3UVPA

Human p38 map kinase in complex with a benzamide substituted benzosuberone
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Targeting the Hinge Glycine Flip and the Activation Loop: Novel Approach to Potent p38 alpha Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 106
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvpA01
2BHEA 3IW4A 2R3HA 2PVMA 4RLKA 1YI6A 4XG6A 2VTPA 4LUDA 4RFYA 5B2KA 3NIZA 4LMNA 5EI8A 4CXAA 1PKGA 3OBGA 5JFXA 4HVSA 3V8TA 4TL0A 4K8AA 5GIOE 5TOZA 2YEXA 2G2FA 3ORPA 3KRJA 4FSNA 3FMMA 3QAME 3OEFX 3POOA 4BTMA 5AUYA 2HWOA 4O6LA 3R9HA 4XJ0A 2QU5A 4X7QA 4ERWA 2HYYA 4G34A 2YDIA 2YJSA 2UUEA 4CFMA 4RIXB 1KOAA 4N57A 4EOKA 4O27B 3V5LA 4O0VA 2VX0A 3M11A 4F1OA 3V6SA 2W9FB 2R3JA 2PE1A 4BTKA 2IJMA 3JR1A 2C1BA 3P23A 4JOAA 4G6NA 4PP9A 2C5OA 3FMEA 1MRUA 3ZUUA 4CMUA 4EORA 3VS2A 4FOBA 2EXEA 4YR8A 2WXVA 4TT7A 2B0QA 1ZMWA 1PMUA 2VD5A 3T9TA 1H26A 3F2AA 3QGYA 4XOYA 5HBHA 5JGBA 5M55A 1KUTA 1UU7A 2HY0A 4FKRA 3OHTA 1URWA 2BZJA 5CT7A 3DA6A 3NGAA 5IA5A 3GUBA 4E1ZA 5AEPA 1PXPA 3Q9ZA 4KIQA 4O0SA 1WBOA 4J71A 2YIXA 2GQSA 3C0GA 4YU2A 2E9UA 5HIEA 4KRDA 4F64A 4MXXA 3MIYA 4QQ5A 4GL9A 3Q5ZA 3MVLA 4KS7A 2X8IA 5KMLA 2W4KA 4FUYA 4H1JA 4GU6A 3A4OX 3TNIA 5L6OA 2X2MA 4NH1A 4ERKA 5BPYA 4PRJA 1FMKA 1ZZ2A 3RHKA 1H01A 3R8UA 3HUBA 1J1BA 1YWNA 1FMOE 3GOPA 4BI2A 2GFCA 1LPUA 3LXNA 3HL7A 4JT3A 4RVTA 3NAYA 4FI1A 3ZFXA 5IUGA 3CY3A 4FV3A 4I0TA 4V01A 2IW8A 3TI1A 3GB2A 3EQHA 5BUEA 2BR1A 3VUHA 3I7BA 3FC2A 3UQGA 3I0OA 1JKLA 3CE3A 3V01A 4D55A 4EQMA 3IW8A 5HX6A 5HE3A 5I3RA 3PSBA 1Y8GA 4D1XA 4IAFA 5LVOA 2J6MA 3PXQA 3CQEA 3CPBA 3QUEA 4BIEA 4ZLZA 3LCDA 4E4LA 4D2WA 2WGJA 2WMUA 2JITA 3PY1A 2EXMA 5E8YA 4BI0A 3ORXA 3NX8A 3FQSA 2OK1A 3CCNA 3FMNA 4H3QA 4RWJA 3S2PA 5DPVA 4EYJA 2HENA 3PE1A 2IW6A 5EHYA 3VF9A 4GMYA 4QTAA 3AC1A 3H0ZA 4AW2A 2UW8A 4KB8A 3P9JA 4IVCA 4P5QA 2PSQA 3DKFA 3G90X 4V0GB 2ZOQA 4A4XA 5DMZA 2QLQA 5JGAA 4OW8A 4EH7A 4D9TA 5CY3A 4JL9A 4AN9A 4NSTA 4CCBA 3ROYA 3QWKA 3PJ1A 2G1TA 1EH4A 3BX5A 3NUAA 4D0XA 4ASDA 4O0TA 4ZTQA 3R9OA 3W32A 4RFZA 4RIWB 4QPMA 2QONA 2XBAA 3AMAA 4I0RA 4BHNA 5IEVA 3E8CA 3IK3A 1CDKA 4Q2AA 3W1FA 4UMQA 3BYMA 4QMTA 4P5ZA 4ANQA 3E8NA 3KXMA 3SW7A 5FDPA 3OD6X 4EEVA 3EIDA 2A1AB 2BTRA 3MYGA 4YSMA 5AUZA 3DB6A 3CC6A 4BIDA 2OG8A 2XZSA 1KE8A 3G6HA 3EFLA 1YI3A 5CS6A 3Q2JA 1RDQE 1H0WA 3T8OA 2ZV7A 3BQCA 1REJA 1YXSA 4MCVA 3MESA 3GENA 4UMRA 5I0BA 4O7WA 2UZLA 3GEQA 5HCZA 2B54A 2BIYA 1Y6AA 2G9XA 2YLFA 3E63A 3LFDA 3VW6A 2VTQA 4PDOA 3LCKA 4C2VA 5CSVA 2PMIA 2BIKB 4L6QA 4MNFA 5FG8A 4RIXA 2W1FA 4PDSA 4C4GA 3VO3A 4BDJA 5AV4A 2CCIA 2Q83A 4P4CA 3SG9A 2YDKA 3OT3A 1F5QA 3BLHA 3UQCA 3BHTA 4FNWA 4GSBA 4EH6A 3D5UA 4F9AA 3O0GA 3PRFA 5CQWA 2JAVA 3QKLA 3LM5A 4ZTMA 3RAHA 3TTJA 2JFLA 3TEIA 1Y8YA 4U41A 3DXQA 3C4XA 4KKEA 1FQ1B 2ZYBA 3SKCA 3JY9A 2XUUA 3C0IA 4D5HA 5KZIA 4M69B 4EH8A 4GYGA 5L3AA 4J1RA 3NYOA 2VNWA 3BHHA 4IC8A 1PXOA 5E8UA 3JXWA 1TQMA 5CU3A 2J90A 3OWLA 4C35A 4ID7A 3HLLA 1YWRA 3QD0A 4U40A 1JPAA 2W0JA 1NXKA 1KOBA 1Q8TA 3QTUA 4ASEA 5FTQA 3VWAA 1OITA 2R3IA 4OTGA 5K0XA 5FUTA 3KMWA 3OXZA 3ZEWA 2W17A 5EOBA 3LVPA 3QQKA 1PXMA 3H9RA 4FTLA 4OTFA 4ZJVA 3AGLA 3FI4A 4QNAA 3LJ0A 2UVZA 3R1NA 3MA6A 4LI5A 3EQBA 2ETKA 2J4ZA 2XA4A 2JAMA 2JLDA 4GUEA 4MEDA 4U7ZA 5CT0A 4DAWA 3W2PA 2BKKA 3WF5A 4M0ZA 3QRIA 4DH8A 4S2ZA 4Y83A 4FE2A 2GNLA 5J1VA 4C0TA 3DZOA 5CF8A 4FT7A 4U9AA 3F7ZA 2C0TA 3V6RA 2W96B 2OFUA 3RK9A 4YZDA 1G3NA 1YXUA 3BE2A 3LXKA 3BHYA 4UYNA 2ITYA 4J97A 4YLLA 5AV1A 5IMXA 3BLQA 2I0VA 3EQDA 1VR2A 3F3VA 2J0KA 4F09A 4HJOA 5LCKA 5KBQA 4QP9A 3G2FA 3TIYA 4AT3A 3LJ1A 3V5PA 4HYUA 4ZZNA 3NUUA 4XV3A 5KMMA 1YXTA 4UBAA 3ZOSA 2IVTA 4DLJA 4L45A 1H1RA 1WAKA 4IVBA 3I0QA 5D9HA 5CF6A 3VQHA 4I6BA 5HLWA 3ITZA 1PXJA 3SV0A 5M51A 1DI8A 1REKA 4AN2A 3U4UA 4NYEA 2JBPA 2WIHA 3R01A 1IEPA 2R3PA 3KULB 4RSSA 5EDRA 3TM0A 2O3PA 3FAAA 2YIYA 3TNPC 1M2PA 4AGCA 5A4QA 1OL5A 1H24A 4UWYA 1PMVA 2ZM1A 3IONA 2C5NA 5CSHA 3RM6A 3ZC5A 4DBXA 2R0UA 2Z7SA 4JBQA 1WBTA 4ENXA 2Y4IC 3MGYA 3AC4A 2PMOX 3I5NA 2JIIA 4MF1A 5EI6A 3NNUA 5KKRB 3KXNA 2RFSA 5E7RA 3FBVA 3E62A 1JSUA 1WVWA 4BWKA 5C8NA 3BKBA 3LCSA 3L9LA 5FM3A 4ZTHA 2JDSA 3QXOA 5FWKK 2EVAA 4AFJA 2X6DA 2Y4IB 1DS5A 4XCUA 3BWJA 3Q32A 4FL3A 3UOHA 5E1EA 1GAGA 3ZCLA 3EB0A 5IF1A 4F7NA 3LFQA 4FTMA 3TCPA 4ZTNA 4I5PA 1XR1A 3HRBA 4EK4A 3MBLA 3EN4A 1W0XC 4USFA 3UO5A 4J95A 4DFYA 3KXZA 4C59A 1DAYA 3EMGA 4CYIA 2Y9QA 5J79A 4EJ7A 3HMPA 4FSTA 3DK3A 4X2NA 5TT7A 1Q62A 5BQ0A 5HD4A 4LRKA 5IA2A 4CRSA 5HG7A 3S1HA 4QP6A 2W5BA 3O8TA 4NJ3A 1ZMVA 5EHLA 2PU8A 4FNYA 3G0FA 4QYHA 4FYOA 4YHJA 1NVRA 4KBKA 5AP4A 3UP7A 3Q3BA 2GFSA 4CKIA 3R8VA 1M2RA 2JKOA 4E26A 2Z7QA 5JFVA 4DTAA 3F7WA 2C1AA 3MFRA 4E6DA 2VRXA 5FBOA 3ORIA 4ZJIA 3QTXA 1JBPE 2C3KA 3A8WA 5JEBA 2BAQA 4U3ZA 1LEZA 4D4RA 3ZMMA 3AC3A 3ATTA 1Q97A 5FRIA 5AA9A 2F57A 2V22A 5CU4A 2YM7A 3OS3A 4PPBA 5EM6A 4X2KA 3QD4A 3R6XA 1AD5A 3R8PA 3R9DA 4ZMFA 3PPJA 5GZ9A 4YUQA 2OXYA 4V04A 3OBJA 3E8EA 3QCSA 4NU1A 5K4IA 2IZRA 1ZYDA 2OI4X 3R02A 4PMTA 4R5YA 4Y5QA 5EG3A 3NW7A 4JAIA 4O7SA 3KRRA 3MWUA 4QYYA 1V0BA 2R3RA 2ZM4A 4GT5A 4TWCA 1JVPP 3LMHA 4U42A 3NIEA 3VUTA 3EH9A 1KWPA 4NW5A 3ZC6A 3MH2A 3UP2A 3NSZA 5KUPA 5FXSA 2C6TA 1FGIA 3O23A 3D7TA 2J51A 4A9SA 2XNBA 4E4NA 1UKHA 2F7EE 1M52A 4O7RA 3UG2A 4DGLC 3P4KA 3E7VA 3GOKA 1L8TA 2CMWA 4U3YA 3ZS5A 4IJPA 5BMMA 4JQ7A 2WMVA 5AAEA 2FSTX 5IH4A 2LAVA 2I0YA 2PUUA 3Q6WA 3RINA 4FR4A 3CS9A 3E93A 5IPJA 1IA9A 2QR7A 1SVHA 2C47A 2YAKA 3FYJX 1QPCA 4H3PA 5EOLA 2CSNA 2HELA 5LMAA 2V7AA 4NIFB 2UZVA 4MTAA 3DCVA 4G31A 5HESA 4UY9A 3R30A 3T9IA 2XRWA 3OCBA 3UE4A 5H9BA 4ZTRA 5AV0A 5AFVA 4EOOA 4L3LA 3PVGA 3VC4A 3EN7A 4BDIA 5DFPA 1BUHA 3D15A 1Z9XA 2WQEA 5GJFA 4MD9E 3U9NA 5TF9A 4IXPA 4BYJA 5BVNA 3Q52A 4O7TA 5AADA 2X4FA 5CF5A 4D4YA 4XHKB 4O1OA 4CV8A 3RM7A 5DRBA 5HU9A 1KE7A 3VN9A 4IWOA 2WPAA 3OW4A 3S3IA 2ERKA 3KULA 3OMVA 3OXTA 4U44A 3ZTXA 2X2LA 2P0CA 4WUNA 5M4IA 5HOAA 4C4IA 3KB7A 5GINE 1CM8A 2E9PA 4FZFB 2WEIA 3NUNA 4H36A 3FC1X 3V5WA 2UZEA 3ZUVA 3HZTA 1DM2A 1FVVA 1W83A 3R7OA 2UW7A 4BBFA 1PRYA 4OBOA 4AE9A 4L7FA 2O5KA 4IAZA 4QMZA 3DJ5A 4M13A 4RZWA 1H8FA 3F3TA 3R8LA 3AD5A 1HCLA 4E4XA 4W8EA 4O0UA 2WQNA 3NVKI 3Q6UA 3SD0A 2BRHA 5FBNC 5AAGA 3KF4A 2QOIA 3QC9A 3QTWA 1ERKA 3M2WA 2JGZA 4F4PA 2UV2A 2IPXA 2W1GA 1BX6A 3NUPA 3NEWA 3PY3A 2YA9A 4HPUE 5EQYA 2BALA 4X2FA 1Q41A 4C57A 3ZLXA 4MH7A 3PY0A 1UNLA 3NYVA 3DTWA 5M08A 1XHAA 2C30A 4ANOA 4E6AA 3SGCA 2QHNA 1PF8A 2QOHA 4D9UA 5CAQA 4TXCA 4ACGA 3TJDA 1OI9A 2ITZA 4DH3A 3MV5A 4ZSLA 3OWPA 3VBXA 2R3KA 2XH5A 2RSVA 3EFJA 4BDCA 4YHTA 3RAWA 1ZYCA 5AAFA 3DQXA 4C4FA 5BYYA 2VTSA 5AP7A 4ENYA 3DZQA 3MPMA 3VUIA 5HE1A 4MVFA 3UDBA 3COHA 3ENMA 3MJ2A 2XJ0A 2OLCA 4DE4A 5AIRA 1OZ1A 4MX9A 4D2RA 3PG1A 4EQUA 4C33A 3HA6A 1W84A 4JX3A 5AX3A 4IANA 4BDDA 3KREA 2C5XA 3FZTA 3LQ5A 5JSMA 3MTFA 3W2OA 3BEAA 1UNHA 3BV2A 4JS8A 2YACA 3HV4A 4MD8E 2PVFA 2XIRA 4GJ2A 4RWLA 2BHHA 1OL6A 4FKJA 5KHXA 5D7VA 1R39A 4IFCA 4IE9A 5J9ZA 5FP5A 5IQBA 5FXQA 1S9JA 3E88A 5H3QA 1Q61A 2YM4A 4PDPA 4YPDA 2HAKA 5FD2A 4IZAA 3UZTA 5ANDA 3GFWA 3TDWA 2W99B 3M42A 3DNDA 4C2WA 5BYLA 4BCGA 4NFNA 5JRSA 4FTJA 4FIJA 3OG7A 1Q8WA 4DFZE 3P79A 2RFDA 3ORLA 3ZBFA 4KINA 3COMA 2OFVA 4EUUA 2XKFA 3LLAA 3QF9A 4NJDA 3FMJA 4M67A 4FIEA 5J5SA 2XS0A 2ITVA 4TYIA 4FTQA 3C50A 4PQNA 3I4BA 3LW0A 4UMTA 3VS7A 4CMTA 1ZARA 2ZB0A 5AWMA 4EZ7A 2WQOA 4F99A 4GV1A 2ZJWA 4JAJA 2R3MA 1ZMUA 1H4LA 1G8AA 3SOCA 3R00A 1ZZLA 5A4EA 1QPJA 4K11A 1J7IA 4BDKA 4WSYA 3ENHA 4DFNA 3LFBA 4AZVA 2UZBA 3PLSA 5DNRA 5E8WA 3DBQA 3R04A 4IEBA 4EOSA 4HVIA 2GHLA 1S9IA 4FZDB 1UU9A 2A4LA 4F1MA 2UW9A 3ZLYA 3Q5IA 4NCTC 2YCFA 3ZEPA 2X7FA 3BGQA 3UYTA 2P2HA 3QGWA 3Q96A 2PE0A 3L8VA 4FKLA 3PPZA 3KVXA 3WYYA 4AOJA 1OPLA 4BCNA 3HRCA 3V5JA 4BC6A 4X6RA 3KGAA 4Y73A 4WT6A 4YTIA 4GEOA 3QBNA 4XP2A 5HG9A 3EKKA 3CD8A 4YZ9A 3BELA 2XKEA 3WILA 4B6LA 2VWVA 3AC2A 3D9VA 3ZZEA 1O6YA 3IQ7A 1XH9A 4MNEA 1AQ1A 2UZUE 3FZOA 4TYJA 4H3BA 5E8ZA 3DJ6A 2V62A 5TE0A 5LVNA 3IECA 4RJ6A 2XM8A 3NWWA 5IEXA 3FHIA 1WZYA 3ZSIA 3P1AA 4FG9A 1K2PA 1ZRZA 2YZAA 1W82A 1H25A 4HGLA 4EK5A 3MY1A 4Z16A 3T3VA 4ZZOA 3AT4A 4ITJA 5I9VA 3HDNA 4W8DA 4XH6A 3ZRKA 4H39A 4CYJA 2Z02A 2YLEA 3PVBA 2BZIB 1QPDA 3SG8A 2VTRA 3F5PA 4EKLA 2P2IA 4QMVA 3VS3A 3AMYA 4FZ6A 3Q9YA 4RVKA 2GTMA 5AV2A 3F66A 4FG8A 4FKWA 4JBPA 4QMNA 2R4BA 4BCHA 4Z7GA 5HIBA 2VO7A 3HV7A 2YCQA 2C6LA 4PNIA 2HXQA 2ZB1A 3IDCA 4UXQA 5I3OA 1Q3WA 2QG5A 4O1PA 4GFMA 2ZV2A 3LAUA 2F49A 4K2RA 3ORZA 1WFCA 4EONA 4O6EA 4ACHA 1GNGA 3WE8A 1VZOA 5GZAA 4CGAA 3A7HA 2GTNA 4BZOA 3F88A 3U51A 3TNWA 2FH9A 1Q8YA 2CJMA 4L9IA 5CANA 3A7JA 3GGFA 1NY3A 4WNKA 2J7TA 2B55A 2VWWA 4U43A 4NFMA 4GIIA 3PSDA 3TDVA 2ITTA 4M97A 3WE4A 4USEA 1K9AA 2C6OA 3EQPA 5EYMA 4FF8A 3VRZA 5LMKC 2Q0BA 2ITPA 3CXWA 1T45A 3DBCA 4O21A 2BDWA 1ND4A 2BMCA 3HMOA 2OKRA 4ZXTA 4FT9A 2PVHA 4BICA 4IZYA 1JWHA 4RWKA 3VRYA 4FKGA 5HKMA 2HZIA 1SNXA 2YN8A 4XNEA 3OVVA 3B8RA 3QCXA 3ODYX 3RPOA 3QC4A 4FK6A 4EI4A 2OZAB 3BYUA 3ZDIA 2ITNA 5BVKA 4GCJA 3PP1A 5A4TA 3VS0A 1FVTA 4XG2A 4BGGA 3RP9A 5HO7A 4KAOA 4BGHA 4KIOA 4MQ1A 5AP2A 3W10A 3I60A 4L53A 4EH9A 4RVLA 1ZOGA 4CKJA 4RJ5A 5AR7A 3E8DA 4I3ZA 4X0MA 3LZBA 3FMHA 2UW0A 4X3FA 3CPCA 3E87A 2PULA 3BHVA 2IZSA 2BPMA 3Q4UA 1IAJA 3QHWA 1H27A 2XK8A 2IVUA 1QPEA 3LMGA 3OTVA 4D1ZA 3U54A 1OGUA 2F9GA 2O63A 2F7XE 2WTVA 3PUPA 3VBWA 4ORKA 5M07A 4OLIA 4D5KA 2NPQA 4NUSA 4HVDA 2C3JA 3F2RA 2PZ5A 1XBCA 4JG6A 4H05A 3I6WA 5CYIA 5C27A 4DGOA 3RNYA 3FLQA 2X0GA 5L8KA 3O17A 5ANIA 2W4JA 3MS9A 2F2CB 3IGGA 3OCGA 1GIIA 5HICA 2O65A 3EHAA 1VYWA 4GG7A 4FKTA 4J96A 3TN8A 3HEGA 3PIZA 4O96A 3DBFA 4YJQA 4AGDA 2Z60A 5IA1A 5CNOA 2HOGA 2HXLA 5FEDA 2CGXA 4E6QA 4R8QA 2A27A 4ACCA 4FKVA 4LGDA 4FTUA 5IDNA 5CEPA 2WOTA 2VZ6A 2PK9A 1JAMA 4I20A 2FB8A 1B39A 3ULIA 4MAOA 5CAUA 3AOXA 5CAOA 1JNKA 1K3AA 1R78A 4WNMA 5FTOA 1VYZA 2C5YA 4TYHB 4FV5A 2O2UA 3IW7A 4L3PA 4AN3A 4JQEA 1FINA 2XKCA 4CZUA 5HG5A 4AW0A 4E3CA 3UNKA 3R1YA 4TTHB 4XG7A 2WTKC 4AGWA 4BZNA 4RJ4A 3E3PA 2BAJA 3NYXA 5C4KA 3GU5A 3UTOA 1A06A 2VO6A 1WVXA 3IW6A 4KABA 3QYWA 2B7AA 2OU7A 4LV8A 2ZAZA 2QO2A 4QMSA 3UO4A 3CQWA 3K54A 2W1HA 3RCDA 3W16A 5KMNA 3R0TA 4RIYB 1U54B 4HPTE 2OICA 4YZMA 3THBA 5D12A 2YCRA 3FZSA 3FI8A 2WTKB 4LRMA 3QQGA 5DYJA 2XJ1A 4Z3VA 3C51A 3QRTA 5FM2A 1XBAA 5C4LA 5HORA 1ZY5A 5LXMA 4L43A 3D2IA 4FSWA 4EBWA 2V7OA 2W5HA 4C8BA 3OOGA 3G5DA 4F7SA 5IMEA 4PY1A 1QCFA 4FTRA 3QFVA 5BVDA 1TQPA 2H96A 4B99A 4Q9SA 3VJNA 4JI9A 5ANKA 4GK3A 1VEBA 5J87A 3ZM4A 4HW7A 5I9WA 3VUMA 5IQCA 3GT8A 3R7IA 1YKRA 4QMUA 2YZLA 2PVKA 3VAPA 3BV3A 4QYEA 3CLYA 5A54A 2C68A 2ETRA 1KSWA 4RG0A 3UIBA 4KKGA 4YZBA 4YTHA 3TTIA 3OCSA 2EUFB 5AP3A 2CDZA 3PWYA 3RHXA 4FVQA 3MVHA 4RA5A 4EOPA 1YW2A 4FX3A 5HHWA 1R3CA 3UYSA 5BUJA 2E9VA 3FXWA 5KMIA 1W7HA 5IEYA 2PL0A 4W4VA 3PXYA 4AT5A 5M56A 4BKZA 4FTKA 1SYKA 3QKKA 2HK5A 4PWNA 4TZRA 2PVNA 3NUSA 4TWPA 4HNFA 4ZSJA 3SLSA 2JDRA 2R64A 3MW1A 5I9UA 2OXXA 2WTDA 4Y85A 3TZ9A 3DXNA 3A4PA 3ODZX 1PXIA 3AXWA 1O6KA 4YC6A 1YWVA 5L2TA 1Y6BA 4C37A 4XS2A 4D58A 4RRVA 5LVMA 1PXKA 3N51A 4PTGA 4QNYA 3PA3A 3WZEA 4EQCA 3H0YA 4B4LA 2WOUA 3TV7A 3ORNA 3COIA 3I7CA 4PX6A 2QOOA 5L2SA 5K3YA 4LQMA 3KN5A 3M1SA 3FE3A 5E92A 1PY5A 4LV5A 2GMXA 2PMLX 3UVPA 3EN5A 4IB5A 3SAYA 3VW8A 3WZUA 3S4QA 4ZK5A 3SQQA 5DWRA 2OXDA 4XBUA 4ALVA 5CEMA 3KVWA 4LL5A 2VWIA 4USDA 5I4NA 2WFYA 3FY0A 2XNGA 5AR3A 1CKPA 5JQ8A 2GS2A 5E9EA 4QQCA 2WIPA 3IDBA 5F9EA 3A7FA 2GNGA 1L3RE 2X2KA 4XBRA 4ZJJA 4EHGA 5LQFA 4CEGA 3GI3A 4DBNA 4Z9LA 4WSQA 4YMJA 3GC9A 2QODA 2XEZA 3MY0A 5CQUA 4CT1A 4IH8A 3ZFYA 2OWBA 4QP3A 4O0XA 5HQ0A 1B38A 1FBNA 3R71A 3GVUA 4AZSA 4JRNA 5A9UA 2JEDA 5IISA 2WTIA 1YOMA 4DFXE 2PPQA 3QUPA 2FSLX 2Y8OA 5GJGA 4R5SA 4R3RA 4B0GA 2VO0A 4PP7A 2XNEA 3LPBA 3MVMA 5AR5A 3KCKA 4L46A 3QA8A 4E7WA 1YDRE 4QTDA 2FSMX 3A61A 4QPSA 2ZMDA 3IOPA 3OC1A 4Y95A 3UMWA 3SX9A 2EWAA 2X1NA 3A2CA 3PIYA 1DI9A 4FKQA 2RL5A 4EK6A 3HMNA 1YDSE 4I5HA 5AUWA 4X21A 4O7YA 2CCHA 3FL4A 5DIAA 5LWMA 3PPKA 5CLPA 3R7UA 4BY9E 5CNNA 3K2LA 3L8XA 4ALUA 5AUTA 3V04A 4ZAUA 2JDOA 4NK9A 3Q9XA 4O38A 4XUFA 5AJQA 1CTPE 4JR7A 5HI2A 2XRUA 2IG7A 2W1DA 4RIYA 3RZBA 2CNQA 3MI9A 4I22A 3V51A 4R78A 3DQWA 1OKWA 3K5UA 2CKOA 4UN0C 5HX8A 1OIUA 1SVEA 3ZRMA 4FNXA 2PY3A 4I4FA 4YLKA 4DEIA 4BCIA 4FV1A 4C62A 1UU3A 4RC2A 1U4DA 2VUWA 4D2VA 3CBLA 3O8UA 3RCJA 5HZNA 5LJJA 3BHUA 5ITAA 4ZY4A 2X8DA 3FKNA 3FLNC 5EFQA 4BBMA 3F82A 4ANBA 4IM2A 4GVAA 5EQPA 2BVAA 3PIXA 2VTAA 1SZMA 5FEQA 2V5QA 3ZO3A 4DYMA 4CNHA 3C5UA 4IFGA 2J50A 4QP4A 4HZSA 4DCEA 5LVLA 3BU6A 3FI2A 4QQJA 4RQVA 4E93A 1R0EA 3L9MA 2CLXA 4LOOA 3G33A 1SVGA 3RAIA 3VQUA 3AD6A 2JBOA 5HO8A 3JYAA 4EL9A 5IQFA 4KBCA 4EH4A 5KCVA 2JKKA 3F3ZA 3ETAA 4Z7HA 4XEYA 4TY1A 3VBTA 4WOVA 5DBXA 4IX5A 1GY3A 2XK6A 3DK7A 1HOWA 1WBSA 4QO9A 5DG5A 4V0GA 5AUVA 2ITOA 2OH0E 4IHPA 4KWPA 3QXPA 4B8MA 4C36A 4GKHA 4DG2E 4O0YA 4FEXA 4EHVA 3ET7A 2YM3A 3U6IA 1PYXA 2VU3A 3B2WA 3LHJA 5H8BA 3R2YA 4O81A 4AW5A 2XK3A 1R1WA 4O2PA 2C69A 3PA4A 2HZ4A 2FA2A 4DG0E 5TO8A 4RIWA 3G6GA 2ITWA 2Z8CA 3NPCA 3FHRA 5CSXA 4S34A 5M44A 3H4JA 2WMSA 4AG8A 5IDPA 1NT2A 4DFUA 5HTIA 3V8WA 4QMQA 3AT2A 3P7AA 4UYAA 3C5IA 4YJNA 1OMWA 4FEQA 3QLGA 1Q3DA 3FUPA 3WBLA 2GPHA 2PUPA 5JK3A 2BRNA 4UWCA 3VUDA 5JGDA 3QX2A 1OIRA 4C4JA 4K33A 4FV7A 1MRVA 1URCA 2HY81 1KV2A 5IQDA 5L4QA 5EM5A 4W4YA 2WELA 4HNIA 1YHSA 2PVYA 2WO6A 4DG3E 5A4CA 3ZUTA 3AQVA 3DBEA 3NMUF 3LFSA 4M84A 1XH4A 3PJ2A 2BILB 2SRCA 3II5A 3FLYA 3KK9A 4L3JA 5B2LA 1OM1A 3QTIA 4IAAA 2PYWA 2Z7RA 4O7ZA 4J7BA 3LJ2A 4CV9A 2VX3A 4DH5A 5DE2A 4WUAA 4FEWA 2G15A 3AD4A 4EJNA 4QMXA 3MPTA 3QQFA 3KU2A 3SW4A 3WARA 4RPVA 4KIKB 5AP5A 3LE6A 4F63A 4ZOGA 4IX4A 5ETIA 1J7LA 2V55A 3LOKA 3GFEA 1OIYA 3MY5A 4XG8A 2IN6A 2XYNA 1M7QA 3QD2B 2VWBA 1Q4LA 4M69A 5DVRA 4RJ8A 3TNQB 3ZONA 4DN5A 3H9OA 3HMMA 5K5XA 3IKAA 2JIVA 3UMXA 4IMYA 2C6IA 4BCOA 3D4QA 1X8BA 3P0MA 1OBGA 2YM5A 3Q4TA 4OTDA 4GYIA 2GHMA 3FL5A 4M14A 5KBRA 4E73A 4B7TA 2XBJA 1M17A 4I94A 4M8TA 4BL1A 3HYHA 5FDXA 4AOTA 4CFFA 3EFWA 3WZKA 3Q4CA 2JC6A 4IM3A 3TWJA 5HTBA 4CG9A 3EKNA 3QWJA 5CU0A 4BDHA 5D7AA 3C4CA 5IU2A 2OJGA 3C0HA 3H10A 2VTLA 2J2IB 5AP6A 2YDJA 2IWIA 5HIDA 2JFMA 3ZH8A 4WG4A 4E6CA 3HX4A 3BRBA 3VS5A 3TIZA 4DITA 4K9YA 5LCJA 4ANMA 2C4GA 3FZPA 1KV1A 2CGVA 4AX8A 1KE9A 2ONLC 2RGPA 3R1SA 5CXHA 5EM7A 4NTSA 5HEZA 2R5TA 3SRVB 2X6EA 3HV3A 4FTNA 3UZPA 2GDOA 3T3UA 4BF2A 2WHBA 2YISA 3Q60A 3CSVA 3I81A 5J9LA 5FEEA 5BUIA 2WU6A 4ZTLA 5TR6A 5HCXA 3SVVA 5HG8A 2BRGA 3N9XA 1AGWA 2LGCA 4A4OA 4ASZA 2XCKA 3HNGA 3LFFA 3PRIA 4OAUC 4QP2A 3HRFA 3QQUA 4YC3A 2XK4A 5ANGA 4HVGA 5F4NA 3R9NA 3HKOA 4K18A 3ZZWA 3V3VA 3EZVA 4X2GA 2GNHA 3PSCA 1I09A 2YM6A 3QYZA 3BI6A 4FKPA 3EQGA 4O7VA 3DB8A 2C0IA 5G6VA 2C6EA 4AZFA 2B4SB 2RG5A 3V8SA 3G51A 5EM8A 5AV3A 2P55A 4JXFA 3FMDA 4AS0A 2ETMA 4KSQA 3IO7A 4EZ3A 4F9BA 3KXGA 3PZEA 5H8GA 5B2MA 3GBZA 3LFNA 5ACBC 4MWHA 4FG7A 3BWFA 3A8XA 3WOWA 4DCAA 4BKJA 5ANEA 1BYGA 4TW9A 5HVKA 1O6LA 4E8AA 3ZLSA 2Y4PA 4CLIA 3ACKA 3F5UA 4IVAA 4P90A 4UALA 3MN3A 1YHVA 2RFEA 5CI6A 4ONAA 4ITIA 3ZM9A 3LFEA 5C1QB 4XLVA 3BEGA 3BU5A 2VN9A 4K77A 3FPMA 4YNOA 3GQLA 5HLPA 3W8LA 4YJVA 3WZDA 4FSYA 2ZV8A 4IW0A 3SOAA 4CLJA 3KMMA 2X81A 4MBLA 1JKSA 4F9YA 3BBTB 3OUNB 5DA3A 5M4CA 3W18A 4AFEA 4FL1A 4EOLA 3QZGA 4FTAA 2R0IA 2EB3A 5DH3A 3GCVA 4CSVA 4U80A 3VBQA 4D1SA 1GIHA 2P33A 2CKPA 4BDBA 4GK4A 2B1PA 4JDHA 5DR2A 2G01A 4O82A 3ELJA 4O7NA 4UB7A 1APME 2IZUA 4EHZA 4G6LA 3EQRA 4KSPA 2UVYA 4ZY6A 3QCYA 2VWYA 1OB3A 4G3DA 3KA0A 3VIDA 3EYGA 5BVFA 3PXFA 2P4IA 5J8IA 4GVJA 4FEUA 1WCCA 3C4WA 2WTWA 4RBLA 4ANSA 4LG4A 3QZHA 5CEKA 2VAGA 3WI6A 1E1XA 5LVPA 3MH1A 2R3LA 4G5PA 4RQKA 4BHZA 3R8ZA 4E20A 3FLSA 2YWPA 4Q5HA 3HDMA 2PVJA 4WBOA 2HZ0A 3TACA 3PVUA 3CJFA 5CWZA 5DEWA 5C01A 3OEZA 4IDVA 5CF4A 3NCZA 5H2UA 3NNXA 2H9VA 3DLZA 4OR5A 4XG4A 3W2SA 4BWXA 4EOQA 3OWKA 3IG7A 2QOLA 2QI8A 4I5MA 5LWNA 4F08A 5A6OA 4R7IA 3HGKA 3HV5A 2C6KA 4FV2A 4YNEA 3D94A 4BDAA 4ZMEA 3HP2A 1ZWSA 4PTEA 4YZNA 4PTCA 1YRPA 3S00A 3EZRA 2A2AA 4CQGA 4MXYA 4ALWA 2PZPA 5ETCA 4C61A 2QKWB 4HYHA 4L52A 2UW5A 4JIAA 4LOQA 4ZIMA 4JRVA 3LM0A 5BYZA 1BL7A 1I44A 3OFMA 1MP8A 1NVSA 3UPXA 5J9YA 5E8VA 3R63A 4QTCA 4MF0A 1J1CA 2OJJA 4CMOA 3ID6C 1SM2A 2XNOA 4Y8DA 3G9LX 3NYNA 2WMXA 4RT7A 1PXLA 3R8MA 3TKHA 3UG1A 2XCHA 4PNKA 4O7LA 4ZS4A 3D5WA 2X7GA 3GP0A 4D4VA 3H9FA 3FKOA 2JDVA 3UGCA 1PJKA 2XIXA 3KRWA 5AR4A 2BAKA 5K5NA 3O50A 2VX1A 2QC6A 3FEGA 4U8ZA 4EYMA 2OO8X 3PJ3A 2X8EA 3UC4A 5IH5A 3CKWA 3CY2A 4QRCA 1PHKA 4WD5A 5T3QA 4XYFA 4NIFA 2FGIA 3R73A 4XV1A 3BQRA 3EOCA 2X9FA 4MBJA 5HVYA 3ZRLA 3NUXA 4LFIA 4I6QA 5FP6A 1KE5A 2YFXA 4FTOA 2B52A 2XNMA 2XMYA 4EC9A 3DT1A 3BIZA 5CX9A 1TQIA 3POZA 5HBEA 4E5BA 3A60A 3DDQA 3QRUA 4YBKA 3SC1A 4RMZA 4XMOA 4F6UA 4AE6A 4FL2A 4W9WA 4E4MA 4CCUA 5J7HA 3UO6A 5J95A 4YJPA 3ZYAA 3MFTA 2WMTA 4FTIA 4FV6A 3QRJA 4N0SA 5ACKA 4C4HA 4KA3A 5E8TA 3COKA 4TRLA 4RJ3A 3ZO1A 5IG1A 4FSQA 4IAIA 3QA0A 1ZAOA 4G9CA 3JS2A 4GJ3A 2HW6A 4H1MA 2BRMA 4AP7A 3UIXA 3OT8A 3BYVA 4RX7A 1R0PA 4UZDA 3KL8A 3W2CA 4EH2A 3TT0A 2H6DA 3FXXA 4IZ7A 2BROA 3CTQA 1GIJA 3GCSA 4JQ8A 2F4JA 4EOMA 5A6NA 5HNIX 4DF3A 1ZLTA 3MH0A 2OIQA 4JLCA 3O51A 3RPSA 2ITUA 2WEVA 3EQCA 3PJ8A 5T68A 3ULZA 1XJDA 1DAWA 4U0IA 4GFGA 3GCUA 5CENA 2KTYA 3L8SA 5HD7A 3RNIA 1M2QA 4GT4A 1JKKA 3KEXA 4MD7E 4I4EA 5BMSA 5JKGA 3WZJA 3S0OA 4A4LA 3LIJA 2QR8A 1RW8A 3E92A 4QMLA 5A46A 2OH4A 2WB8A 1M14A 4IWDA 4OUCA 1JQHA 3DKCA 2QOBA 1ZOEA 4FV4A 4ACMA 4CD0A 1XO2B 2HW7A 2QQ7A 1OPKA 3KY2A 4O22A 4G3GA 4BKYA 5LMBA 3TUCA 4LRJA 2WMAA 3QLFA 4M7IA 4XG9A 4XX9A 4LGGA 4XP0A 5CEOA 3FJQE 2C6MA 3WIKA 4AXAA 5JFWA 3TZMA 4LOPA 1E1VA 1GZ8A 1P5EA 4YURA 4CZYB 4MXAA 3RK5A 4WRGA 4AGUA 4L00A 3CKXA 4AW1A 3LQ3A 3A99A 4X6QC 3RK7A 2F2UA 2PMNX 3W8QA 3AC5A 3HUCA 5E90A 2Q0NA 2WQBA 3UIUA 2QD9A 3TNHA 5TKDA 3R7YA 3BE9A 5JFSA 1Q8ZA 3QU0A 2CNUA 3VS4A 3DBDA 4NM5A 1SMHA 4AUAA 2ITQA 2O8YA 3FY2A 5DT3A 4DEAA 4WNPA 2YIWA 1PMEA 4UMUA 4QD6A 3KCFA 3NUYA 3NRMA 1UNGA 5DGZA 4UX9A 2NRYA 4QT1A 1Z57A 4HCTA 4FSZA 2QLUA 2W05A 4ASXA 3LCTA 3ALNA 3KFAA 4RX8A 3WYXA 4YJRA 3BPRA 3NS9A 2ZDUA 4WO5A 4G1WA 2PZYA 4C58A 4FIHA 3MSSA 4J8NA 5GJDA 1FGKA 3IS5A 5KE0A 2WKMA 4IQ6A 1NW1A 3D5VA 2GNIA 3FLZA 2YIQA 3PJCA 4F0GA 1RJBA 2A0CX 4KS8A 1Y57A 4X3JA 4FZ7A 3O8PA 5CAVA 3I5ZA 2CKEA 3NW6A 1UWHA 1GOLA 3OROA 5IQEA 4ZTSA 4JBVA 3C7QA 4OBQA 3REPA 5LOHA 5AUXA 3RTPA 5F1ZA 3CGOA 4FICA 4R3CA 4F0FA 2J5EA 1SNUA 2BUJA 3KK8A 4HGSA 4OTIA 4BZDA 4N6YA 4H58A 3MDYA 4U45A 5C8MA 4ANNA 3K5VA 1WBWA 4HZRA 4LYNA 2WMQA 5CU2A 3RWPA 4P7EA 4LUEA 3UNZA 3OF0A 4DINA 4FKOA 1F3MC 4AA0A 2YHVA 2C5VA 4O83A 3E5AA 3HP5A 2R3GA 1IRKA 4NCTA 4GG5A 4QP8A 4PUZA 4CT2A 4MXZA 3RMFA 4M68A 2FO0A 4R6VA 4OGRA 4ZY5A 1STCE 5HE0A 4F7JA 2BKZA 4PF4A 2I0EA 5JN2A 4K1BA 4JDKA 4RJ7A 5T6KA 3FDNA 2XK9A 4G16A 5D10A 3AMBA 3DLSA 5B7VA 3MIAA 4QTEA 4L42A 5EDPA 4FIFA 1ZYJA 3CGFA 3KXHA 3FZRA 2JDTA 3DS6A 4EK3A 1RE8A 1ZYSA 3P5KA 2R3QA 4PL3A 1OL1A 2GHGA 2OGVA 3OY1A 5I9YA 3SDJA 5CZHA 2XIZA 1GZKA 4C02A 2OIDA 2VTNA 4P2KA 3K3JA 3PE2A 3F3WA 3GU6A 5BVWA 3PDTA 3R9RA 3P86A 4B9DA 3EN6A 1Z5MA 3ZSHA 4DEDA 3PXKA 4QPAA 4NWMA 3W2QA 3DDPA 2ZV9A 2CN5A 2WTCA 3IOKA 3OW3A 3PFQA 4HVHA 2QVSE 4XRLA 4F0IA 4BB4A 3IDPA 3DK6A 3U4WA 2Z7LA 2BDJA 3RJCA 4DFBA 1ATPE 3O7LB 3Q04A 1P2AA 5JQ5A 3P78A 4PDYA 2JIUA 4XV9A 3R1QA 4CTBA 1FPUA 3BYOA 3CP9A 4C3FA 3DAJA 4RX9A 4UEUA 2QG7A 2CKQA 3G0EA 4N70A 5DT4A 2CGWA 5DR9A 4CFVA 2VGPA 1OBDA 2BCJA 5CASA 3C13A 5AR8A 3ORMA 4DA5A 2IVSA 1V1KA 4CZTA 4I6HA 3FSKA 5JMSA 3DFCB 5B0XA 3EQIA 1KE6A 4F9CA 3BGZA 3U9CA 4YTFA 5K4JA 4O86A 4DH7A 3LLTA 1XH8A 3NCGA 5A3XA 2BRBA 2I7QA 1ZYLA 1HCKA 5I9ZA 2I40A 3GC0A 4PL5A 3MB7A 4L44A 4GS6A 3MFSA 4Q5EA 3EN9A 5GHVA 1Y91A 3FPQA 5AX9A 4QP1A 3RAKA 3W2RA 5EYCA 5ANOA 5EHOA 3SXFA 5I5ZA 2BZHB 4YSJA 5LMKA 3ZDUA 2PUNA 3R7EA 2OZAA 2XNPA 3JY0A 3TV4A 2X9EA 2GNJA 3PA5A 2QOCA 4ZEGA 3C4FA 4L01A 3EYHA 4II5A 4XRJA 1OECA 4F65A 5A14A 2B9FA 3N4VA 1WBNA 1ZY4A 5DLSA 2YAAA 5L6WL 4OTHA 3A7GA 3MB6A 4U97A 3MFUA 5DOSA 5CXZA 1Q8UA 2B53A 4J98A 3ZO4A 3RWQA 2R7BA 1OUYA 3CJGA 4DEGA 4D4SA 1A9UA 4S32A 1PXNA 2RG6A 1B6CB 4EKKA 4QYFA 5IQGA 3LCOA 3BZ3A 4IB1A 3QL8A 3UBDA 5AM7A 5IQAA 5EH0A 3PYYA 3QTQA 5F94A 4BWPA 2YM8A 4BDGA 4FVRA 1LP4A 5E8SA 4PMMA 4ITHA 1O9UA 4MBIA 5FGKA 2FUMA 3W55A 2AC3A 3HA8A 4WBBB 2OJ9A 2O0UA 4YZCA 3EL8A 2ESMA 1IR3A 1UVRA 3AT3A 5H8EA 4BCFA 2X4ZA 1BLXA 4ZLOA 4HOKA 5D1JA 1PW2A 4U79A 3D14A 4JR3A 4Y46A 3SHEA 3U55A 3Q2MA 4Y72A 1Q99A 2VTTA 2HZNA 4RA4A 3GU8A 3SXRA 4CTCA 3UOJA 2I0HA 1TVOA 4TNDA 5C9CA 3WIGA 3H3CA 2RF9A 2VV9A 2I1MA 5EYKA 3D5XA 3PXRA 1BKXA 1P14A 4M3QA 4AF3A 2V0DA 3ORKA 4IWQA 4I41A 5GZ8A 4MXOA 2R3NA 3MJ1A 4R77A 3CEKA 4IWPA 4FBXA 4AAAA 5C8KA 4F9WA 3CTHA 3F69A 5KZ0A 4WKQA 4TYHA 4LGHA 4RGJA 4QYGA 2W7XA 2UVXA 5JZJA 2GS7A 4OTWA 2CGUA 2DS1A 2W9ZB 4IX3A 4J52A 4XP3A 3FQHA 5IQHA 4ZSAA 5M4FA 3U87A 4ARKA 4FGRA 4D2SA 4V05A 3KQ7A 4R3PA 3JPVA 3KRXA 4IC7A 1WVYA 3GCPA 4YGAA 5IKWA 5AP0A 3R7VA 1U54A 3Q53A 5DRDA 5L6PA 1OKZA 2J0LA 3OY3A 5FQDC 5GNKA 3UIMA 4ZLYA 4QMMA 3ACJA 4FKUA 5G1XA 1H07A 4DEBA 4D0WA 1JSVA 3VS6A 4IIRA 4MK0A 3DKOA 4CQEA 4YHFA 2J5FA 4DGMA 2VTJA 4APCA 4FKIA 4MKCA 2C6DA 2W1IA 2RFNA 4FTCA 1Q5KA 4LMUA 3HAVA 3C4EA 2QCSA 3QALE 3Q9WA 3W33A 4OTPA 1G8SA 2QKRA 3V5TA 1V0PA 5EW8A 4QMWA 4IVDA 5D41A 2FSOX 4FUXA 1WBVA 4RX5A 3F61A 4IB3A 4BR3A 3HVCA 4FIGA 4N4SA 4GIHA 5CEQA 3PG3A 2W1EA 4G3CA 3BLRA 1OL2A 4GU9A 4PPCA 4CFUA 2WTJA 3BYSA 1CKJA 2QNJA 3D7TB 5BNJA 4LL0A 5FTGA 3EJ1A 3DU8A 4G6OA 4DGGA 2VGOA 3NZ0A 1MQBA 2OBJA 3B8QA 4FOCA 4I23A 4MXCA 4W4WA 4A06A 2JD5A 2XF0A 3A62A 4EOIA 4FT3A 3OP5A 2IO6A 3FZ1A 4C3RA 4NEUA 2QHMA 1CKIA 2FYSA 3DGKA 3WF6A 1XH6A 5EW3A 1U46A 3JUHA 2R3FA 2R3OA 2B9JA 4FIIA 3WF7A 3BBWA 4RVMA 3ORTA 2RIOA 2DUVA 3QRKA 2JKQA 4AZTA 3P7BA 3JVRA 5LARA 1H00A 1JKTA 4MWIA 1QMZA 3MTLA 1WBPA 4R1VA 4EWHA 2B9IA 4KKHA 5HNBA 1XQZA 4CVAA 4O84A 5CVGA 3EFKA 5IA4A 3VVHA 2PVLA 3FQEA 3RALA 3U8WA 2OJFE 3ZFMA 2HIWA 3QD3A 2WMWA 4IZ5A 4YC8A 5CU6A 4L68A 4HCUA 4HGEA 4IACA 2EB2A 3LXPA 3TUBA 4DT8A 3BCEA 3TKUA 4BYIA 3F6XA 5L8LA 2UW3A 2VNYA 4HYIA 5KKRC 1H1WA 3UODA 2ACXA 2Y0AA 4ZSEA 3G15A 1LEWA 4IM0A 3FMKA 4FT5A 1YQJA 5DHJA 4E5WA 5L2IA 2P3GX 2WMRA 1FOTA 1OKYA 1YOJA 2G2HA 3VUGA 3NNVA 4IADA 3NNWA 4I6FA 3RPVA 3GXLA 4Y5HA 5FLFA 2CPKE 3O96A 5IQIA 1YI4A 4EK8A 2EXCX 3F9NA 1XWSA 2F7ZE 3Q4ZA 4A9RA 4F7LA 3GC7A 3IPHA 3DAKA 2W1CA 4RWIA 4TNBA 4BDFA 1BMKA 1XH7A 4F6SA 1YVJA 5AR2A 4C3PA 3R28A 2H34A 1IG1A 1OPJA 2GSFA 2VWXA 4G3EA 2XYUA 5E91A 3OUKA 4QQTA 4BI1A 1P4OA 3FLWA 3ZO2A 3GCQA 4TYGA 4NTTA 3E3BX 4R7BA 1M7NA 4O91A 1W98A 3AC8A 1H0VA 4G2FA 4I5CA 5BVEA 1XBBA 4DHFA 4NL0A 5A4LA 3O2MA 2JKMA 4FV0A 2Y6OA 3D0EA 3UNJA 4FC0A 4AZWA 4BCMA 3R7GA 3FYKX 4XV2A 4ACDA 1YHWA 4J53A 3PTGA 4J99A 2C0OA 4L8MA 4S30A 3PLAE 2UZDA 5E8XA 3KXXA 4JG7A 2VTHA 4TKSA 5EK7A 3NAXA 3ZXZA 5HVJA 4BTFA 4NM3A 4AACA 3R83A 4K6ZA 4EH5A 5IH6A 1XH5A 3D7ZA 3VBYA 3I6UA 2E9OA 1H1SA 4IJ9A 3C4ZA 4JNWA 4GT3A 2Z2WA 3UJGA 1J3HA 3MH3A 4I0SA 3NR9A 5JT2A 4W9XA 2AUHA 1J91A 1IASA 4FGBA 4YBJA 5F20A 4MQ2A 3KN6A 4APPA 1OVEA 4YTCA 2DWBA 5L2QA 5DEYA 4PMPA 4BCKA 3GU4A 4WG3A 4EUTA 2R2PA 1YOLA 3OZ6A 1NVQA 3EL7A 4G3FA 4QMYA 3AG9A 4D2PA 2G2IA 3R21A 1MRYA 4KRCA 2PVRA 2YCSA 1IA8A 2OIBA 4WA9A 4BBEA 5EKNA 4PL4A 4O0WA 2A19B 1NA7A 4TWNA 4PV0A 4YLJA 5HBJA 2BFYA 4RC3A 4ZSGA 3DAEA 4BVUA 2UZOA 3OOMA 5JH6A 4A9UA 2CHLA 4EWQA 1LUFA 2I6LA 3F2NA 3H30A 3OCTA 2OJIA 4BTJA 4GKIA 2ZMCA 5AUUA 1ZOHA 4KBAA 5M09A 3QUDA 5JRQA 3MA3A 3IGOA 4BCPA 4NM0A 4I1ZA 4AOIA 3WF8A 4XLIA 5I9XA 4FK3A 1FVRA 4CFWA 3PP0A 2E9NA 4CFNA 4DLIA 2HCKA 3ERKA 4CRLA 3DJ7A 2B9HA 4FSRA 4R7HA 4YO4A 2WU7A 3I79A 4OBPA 2GS6A 3ZXTA 4EH3A 1J7UA 4O2ZA 4RC4A 1MQ4A 3QHRA 4UZHA 3UQFA 4NW6A 2WQMA 2H8HA 3DTCA 4K0YA 4YJTA 5KMKA 5IZFA 5AIKA 1UKIA 3F5XA 4CFXA 4C34A 4RFMA 2REIA 3TXOA 4FKSA 2HWPA 4MNEB 5EDQA 3BGPA 5CAPA 4JG8A 1H1QA 2UW4A 5HU3A 4KIPA 3LMIA 5L2WA 2GQRA 4I92A 4UWBA 4F1TA 4KUJA 2BDFA 3ZSGA 2VTOA 4FZAB 4WG5A 1GJOA 3B2TA 4OTQA 1YXVA 4FSUA 1Q24A 4L7SA 1XKKA 3N4UA 2QO7A 5HNGA 4FEVA 5GIPE 1UU8A 3RZFA 3R2BA 3TG1A 2NO3A 2XIKA 4EZ5A 2YWVA 4DT9A 4CKRA 4A9YA 4FODA 2PTKA 4PPAA 4DEEA 4I21A 2QOFA 4HGTA 3RPYA 4X2JA 4KIKA 4U81A 1ZXEA 4NKSA 2WMBA 4ZZMA 4C4EA 1MUOA 2KULA 2GU8A 4RLLA 5DR6A 1V0OA 3UOKA 4LM5A 5KMJA 5HLNA 3U6HA 5CSPA 5JZNA 4AQCA 2VO3A 3LXLA 5EKOA 2ERZE 3ATSA 2ITXA 3OWJA 1OIQA 3JVSA 4G9RA 4WIHA 4J8MA 3QZFA 4R1YA 1F0QA 3KF7A 3QTSA 4XOZA 3TZ8A 1U59A 3SA0A 2BFXA 2XEYA 2XP2A 2YITA 4RIOA 5CEIA 1OKVA 3RVGA 1BL6A 4S31A 3FKLA 1OL7A 4ZS0A 3ANRA 5KHWA 4S33A 2XIYA 4W4XA 4YPSA 2C3IB 1H1PA 3GQIA 2AC5A 4GW8A 4O0RA 3CIKA 4MHAA 2WZJA 3TJCA 3UPZA 2OF2A 2AYPA 1BI8A 1WMKA 2OSCA 3VNTA 2W1ZA 2J0JA 3RGFA 3OXIA 1BI7A 5C03A 4EOJA 3BU3A 4AZEA 1UA2A 4OT5A 2UW6A 2XJ2A 3EWHA 4FV9A 4B8LA 2ZVAA 2WAJA 2VTIA 3FI3A 3KC3A 3SRVA 2W06A 4DC2A 4UMPA 3V5QA 2X7OA 3DKGA 5BX0A 5EW9A 3CD3A 3E64A 4TN6A 3VF8A 2IVVA 3OTUA 3QQJA 2R7IA 1E9HA 5CSWA 3MVJA 4DTKA 3TUDA 2C3LA 2NP8A 2OW3A 2PZIA 3CTJA 4U6RA 4BRXA 4AA5A 3DY7A 2OF4A 4BGQA 2PZRA 2ONLA 2Y6MA 1U5RA 3L9PA 4IAYA 3VHEA 2YJRA 4X3FC 4D28A 4F6WA 2CNVA 3PVWA 4AA4A 2GQGA 2QOQA 3QTRA 3CQUA 2PWLA 3LKMA 3D2KA 3FXZA 2GNFA 3ALOA 4OTRA 4PMSA 3HV6A 4EBVA 2QURA 2VTMA 1TKIA 5D11A 3UVQA 5CTPA 4U5JA 4A07A 2CLQA 3KRLA 2QU6A 3DPKA 4FSMA 3PWDA 3HECA 4X3FB 1YXXA 5IUIA 4DEHA 2OZOA 4HCVA 5HE2A 3NW5A 4FNZA 2RKUA 4KD1A 5ETFA 3GNIB 3QCQA 4JVGA 5AMNA 5E1SA 1H08A 3DNEA 3NLBA 3DXPA 3L8PA 3ANQA 3L1SA 4FTTA 4GRBA 4IBMA 1VJYA 3QKMA 3DOGA 4KNBA 5ETAA 3NVMB 4C38A 4YO6A 1W8CA 3F5GA 3C1XA 4IB0A 3P08A 5EYDA 3RKBA 5E4HA 5KMOA 2VWZA 4D2TA 3E7OA 3TKIA 4YJSA 5HGIA 4NT4A 4BDEA 4NKAA 5J1WA 5K0KA 2XVDA 2XNNA 2R9SA 2YABA 3LFCA 4XG3A 1IAHA 4BFMA 4TWOA 3UZRA 1UV5A 1PMNA 2BZKB 4AU8A 3ZLWA 5IUHA 3GU7A 3DV3A 5J5TA 3VULA 4G5JA 3HAMA 1PYEA 2IW9A 2DYLA 2O64A 3KKVA 4IAKA 4WRSA 5HCYA 4JDJA 4WNOA 2VWUA 1RQQA 2NNWB 4EHEA 1JLUE 4TPTA 4L67A 4BIBA 4QTBA 1YDTE 2YIRA 4ANLA 4Q9ZA 4FYNA 4MYGA 4BCJA 4C7TA 4AT4A 4GH2A 2UZWE 3NDMA 4ZP5A 4DTBA 5CZIA 1U5QA 2WD1A 4RZVA 5M53A 2CN8A 4IX6A 4QMPA 1P4FA 2WNTA 5EQEA 3QX4A 4Z55A 3N4TA 2PHKA 2Y7JA 3A7IA 2XM9A 4I24A 4JBOA 4JJRA 5DI1A 4M15A 3VHKA 3ZBXA 5IA0A 5ANJA 3UOLA 5KNJA 3HMIA 1G5SA 1OUKA 2EU9A 3VS1A 2UZTA 4A9TA 4N6ZA 1GZNA 3L9NA 3RPRA 4F70A 5M57A 4OT6A 2J0MB 3GC8A 2J9MA 4DGNA 3ZU7A 1PKDA 3UC3A 5HTCA 2QO9A 1T46A 3S95A 2YERA 3IW5A 2XB7A 3G9NA 2W4OA 4NZWB 1GZOA 3TL8A 3FSFA 3UVRA 4FMQA 3C9WA 2UZNA 3DFAA 4YP8A 3VUKA 5ICPA 3FV8A 2XKDA 2W5AA 3ZHPC 3FWQA 4QOXA 5DT0A 4E5AX 4UV0A 3SXSA 4JIKA 4TYEA 4JX7A 3RBWA 4UXLA 5IA3A 1UWJA 2ZDTA 4DH1A 5K9IA 4FA2A 5CI7A 2BTSA 4G17A 2GCDA 2DQ7X 3MPAA 5CALA 4GK2A 4GUBA 2PE2A 2XK7A 2E2BA 4QMOA 4QP7A 5HO6A 3R22A 3QQHA 3QTZA 3VJOA 4OAVB 3D83A 4M66A 5C26A 5J7BA 2FVDA 4FV8A 4BCQA 3O71A 4YJOA 3ROCA 4AWIA 3O7LD 1CMKE 4A7CA 5F95A 5M4UA 2ZM3A 3RI1A 4WHZA 4FVPA 5EI2A 4DFLA 5AM6A 5KX8A 3PZHA 2NRUA 4M0YA 5CVHA 3PXZA 5CVFA 4IDTA 1JOWB 3CR0A 3F3UA 3QZIA 3FMLA 3K3IA 4FT0A 4JDIA 3QQLA 3VBVA 3TV6A 3LFAA 1H28A 1QL6A 3EQFA 3I1AA 3P7CA 5DN3A 3WF9A 2PUIA 4NM7A 1JSTA 3KMUA 5M06A 4EC8A 5BVOA 2J0IA 4GFOA 4I93A 1LR4A 3U6JA 4CG8A 3LQ8A 2X39A 5KO1A 4M12A 2IZTA 4HYSA 5AP1A 4BN1A 2QOKA 1A48A 5L8JA 3AGMA 5FXRA 5AA8A 1CSNA 3TZ7A 4YJUA
chains in the Genus database with same CATH superfamily
2BHEA 3IW4A 2R3HA 2PVMA 4RLKA 1YI6A 4XG6A 2VTPA 4LUDA 4RFYA 5B2KA 3NIZA 4LMNA 5EI8A 4CXAA 1PKGA 3OBGA 5JFXA 4HVSA 3V8TA 4TL0A 4K8AA 5GIOE 5TOZA 2YEXA 2G2FA 3ORPA 3KRJA 4FSNA 3FMMA 3QAME 3OEFX 3POOA 4BTMA 5AUYA 2HWOA 4O6LA 3R9HA 4XJ0A 2QU5A 4X7QA 4ERWA 2HYYA 4G34A 2YDIA 2YJSA 2UUEA 4CFMA 4RIXB 1KOAA 4N57A 4EOKA 4O27B 3V5LA 4O0VA 2VX0A 3M11A 4F1OA 3V6SA 2W9FB 2R3JA 2PE1A 4BTKA 2IJMA 3JR1A 2C1BA 3P23A 4JOAA 4G6NA 4PP9A 2C5OA 3FMEA 1MRUA 3ZUUA 4CMUA 4EORA 3VS2A 4FOBA 2EXEA 4YR8A 2WXVA 4TT7A 2B0QA 1ZMWA 1PMUA 4AAYA 2VD5A 3T9TA 1H26A 3F2AA 3QGYA 4XOYA 5HBHA 5JGBA 5M55A 1KUTA 1UU7A 2HY0A 4FKRA 3OHTA 1URWA 2BZJA 5CT7A 3DA6A 3NGAA 5IA5A 3GUBA 4E1ZA 5AEPA 1PXPA 3Q9ZA 4KIQA 4O0SA 1WBOA 4J71A 2YIXA 2GQSA 3C0GA 4YU2A 2E9UA 5HIEA 4KRDA 4F64A 4MXXA 3MIYA 4QQ5A 4GL9A 3Q5ZA 3MVLA 4KS7A 2X8IA 5KMLA 2W4KA 4FUYA 4H1JA 4GU6A 3A4OX 3TNIA 5L6OA 2X2MA 4NH1A 4ERKA 5BPYA 4PRJA 1FMKA 1ZZ2A 3RHKA 1H01A 3R8UA 3HUBA 1J1BA 1YWNA 1FMOE 3GOPA 4BI2A 2GFCA 1LPUA 3LXNA 3HL7A 4JT3A 4RVTA 3NAYA 4FI1A 3ZFXA 5IUGA 3CY3A 4FV3A 4I0TA 4V01A 2IW8A 3TI1A 3GB2A 3EQHA 5BUEA 2BR1A 3VUHA 4AXDA 3I7BA 3FC2A 3UQGA 3I0OA 1JKLA 3CE3A 3V01A 4D55A 4EQMA 3IW8A 5HX6A 5HE3A 5I3RA 3PSBA 1Y8GA 4D1XA 4IAFA 5LVOA 2J6MA 3PXQA 3CQEA 3CPBA 3QUEA 4BIEA 4ZLZA 3LCDA 4E4LA 4D2WA 2WGJA 2WMUA 2JITA 3PY1A 2EXMA 5E8YA 4BI0A 3ORXA 3NX8A 3FQSA 2OK1A 3CCNA 3FMNA 4H3QA 4RWJA 3S2PA 5DPVA 4EYJA 3NFFB 2HENA 3PE1A 2IW6A 5EHYA 3VF9A 4GMYA 4QTAA 3AC1A 3H0ZA 4AW2A 2UW8A 4KB8A 3P9JA 4IVCA 4P5QA 2PSQA 3DKFA 3G90X 4V0GB 2ZOQA 4A4XA 5DMZA 2QLQA 5JGAA 4OW8A 4EH7A 4D9TA 5CY3A 4JL9A 4AN9A 4NSTA 4CCBA 3ROYA 3QWKA 3PJ1A 2G1TA 1EH4A 3BX5A 3NUAA 4D0XA 4ASDA 4O0TA 4ZTQA 3R9OA 3W32A 4RFZA 4RIWB 4QPMA 2QONA 2XBAA 3AMAA 4I0RA 4BHNA 5IEVA 3E8CA 3IK3A 1CDKA 4Q2AA 3W1FA 4UMQA 3BYMA 4QMTA 4P5ZA 4ANQA 3E8NA 3KXMA 3SW7A 5FDPA 3OD6X 4EEVA 3EIDA 2A1AB 2BTRA 3MYGA 4YSMA 5AUZA 3DB6A 3CC6A 4BIDA 2OG8A 2XZSA 1KE8A 3G6HA 3EFLA 1YI3A 5CS6A 3Q2JA 1RDQE 1H0WA 3T8OA 2ZV7A 3BQCA 1REJA 1YXSA 4MCVA 3MESA 3GENA 4UMRA 5I0BA 4O7WA 4QDVA 2UZLA 3GEQA 5HCZA 2B54A 2YLFA 1Y6AA 2BIYA 2G9XA 3E63A 3LFDA 3VW6A 2VTQA 4PDOA 3LCKA 4C2VA 5CSVA 2PMIA 2BIKB 4L6QA 4MNFA 5FG8A 4RIXA 2W1FA 4PDSA 4C4GA 3VO3A 4BDJA 5AV4A 2CCIA 2Q83A 4P4CA 3SG9A 2YDKA 3OT3A 1F5QA 3BLHA 3UQCA 3BHTA 4FNWA 4GSBA 4EH6A 3D5UA 4F9AA 3O0GA 3PRFA 5CQWA 3KIOC 2JAVA 3QKLA 3LM5A 4ZTMA 3RAHA 3TTJA 2JFLA 3TEIA 1Y8YA 4U41A 3DXQA 3C4XA 4KKEA 1FQ1B 2ZYBA 3SKCA 3JY9A 2XUUA 3C0IA 4D5HA 5KZIA 4M69B 4EH8A 4GYGA 5L3AA 4J1RA 3NYOA 2VNWA 3BHHA 4IC8A 1PXOA 5E8UA 3JXWA 1TQMA 5CU3A 2J90A 3OWLA 4C35A 4ID7A 3HLLA 1YWRA 3QD0A 4U40A 1JPAA 2W0JA 1NXKA 1KOBA 1Q8TA 3QTUA 4ASEA 5FTQA 3VWAA 1OITA 2R3IA 4OTGA 5K0XA 5FUTA 3KMWA 3AKJA 3OXZA 3ZEWA 2W17A 5EOBA 3LVPA 3QQKA 1PXMA 3H9RA 4FTLA 4OTFA 4ZJVA 3AGLA 3FI4A 4QNAA 3LJ0A 2UVZA 3R1NA 3MA6A 4LI5A 3EQBA 2ETKA 2J4ZA 2XA4A 2JAMA 2JLDA 4GUEA 4MEDA 4U7ZA 5CT0A 4DAWA 3W2PA 2BKKA 3WF5A 4M0ZA 3QRIA 4DH8A 4S2ZA 4Y83A 4FE2A 2GNLA 5J1VA 4C0TA 3DZOA 3O5AA 5CF8A 4FT7A 4U9AA 3F7ZA 2C0TA 3V6RA 2W96B 2OFUA 3RK9A 4YZDA 1G3NA 1YXUA 3BE2A 3LXKA 3BHYA 4UYNA 2ITYA 4J97A 4YLLA 5AV1A 5IMXA 3BLQA 2I0VA 3EQDA 1VR2A 3F3VA 2J0KA 4F09A 4HJOA 5LCKA 5KBQA 4QP9A 3G2FA 3TIYA 4AT3A 3LJ1A 3V5PA 4HYUA 4ZZNA 3NUUA 4XV3A 5KMMA 1YXTA 4UBAA 3ZOSA 2IVTA 4DLJA 4L45A 1H1RA 1WAKA 4IVBA 3I0QA 5D9HA 5CF6A 3VQHA 4I6BA 5HLWA 3ITZA 1PXJA 3SV0A 5M51A 1DI8A 1REKA 4AN2A 3U4UA 4NYEA 2JBPA 2WIHA 3R01A 1IEPA 2R3PA 3KULB 4RSSA 5EDRA 3TM0A 2O3PA 3FAAA 2YIYA 3TNPC 1M2PA 4AGCA 5A4QA 1OL5A 1H24A 4UWYA 1PMVA 2ZM1A 3IONA 2C5NA 5CSHA 3RM6A 3ZC5A 4DBXA 2R0UA 2Z7SA 4JBQA 1WBTA 4ENXA 2Y4IC 3MGYA 3AC4A 2PMOX 3I5NA 2JIIA 4MF1A 5EI6A 3NNUA 5KKRB 3KXNA 2RFSA 5E7RA 3FBVA 3E62A 1JSUA 1WVWA 4BWKA 5C8NA 3BKBA 3LCSA 3L9LA 5FM3A 4ZTHA 2JDSA 3QXOA 5FWKK 2EVAA 4AFJA 2X6DA 2Y4IB 1DS5A 4XCUA 3BWJA 3Q32A 4FL3A 3UOHA 5E1EA 1GAGA 3ZCLA 3EB0A 5IF1A 4F7NA 3LFQA 4FTMA 3TCPA 4ZTNA 4I5PA 1XR1A 3HRBA 4EK4A 3MBLA 3EN4A 1W0XC 4USFA 3UO5A 4J95A 4DFYA 3KXZA 4C59A 1DAYA 3EMGA 4CYIA 2Y9QA 5J79A 4EJ7A 3HMPA 4FSTA 3DK3A 4X2NA 5TT7A 1Q62A 5BQ0A 5HD4A 4LRKA 5IA2A 4CRSA 5HG7A 3S1HA 4QP6A 2W5BA 3O8TA 4NJ3A 1ZMVA 5EHLA 2PU8A 4FNYA 3G0FA 4QYHA 4FYOA 4YHJA 1NVRA 4KBKA 5AP4A 3UP7A 3Q3BA 2GFSA 4CKIA 3R8VA 1M2RA 2JKOA 4E26A 2Z7QA 5JFVA 4DTAA 3F7WA 2C1AA 3MFRA 4E6DA 2VRXA 5FBOA 3ORIA 4ZJIA 3QTXA 1JBPE 2C3KA 3A8WA 5JEBA 2BAQA 4U3ZA 1LEZA 4AQKA 4D4RA 3ZMMA 3AC3A 3ATTA 1Q97A 5FRIA 5AA9A 2F57A 2V22A 5CU4A 2YM7A 3OS3A 4PPBA 5EM6A 4X2KA 3QD4A 3R6XA 1AD5A 3R8PA 3R9DA 4ZMFA 3PPJA 5GZ9A 4YUQA 2OXYA 4V04A 3OBJA 3E8EA 3QCSA 4NU1A 5K4IA 2IZRA 1ZYDA 2OI4X 3R02A 4PMTA 4R5YA 2A98A 4Y5QA 3NW7A 4JAIA 5EG3A 3KRRA 3MWUA 4QYYA 4O7SA 1V0BA 2R3RA 2ZM4A 4GT5A 4TWCA 1JVPP 3LMHA 4U42A 3NIEA 3VUTA 3EH9A 1KWPA 4NW5A 3ZC6A 3MH2A 3UP2A 3NSZA 5KUPA 5FXSA 2C6TA 1FGIA 3O23A 3D7TA 2J51A 4A9SA 2XNBA 4E4NA 1UKHA 2F7EE 1M52A 4O7RA 3UG2A 4DGLC 3P4KA 3E7VA 3GOKA 1L8TA 2CMWA 4U3YA 3ZS5A 4IJPA 5BMMA 4JQ7A 2WMVA 5AAEA 2FSTX 5IH4A 2LAVA 2I0YA 2PUUA 3Q6WA 3RINA 4FR4A 3CS9A 3E93A 5IPJA 1IA9A 2QR7A 1SVHA 2C47A 2YAKA 3FYJX 1QPCA 4H3PA 5EOLA 2CSNA 2HELA 5LMAA 2V7AA 4NIFB 2UZVA 4MTAA 3DCVA 4G31A 5HESA 4UY9A 3R30A 3T9IA 2XRWA 3OCBA 3UE4A 5H9BA 4ZTRA 5AV0A 5AFVA 4EOOA 4L3LA 3PVGA 3VC4A 3EN7A 4BDIA 5DFPA 1BUHA 3D15A 1Z9XA 2WQEA 5GJFA 4MD9E 3U9NA 5TF9A 4IXPA 4BYJA 5BVNA 3Q52A 4O7TA 5AADA 2X4FA 5CF5A 4D4YA 4XHKB 4O1OA 4CV8A 3RM7A 5DRBA 5HU9A 1KE7A 3VN9A 4IWOA 2WPAA 3OW4A 3S3IA 2ERKA 3KULA 3OMVA 3OXTA 4U44A 3ZTXA 2X2LA 4O4CA 2P0CA 4WUNA 5M4IA 5HOAA 4C4IA 3KB7A 5GINE 1CM8A 2E9PA 4FZFB 2WEIA 3NUNA 4H36A 3FC1X 3V5WA 2UZEA 3ZUVA 3HZTA 1DM2A 1FVVA 1W83A 3R7OA 2UW7A 4BBFA 1PRYA 4OBOA 4AE9A 4L7FA 2O5KA 4IAZA 4QMZA 3DJ5A 4M13A 4RZWA 1H8FA 3F3TA 3R8LA 3AD5A 1HCLA 4E4XA 4W8EA 4O0UA 2WQNA 3NVKI 3Q6UA 3SD0A 2BRHA 5FBNC 5AAGA 3KF4A 2QOIA 3QC9A 3QTWA 1ERKA 3M2WA 2JGZA 4F4PA 2UV2A 2IPXA 2W1GA 1BX6A 3NUPA 3NEWA 3PY3A 2YA9A 4HPUE 5EQYA 2BALA 4X2FA 1Q41A 4C57A 3ZLXA 4MH7A 3PY0A 1UNLA 3NYVA 3DTWA 5M08A 1XHAA 2C30A 4ANOA 4E6AA 3SGCA 2QHNA 1PF8A 2QOHA 4D9UA 5CAQA 4TXCA 4ACGA 3TJDA 1OI9A 2ITZA 4DH3A 3MV5A 4ZSLA 3OWPA 3VBXA 2R3KA 2XH5A 2RSVA 3EFJA 4BDCA 4YHTA 3RAWA 1ZYCA 5AAFA 3DQXA 4C4FA 5BYYA 2VTSA 5AP7A 4ENYA 3DZQA 3MPMA 3VUIA 5HE1A 4MVFA 3UDBA 3COHA 3ENMA 3MJ2A 2XJ0A 2OLCA 4DE4A 5AIRA 1OZ1A 4MX9A 4D2RA 3PG1A 4EQUA 4C33A 3HA6A 1W84A 4JX3A 5AX3A 4IANA 4BDDA 3KREA 2C5XA 3FZTA 3LQ5A 5JSMA 3MTFA 3W2OA 3BEAA 1UNHA 3BV2A 4JS8A 2YACA 3HV4A 4MD8E 2PVFA 2XIRA 4GJ2A 4RWLA 2BHHA 1OL6A 4FKJA 5KHXA 5D7VA 1R39A 4IFCA 4IE9A 5J9ZA 5FP5A 5IQBA 5FXQA 1S9JA 3E88A 5H3QA 1Q61A 2YM4A 4PDPA 4YPDA 2HAKA 5FD2A 4IZAA 3UZTA 5ANDA 3GFWA 3TDWA 2W99B 3M42A 3DNDA 4C2WA 5BYLA 4BCGA 4NFNA 5JRSA 4FTJA 4FIJA 3OG7A 1Q8WA 4DFZE 3P79A 2RFDA 3ORLA 3ZBFA 4KINA 3COMA 2OFVA 4EUUA 2XKFA 3LLAA 3QF9A 4NJDA 3FMJA 4M67A 4FIEA 5J5SA 2XS0A 2ITVA 4TYIA 4FTQA 3C50A 4PQNA 3I4BA 3LW0A 4UMTA 3VS7A 4CMTA 1ZARA 2ZB0A 5AWMA 4EZ7A 2WQOA 4F99A 4GV1A 2ZJWA 4JAJA 2R3MA 1ZMUA 1H4LA 1G8AA 3SOCA 3R00A 1ZZLA 5A4EA 1QPJA 4K11A 1J7IA 4BDKA 4WSYA 3ENHA 4DFNA 3LFBA 4AZVA 2UZBA 3PLSA 5DNRA 5E8WA 3DBQA 3R04A 4IEBA 4EOSA 4HVIA 2GHLA 1S9IA 4FZDB 1UU9A 2A4LA 4F1MA 2UW9A 3ZLYA 3Q5IA 4NCTC 2YCFA 3ZEPA 2X7FA 3BGQA 3UYTA 2P2HA 3QGWA 3Q96A 2PE0A 3L8VA 4FKLA 3PPZA 3KVXA 3WYYA 4AOJA 1OPLA 4BCNA 3HRCA 3V5JA 4BC6A 4X6RA 3KGAA 4Y73A 4WT6A 4YTIA 4GEOA 3QBNA 4XP2A 5HG9A 3EKKA 3CD8A 4YZ9A 3BELA 2XKEA 3WILA 4B6LA 2VWVA 3AC2A 3D9VA 3ZZEA 1O6YA 3IQ7A 1XH9A 4MNEA 1AQ1A 2UZUE 3FZOA 4TYJA 4H3BA 5E8ZA 3DJ6A 2V62A 5TE0A 1VLRA 5LVNA 3IECA 4RJ6A 2XM8A 3NWWA 5IEXA 3FHIA 1WZYA 3ZSIA 3P1AA 4FG9A 1K2PA 1ZRZA 2YZAA 1W82A 1H25A 4HGLA 4EK5A 3MY1A 4Z16A 3T3VA 4ZZOA 3AT4A 4ITJA 5I9VA 3HDNA 4W8DA 4XH6A 3ZRKA 4H39A 4CYJA 2Z02A 2YLEA 3PVBA 2BZIB 1QPDA 3SG8A 2VTRA 3F5PA 4EKLA 2P2IA 4QMVA 3VS3A 3AMYA 4FZ6A 1W2FA 3Q9YA 4RVKA 2GTMA 5AV2A 3F66A 4FG8A 4FKWA 4JBPA 4QMNA 2R4BA 4BCHA 4Z7GA 5HIBA 2VO7A 3HV7A 2YCQA 2C6LA 4PNIA 2HXQA 2ZB1A 3IDCA 4UXQA 5I3OA 1Q3WA 2QG5A 4O1PA 2NYAA 4GFMA 2ZV2A 3LAUA 2F49A 4K2RA 3ORZA 1WFCA 4EONA 4O6EA 4ACHA 1GNGA 3WE8A 1VZOA 5GZAA 4CGAA 3A7HA 2GTNA 4BZOA 3F88A 3U51A 3TNWA 2FH9A 1Q8YA 2CJMA 4L9IA 5CANA 3A7JA 3GGFA 1NY3A 4WNKA 2J7TA 2B55A 2VWWA 4U43A 2AQXA 4NFMA 4GIIA 3PSDA 3TDVA 2ITTA 4M97A 3WE4A 4USEA 1K9AA 2C6OA 3EQPA 5EYMA 4FF8A 3VRZA 5LMKC 2Q0BA 2ITPA 3CXWA 1T45A 3DBCA 4O21A 2BDWA 1ND4A 2BMCA 3HMOA 2OKRA 4ZXTA 4FT9A 2PVHA 4BICA 4IZYA 1JWHA 4RWKA 3VRYA 4FKGA 5HKMA 2HZIA 1SNXA 2YN8A 4XNEA 3OVVA 3B8RA 3QCXA 3ODYX 3RPOA 3QC4A 4FK6A 4EI4A 2OZAB 3BYUA 3ZDIA 2ITNA 5BVKA 4GCJA 3PP1A 5A4TA 3VS0A 1FVTA 4XG2A 4BGGA 3RP9A 5HO7A 4KAOA 4BGHA 4KIOA 4MQ1A 5AP2A 3W10A 3I60A 4L53A 4EH9A 4RVLA 1ZOGA 4CKJA 4RJ5A 5AR7A 2X0PA 3E8DA 4I3ZA 4X0MA 3LZBA 3FMHA 2UW0A 4X3FA 3CPCA 3E87A 2PULA 4DDGA 3BHVA 2IZSA 2IEWA 2BPMA 3Q4UA 1IAJA 3QHWA 1H27A 2XK8A 2IVUA 1QPEA 3LMGA 3OTVA 4D1ZA 3U54A 1OGUA 2F9GA 2O63A 2F7XE 2WTVA 3PUPA 3VBWA 4ORKA 5M07A 4OLIA 4D5KA 2NPQA 4NUSA 4HVDA 2C3JA 3F2RA 3UDSA 2PZ5A 1XBCA 4JG6A 4H05A 3I6WA 5CYIA 5C27A 4DGOA 3RNYA 3FLQA 2X0GA 5L8KA 3O17A 5ANIA 2W4JA 3MS9A 2F2CB 3IGGA 3OCGA 1GIIA 5HICA 2O65A 3EHAA 1VYWA 4GG7A 4FKTA 4J96A 3TN8A 4FJVA 3HEGA 3PIZA 4O96A 3DBFA 4YJQA 4AGDA 2Z60A 5IA1A 5CNOA 2HOGA 2HXLA 5FEDA 2CGXA 4E6QA 4R8QA 2A27A 4ACCA 4FKVA 4LGDA 4FTUA 5IDNA 5CEPA 2WOTA 2VZ6A 2PK9A 1JAMA 4I20A 2FB8A 1B39A 3ULIA 4MAOA 5CAUA 3AOXA 5CAOA 1JNKA 1K3AA 1R78A 4WNMA 5FTOA 1VYZA 2C5YA 4TYHB 4FV5A 2O2UA 3IW7A 4L3PA 4AN3A 4JQEA 1OGYA 1FINA 2XKCA 4CZUA 5HG5A 4AW0A 4E3CA 3AKKA 3UNKA 3R1YA 4TTHB 4XG7A 2WTKC 4AGWA 4BZNA 4RJ4A 3E3PA 2BAJA 3NYXA 5C4KA 3GU5A 3UTOA 1A06A 2VO6A 1WVXA 3IW6A 4KABA 3QYWA 2B7AA 2OU7A 4LV8A 2ZAZA 2QO2A 4QMSA 3UO4A 3CQWA 3K54A 2W1HA 3RCDA 3W16A 5KMNA 3R0TA 4RIYB 1U54B 4HPTE 2OICA 4YZMA 3THBA 5D12A 2YCRA 3FZSA 3FI8A 2WTKB 4LRMA 3QQGA 5DYJA 2XJ1A 4Z3VA 3C51A 3QRTA 5FM2A 1XBAA 5C4LA 5HORA 1ZY5A 5LXMA 4L43A 3D2IA 4FSWA 4EBWA 2V7OA 2W5HA 4C8BA 3OOGA 3G5DA 4F7SA 5IMEA 4PY1A 1QCFA 4FTRA 3QFVA 5BVDA 1TQPA 2H96A 4B99A 4Q9SA 3VJNA 4JI9A 5ANKA 4GK3A 1VEBA 5J87A 3ZM4A 4HW7A 5I9WA 3VUMA 5IQCA 3GT8A 3R7IA 1YKRA 4QMUA 2YZLA 2PVKA 3VAPA 3BV3A 4QYEA 3CLYA 5A54A 2C68A 2ETRA 1KSWA 4RG0A 3UIBA 4KKGA 4YZBA 4YTHA 3TTIA 3OCSA 2EUFB 5AP3A 2CDZA 3PWYA 3RHXA 4FVQA 3MVHA 4RA5A 4EOPA 1YW2A 4FX3A 5HHWA 1R3CA 3UYSA 5BUJA 2E9VA 3FXWA 5KMIA 1W7HA 5IEYA 2PL0A 4W4VA 3PXYA 4AT5A 5M56A 4BKZA 4FTKA 1SYKA 3QKKA 2HK5A 4PWNA 4TZRA 2PVNA 3NUSA 4TWPA 4HNFA 4ZSJA 3SLSA 2JDRA 2R64A 3MW1A 5I9UA 2OXXA 2WTDA 3W0RA 4Y85A 3TZ9A 3DXNA 3A4PA 3ODZX 1PXIA 3AXWA 1O6KA 4YC6A 1YWVA 5L2TA 1Y6BA 4C37A 4XS2A 2XARA 4D58A 4RRVA 5LVMA 1PXKA 3N51A 4PTGA 4QNYA 3PA3A 3WZEA 4EQCA 3H0YA 4B4LA 2WOUA 3TV7A 3ORNA 3COIA 3I7CA 4PX6A 2QOOA 5L2SA 5K3YA 4LQMA 3KN5A 3M1SA 3FE3A 5E92A 1PY5A 4LV5A 2GMXA 2PMLX 3UVPA 3EN5A 4IB5A 3SAYA 3VW8A 3WZUA 3S4QA 4ZK5A 3SQQA 5DWRA 2OXDA 4XBUA 4ALVA 5CEMA 3KVWA 4LL5A 2VWIA 4USDA 5I4NA 2WFYA 3FY0A 2XNGA 5AR3A 3BL9A 1CKPA 5JQ8A 2GS2A 5E9EA 4QQCA 2WIPA 3IDBA 5F9EA 3A7FA 2GNGA 1L3RE 2X2KA 4XBRA 4ZJJA 4EHGA 5LQFA 4CEGA 3GI3A 4DBNA 4Z9LA 4WSQA 4YMJA 3GC9A 2QODA 2XEZA 1XMMA 3MY0A 5CQUA 4CT1A 4IH8A 3ZFYA 2OWBA 4QP3A 4O0XA 5HQ0A 1B38A 1FBNA 3R71A 3GVUA 4AZSA 4JRNA 5A9UA 2JEDA 5IISA 2WTIA 1YOMA 4DFXE 2PPQA 3QUPA 2FSLX 2Y8OA 5GJGA 4R5SA 4R3RA 4B0GA 2VO0A 4PP7A 2XNEA 3LPBA 3MVMA 5AR5A 3KCKA 4L46A 3QA8A 4E7WA 1YDRE 4QTDA 2FSMX 3A61A 4QPSA 2ZMDA 3IOPA 3OC1A 4Y95A 3UMWA 3SX9A 2EWAA 2X1NA 3A2CA 3PIYA 1DI9A 4FKQA 2RL5A 4EK6A 3HMNA 1YDSE 4I5HA 5AUWA 4X21A 4O7YA 2CCHA 3FL4A 5DIAA 5LWMA 3PPKA 5CLPA 3R7UA 4BY9E 5CNNA 3K2LA 3L8XA 4ALUA 5AUTA 3V04A 4ZAUA 2JDOA 4NK9A 3Q9XA 4O38A 4XUFA 5AJQA 1CTPE 4JR7A 5HI2A 2XRUA 2IG7A 2W1DA 4RIYA 3RZBA 2CNQA 3MI9A 4I22A 3V51A 4R78A 3DQWA 1OKWA 3K5UA 2CKOA 4UN0C 5HX8A 1OIUA 1SVEA 3ZRMA 4FNXA 2PY3A 4I4FA 4YLKA 4DEIA 4BCIA 4FV1A 4C62A 1UU3A 4RC2A 1U4DA 2VUWA 4D2VA 3CBLA 3O8UA 3RCJA 5HZNA 5LJJA 3BHUA 5ITAA 4ZY4A 2X8DA 3FKNA 3FLNC 5EFQA 4BBMA 3F82A 4ANBA 4IM2A 4GVAA 5EQPA 2BVAA 3PIXA 2VTAA 1SZMA 5FEQA 2V5QA 3ZO3A 4DYMA 4CNHA 3C5UA 1TFFA 4IFGA 2J50A 4QP4A 4HZSA 4DCEA 5LVLA 3BU6A 3FI2A 4QQJA 4RQVA 4E93A 1R0EA 4O4EA 3L9MA 2CLXA 4LOOA 3G33A 1SVGA 3RAIA 3VQUA 3AD6A 2JBOA 5HO8A 3JYAA 4EL9A 5IQFA 4KBCA 4EH4A 5KCVA 2JKKA 3F3ZA 3ETAA 4Z7HA 4XEYA 4TY1A 3VBTA 4WOVA 5DBXA 3PFYA 4IX5A 1GY3A 2XK6A 3DK7A 1HOWA 1WBSA 4QO9A 5DG5A 4V0GA 5AUVA 2ITOA 2OH0E 4IHPA 4KWPA 3QXPA 4B8MA 4C36A 4GKHA 4DG2E 4O0YA 4FEXA 3UDTA 4EHVA 3ET7A 2YM3A 3U6IA 1PYXA 2VU3A 3B2WA 3LHJA 5H8BA 3R2YA 4O81A 4AW5A 2XK3A 1R1WA 4O2PA 2C69A 3PA4A 2HZ4A 2FA2A 4DG0E 5TO8A 4RIWA 3PUFC 3G6GA 2ITWA 2Z8CA 3NPCA 3FHRA 5CSXA 4S34A 5M44A 3H4JA 2WMSA 4O4FA 4AG8A 5IDPA 1NT2A 4DFUA 5HTIA 3V8WA 4QMQA 3AT2A 3P7AA 4UYAA 3C5IA 4YJNA 1OMWA 4FEQA 3QLGA 1Q3DA 3FUPA 3WBLA 2GPHA 2PUPA 5JK3A 2BRNA 4UWCA 3VUDA 5JGDA 3QX2A 1OIRA 4C4JA 4K33A 4FV7A 1MRVA 1URCA 2HY81 1KV2A 5IQDA 5L4QA 5EM5A 4W4YA 2WELA 4HNIA 1YHSA 2PVYA 2WO6A 4DG3E 5A4CA 3ZUTA 3AQVA 3DBEA 3NMUF 3LFSA 4M84A 1XH4A 3PJ2A 2BILB 2SRCA 3II5A 3FLYA 3KK9A 4L3JA 5B2LA 1OM1A 3QTIA 4IAAA 2PYWA 2Z7RA 4O7ZA 4J7BA 3LJ2A 4CV9A 2VX3A 4DH5A 5DE2A 4WUAA 4FEWA 2G15A 3AD4A 4EJNA 4QMXA 3MPTA 3QQFA 3KU2A 3SW4A 3WARA 4RPVA 4KIKB 5AP5A 3LE6A 4F63A 4ZOGA 4IX4A 5ETIA 1J7LA 2V55A 3LOKA 3GFEA 1OIYA 3MY5A 4XG8A 2IN6A 2XYNA 1M7QA 3QD2B 2VWBA 1Q4LA 4M69A 5DVRA 4RJ8A 3TNQB 3ZONA 4DN5A 3H9OA 3HMMA 5K5XA 3IKAA 2JIVA 3UMXA 4IMYA 2C6IA 4BCOA 3D4QA 1X8BA 3P0MA 1OBGA 2YM5A 3Q4TA 4OTDA 4GYIA 2GHMA 3FL5A 4M14A 5KBRA 4E73A 4B7TA 2XBJA 1M17A 4I94A 4M8TA 4BL1A 3HYHA 5FDXA 4AOTA 4CFFA 3EFWA 3WZKA 3Q4CA 2JC6A 4IM3A 3TWJA 5HTBA 4CG9A 3EKNA 3QWJA 5CU0A 4BDHA 5D7AA 3C4CA 5IU2A 2OJGA 3C0HA 3H10A 2VTLA