGYA 2CE8A 3V7DB 5IGQA 4QT8A 3CFVA 4GM8A 5HE0B 2CO0A 3A0FA 4A09B 2QXVA 4EWRA 1SQJA 3I8EA 5GXHA 2B4EA 3IJ1A 3V5WB 3BG0A 4AOWA 2MTAH 4E54A 1B9YA 3PSLA 5CYKB 1SHYB 3F3GA 4Y7RA 3DSMA 4PXWA 2OK4A 4A0BB 3C99A 4J78A 5THAA 3AFCA 3PXWD 3OTTA 4CI1A 2OVRB 2AH0A 1A0RB 3SXTD 4CI3A 3JROA 3NVQA 3PVUB 2OVPB 2AGZA 4E5ZA 4A11B 2PM6B 3C5MA 3I7NA 2IAAA 3F3FA 5TF2A 4ERYA 4ZOYA 4D0KA 2OJYA 3ULEC 4JSVC 3OKYA 3EI1A 1JMZB 3PVWB 3SVWD 3EG6A 4KFMB 5H17A 2B5LA 1K8KC 4NSXA 4FHLA 2BBKH 5FKRA 4O3TB 1ERJA 1TYQC 3V9FA 3PXTD 2Z2PA 2XYIA 3KRWB 3MXXA 3MKSB 4PBZA 1SQ9A 4GM3A 4FB1D 3I8CA 3E0CA 1U2VC 5C2WB 3C75H 5GXIA 3J81g 4A08B 2IURA 3I89A 3SMRA 2AQ5A 3SN6B 3UKRC 3DXKC 4FAVD 4BL0A 3W15A 3B7FA 4J8GA 4Y5RD 2B5NA 3I7HA 4O9DA 3EI2A 4CI8A 3EI3B 5GMKn 4JXMA 5HE1B 4A7JA 3I7LA 4FA5D 2I3TA 4L9OA 3MMYA 2P9SC 1FWXA 3PSCB 1S4UX 4ZOVA 3JAMg 4X3EA 3UVKA 2YB8B 1GOTB 1NR0A 1PEVA 2TRCB 1PBYB 4MK0B 1NEXB 2OVQB 2H9MA 2AGWA 2P9PC 4CY3A 2IWKA 3K27A 2CN2A 3N0DA 2IWFA 3UVOA 4ERZA 3OL2A 3BWSA 3IJ0A 4PSXB 2H14A 3OW8A 4AEZA 5AMSA 5HE2B 3RLMD 5HYNB 5AJAA 3AL9A 3SHFA 2HESX 2YBAA 3HFQA 3RMZD 3L4MD 3SBQA 3EI4A 2PM9A 1K32A 3C9CA 3NVNA 4A0AB 5I5JA 2CN3A 2P9LC 4U1EI 2P9KC 2GNQA 3FRXA 4GGCA 2I0SA 5EMJB 4UI9R 5HE3B 1B9XA 4ZOZA 2H9NA 1XHMA 1QNIA 2Q7QA 4JT6C 4ZOXA 2CE9A 2OIZA 3VA6A 5IT9g 5CXCA 5EM2A 4GZ8A 4PNKB 4CZVA 1N6EA 3I7OA 3I7PA 4J0WA 3AL8A 4CZXA 5EALA 4LG9A 3OKWA 1MG2A 5CXBA
chains in the Genus database with same CATH superfamily
5FQDA 2AH1A 4U7AA 3K6SA 2H6KA 2VDOA 2VDQA 2AGXA 4O3UB 2HKRA 2J55H 1I2MB 1H2YA 4FAND 2H9LA 4ESGA 4XYHA 4J73A 4Z7OA 4JSXC 3SWSD 1GG2B 2Z2OA 4A09A 4GQ1A 2VDPA 3EU7A 1OLZA 3MKQA 3QI0A 5FKQA 1JTDB 4K3ID 3OKTA 4CI2A 1C9LA 1TYEA 1BPOA 3ODTA 5GSAA 1N6DA 5C2VB 5EMKB 4AN1A 4OZUA 4G55A 3FM0A 3J80g 1JOFA 2UZXB 5EMLB 3MUOA 5CYKA 2WQ8A 3I2NA 3SJLD 3N0EA 4R7AB 3SBPA 3ZWLB 3DWLC 2H6QA 5IJ7E 4PC0A 1XKSA 4E54B 2IUPA 3IKOA 5H1MA 4NBMA 4N14A 5IJ8E 4A0BA 5EAPA 3CFSB 4BCBA 4J0XA 3CIKB 3IUQA 2H3XA 4GQ2P 1RI6A 1XIPA 3UKUC 2YNPA 5E6RA 1N6FA 3JPXA 1Q47A 2XE4A 2GC4A 3IJCA 4A2MA 5EMMB 5E6UA 5I5IA 4A11A 5FKTA 1U4CA 1K3IA 4O1QD 4A2LA 3GC3B 5C92A 4E5ZB 3PE7A 1GXRA 2G9AA 5TEEA 4D9SA 4DNVA 3EWEA 4XYIA 3MZKA 1YFQA 1H2WA 4JD2C 5A2Qg 3T3PA 3UVNA 3I7KA 3OKYB 3RN0D 4FA1D 3EI1B 3ORVD 2H6NA 3BG1A 3OF7A 5TEFA 2VZ3A 3RN1D 4JT5C 2VZ1A 4L3GD 4ERQA 2HJ4A 3DM0A 5B4WA 4ES0A 2W18A 1E5TA 5TDHB 5FXYA 2PBIB 4O45A 3UR4A 1L5GA 1L0QA 1GP2B 2G99A 3IURA 4J84A 3SLED 3ZDZA 4A08A 2YNOA 3JB9L 5K19A 4L3HD 3SCYA 1MG3A 2XU7A 5FFGA 5C9ZB 4O02A 4CC9A 4CZYA 3K72A 1PI6A 2XL3A 4JSPC 3IVMA 4G1MA 5I5MA 4NC4A 2BCJB 1QFMA 3GD1I 2XL2A 3EI3A 3UVMA 3O4HA 1JJUB 3F3PA 2VC2A 4OWRA 1OMWB 3EI2B 5K1CC 4BUJC 5KDOB 3P4FA 2UZYB 2HKMA 5AFU3 3ZDYA 5M5VA 2P9IC 4QL1A 4WK4A 3SBRA 3GREA 3IUJA 4PBYA 3MVDK 4IMMA 4IRZA 5EARA 4GM9A 3JZGA 4L1MA 2CNXA 4J77A 2QC5A 4K3JB 5IC7A 4MMZA 3K26A 2HYEA 5FLXg 4J81A 1U8CA 2Z2NA 2HU5A 3IIWA 2HJBA 3IULA 2H13A 4L1QD 3RRMC 4BH6A 2I0TA 4J86A 2VDNA 1R5MA 5HDBA 2H68A 4TZ4A 1JMXB 3DXMC 4GGAA 4ZN4A 1TBGA 4J79A 4GQBB 4H5JA 2I3SA 5IGOA 3RFGA 5M5TA 4JHPC 5FA5B 4CY5A 3KRXB 4PSWB 3OL2B 2EBSA 4QQEA 4H5IA 4X61B 2B5MA 4D6VA 2OK6A 2QR5A 2YNNA 2H9PA 3JRPA 2J56H 1VYHC 2AGLA 4CY2A 2YMUA 4X63B 3UVLA 2PM7B 3VH0A 4A0AA 4Z7QA 4YVDA 5JWZA 3EI4B 2PM9B 5EAMA 4HDJA 3GFCA 4LG8A 2EIBA 3FGBA 2I0RA 2EIEA 4Z8LA 2IUVA 3EMHA 2IUQA 3VGZA 4J82A 4BP9A 1P22A 2H47A 2GC7A 2P9UC 4GGDA 4G56B 4J87A 4GMBA 3RSEC 3U4YA 2P9NC 5FKSA 4DNWA 4QRJA 4JSNC 4J8BA 4XEIC 3MZLA 4CY1A 5SXMA 3L4OD 5CXCB 4WJKA 5EM2B 1MDAH 1PGUA 3JZHA 1JV2A 5H14A 3O4JA 3RFHA 3PXSD 4IA9A 4I79A 3AH8B 3AL8B 5M5RA 4FA4D 5HQGA 4LGNA 5CXBB 3IIYA 3SFZA 2HXCA 4FA9D 2J57G 2CO0C 3EQ9A 4FWWA 4X60B 3NVXA 2O9KA 3JZNA 2AGYA 2CE8A 2HU8A 3V7DB 5IGQA 4QT8A 3CFVA 4GM8A 5HE0B 2CO0A 3A0FA 4A09B 1VZ2A 4AMYA 3ZE1A 2QXVA 4EWRA 1O6GA 2XDWA 3ZE2A 1SQJA 3I8EA 5GXHA 2B4EA 4AX4A 3IJ1A 3NIDA 3V5WB 2EIDA 2BKLA 3BG0A 4AOWA 2MTAH 4E54A 1B9YA 4NENA 3PSLA 5CYKB 1SHYB 3F3GA 4Y7RA 3DSMA 4PXWA 2OK4A 3K71A 4A0BB 3C99A 4J78A 5THAA 3AFCA 3PXWD 3OTTA 4CI1A 4G1EA 3QHYB 2OVRB 2AH0A 1A0RB 4UM9A 3SXTD 4CI3A 3JROA 3NVQA 3PVUB 4WK2A 2OVPB 4BCDA 2AGZA 2VDRA 4E5ZA 1C9IA 4A11B 2PM6B 3T3MA 3C5MA 3I7NA 2IAAA 3F3FA 5TF2A 4ERYA 4ZOYA 2VDKA 3NIFA 4D0KA 2OJYA 3ULEC 4JSVC 3OKYA 3EI1A 1JMZB 3PVWB 5C86A 3SVWD 1T2XA 3EG6A 1VE7A 3IUNA 3EQ8A 4KFMB 1UOPA 5FFOA 5H17A 1UTCA 1GOFA 4BP8A 2VDMA 2B5LA 1K8KC 4O2WA 3VI4A 4NSXA 3ZDXA 3O4IA 4FHLA 2BBKH 4Z7NA 5FKRA 1ERJA 1TYQC 2VDLA 4O3TB 3V9FA 3PXTD 2JKXA 1GOHA 2XYIA 2Z2PA 3KRWB 5M61A 3MXXA 3MKSB 4PBZA 5E6SA 1M1XA 1SQ9A 4GM3A 4FB1D 4AMZA 3I8CA 1E8NA 3E0CA 1GOGA 1U2VC 4WK0A 3VI3A 5C2WB 3C75H 5GXIA 3J81g 1H2ZA 2EICA 4A08B 2IURA 5M5UA 3I89A 3SMRA 2AQ5A 3SN6B 3UKRC 3DXKC 4RE6A 4FAVD 3O4GA 3MUNA 3B7FA 3W15A 4BL0A 4J8GA 4UM8A 4Y5RD 3NIGA 2B5NA 3I7HA 3IUMA 4O9DA 4BCCA 4NAAA 3EI2A 4CI8A 3EI3B 1YR2A 5GMKn 4MMYA 4JXMA 5HE1B 4A7JA 3I7LA 4FA5D 2I3TA 3DDUA 4L9OA 3EQ7A 3MMYA 2P9SC 1FWXA 3KCIA 3PSCB 1S4UX 4ZOVA 3JAMg 4X3EA 3UVKA 4RE5A 2YB8B 1GOTB 1NR0A 1PEVA 1VZ3A 2TRCB 1PBYB 4MK0B 1NEXB 2OVQB 2H9MA 2AGWA 2P9PC 4CY3A 1O6FA 2IWKA 4DNUA 2XZGA 1E8MA 3K27A 2CN2A 3N0DA 2IWFA 3UVOA 4ERZA 4QAMA 3OL2A 3BWSA 3IJ0A 4PSXB 2H14A 3OW8A 4AEZA 3V4PA 5AMSA 5HE2B 3RLMD 5HYNB 4JHNA 3AL9A 5AJAA 3SHFA 1VE6A 2HESX 3ZE0A 3FCUA 3IJEA 2YBAA 3HFQA 3FCSA 3RMZD 1UOOA 1QFSA 3L4MD 3SBQA 4AN0A 3EI4A 2PM9A 1K32A 3C9CA 3NVNA 4A0AB 2HU7A 5I5JA 2CN3A 2P9LC 4U1EI 2QZPA 2P9KC 2GNQA 3FRXA 4GGCA 2I0SA 5EMJB 4UI9R 1UOQA 5HE3B 1B9XA 4ZOZA 2H9NA 1XHMA 1QNIA 2Q7QA 4JT6C 4ZOXA 2CE9A 2OIZA 1H2XA 3VA6A 5IT9g 5CXCA 5M5SA 4MMXA 5EM2A 4GZ8A 4PNKB 4CZVA 1N6EA 3I7OA 3I7PA 4J0WA 3AL8A 4CZXA 5EALA 4LG9A 3OKWA 1A12A 1MG2A 5CXBA 3V4VA
chains in the Genus database with same CATH topology
5FQDA 2AH1A 4U7AA 2H6KA 2AGXA 4O3UB 2HKRA 2J55H 4FAND 2H9LA 4ESGA 4XYHA 4J73A 4A09A 4JSXC 3SWSD 1GG2B 2Z2OA 4GQ1A 3EU7A 1OLZA 3MKQA 5FKQA 4K3ID 3OKTA 4CI2A 5GSAA 3ODTA 1N6DA 5C2VB 5EMKB 4OZUA 3FM0A 3J80g 1JOFA 2UZXB 5EMLB 5CYKA 3I2NA 3SJLD 3N0EA 4R7AB 3SBPA 3ZWLB 3DWLC 2H6QA 5IJ7E 4PC0A 1XKSA 4E54B 2IUPA 3IKOA 5H1MA 4N14A 5IJ8E 4A0BA 5EAPA 3CFSB 4J0XA 3CIKB 2H3XA 4GQ2P 1RI6A 1XIPA 3UKUC 2YNPA 1N6FA 3JPXA 1Q47A 2GC4A 3IJCA 4A2MA 5EMMB 5I5IA 4A11A 5FKTA 1U4CA 4O1QD 4A2LA 4E5ZB 3PE7A 1GXRA 2G9AA 5TEEA 3EWEA 4XYIA 3MZKA 1YFQA 4JD2C 5A2Qg 3UVNA 3I7KA 3OKYB 3RN0D 4FA1D 3EI1B 3ORVD 2H6NA 3BG1A 5TEFA 3RN1D 4JT5C 4L3GD 4ERQA 2HJ4A 3DM0A 5B4WA 4ES0A 2W18A 5TDHB 5FXYA 2PBIB 4O45A 3UR4A 1L0QA 1GP2B 2G99A 4J84A 3SLED 4A08A 2YNOA 3JB9L 5K19A 4L3HD 3SCYA 1MG3A 2XU7A 5C9ZB 4CC9A 4CZYA 1PI6A 2XL3A 4JSPC 5I5MA 2BCJB 2XL2A 3EI3A 3UVMA 1JJUB 3F3PA 4OWRA 1OMWB 3EI2B 5K1CC 4BUJC 5KDOB 3P4FA 2UZYB 2HKMA 5AFU3 2P9IC 4QL1A 3SBRA 3GREA 4PBYA 4IMMA 5EARA 4GM9A 3JZGA 2CNXA 4J77A 2QC5A 4K3JB 5IC7A 3K26A 2HYEA 5FLXg 4J81A 2Z2NA 3IIWA 2HJBA 3RRMC 2H13A 4L1QD 4BH6A 2I0TA 4J86A 1R5MA 2H68A 4TZ4A 1JMXB 3DXMC 4GGAA 4ZN4A 1TBGA 4J79A 4GQBB 4H5JA 2I3SA 5IGOA 3RFGA 5FA5B 4CY5A 3KRXB 4PSWB 3OL2B 2EBSA 4QQEA 4H5IA 4X61B 2B5MA 4D6VA 2OK6A 2YNNA 2H9PA 2J56H 1VYHC 3JRPA 2AGLA 4CY2A 2YMUA 4X63B 3UVLA 2PM7B 3VH0A 4A0AA 4YVDA 5JWZA 3EI4B 2PM9B 5EAMA 4HDJA 3GFCA 4LG8A 3FGBA 2I0RA 4Z8LA 2IUVA 3EMHA 2IUQA 3VGZA 4J82A 1P22A 2H47A 2GC7A 2P9UC 4GGDA 4G56B 4J87A 4GMBA 3RSEC 3U4YA 2P9NC 5FKSA 4QRJA 4JSNC 4J8BA 4XEIC 3MZLA 4CY1A 5SXMA 3L4OD 5CXCB 5EM2B 1MDAH 1PGUA 3JZHA 5H14A 3RFHA 4IA9A 3PXSD 4I79A 3AH8B 3AL8B 4FA4D 5HQGA 4LGNA 5CXBB 3IIYA 3SFZA 2HXCA 4FA9D 2J57G 2CO0C 4FWWA 4X60B 3NVXA 2O9KA 3JZNA 2AGYA 2CE8A 3V7DB 5IGQA 4QT8A 3CFVA 4GM8A 5HE0B 2CO0A 3A0FA 4A09B 2QXVA 4EWRA 1SQJA 3I8EA 5GXHA 2B4EA 3IJ1A 3V5WB 3BG0A 4AOWA 2MTAH 4E54A 1B9YA 3PSLA 5CYKB 1SHYB 3F3GA 4Y7RA 3DSMA 4PXWA 2OK4A 4A0BB 3C99A 4J78A 5THAA 3AFCA 3PXWD 3OTTA 4CI1A 2OVRB 2AH0A 1A0RB 3SXTD 4CI3A 3JROA 3NVQA 3PVUB 2OVPB 2AGZA 4E5ZA 4A11B 2PM6B 3C5MA 3I7NA 2IAAA 3F3FA 5TF2A 4ERYA 4ZOYA 4D0KA 2OJYA 3ULEC 4JSVC 3OKYA 3EI1A 1JMZB 3PVWB 3SVWD 3EG6A 4KFMB 5H17A 2B5LA 1K8KC 4NSXA 4FHLA 2BBKH 5FKRA 4O3TB 1ERJA 1TYQC 3V9FA 3PXTD 2Z2PA 2XYIA 3KRWB 3MXXA 3MKSB 4PBZA 1SQ9A 4GM3A 4FB1D 3I8CA 3E0CA 1U2VC 5C2WB 3C75H 5GXIA 3J81g 4A08B 2IURA 3I89A 3SMRA 2AQ5A 3SN6B 3UKRC 3DXKC 4FAVD 4BL0A 3W15A 3B7FA 4J8GA 4Y5RD 2B5NA 3I7HA 4O9DA 3EI2A 4CI8A 3EI3B 5GMKn 4JXMA 5HE1B 4A7JA 3I7LA 4FA5D 2I3TA 4L9OA 3MMYA 2P9SC 1FWXA 3PSCB 1S4UX 4ZOVA 3JAMg 4X3EA 3UVKA 2YB8B 1GOTB 1NR0A 1PEVA 2TRCB 1PBYB 4MK0B 1NEXB 2OVQB 2H9MA 2AGWA 2P9PC 4CY3A 2IWKA 3K27A 2CN2A 3N0DA 2IWFA 3UVOA 4ERZA 3OL2A 3BWSA 3IJ0A 4PSXB 2H14A 3OW8A 4AEZA 5AMSA 5HE2B 3RLMD 5HYNB 5AJAA 3AL9A 3SHFA 2HESX 2YBAA 3HFQA 3RMZD 3L4MD 3SBQA 3EI4A 2PM9A 1K32A 3C9CA 3NVNA 4A0AB 5I5JA 2CN3A 2P9LC 4U1EI 2P9KC 2GNQA 3FRXA 4GGCA 2I0SA 5EMJB 4UI9R 5HE3B 1B9XA 4ZOZA 2H9NA 1XHMA 1QNIA 2Q7QA 4JT6C 4ZOXA 2CE9A 2OIZA 3VA6A 5IT9g 5CXCA 5EM2A 4GZ8A 4PNKB 4CZVA 1N6EA 3I7OA 3I7PA 4J0WA 3AL8A 4CZXA 5EALA 4LG9A 3OKWA 1MG2A 5CXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQD A;  2AH1 A;  4U7A A;  2H6K A;  2AGX A;  4O3U B;  2HKR A;  2J55 H;  4FAN D;  2H9L A;  4ESG A;  4XYH A;  4J73 A;  4A09 A;  4JSX C;  3SWS D;  1GG2 B;  2Z2O A;  4GQ1 A;  3EU7 A;  1OLZ A;  3MKQ A;  5FKQ A;  4K3I D;  3OKT A;  4CI2 A;  5GSA A;  3ODT A;  1N6D A;  5C2V B;  5EMK B;  4OZU A;  3FM0 A;  3J80 g;  1JOF A;  2UZX B;  5EML B;  5CYK A;  3I2N A;  3SJL D;  3N0E A;  4R7A B;  3SBP A;  3ZWL B;  3DWL C;  2H6Q A;  5IJ7 E;  4PC0 A;  1XKS A;  4E54 B;  2IUP A;  3IKO A;  5H1M A;  4N14 A;  5IJ8 E;  4A0B A;  5EAP A;  3CFS B;  4J0X A;  3CIK B;  2H3X A;  4GQ2 P;  1RI6 A;  1XIP A;  3UKU C;  2YNP A;  1N6F A;  3JPX A;  1Q47 A;  2GC4 A;  3IJC A;  4A2M A;  5EMM B;  5I5I A;  4A11 A;  5FKT A;  1U4C A;  4O1Q D;  4A2L A;  4E5Z B;  3PE7 A;  1GXR A;  2G9A A;  5TEE A;  3EWE A;  4XYI A;  3MZK A;  1YFQ A;  4JD2 C;  5A2Q g;  3UVN A;  3I7K A;  3OKY B;  3RN0 D;  4FA1 D;  3EI1 B;  3ORV D;  2H6N A;  3BG1 A;  5TEF A;  3RN1 D;  4JT5 C;  4L3G D;  4ERQ A;  2HJ4 A;  3DM0 A;  5B4W A;  4ES0 A;  2W18 A;  5TDH B;  5FXY A;  2PBI B;  4O45 A;  3UR4 A;  1L0Q A;  1GP2 B;  2G99 A;  4J84 A;  3SLE D;  4A08 A;  2YNO A;  3JB9 L;  5K19 A;  4L3H D;  3SCY A;  1MG3 A;  2XU7 A;  5C9Z B;  4CC9 A;  4CZY A;  1PI6 A;  2XL3 A;  4JSP C;  5I5M A;  2BCJ B;  2XL2 A;  3EI3 A;  3UVM A;  1JJU B;  3F3P A;  4OWR A;  1OMW B;  3EI2 B;  5K1C C;  4BUJ C;  5KDO B;  3P4F A;  2UZY B;  2HKM A;  5AFU 3;  2P9I C;  4QL1 A;  3SBR A;  3GRE A;  4PBY A;  4IMM A;  5EAR A;  4GM9 A;  3JZG A;  2CNX A;  4J77 A;  2QC5 A;  4K3J B;  5IC7 A;  3K26 A;  2HYE A;  5FLX g;  4J81 A;  2Z2N A;  3IIW A;  2HJB A;  3RRM C;  2H13 A;  4L1Q D;  4BH6 A;  2I0T A;  4J86 A;  1R5M A;  2H68 A;  4TZ4 A;  1JMX B;  3DXM C;  4GGA A;  4ZN4 A;  1TBG A;  4J79 A;  4GQB B;  4H5J A;  2I3S A;  5IGO A;  3RFG A;  5FA5 B;  4CY5 A;  3KRX B;  4PSW B;  3OL2 B;  2EBS A;  4QQE A;  4H5I A;  4X61 B;  2B5M A;  4D6V A;  2OK6 A;  2YNN A;  2H9P A;  2J56 H;  1VYH C;  3JRP A;  2AGL A;  4CY2 A;  2YMU A;  4X63 B;  3UVL A;  2PM7 B;  3VH0 A;  4A0A A;  4YVD A;  5JWZ A;  3EI4 B;  2PM9 B;  5EAM A;  4HDJ A;  3GFC A;  4LG8 A;  3FGB A;  2I0R A;  4Z8L A;  2IUV A;  3EMH A;  2IUQ A;  3VGZ A;  4J82 A;  1P22 A;  2H47 A;  2GC7 A;  2P9U C;  4GGD A;  4G56 B;  4J87 A;  4GMB A;  3RSE C;  3U4Y A;  2P9N C;  5FKS A;  4QRJ A;  4JSN C;  4J8B A;  4XEI C;  3MZL A;  4CY1 A;  5SXM A;  3L4O D;  5CXC B;  5EM2 B;  1MDA H;  1PGU A;  3JZH A;  5H14 A;  3RFH A;  4IA9 A;  3PXS D;  4I79 A;  3AH8 B;  3AL8 B;  4FA4 D;  5HQG A;  4LGN A;  5CXB B;  3IIY A;  3SFZ A;  2HXC A;  4FA9 D;  2J57 G;  2CO0 C;  4FWW A;  4X60 B;  3NVX A;  2O9K A;  3JZN A;  2AGY A;  2CE8 A;  3V7D B;  5IGQ A;  4QT8 A;  3CFV A;  4GM8 A;  5HE0 B;  2CO0 A;  3A0F A;  4A09 B;  2QXV A;  4EWR A;  1SQJ A;  3I8E A;  5GXH A;  2B4E A;  3IJ1 A;  3V5W B;  3BG0 A;  4AOW A;  2MTA H;  4E54 A;  1B9Y A;  3PSL A;  5CYK B;  1SHY B;  3F3G A;  4Y7R A;  3DSM A;  4PXW A;  2OK4 A;  4A0B B;  3C99 A;  4J78 A;  5THA A;  3AFC A;  3PXW D;  3OTT A;  4CI1 A;  2OVR B;  2AH0 A;  1A0R B;  3SXT D;  4CI3 A;  3JRO A;  3NVQ A;  3PVU B;  2OVP B;  2AGZ A;  4E5Z A;  4A11 B;  2PM6 B;  3C5M A;  3I7N A;  2IAA A;  3F3F A;  5TF2 A;  4ERY A;  4ZOY A;  4D0K A;  2OJY A;  3ULE C;  4JSV C;  3OKY A;  3EI1 A;  1JMZ B;  3PVW B;  3SVW D;  3EG6 A;  4KFM B;  5H17 A;  2B5L A;  1K8K C;  4NSX A;  4FHL A;  2BBK H;  5FKR A;  4O3T B;  1ERJ A;  1TYQ C;  3V9F A;  3PXT D;  2Z2P A;  2XYI A;  3KRW B;  3MXX A;  3MKS B;  4PBZ A;  1SQ9 A;  4GM3 A;  4FB1 D;  3I8C A;  3E0C A;  1U2V C;  5C2W B;  3C75 H;  5GXI A;  3J81 g;  4A08 B;  2IUR A;  3I89 A;  3SMR A;  2AQ5 A;  3SN6 B;  3UKR C;  3DXK C;  4FAV D;  4BL0 A;  3W15 A;  3B7F A;  4J8G A;  4Y5R D;  2B5N A;  3I7H A;  4O9D A;  3EI2 A;  4CI8 A;  3EI3 B;  5GMK n;  4JXM A;  5HE1 B;  4A7J A;  3I7L A;  4FA5 D;  2I3T A;  4L9O A;  3MMY A;  2P9S C;  1FWX A;  3PSC B;  1S4U X;  4ZOV A;  3JAM g;  4X3E A;  3UVK A;  2YB8 B;  1GOT B;  1NR0 A;  1PEV A;  2TRC B;  1PBY B;  4MK0 B;  1NEX B;  2OVQ B;  2H9M A;  2AGW A;  2P9P C;  4CY3 A;  2IWK A;  3K27 A;  2CN2 A;  3N0D A;  2IWF A;  3UVO A;  4ERZ A;  3OL2 A;  3BWS A;  3IJ0 A;  4PSX B;  2H14 A;  3OW8 A;  4AEZ A;  5AMS A;  5HE2 B;  3RLM D;  5HYN B;  5AJA A;  3AL9 A;  3SHF A;  2HES X;  2YBA A;  3HFQ A;  3RMZ D;  3L4M D;  3SBQ A;  3EI4 A;  2PM9 A;  1K32 A;  3C9C A;  3NVN A;  4A0A B;  5I5J A;  2CN3 A;  2P9L C;  4U1E I;  2P9K C;  2GNQ A;  3FRX A;  4GGC A;  2I0S A;  5EMJ B;  4UI9 R;  5HE3 B;  1B9X A;  4ZOZ A;  2H9N A;  1XHM A;  1QNI A;  2Q7Q A;  4JT6 C;  4ZOX A;  2CE9 A;  2OIZ A;  3VA6 A;  5IT9 g;  5CXC A;  5EM2 A;  4GZ8 A;  4PNK B;  4CZV A;  1N6E A;  3I7O A;  3I7P A;  4J0W A;  3AL8 A;  4CZX A;  5EAL A;  4LG9 A;  3OKW A;  1MG2 A;  5CXB A; 
#chains in the Genus database with same CATH topology
 5FQD A;  2AH1 A;  4U7A A;  3K6S A;  2H6K A;  2VDO A;  2VDQ A;  2AGX A;  4O3U B;  2HKR A;  2J55 H;  1I2M B;  1H2Y A;  4FAN D;  2H9L A;  4ESG A;  4XYH A;  4J73 A;  4Z7O A;  4JSX C;  3SWS D;  1GG2 B;  2Z2O A;  4A09 A;  4GQ1 A;  2VDP A;  3EU7 A;  1OLZ A;  3MKQ A;  3QI0 A;  5FKQ A;  1JTD B;  4K3I D;  3OKT A;  4CI2 A;  1C9L A;  1TYE A;  1BPO A;  3ODT A;  5GSA A;  1N6D A;  5C2V B;  5EMK B;  4AN1 A;  4OZU A;  4G55 A;  3FM0 A;  3J80 g;  1JOF A;  2UZX B;  5EML B;  3MUO A;  5CYK A;  2WQ8 A;  3I2N A;  3SJL D;  3N0E A;  4R7A B;  3SBP A;  3ZWL B;  3DWL C;  2H6Q A;  5IJ7 E;  4PC0 A;  1XKS A;  4E54 B;  2IUP A;  3IKO A;  5H1M A;  4NBM A;  4N14 A;  5IJ8 E;  4A0B A;  5EAP A;  3CFS B;  4BCB A;  4J0X A;  3CIK B;  3IUQ A;  2H3X A;  4GQ2 P;  1RI6 A;  1XIP A;  3UKU C;  2YNP A;  5E6R A;  1N6F A;  3JPX A;  1Q47 A;  2XE4 A;  2GC4 A;  3IJC A;  4A2M A;  5EMM B;  5E6U A;  5I5I A;  4A11 A;  5FKT A;  1U4C A;  1K3I A;  4O1Q D;  4A2L A;  3GC3 B;  5C92 A;  4E5Z B;  3PE7 A;  1GXR A;  2G9A A;  5TEE A;  4D9S A;  4DNV A;  3EWE A;  4XYI A;  3MZK A;  1YFQ A;  1H2W A;  4JD2 C;  5A2Q g;  3T3P A;  3UVN A;  3I7K A;  3OKY B;  3RN0 D;  4FA1 D;  3EI1 B;  3ORV D;  2H6N A;  3BG1 A;  3OF7 A;  5TEF A;  2VZ3 A;  3RN1 D;  4JT5 C;  2VZ1 A;  4L3G D;  4ERQ A;  2HJ4 A;  3DM0 A;  5B4W A;  4ES0 A;  2W18 A;  1E5T A;  5TDH B;  5FXY A;  2PBI B;  4O45 A;  3UR4 A;  1L5G A;  1L0Q A;  1GP2 B;  2G99 A;  3IUR A;  4J84 A;  3SLE D;  3ZDZ A;  4A08 A;  2YNO A;  3JB9 L;  5K19 A;  4L3H D;  3SCY A;  1MG3 A;  2XU7 A;  5FFG A;  5C9Z B;  4O02 A;  4CC9 A;  4CZY A;  3K72 A;  1PI6 A;  2XL3 A;  4JSP C;  3IVM A;  4G1M A;  5I5M A;  4NC4 A;  2BCJ B;  1QFM A;  3GD1 I;  2XL2 A;  3EI3 A;  3UVM A;  3O4H A;  1JJU B;  3F3P A;  2VC2 A;  4OWR A;  1OMW B;  3EI2 B;  5K1C C;  4BUJ C;  5KDO B;  3P4F A;  2UZY B;  2HKM A;  5AFU 3;  3ZDY A;  5M5V A;  2P9I C;  4QL1 A;  4WK4 A;  3SBR A;  3GRE A;  3IUJ A;  4PBY A;  3MVD K;  4IMM A;  4IRZ A;  5EAR A;  4GM9 A;  3JZG A;  4L1M A;  2CNX A;  4J77 A;  2QC5 A;  4K3J B;  5IC7 A;  4MMZ A;  3K26 A;  2HYE A;  5FLX g;  4J81 A;  1U8C A;  2Z2N A;  2HU5 A;  3IIW A;  2HJB A;  3IUL A;  2H13 A;  4L1Q D;  3RRM C;  4BH6 A;  2I0T A;  4J86 A;  2VDN A;  1R5M A;  5HDB A;  2H68 A;  4TZ4 A;  1JMX B;  3DXM C;  4GGA A;  4ZN4 A;  1TBG A;  4J79 A;  4GQB B;  4H5J A;  2I3S A;  5IGO A;  3RFG A;  5M5T A;  4JHP C;  5FA5 B;  4CY5 A;  3KRX B;  4PSW B;  3OL2 B;  2EBS A;  4QQE A;  4H5I A;  4X61 B;  2B5M A;  4D6V A;  2OK6 A;  2QR5 A;  2YNN A;  2H9P A;  3JRP A;  2J56 H;  1VYH C;  2AGL A;  4CY2 A;  2YMU A;  4X63 B;  3UVL A;  2PM7 B;  3VH0 A;  4A0A A;  4Z7Q A;  4YVD A;  5JWZ A;  3EI4 B;  2PM9 B;  5EAM A;  4HDJ A;  3GFC A;  4LG8 A;  2EIB A;  3FGB A;  2I0R A;  2EIE A;  4Z8L A;  2IUV A;  3EMH A;  2IUQ A;  3VGZ A;  4J82 A;  4BP9 A;  1P22 A;  2H47 A;  2GC7 A;  2P9U C;  4GGD A;  4G56 B;  4J87 A;  4GMB A;  3RSE C;  3U4Y A;  2P9N C;  5FKS A;  4DNW A;  4QRJ A;  4JSN C;  4J8B A;  4XEI C;  3MZL A;  4CY1 A;  5SXM A;  3L4O D;  5CXC B;  4WJK A;  5EM2 B;  1MDA H;  1PGU A;  3JZH A;  1JV2 A;  5H14 A;  3O4J A;  3RFH A;  3PXS D;  4IA9 A;  4I79 A;  3AH8 B;  3AL8 B;  5M5R A;  4FA4 D;  5HQG A;  4LGN A;  5CXB B;  3IIY A;  3SFZ A;  2HXC A;  4FA9 D;  2J57 G;  2CO0 C;  3EQ9 A;  4FWW A;  4X60 B;  3NVX A;  2O9K A;  3JZN A;  2AGY A;  2CE8 A;  2HU8 A;  3V7D B;  5IGQ A;  4QT8 A;  3CFV A;  4GM8 A;  5HE0 B;  2CO0 A;  3A0F A;  4A09 B;  1VZ2 A;  4AMY A;  3ZE1 A;  2QXV A;  4EWR A;  1O6G A;  2XDW A;  3ZE2 A;  1SQJ A;  3I8E A;  5GXH A;  2B4E A;  4AX4 A;  3IJ1 A;  3NID A;  3V5W B;  2EID A;  2BKL A;  3BG0 A;  4AOW A;  2MTA H;  4E54 A;  1B9Y A;  4NEN A;  3PSL A;  5CYK B;  1SHY B;  3F3G A;  4Y7R A;  3DSM A;  4PXW A;  2OK4 A;  3K71 A;  4A0B B;  3C99 A;  4J78 A;  5THA A;  3AFC A;  3PXW D;  3OTT A;  4CI1 A;  4G1E A;  3QHY B;  2OVR B;  2AH0 A;  1A0R B;  4UM9 A;  3SXT D;  4CI3 A;  3JRO A;  3NVQ A;  3PVU B;  4WK2 A;  2OVP B;  4BCD A;  2AGZ A;  2VDR A;  4E5Z A;  1C9I A;  4A11 B;  2PM6 B;  3T3M A;  3C5M A;  3I7N A;  2IAA A;  3F3F A;  5TF2 A;  4ERY A;  4ZOY A;  2VDK A;  3NIF A;  4D0K A;  2OJY A;  3ULE C;  4JSV C;  3OKY A;  3EI1 A;  1JMZ B;  3PVW B;  5C86 A;  3SVW D;  1T2X A;  3EG6 A;  1VE7 A;  3IUN A;  3EQ8 A;  4KFM B;  1UOP A;  5FFO A;  5H17 A;  1UTC A;  1GOF A;  4BP8 A;  2VDM A;  2B5L A;  1K8K C;  4O2W A;  3VI4 A;  4NSX A;  3ZDX A;  3O4I A;  4FHL A;  2BBK H;  4Z7N A;  5FKR A;  1ERJ A;  1TYQ C;  2VDL A;  4O3T B;  3V9F A;  3PXT D;  2JKX A;  1GOH A;  2XYI A;  2Z2P A;  3KRW B;  5M61 A;  3MXX A;  3MKS B;  4PBZ A;  5E6S A;  1M1X A;  1SQ9 A;  4GM3 A;  4FB1 D;  4AMZ A;  3I8C A;  1E8N A;  3E0C A;  1GOG A;  1U2V C;  4WK0 A;  3VI3 A;  5C2W B;  3C75 H;  5GXI A;  3J81 g;  1H2Z A;  2EIC A;  4A08 B;  2IUR A;  5M5U A;  3I89 A;  3SMR A;  2AQ5 A;  3SN6 B;  3UKR C;  3DXK C;  4RE6 A;  4FAV D;  3O4G A;  3MUN A;  3B7F A;  3W15 A;  4BL0 A;  4J8G A;  4UM8 A;  4Y5R D;  3NIG A;  2B5N A;  3I7H A;  3IUM A;  4O9D A;  4BCC A;  4NAA A;  3EI2 A;  4CI8 A;  3EI3 B;  1YR2 A;  5GMK n;  4MMY A;  4JXM A;  5HE1 B;  4A7J A;  3I7L A;  4FA5 D;  2I3T A;  3DDU A;  4L9O A;  3EQ7 A;  3MMY A;  2P9S C;  1FWX A;  3KCI A;  3PSC B;  1S4U X;  4ZOV A;  3JAM g;  4X3E A;  3UVK A;  4RE5 A;  2YB8 B;  1GOT B;  1NR0 A;  1PEV A;  1VZ3 A;  2TRC B;  1PBY B;  4MK0 B;  1NEX B;  2OVQ B;  2H9M A;  2AGW A;  2P9P C;  4CY3 A;  1O6F A;  2IWK A;  4DNU A;  2XZG A;  1E8M A;  3K27 A;  2CN2 A;  3N0D A;  2IWF A;  3UVO A;  4ERZ A;  4QAM A;  3OL2 A;  3BWS A;  3IJ0 A;  4PSX B;  2H14 A;  3OW8 A;  4AEZ A;  3V4P A;  5AMS A;  5HE2 B;  3RLM D;  5HYN B;  4JHN A;  3AL9 A;  5AJA A;  3SHF A;  1VE6 A;  2HES X;  3ZE0 A;  3FCU A;  3IJE A;  2YBA A;  3HFQ A;  3FCS A;  3RMZ D;  1UOO A;  1QFS A;  3L4M D;  3SBQ A;  4AN0 A;  3EI4 A;  2PM9 A;  1K32 A;  3C9C A;  3NVN A;  4A0A B;  2HU7 A;  5I5J A;  2CN3 A;  2P9L C;  4U1E I;  2QZP A;  2P9K C;  2GNQ A;  3FRX A;  4GGC A;  2I0S A;  5EMJ B;  4UI9 R;  1UOQ A;  5HE3 B;  1B9X A;  4ZOZ A;  2H9N A;  1XHM A;  1QNI A;  2Q7Q A;  4JT6 C;  4ZOX A;  2CE9 A;  2OIZ A;  1H2X A;  3VA6 A;  5IT9 g;  5CXC A;  5M5S A;  4MMX A;  5EM2 A;  4GZ8 A;  4PNK B;  4CZV A;  1N6E A;  3I7O A;  3I7P A;  4J0W A;  3AL8 A;  4CZX A;  5EAL A;  4LG9 A;  3OKW A;  1A12 A;  1MG2 A;  5CXB A;  3V4V A; 
#chains in the Genus database with same CATH homology
 5FQD A;  2AH1 A;  4U7A A;  2H6K A;  2AGX A;  4O3U B;  2HKR A;  2J55 H;  4FAN D;  2H9L A;  4ESG A;  4XYH A;  4J73 A;  4A09 A;  4JSX C;  3SWS D;  1GG2 B;  2Z2O A;  4GQ1 A;  3EU7 A;  1OLZ A;  3MKQ A;  5FKQ A;  4K3I D;  3OKT A;  4CI2 A;  5GSA A;  3ODT A;  1N6D A;  5C2V B;  5EMK B;  4OZU A;  3FM0 A;  3J80 g;  1JOF A;  2UZX B;  5EML B;  5CYK A;  3I2N A;  3SJL D;  3N0E A;  4R7A B;  3SBP A;  3ZWL B;  3DWL C;  2H6Q A;  5IJ7 E;  4PC0 A;  1XKS A;  4E54 B;  2IUP A;  3IKO A;  5H1M A;  4N14 A;  5IJ8 E;  4A0B A;  5EAP A;  3CFS B;  4J0X A;  3CIK B;  2H3X A;  4GQ2 P;  1RI6 A;  1XIP A;  3UKU C;  2YNP A;  1N6F A;  3JPX A;  1Q47 A;  2GC4 A;  3IJC A;  4A2M A;  5EMM B;  5I5I A;  4A11 A;  5FKT A;  1U4C A;  4O1Q D;  4A2L A;  4E5Z B;  3PE7 A;  1GXR A;  2G9A A;  5TEE A;  3EWE A;  4XYI A;  3MZK A;  1YFQ A;  4JD2 C;  5A2Q g;  3UVN A;  3I7K A;  3OKY B;  3RN0 D;  4FA1 D;  3EI1 B;  3ORV D;  2H6N A;  3BG1 A;  5TEF A;  3RN1 D;  4JT5 C;  4L3G D;  4ERQ A;  2HJ4 A;  3DM0 A;  5B4W A;  4ES0 A;  2W18 A;  5TDH B;  5FXY A;  2PBI B;  4O45 A;  3UR4 A;  1L0Q A;  1GP2 B;  2G99 A;  4J84 A;  3SLE D;  4A08 A;  2YNO A;  3JB9 L;  5K19 A;  4L3H D;  3SCY A;  1MG3 A;  2XU7 A;  5C9Z B;  4CC9 A;  4CZY A;  1PI6 A;  2XL3 A;  4JSP C;  5I5M A;  2BCJ B;  2XL2 A;  3EI3 A;  3UVM A;  1JJU B;  3F3P A;  4OWR A;  1OMW B;  3EI2 B;  5K1C C;  4BUJ C;  5KDO B;  3P4F A;  2UZY B;  2HKM A;  5AFU 3;  2P9I C;  4QL1 A;  3SBR A;  3GRE A;  4PBY A;  4IMM A;  5EAR A;  4GM9 A;  3JZG A;  2CNX A;  4J77 A;  2QC5 A;  4K3J B;  5IC7 A;  3K26 A;  2HYE A;  5FLX g;  4J81 A;  2Z2N A;  3IIW A;  2HJB A;  3RRM C;  2H13 A;  4L1Q D;  4BH6 A;  2I0T A;  4J86 A;  1R5M A;  2H68 A;  4TZ4 A;  1JMX B;  3DXM C;  4GGA A;  4ZN4 A;  1TBG A;  4J79 A;  4GQB B;  4H5J A;  2I3S A;  5IGO A;  3RFG A;  5FA5 B;  4CY5 A;  3KRX B;  4PSW B;  3OL2 B;  2EBS A;  4QQE A;  4H5I A;  4X61 B;  2B5M A;  4D6V A;  2OK6 A;  2YNN A;  2H9P A;  2J56 H;  1VYH C;  3JRP A;  2AGL A;  4CY2 A;  2YMU A;  4X63 B;  3UVL A;  2PM7 B;  3VH0 A;  4A0A A;  4YVD A;  5JWZ A;  3EI4 B;  2PM9 B;  5EAM A;  4HDJ A;  3GFC A;  4LG8 A;  3FGB A;  2I0R A;  4Z8L A;  2IUV A;  3EMH A;  2IUQ A;  3VGZ A;  4J82 A;  1P22 A;  2H47 A;  2GC7 A;  2P9U C;  4GGD A;  4G56 B;  4J87 A;  4GMB A;  3RSE C;  3U4Y A;  2P9N C;  5FKS A;  4QRJ A;  4JSN C;  4J8B A;  4XEI C;  3MZL A;  4CY1 A;  5SXM A;  3L4O D;  5CXC B;  5EM2 B;  1MDA H;  1PGU A;  3JZH A;  5H14 A;  3RFH A;  4IA9 A;  3PXS D;  4I79 A;  3AH8 B;  3AL8 B;  4FA4 D;  5HQG A;  4LGN A;  5CXB B;  3IIY A;  3SFZ A;  2HXC A;  4FA9 D;  2J57 G;  2CO0 C;  4FWW A;  4X60 B;  3NVX A;  2O9K A;  3JZN A;  2AGY A;  2CE8 A;  3V7D B;  5IGQ A;  4QT8 A;  3CFV A;  4GM8 A;  5HE0 B;  2CO0 A;  3A0F A;  4A09 B;  2QXV A;  4EWR A;  1SQJ A;  3I8E A;  5GXH A;  2B4E A;  3IJ1 A;  3V5W B;  3BG0 A;  4AOW A;  2MTA H;  4E54 A;  1B9Y A;  3PSL A;  5CYK B;  1SHY B;  3F3G A;  4Y7R A;  3DSM A;  4PXW A;  2OK4 A;  4A0B B;  3C99 A;  4J78 A;  5THA A;  3AFC A;  3PXW D;  3OTT A;  4CI1 A;  2OVR B;  2AH0 A;  1A0R B;  3SXT D;  4CI3 A;  3JRO A;  3NVQ A;  3PVU B;  2OVP B;  2AGZ A;  4E5Z A;  4A11 B;  2PM6 B;  3C5M A;  3I7N A;  2IAA A;  3F3F A;  5TF2 A;  4ERY A;  4ZOY A;  4D0K A;  2OJY A;  3ULE C;  4JSV C;  3OKY A;  3EI1 A;  1JMZ B;  3PVW B;  3SVW D;  3EG6 A;  4KFM B;  5H17 A;  2B5L A;  1K8K C;  4NSX A;  4FHL A;  2BBK H;  5FKR A;  4O3T B;  1ERJ A;  1TYQ C;  3V9F A;  3PXT D;  2Z2P A;  2XYI A;  3KRW B;  3MXX A;  3MKS B;  4PBZ A;  1SQ9 A;  4GM3 A;  4FB1 D;  3I8C A;  3E0C A;  1U2V C;  5C2W B;  3C75 H;  5GXI A;  3J81 g;  4A08 B;  2IUR A;  3I89 A;  3SMR A;  2AQ5 A;  3SN6 B;  3UKR C;  3DXK C;  4FAV D;  4BL0 A;  3W15 A;  3B7F A;  4J8G A;  4Y5R D;  2B5N A;  3I7H A;  4O9D A;  3EI2 A;  4CI8 A;  3EI3 B;  5GMK n;  4JXM A;  5HE1 B;  4A7J A;  3I7L A;  4FA5 D;  2I3T A;  4L9O A;  3MMY A;  2P9S C;  1FWX A;  3PSC B;  1S4U X;  4ZOV A;  3JAM g;  4X3E A;  3UVK A;  2YB8 B;  1GOT B;  1NR0 A;  1PEV A;  2TRC B;  1PBY B;  4MK0 B;  1NEX B;  2OVQ B;  2H9M A;  2AGW A;  2P9P C;  4CY3 A;  2IWK A;  3K27 A;  2CN2 A;  3N0D A;  2IWF A;  3UVO A;  4ERZ A;  3OL2 A;  3BWS A;  3IJ0 A;  4PSX B;  2H14 A;  3OW8 A;  4AEZ A;  5AMS A;  5HE2 B;  3RLM D;  5HYN B;  5AJA A;  3AL9 A;  3SHF A;  2HES X;  2YBA A;  3HFQ A;  3RMZ D;  3L4M D;  3SBQ A;  3EI4 A;  2PM9 A;  1K32 A;  3C9C A;  3NVN A;  4A0A B;  5I5J A;  2CN3 A;  2P9L C;  4U1E I;  2P9K C;  2GNQ A;  3FRX A;  4GGC A;  2I0S A;  5EMJ B;  4UI9 R;  5HE3 B;  1B9X A;  4ZOZ A;  2H9N A;  1XHM A;  1QNI A;  2Q7Q A;  4JT6 C;  4ZOX A;  2CE9 A;  2OIZ A;  3VA6 A;  5IT9 g;  5CXC A;  5EM2 A;  4GZ8 A;  4PNK B;  4CZV A;  1N6E A;  3I7O A;  3I7P A;  4J0W A;  3AL8 A;  4CZX A;  5EAL A;  4LG9 A;  3OKW A;  1MG2 A;  5CXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...