3UVPA

Human p38 map kinase in complex with a benzamide substituted benzosuberone
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
348
structure length
334
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting the Hinge Glycine Flip and the Activation Loop: Novel Approach to Potent p38 alpha Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 106
structure length 334
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvpA01
3NZ0A 3QRJA 2BFXA 1FVVA 2IZSA 3TKHA 3RWQA 2EB2A 2F49A 4DEIA 3R02A 4FNWA 1OUKA 5IEXA 3G6GA 5LQFA 3QTQA 5EFQA 2XK8A 2BRNA 4NJ3A 4IX4A 4J98A 2IJMA 3BHYA 4EBWA 3UNKA 2GHMA 4MTAA 2P4IA 3BBTB 3R1YA 4AX8A 1UKIA 4FOBA 3QRTA 4E6DA 3JPVA 4MF1A 2BMCA 1ZZ2A 4FK3A 4FZ7A 5C8MA 3GP0A 4Y46A 4YBJA 2GMXA 1YRPA 3P5KA 5KBRA 4FE2A 2PZYA 2BZKB 1YHWA 4ZMEA 4YJRA 2HZ4A 2YCSA 5I0BA 2B52A 4O0SA 3GBZA 4D5KA 3R8ZA 2O0UA 2RG5A 4E6AA 1BMKA 5LWMA 1GIJA 2YABA 4WOVA 3BKBA 1CDKA 3VN9A 2VGOA 2YERA 4DFLA 3I0QA 5HBHA 5IZFA 3KB7A 3FXWA 4NK9A 2PVJA 4DH7A 2GHGA 3PE1A 3SD0A 4W4VA 4NIFA 4JQ7A 3W1FA 4ACGA 3MVHA 4XG9A 2BZJA 4FIFA 3ZZWA 4JI9A 1GAGA 1JOWB 4UMTA 1IAHA 3QTSA 1PXLA 1WZYA 3DU8A 5AP3A 4C59A 2J51A 3BHVA 2UVYA 1U5RA 3CLYA 2XIRA 3BE9A 3L1SA 4G3DA 2PPQA 4JBOA 3VBXA 4N6YA 3R9DA 3TIYA 4DINA 2B53A 2PVHA 2H96A 3A61A 4RIWA 4F0FA 5JGAA 3R7OA 5C27A 4GL9A 4FF8A 4XBUA 5ETFA 3IW5A 3L8SA 4IVDA 2WELA 4XP0A 5H8GA 3RALA 4FOCA 4D1SA 1VR2A 2V0DA 3ORPA 3ZRMA 5GZAA 3FXXA 4ZAUA 1Q8UA 3CE3A 3W18A 2WOTA 2C3KA 4FT0A 4BCIA 2IW6A 5AX9A 2ZV8A 4QMZA 2WIHA 3LCTA 2I0EA 2ITZA 4XMOA 3Q9YA 4PX6A 1JBPE 5HEZA 4A9SA 3GU4A 4EK8A 3A2CA 3GFWA 5A4LA 5EM5A 1Q4LA 4GT4A 4TYHA 4UZHA 2H9VA 3O7LD 4H39A 4BBMA 1ND4A 3CSVA 3GCQA 4GFMA 4EOIA 4FV2A 5IA2A 3NW7A 5AUXA 2OF4A 3TJCA 4JG7A 5C4KA 1O6YA 1LEZA 2X4ZA 2XS0A 1WBOA 4O7VA 3DBQA 3GC8A 3MVLA 4DT9A 3NW6A 5AP0A 4ASZA 1YDTE 4GFOA 2X7GA 4O0VA 3CY2A 5AUWA 3ZO3A 1OIRA 3RK5A 2OG8A 4IC7A 4YU2A 3EH9A 4PDOA 5FRIA 3PJCA 4QMOA 4O6EA 4BF2A 3HMOA 3V3VA 1BL7A 3AD6A 4NU1A 4FKVA 4KWPA 4TY1A 4B6LA 3HRBA 2XNBA 3VS0A 4O7ZA 5AR8A 2J4ZA 2UW4A 4IAIA 3HX4A 2NNWB 3S2PA 3NAYA 3FLSA 5CNOA 4F99A 4DH5A 2WEVA 1H08A 5D1JA 1AGWA 4UMUA 4GEOA 1ZLTA 4X3FB 2XB7A 1G5SA 3CCNA 3LW0A 5FXQA 2C6EA 3I5NA 1CKJA 2XNPA 3AXWA 4FNXA 4YC8A 3DJ7A 3ZUVA 3RINA 4D28A 3R01A 4YC3A 2PZ5A 1LP4A 3GENA 2ZMDA 5AMNA 3P7CA 2GHLA 5AUVA 4OTRA 5TE0A 4O1PA 3BYOA 3RBWA 3D7TB 4BHZA 2P0CA 3HP2A 2XJ0A 3IDPA 1YI3A 5CSWA 4KBAA 1A9UA 3QQFA 3BWFA 5CAQA 3ZBXA 4CT1A 4BCQA 5IQFA 3ZSIA 2BDFA 5DFPA 4MXCA 4F09A 4ZY5A 5L2WA 5E8SA 3A8XA 4YSJA 3SXSA 2IVUA 3KQ7A 4H58A 4D2SA 2O8YA 4HNIA 5I9YA 4EH5A 3CY3A 2RFSA 5IQIA 3VUHA 2VAGA 3QQHA 2ERZE 5KMOA 2QOQA 3DTCA 5HE0A 3HV4A 4FT9A 4OTHA 3ZLXA 4X2FA 4DFZE 4PTCA 4N6ZA 3ZO4A 3UIMA 2JAVA 4DFXE 2GPHA 3OCTA 1NVRA 2FO0A 3R2YA 1ZWSA 3R7GA 3QQUA 1CMKE 1FGKA 4MEDA 4O0WA 3D5VA 4EOLA 3PE2A 3KGAA 3Q2JA 4FIHA 5E1SA 5CEMA 5HI2A 3ZXZA 3RAHA 4BY9E 5DWRA 4ZSEA 4H1MA 2PL0A 3OC1A 2FSOX 2OW3A 2WQOA 2YEXA 4W4XA 4BBEA 2GCDA 5KMKA 3AC2A 4P5QA 5JFSA 3R9OA 1OMWA 4FL1A 5GNKA 3TV6A 2C6OA 3QBNA 4PY1A 4HNFA 2C6MA 3DY7A 5CQUA 1MQ4A 3NNVA 4AZEA 3V5JA 1Z5MA 3EOCA 4IVBA 2YIWA 3BELA 3PXYA 5EDPA 3Q9ZA 5HE2A 2LAVA 4FVQA 3TI1A 3BHTA 3LMHA 5HBEA 4FSRA 2VN9A 5CU6A 3R7EA 4NEUA 3EYHA 2ITOA 4GFGA 3LCKA 4EOSA 3HAVA 3KMUA 4FG8A 3R8PA 3CTQA 3F61A 3LOKA 3UYTA 2VO0A 3EMGA 4AW2A 3SG8A 4R3CA 4Z55A 3AOXA 2HWOA 3RK9A 2BROA 2VUWA 2ZV2A 3DJ5A 4GUEA 5I4NA 1I09A 3CGFA 3F69A 4UB7A 4BYJA 2YLEA 2X9EA 3I60A 5A6NA 2P2HA 4WBOA 2UW6A 1ZZLA 4IBMA 4OBPA 2UZWE 4BFMA 3EKNA 2C5YA 1PXMA 4YJSA 5ETAA 5CAVA 3TV4A 4O7SA 5J7HA 3P9JA 5GJFA 4EZ3A 2G9XA 1YDSE 2OICA 2JBPA 4LV5A 2WMAA 4A9RA 3FSFA 2XNMA 3RVGA 3LKMA 4QPSA 3VS3A 4LV8A 5DEWA 4NYEA 4FV7A 5H8BA 3ZZEA 4C37A 4FTKA 3WZEA 3L8VA 4C34A 3FMKA 3HV6A 4UXQA 2Z7LA 4CZUA 1PYEA 4O82A 2OKRA 4UBAA 1KE7A 3MH1A 3TZ8A 3HKOA 2PVMA 5CI7A 4DCEA 3O17A 3E63A 3D5WA 3W2QA 4AA5A 1XO2B 3AMAA 5A9UA 2VTAA 2XNEA 3R8VA 1UA2A 2GDOA 3QGWA 4M8TA 3W2PA 4XJ0A 2XKCA 3FL4A 5IH5A 2IO6A 3DAKA 3MPTA 4ZXTA 3LHJA 4I94A 2ZVAA 3ZU7A 3EN5A 2GSFA 4BDFA 3WILA 4EEVA 5AUUA 2ETRA 3LPBA 2ERKA 4Y5HA 5CANA 3EHAA 4LL0A 5B7VA 2W7XA 3GCVA 4WG4A 2C1BA 3BGPA 1OI9A 5JSMA 2DQ7X 4RZVA 1XQZA 4W4WA 3MIAA 4XH6A 4CT2A 3IW6A 3EYGA 2B9HA 3A4OX 3IW4A 4NCTC 4F9BA 4FVPA 3U6HA 2C6DA 4IACA 5ETIA 5LMBA 4IAKA 5K0XA 3A7IA 3UC3A 1FOTA 4MXAA 4IVCA 4CMOA 4ZP5A 1E9HA 3CC6A 4AOIA 2WMBA 3RJCA 4APPA 5C8NA 3LZBA 1OL5A 1TVOA 4GMYA 5A4QA 1UU8A 2VTNA 1K9AA 3GI3A 4QP1A 4F08A 3ACJA 3MVMA 2PUIA 5BYZA 2Y4PA 2JFMA 4TYGA 3K2LA 5ACKA 1OKYA 2O64A 2XVDA 2J9MA 4M68A 4JNWA 3NDMA 4PMMA 3ORTA 2ZB1A 2P3GX 1WMKA 3C4FA 3CIKA 4FTUA 3ORNA 4EK6A 2C68A 3HRCA 4AXAA 3F66A 2WFYA 5LARA 4YJVA 2GQGA 4ZSLA 4CZTA 5CU3A 4OR5A 4LM5A 3V5PA 2WMQA 5HX6A 4UYAA 3UVPA 3TZ7A 4F6SA 1ZY5A 4DBNA 3DXNA 4YR8A 5HKMA 5HTBA 1H1RA 4G6NA 5LVPA 4U0IA 1Q61A 3KL8A 4GK3A 1STCE 1M2RA 4BZOA 4X2JA 2X2LA 4XV1A 4IAAA 4FVRA 1SVHA 4I22A 4D2WA 2VTOA 4NW5A 3L9LA 3HGKA 2F4JA 4L01A 4QNAA 4RQKA 3LLTA 3POZA 4ANNA 3CD3A 4O0YA 1Q8WA 4C4JA 5LMKA 2ITQA 4XG6A 1XH4A 5L8JA 4RX7A 2W1HA 2YWPA 4JG8A 1K3AA 3KK8A 2O65A 2PMOX 3EQIA 4KAOA 4M15A 3TIZA 4F7LA 3K54A 5DE2A 4FSTA 4K18A 2X8DA 4PMTA 4EK4A 1WBTA 1CSNA 1ZOHA 3V04A 3V5WA 5AAGA 2R64A 3OWPA 5M08A 2PVFA 1Q8YA 2GNFA 4O0RA 1DM2A 5LVLA 4FKQA 3IS5A 5FG8A 2O5KA 2OFUA 2V7AA 3NNUA 2FSTX 4IAZA 1JKLA 4JX7A 3V5LA 4G5PA 2W5BA 2WTIA 4GKHA 4D9TA 2JIUA 2H8HA 5HVJA 2QLQA 5KZ0A 4BKZA 5K3YA 1PMUA 2GQSA 1H26A 1FMKA 4YPDA 3SVVA 3KVWA 3LXNA 4BTMA 4ITIA 3KU2A 3UP7A 4IEBA 4GK2A 4Y95A 2XRWA 3NIEA 1UNLA 3GC0A 4FZ6A 3BHHA 1JKSA 2IWIA 2WEIA 2C5NA 4MKCA 4PQNA 4U42A 2W1ZA 4X3FA 4C36A 4D2VA 3PLAE 4OTFA 5AUZA 4BDCA 1JLUE 2C6TA 2VO7A 4C2WA 5E1EA 3R9NA 1YHSA 4ZIMA 4FEUA 2OBJA 3HMNA 2ACXA 3QTIA 4PPBA 4EWHA 3KRRA 2WGJA 3BLRA 4ZJJA 3TT0A 3EB0A 3ORXA 2XNOA 3Q52A 3SX9A 5JKGA 4FL2A 2CGWA 4CGAA 3NS9A 2ZJWA 3L9NA 4BDDA 5E92A 1PMEA 5HG5A 4YHFA 5AP4A 4ERKA 3LM5A 4IJ9A 2BZIB 2PMLX 5T68A 4J99A 4NM5A 3GU7A 5AADA 5JGDA 4O86A 5GINE 3OVVA 5LCKA 5DEYA 1B39A 3G2FA 3Q96A 4M0YA 3SKCA 2GU8A 4CYJA 4F70A 2O2UA 4CNHA 2ONLA 5LXMA 3RNIA 4RJ8A 4I21A 4M69B 4YNOA 2UZVA 3UC4A 1JKTA 3VHEA 2OI4X 4XCUA 4DT8A 3FLZA 1FVRA 3AC1A 4GYGA 4TNBA 4YJOA 3C7QA 5EHLA 2W9FB 4S32A 4L45A 3OEZA 3PXRA 2V5QA 3BIZA 3OWKA 4G6OA 4IDVA 4G5JA 4RWLA 4QPAA 4TYEA 1M17A 2EXCX 3TNHA 4BWPA 4D0WA 4BBFA 5FTQA 3UO6A 2XNNA 3TACA 2BUJA 2GS6A 4XV9A 4YLLA 5BVOA 5IQBA 4MBIA 2C6KA 5HVKA 4L42A 2ZV9A 4HGSA 3H0YA 1M14A 5DOSA 1SMHA 3UPXA 2QOHA 4G6LA 3GNIB 3R73A 2OIQA 4ZOGA 4BTJA 2RGPA 3LCOA 1BLXA 5EOBA 4DGMA 4C3RA 1J7LA 4JBQA 4RIWB 1OGUA 3BYMA 3WOWA 1OIYA 4O6LA 3G9LX 5FM3A 4B99A 3ATTA 4WSQA 3CTHA 5B2LA 2ITUA 2Z7QA 3BZ3A 4QYHA 5AP6A 4BCGA 4ACCA 4BCJA 4MHAA 5F4NA 3PTGA 4XP3A 1Y6AA 2CPKE 1H0VA 1KV2A 4PL5A 4NIFB 1W8CA 3PG3A 4YNEA 5AFVA 2IVVA 1YWRA 1OKZA 3R71A 1G8SA 4IZAA 5CU4A 3NYOA 5C26A 4KBKA 2OGVA 5CX9A 1PXIA 5JRSA 2QOCA 4PL3A 4R8QA 3HV5A 4DAWA 1UNHA 3QZIA 4FTCA 4IFCA 2F7XE 5FEDA 3T3UA 2QG5A 4OGRA 1ZAOA 3S95A 4QP8A 1W82A 2FUMA 1S9IA 2B1PA 4O1OA 5LWNA 2PULA 4NUSA 2JKOA 3NUXA 3UDBA 3TZ9A 4DEGA 4DLJA 4L53A 3KCKA 5DPVA 2X0GA 2E9NA 3IGOA 2J2IB 5A54A 5JMSA 4L3JA 3T9TA 3ZFMA 1H8FA 3C9WA 4LGGA 3PDTA 2XBJA 3T9IA 2BIYA 2R2PA 3A99A 4RG0A 4M97A 3PWDA 1ZYJA 2BVAA 3RNYA 4OT6A 4OBQA 2I0HA 3VBWA 4Y85A 4ANQA 2WU7A 5CZIA 3UGCA 3UE4A 2W4KA 2HWPA 3OBGA 1WBVA 3MH2A 4J52A 3NUNA 1BI7A 4JRVA 4UMRA 2OZAB 5HNIX 4G34A 1APME 2ZOQA 3HV3A 3JY0A 4OBOA 3T8OA 2R3FA 2Y6OA 4WHZA 5E8ZA 5I9XA 3I6WA 2J50A 3ORMA 4RVKA 4HPUE 1H01A 1V0BA 5BVNA 2HW6A 2WMTA 3FJQE 4NFMA 3EL8A 5EYKA 4D2TA 5IDPA 5HTCA 1OPJA 5J87A 3FQEA 3OTUA 5M55A 2XK6A 5DT4A 3IKAA 4S33A 2V22A 5HICA 2QCSA 3IONA 2WTKB 3KULB 2VTIA 2NRUA 4X2NA 3O8PA 4TWOA 1BI8A 2F2UA 4WO5A 4U80A 3SQQA 5M06A 2WMRA 2R5TA 2HIWA 2R0IA 4IVAA 3KXHA 3VWAA 2QOKA 1M2QA 1K2PA 2ITYA 4IW0A 4TZRA 4QMYA 4C2VA 3QZFA 4AT3A 3R8MA 1XBCA 3KMMA 3P23A 2OXYA 3V8TA 2H6DA 2CLXA 4FSYA 5BVDA 5HX8A 3BI6A 4KNBA 4TRLA 4BHNA 1S9JA 1X8BA 4FSZA 4FV8A 4LRMA 1GIHA 4BC6A 4H05A 4KS8A 1WBNA 3ZBFA 3SGCA 1REKA 4KIPA 2G2HA 5CXHA 3E8CA 5M4UA 2F57A 4I4EA 4HYIA 3E3PA 4AF3A 4IAYA 5CWZA 3UMXA 5JT2A 4PDYA 4A4XA 4EI4A 4V05A 3ZXTA 2JDVA 3LMIA 4X0MA 5DNRA 3QQKA 2PZIA 1PXJA 3G0FA 4S31A 4WG5A 3DNDA 3GU6A 3PG1A 3D94A 3FE3A 3OD6X 4ACHA 2J0IA 3Q04A 5AEPA 2R3NA 1J7IA 4RQVA 2P33A 4GUBA 3WZDA 2UV2A 4ARKA 3O0GA 5IQAA 5EYDA 2XJ1A 4K9YA 3FI4A 4R5YA 3OROA 5AP5A 3RKBA 5IA3A 3R8UA 5ANOA 5KBQA 3OMVA 4OTIA 3FZOA 4FIJA 4ALWA 2G15A 4OAUC 4I20A 3F2AA 3NNXA 1JWHA 3BV2A 5E8XA 2XEYA 4AZVA 3U55A 3EQPA 5KE0A 3O71A 3RHXA 3PXZA 3PIZA 3CJGA 4H3BA 2A2AA 3UZPA 3EFJA 2QURA 3NUPA 3NX8A 4NKSA 3P08A 4J7BA 2VRXA 2XCHA 2J0MB 2WMSA 4FUYA 4ZTMA 1PY5A 2ZAZA 4BGQA 4BI0A 4X6QC 2W99B 3CEKA 5E8WA 3VS6A 3IW8A 4FV9A 4AN3A 2OH0E 4AN2A 4EJNA 1URWA 3GCSA 4HZSA 4W4YA 1ZOEA 4KBCA 2R3KA 3QUPA 4JAJA 4B0GA 2UVZA 2W4OA 3HL7A 3OTVA 3PY1A 3NNWA 3D2KA 2PE0A 4K11A 4EOKA 5K4JA 3C5UA 3COMA 3JVSA 1U5QA 4ZJVA 5FUTA 3G51A 4D2RA 2ITVA 2R3JA 2VTJA 3D9VA 3M11A 1W98A 3QC9A 4RIYB 5B2KA 3DK6A 1Y91A 4G9RA 3NUSA 4J53A 2Z02A 4AA4A 4WKQA 4EQUA 4F4PA 2E9VA 4BCHA 3QLFA 1WBSA 2PHKA 4ZTRA 3UODA 2UZBA 2WNTA 1GZ8A 3BE2A 4GV1A 2QO9A 1XH8A 4Y72A 5EW9A 2CGXA 3II5A 3UIBA 4FV3A 4QPMA 4F9WA 5IUHA 2XA4A 1QCFA 2O3PA 3QALE 3FL5A 3DDQA 1H07A 4NFNA 4K33A 3L8XA 4Z7GA 5M56A 5HNBA 1PRYA 2VTLA 4EOQA 4XX9A 3K5VA 5ACBC 5KMJA 3AC8A 4GJ2A 3NVMB 3PPKA 3MYGA 2OXXA 1ZYDA 2VWXA 3DGKA 4FT5A 3K3IA 5AIRA 4AOTA 4Q9ZA 5L6OA 2NRYA 3EQHA 5FP6A 5LCJA 3WYXA 3IK3A 4ENXA 2W06A 2QU5A 3ALNA 2W0JA 3E87A 2WMVA 4KRDA 4M66A 3AGLA 3EQBA 4I6HA 4N4SA 3CP9A 4X21A 2CKEA 3Q4TA 5KUPA 3O96A 3N4UA 3ZLYA 3ZM9A 2QOIA 4EYJA 4I5PA 3W2RA 2GS2A 1AD5A 2BRBA 3MA3A 3MV5A 4ZY6A 5KO1A 1GY3A 3G0EA 2J0KA 5HE3A 2R3QA 4L8MA 2OIBA 4I5CA 3W8QA 4PV0A 2JDRA 4IIRA 1R3CA 4BZDA 3HMIA 2QG7A 4QP9A 2XRUA 3CR0A 1FMOE 5HNGA 3OUKA 3EN9A 1NA7A 3R04A 5AP1A 2ITWA 3SV0A 2W05A 3BQRA 3H10A 3PY0A 3DLZA 3GOPA 4QMTA 4TXCA 1UKHA 1G8AA 2FGIA 1OL1A 3PVWA 4WA9A 4AZWA 2QKWB 2WMWA 4DG2E 1UVRA 4FV4A 3N4VA 3IQ7A 4G1WA 2CSNA 2QR7A 4YGAA 2IVTA 3F9NA 3PVUA 4AT5A 3ERKA 4YZDA 3SRVB 3Q5IA 1H1QA 2PVYA 4FA2A 4O83A 4PMPA 3D5XA 3RWPA 2OSCA 3E92A 5E8TA 3ZRLA 4C35A 3LLAA 2VTQA 5K5XA 4I1ZA 2XK3A 3FMMA 5C4LA 1P14A 4O0TA 3GFEA 4CTCA 5CAUA 1QPDA 1CKIA 4DTKA 4NM0A 5CSVA 3DV3A 4GSBA 3G9NA 1OITA 4G31A 4W9WA 2IPXA 1RJBA 3WBLA 2XIXA 3VS1A 3RAIA 3ENMA 3RZFA 1TQMA 3E88A 3A62A 4JQ8A 1NT2A 3WF8A 1W83A 4ZS0A 3C0HA 4KKHA 1YWNA 3VS2A 3VULA 3VO3A 4ONAA 5J9YA 3DQWA 4CXAA 1R0EA 3OOMA 2RG6A 2WB8A 1Q24A 2CGVA 5L4QA 5KNJA 3A7JA 1OKWA 4C4FA 1KUTA 3AGMA 4DC2A 1O6LA 4ERWA 5DYJA 2C47A 3R9HA 2IZRA 2C0TA 2Z7SA 3L8PA 2CKPA 4DH1A 4AFEA 1H28A 1O9UA 3G5DA 4DGGA 1PMNA 1ZOGA 3W16A 3VUGA 1OKVA 4D4VA 5FTGA 4YTIA 3AQVA 4IFGA 2QC6A 1KE6A 2YN8A 3E8EA 5KZIA 4QQCA 3EQCA 3BCEA 2JBOA 4XLIA 4XYFA 5EM7A 2HK5A 2WTVA 5BUJA 2PWLA 5F9EA 3NIZA 5AV4A 2CNVA 4DG3E 3VBVA 4HZRA 4R7HA 4FKSA 3WF7A 4YJTA 4OTGA 4ALVA 2UW0A 4PDSA 5CALA 4YTHA 1P2AA 4PWNA 4BZNA 1QMZA 3PXFA 3A60A 4JLCA 2J5EA 2ZMCA 3LJ0A 4XRLA 3QHRA 5IDNA 3H9OA 3I0OA 5EQEA 5IH6A 4CCUA 4ANBA 4FV1A 5CEQA 2YAAA 4R7IA 3PJ2A 4DYMA 5AR2A 1JVPP 1LR4A 4ANOA 2HENA 1GZKA 2WQEA 1GOLA 3N51A 3QAME 3A7GA 5HCXA 5HIBA 5IUIA 4AZSA 3C0IA 3ELJA 1JSVA 5IG1A 5AV3A 4E20A 4FEWA 4FODA 4MBJA 4O7YA 1REJA 2C3IB 1LUFA 5HORA 2Y9QA 3L9PA 4LG4A 2PY3A 2VD5A 4CMTA 3LFBA 5CEIA 4FI1A 1IASA 2B54A 4I6BA 4MBLA 5AJQA 3HLLA 3OXIA 5DRBA 4RIXA 3R2BA 4FZDB 3RPVA 3I7CA 4BIDA 2YIYA 4ZLOA 2RFNA 2CMWA 1U46A 3QTZA 4R3PA 5GJDA 4GG5A 5C03A 3VRZA 4DGNA 4M14A 3SA0A 4FTAA 3AT2A 5I9VA 2WTCA 2JAMA 2PK9A 4I3ZA 2QKRA 3VJNA 3MI9A 3I7BA 2NPQA 1MRYA 5HQ0A 3TDVA 3B8RA 4WUAA 4L9IA 4EUTA 2ONLC 2CLQA 5CEOA 1Y8YA 4TYHB 4IC8A 4U79A 4S34A 4QYFA 3OS3A 3F3ZA 5LVMA 4CKRA 3CS9A 4CYIA 2JKMA 5EM6A 3RM6A 2YDKA 3OF0A 3VQUA 2HZIA 4EOOA 3O8TA 4U5JA 5DR6A 2C0IA 3QXPA 4FGBA 5BPYA 3UBDA 3QTXA 5ANEA 3UO4A 2EWAA 4CKJA 2WTKC 3FV8A 3R1QA 3HP5A 1LPUA 3KN5A 4YZCA 3R7IA 4HGTA 3UNJA 4EHGA 5IMEA 3HMMA 1SVEA 4II5A 4S2ZA 3PIXA 3ZUUA 2ZM3A 4DHFA 3F3TA 2GTMA 5ETCA 3ETAA 3TDWA 5AP7A 4RRVA 3CKXA 4X3FC 5J5SA 1QL6A 3FQSA 3OFMA 5AAFA 3VUKA 4M12A 1SZMA 3G33A 2XK4A 4FEQA 2WPAA 4MXZA 4PTEA 2I40A 3OCBA 2QHNA 2HZNA 4DEAA 5AUTA 4I6FA 2WOUA 2WU6A 2IVSA 3D14A 5DMZA 3EN4A 2XM8A 3GU5A 3H0ZA 4IWDA 3NWWA 3B2WA 5HIEA 1IA9A 3WE8A 4LUDA 4AE6A 3A7FA 4QYEA 1NXKA 4QTCA 4FKUA 3E93A 3GCUA 2R7IA 4OW8A 3W2SA 5HLWA 1UV5A 3HZTA 5BVEA 3GC9A 2I0VA 5HBJA 3KN6A 3KC3A 2UW9A 3QKLA 2PSQA 5AR3A 2IG7A 5KMNA 2NO3A 3LCSA 3NUYA 1JKKA 1XH5A 2C69A 3MFSA 4BI2A 4O7LA 1EH4A 1ERKA 1YXTA 3NR9A 2R0UA 3LVPA 4BDKA 4E7WA 4AZFA 4RJ6A 1Q41A 4ITHA 2BCJA 3FMHA 2JGZA 2PVRA 3KA0A 3KK9A 4Y5QA 3QRKA 2XYUA 5FQDC 5F20A 5J7BA 3H9FA 4GG7A 3B2TA 4GVJA 3R30A 3WIKA 4J97A 3WF6A 2PZPA 4ZK5A 1SVGA 1YHVA 3VF8A 5M4IA 5E9EA 3NAXA 1PF8A 4C7TA 4DEHA 1WFCA 2ZM4A 3JXWA 1W7HA 3MWUA 1R1WA 4R3RA 2BRGA 1WVYA 3FC1X 3FYKX 5DH3A 3PUPA 3UZTA 2VTPA 3OY1A 3JS2A 4LGHA 5M4FA 3VS5A 4BR3A 2PTKA 2Z2WA 3F5PA 4IQ6A 3T3VA 5CQWA 3C13A 2SRCA 1XJDA 2OO8X 3A4PA 4UWBA 4BN1A 3Q60A 5J9LA 2BILB 1Y6BA 3NLBA 2JEDA 4I24A 4C33A 4YLKA 3MTLA 2G2FA 2W4JA 5A14A 5IQDA 3C4XA 2HYYA 4P5ZA 3UTOA 4ASDA 2QLUA 1MQBA 4U6RA 3FZTA 3MY5A 3FLNC 3SC1A 5HD4A 4FMQA 2QR8A 3N9XA 2VWBA 3I6UA 4CTBA 5LVOA 4WNPA 2CN8A 3SOCA 1G3NA 3QD3A 3GU8A 3UNZA 4QMSA 3DB8A 3DCVA 3HA8A 5C01A 3W55A 4FKWA 3SW7A 4YJPA 4J96A 2W1IA 4U40A 4TWCA 3ZC5A 4Y73A 2EXEA 3EFKA 4QP3A 5CS6A 2HOGA 3TJDA 3QZHA 4D9UA 4XG3A 1DS5A 5CVHA 4RFMA 3QQJA 5CAOA 3M1SA 4FNYA 4TW9A 4A06A 5BUIA 4NCTA 1WVXA 3HYHA 5CNNA 5AM7A 3GQLA 4LQMA 3RCDA 4C02A 2FYSA 5E91A 4P2KA 2X1NA 2C0OA 4ID7A 3GQIA 4FGRA 1URCA 2A27A 2BTRA 3FWQA 4I23A 5HU3A 5FBOA 2QO7A 1MP8A 2ITTA 4EJ7A 3LFCA 5GIPE 4JS8A 4J95A 4QQTA 2IW9A 5L6WL 4QYYA 2WO6A 3OOGA 4KABA 3QGYA 3HECA 3LFEA 4F0GA 1VZOA 1CM8A 3ALOA 4L3LA 3QRUA 4MXXA 5EW3A 2YM8A 3UQFA 3FI8A 4EBVA 1OECA 2R3OA 3FPQA 4MH7A 5I9WA 5K0KA 5M44A 4QQ5A 1KE8A 5FDPA 1J7UA 3QKKA 4BL1A 3CTJA 4X7QA 2UVXA 5A4CA 1GZNA 2W1FA 3SXRA 2R3GA 4RSSA 5FEQA 3JVRA 3FLQA 5KHWA 4UV0A 4NTTA 4DFUA 5FBNC 2C6LA 1IR3A 4Z9LA 4FV0A 1SNUA 3DJ6A 5IEVA 4I93A 3EIDA 4EHVA 4Q5HA 3U9NA 3DKGA 4CKIA 2B4SB 3G6HA 5GJGA 3ROCA 1FBNA 1KOBA 4IB0A 4UXLA 5KCVA 2PVNA 1P4OA 2BKZA 2PVLA 3O7LB 2X8EA 3A7HA 3FZSA 4EK3A 4DCAA 4FEVA 3A8WA 2HW7A 3THBA 5B2MA 1XBAA 1ZRZA 2VNYA 3F7ZA 5KMLA 3MVJA 1YOLA 3HEGA 2CJMA 4EH8A 4I6QA 4NTSA 3RK7A 4YJNA 4AWIA 2DS1A 2A4LA 4MQ2A 3ZLSA 2ZV7A 1ZYSA 2R3LA 1OUYA 5E7RA 1QPEA 4CLJA 4BTKA 2KTYA 3K5UA 4I5HA 3ZMMA 4JT3A 3QD2B 3DK3A 5LMKC 1PJKA 5ANKA 5KMMA 2XCKA 2XK7A 4C8BA 1YW2A 5IA4A 4FYOA 2XZSA 3QTRA 4LGDA 2BRMA 1DAYA 1GNGA 3VVHA 1XH7A 5IA1A 1RQQA 5IPJA 3KRXA 2OFVA 3S3IA 4HW7A 4EC9A 2WMXA 4AU8A 3KRJA 2EXMA 3KVXA 2BZHB 4FV5A 4MXOA 2WTDA 3MSSA 3UOLA 3NYNA 4AAAA 4ANLA 3R83A 5CT0A 4O22A 2AC3A 2XIZA 3QFVA 4TT7A 2XIYA 5HO8A 1U54B 2UUEA 3MY0A 3R28A 5IISA 3FKLA 3RCJA 4M67A 4L68A 4J1RA 4HYSA 2OK1A 1H27A 4C57A 2X2KA 3LCDA 4AW0A 4K77A 2W9ZB 3WZKA 4Z16A 3TNIA 4QRCA 4QMMA 2EVAA 4FKTA 3BGZA 3Q9XA 3VC4A 3M2WA 3U4WA 2J7TA 1PXKA 3QXOA 3BWJA 4OLIA 3BRBA 4XBRA 4XS2A 4QMQA 2VV9A 5BYLA 3F5UA 3HV7A 3VJOA 4ZZNA 3PPJA 5CTPA 4BGGA 4NM3A 2YM4A 3NCGA 3C1XA 2YWVA 3DT1A 3OCGA 4U45A 2GFCA 4LOQA 5DR9A 4A9TA 4NM7A 3V01A 2YIXA 4E4LA 2VWZA 5EDRA 3FMJA 1NVQA 2PE1A 3C0GA 3ZONA 3DBCA 3R63A 1P5EA 3FDNA 4AQCA 4XV2A 3IGGA 3BU3A 3GVUA 3TN8A 3MB6A 4GT5A 4EH4A 3D0EA 3KREA 4EOPA 3LE6A 5FLFA 4RX8A 3R7YA 3VBTA 4AN9A 4Z7HA 2VTTA 2VTHA 2YCRA 3ZS5A 1OPKA 3Q5ZA 3MPMA 4FK6A 4Y83A 3RPOA 3BEAA 3EKKA 4B8MA 3NVKI 2RIOA 1B38A 4CFVA 2YITA 3LXPA 4EKLA 5AA9A 3PA5A 2WTWA 4AZTA 2IZUA 3ET7A 3Q3BA 4EWQA 3IW7A 4PDPA 3FHIA 2YA9A 2UZNA 2H34A 3KXZA 5EKNA 2JFLA 3R9RA 4AGCA 4HVSA 3KXXA 3I5ZA 4QMVA 4O2PA 4QP6A 4ZSAA 3KMWA 4FR4A 4ORKA 1Q97A 4YZMA 2OZOA 3KKVA 3LQ3A 5E8VA 2R9SA 4FSMA 1YXXA 4QQJA 4YSMA 3P1AA 4CQEA 4NT4A 3FKNA 2CKOA 4UEUA 4I5MA 5HE1A 2QOLA 4ZTSA 5HVYA 4YTCA 3PFQA 3DOGA 3ROYA 4IJPA 3FAAA 4TWPA 2B55A 5BVFA 4USFA 3OT8A 2F9GA 4JL9A 3TL8A 4AT4A 2Q0NA 4DTAA 3U6IA 4ZS4A 5FEEA 5DI1A 3R7UA 4EORA 5TF9A 4HVGA 2C5VA 5IUGA 4NL0A 3Q6UA 4UYNA 4FTJA 4Q9SA 4CFUA 1IEPA 2PYWA 4AGDA 4FKLA 3CPCA 4D4YA 5H3QA 3FQHA 4ITJA 4JR7A 2OXDA 3N4TA 1YOJA 2WQBA 5IQHA 5A3XA 4D4RA 4FTTA 3F2RA 4JIAA 1H1SA 3LQ5A 4F65A 4W9XA 3GC7A 3KEXA 2GNLA 3TNPC 4YHJA 4YZNA 5TR6A 4UWYA 5TT7A 2WHBA 5HG7A 3CKWA 3PVGA 5I9ZA 3LJ1A 3UOKA 4L6QA 3G90X 1V0PA 4FKRA 3ZEPA 5L2IA 1WBWA 2YM7A 3BV3A 3CD8A 4UWCA 3VUTA 4CRSA 1M52A 1HCKA 4FTMA 5CVGA 1ZY4A 5J1VA 3QQGA 4RFZA 1WVWA 3TWJA 2GTNA 4OAVB 4F1MA 3W10A 3EQFA 3PVBA 3F5XA 4BYIA 4HVIA 4PMSA 1XH6A 3MJ1A 5DGZA 2DUVA 4J71A 4ANSA 4L00A 4FYNA 3UIUA 4E26A 3DB6A 3E64A 4QOXA 2BAKA 4IXPA 5A46A 1FVTA 5EM8A 5AR4A 3PIYA 3NGAA 3EN7A 4NKAA 4RC3A 4O21A 3P7AA 5LMAA 3RGFA 4BDAA 2PUUA 4F1TA 1U54A 3PP1A 3QCYA 5EI2A 4OUCA 4CFFA 4YBKA 3TTIA 4BIEA 2XK9A 3QU0A 4ZZMA 2OWBA 3RHKA 2X7FA 4JIKA 4RIOA 4RX9A 5IMXA 5CVFA 4DLIA 4HPTE 5M09A 3ZO1A 4DGOA 5EHOA 3EQRA 4QYGA 4AGWA 2HELA 4L7FA 4KRCA 3U9CA 1PKGA 2R3MA 2QOBA 3ZH8A 5IQEA 3PZEA 4V01A 4BCPA 3OZ6A 4TL0A 4GU9A 5JGBA 4G3GA 2X9FA 4XLVA 4GK4A 3FLYA 3FZPA 2ZM1A 4X2KA 1TQIA 3TG1A 3TKUA 5KKRB 3AC5A 3UO5A 2YZAA 1ZMUA 2W1CA 4WBBB 5DT0A 2XEZA 3V6RA 2VO3A 2VX0A 2E2BA 4C38A 4GIIA 5K5NA 4L43A 3QKMA 4IB3A 4FL3A 4R7BA 3MN3A 4YLJA 4Q2AA 1E1XA 2C30A 5FGKA 1GIIA 4RWJA 4F7SA 5CEPA 4RJ7A 5DR2A 1QPCA 3E7OA 3ORKA 4WNKA 2C6IA 4KS7A 5BMMA 4V04A 3GUBA 3VQHA 4C61A 4RBLA 3MDYA 4GCJA 3V8WA 3REPA 5C9CA 5D12A 1BUHA 3DAJA 3DQXA 4KSPA 4WRGA 4XOZA 3DFCB 3ODZX 4I0SA 4AGUA 4EZ5A 4ALUA 4FUXA 5ICPA 5H2UA 4DGLC 2Y6MA 3TCPA 3AT3A 3SHEA 2QI8A 3ZSHA 5M57A 5FD2A 4AUAA 3QCXA 3C4CA 2DWBA 3VS4A 3WI6A 3O8UA 5CYIA 4R6VA 2C3LA 1UU7A 3OWJA 5L8LA 4MQ1A 3Q53A 2VWUA 4B7TA 2BTSA 1R0PA 5AUYA 2C3JA 3ZDIA 4G2FA 5FWKK 3VHKA 4QP4A 4Q5EA 4GU6A 3C51A 3GGFA 4KKEA 4PNIA 1NY3A 3F88A 2A1AB 4IE9A 3UG1A 3UMWA 3I4BA 4M69A 3VUDA 3C5IA 5TOZA 3ANRA 1O6KA 1ZYCA 3PY3A 5D41A 3AD4A 3MESA 3FUPA 4DA5A 2FH9A 1YVJA 4O7TA 1OZ1A 3ORLA 2GNJA 3R0TA 3QWKA 4L52A 3WZUA 5HLNA 3H3CA 1PHKA 2G01A 4I0RA 3VS7A 4RX5A 3PLSA 4AW5A 4GVAA 4R1YA 3OHTA 5HO6A 5BVKA 1SYKA 3UQGA 2AYPA 4XP2A 3R1NA 2Q83A 3MFUA 3ZCLA 3WF9A 5JFVA 3V8SA 4XG4A 4YO6A 2WMUA 4LYNA 4D1XA 4DH8A 1H00A 4UY9A 4FX3A 3SOAA 4YURA 4DEDA 3DAEA 5JZJA 2I7QA 5KX8A 3ZOSA 4R1VA 1OIUA 3D4QA 5HESA 4HVHA 5IA5A 4QMPA 3D15A 1OL6A 2C1AA 1YDRE 4QP2A 3COIA 5EHYA 3FPMA 3EL7A 3FI2A 5IA0A 4MK0A 4UN0C 3OCSA 4QP7A 1KV1A 4IZYA 3QA8A 5FXSA 1KE5A 5HG8A 5AV0A 5EDQA 4USEA 3ZM4A 5FTOA 1A06A 2BDJA 2ITPA 5E8YA 4DITA 3HAMA 5CENA 1DI8A 1Q62A 4USDA 4YP8A 2J0LA 3EZVA 3ZEWA 4DFBA 2YCQA 4FZFB 4I0TA 4RVTA 1XWSA 2X6EA 5CSHA 5T6KA 3PSBA 1I44A 3UOHA 2F7EE 2YM5A 3F5GA 2CN5A 2GNGA 4ZEGA 3PWYA 2UZUE 5CF6A 5AX3A 4Y8DA 5E90A 2HAKA 2PUPA 3O2MA 4O38A 1Q8ZA 5DN3A 3DKFA 4ZTLA 3SAYA 4EH3A 4P7EA 2Y4IB 3R22A 5AWMA 5KHXA 2Y8OA 3SW4A 4NW6A 3W32A 2YFXA 3I81A 4ZTQA 4CEGA 2YDJA 5EOLA 4D58A 4QMNA 3CQUA 3S1HA 1QPJA 1PW2A 4UZDA 4HYHA 4AA0A 1TKIA 5HLPA 3FXZA 2RSVA 4EQMA 4AW1A 3OG7A 4N70A 2XUUA 4ACDA 3NSZA 4IWQA 4BICA 4IX5A 3QD4A 5BX0A 1M7QA 5LJJA 5KKRC 4MNFA 4PTGA 5DRDA 3D7TA 2UW7A 4LRJA 4CG8A 1W84A 3SLSA 2I6LA 2ZYBA 5IF1A 3MA6A 4YJUA 2YZLA 3CQEA 2X81A 3E7VA 3QUDA 2XP2A 3ULZA 3BEGA 3OW4A 2C4GA 4F7NA 4A7CA 2YLFA 4IANA 5CF4A 5CU0A 3VW8A 1ZARA 2ZDTA 1UWJA 2BHEA 4IZ5A 4W8DA 4E93A 4CZYB 4D4SA 3D7ZA 2XJ2A 3GT8A 3UG2A 3PJ8A 4YHTA 5EKOA 5DA3A 5EYCA 3SDJA 3ZYAA 4C3FA 3VAPA 4FC0A 1H0WA 4K6ZA 1OL2A 1CKPA 2JDOA 3FI3A 3IDBA 1UNGA 1JPAA 5JQ8A 2XM9A 3BU5A 3OW3A 3C4EA 4E73A 1HOWA 5J1WA 3MJ2A 3WIGA 3W8LA 3SRVA 4CFMA 1IRKA 3HUCA 2QO2A 3CPBA 2VTSA 4ZMFA 3VW6A 3I79A 4BIBA 3DTWA 5D9HA 1PKDA 2JKQA 3QA0A 4J8NA 2E9PA 4TWNA 3BU6A 1UU3A 4HYUA 4NJDA 3UIXA 3FY2A 3VUIA 4IB1A 1J91A 4FT3A 4IADA 4IM2A 4KSQA 4O7NA 3B8QA 3ZSGA 1U4DA 4L67A 4BDEA 4FT7A 4O81A 3RAKA 4LRKA 1DI9A 1JSTA 4XOYA 4GIHA 5JEBA 3RP9A 4O84A 4QD6A 2W1EA 2V55A 2PVKA 3AC4A 3OWLA 4KIKB 3BYVA 4E5WA 2JC6A 3E8NA 1OVEA 3V5QA 4TNDA 5TKDA 5J9ZA 4BB4A 5L2SA 1OBDA 2VU3A 2YM6A 2JDTA 4WNOA 1NVSA 5EK7A 2CHLA 4B9DA 2OJFE 4LOPA 2J5FA 4PRJA 4E4XA 1VYZA 4XG8A 2G2IA 4PNKA 3EWHA 3UPZA 3DXQA 4BDJA 4DE4A 4ZY4A 1SM2A 4CG9A 3IOPA 3LQ8A 3MFRA 4RPVA 4U8ZA 3RI1A 3UQCA 4KA3A 3OP5A 4LI5A 4L3PA 4IM0A 4PPCA 2WXVA 5CF8A 5IH4A 3DBEA 3EFWA 5F94A 2W5AA 4JRNA 4G17A 4F1OA 4YTFA 3NUUA 4MYGA 4QMXA 4QTAA 4XG2A 2B9IA 2RL5A 2XIKA 1L3RE 2J0JA 2YIQA 4IH8A 3ANQA 2XBAA 5IQGA 4NWMA 3UVQA 2O63A 1WAKA 3ZFYA 4DBXA 5HZNA 3P86A 5CU2A 4L46A 2R7BA 2HY0A 1DAWA 4RFYA 2XMYA 3IPHA 5JN2A 3BLHA 1Z9XA 4DF3A 2JKKA 3H4JA 2VZ6A 2QODA 1XR1A 2QQ7A 3O50A 3PSDA 4HJOA 4ZJIA 3S00A 1JAMA 1HCLA 2W1GA 4V0GB 4QMUA 2ITXA 4AACA 4F0IA 4LOOA 1VJYA 4FIGA 2EU9A 3FEGA 3F3UA 3R7VA 3MB7A 3QTWA 3W2CA 4XV3A 2QHMA 3WE4A 4E6QA 2PMIA 5I3RA 4FKJA 4O0XA 2FSMX 4C4GA 4D2PA 3ORZA 3EZRA 4GW8A 2F2CB 3UYSA 4C62A 4E8AA 2Y4IC 3FLWA 2PMNX 3CBLA 3KXNA 1IAJA 5EH0A 1FINA 4RWIA 4AE9A 4KKGA 3DLSA 3HRFA 4IX3A 1BX6A 3LXKA 1KWPA 1FPUA 3HDMA 3SG9A 3V51A 3TNQB 4BVUA 3FZ1A 1T46A 2QONA 5L8KA 3DFAA 4F64A 3EQDA 4YUQA 4F63A 3LIJA 4FICA 1Q3WA 3ACKA 1J1CA 3BHUA 5HOAA 3ZRKA 4RLKA 5H8EA 3AT4A 3FSKA 4JXFA 4PUZA 3WYYA 4D55A 3RMFA 5DT3A 5BYYA 1U59A 1YOMA 1JQHA 2OJ9A 4ZSGA 3WARA 2CCIA 4XG7A 2GNIA 4EKKA 5J5TA 3F3WA 4XNEA 3TUDA 3UZRA 3RZBA 3AC3A 2WTJA 3QUEA 3UJGA 3D5UA 5CT7A 2Y0AA 5CSPA 2WKMA 3PJ1A 4RGJA 3NEWA 1AQ1A 2YCFA 3TXOA 4HCVA 4KUJA 4FIEA 4FSQA 2YDIA 4D5HA 2PZRA 2JIVA 1PYXA 2VTMA 3RPSA 1PMVA 1RE8A 2Z7RA 2HXLA 3OUNB 3BYSA 4OTPA 3TNWA 4CCBA 3ZUTA 1BKXA 2W96B 3PRIA 2RF9A 4WNMA 2EB3A 4DEBA 3OXTA 4F9CA 2XNGA 1MRUA 4GYIA 4J8MA 5FP5A 4CSVA 4DTBA 4GJ3A 3U51A 2ESMA 3PZHA 3ATSA 2ETMA 3FKOA 3Q4UA 2AUHA 5F95A 5J95A 4IWOA 3IDCA 3Q6WA 1FGIA 4U43A 2XF0A 4EQCA 4F6WA 5J79A 4FG9A 3IECA 3BYUA 1UWHA 3PA4A 4IDTA 3C4WA 3OBJA 2YISA 4NSTA 4O96A 4UALA 4BCOA 5LOHA 4E5BA 4EH6A 3EN6A 4FZAB 4ASXA 1KOAA 2BHHA 3JY9A 4OTWA 1H1PA 4BDBA 4DFNA 2UZDA 4CQGA 2GQRA 5GIOE 4E4MA 4K0YA 3NYVA 4WSYA 4R77A 2XKDA 1XH9A 5BNJA 4V0GA 3WF5A 4FTIA 3LXLA 3P79A 3DPKA 4DN5A 1PXPA 4I4FA 4MD8E 5DVRA 2G1TA 2NP8A 4D1ZA 3AMBA 2X2MA 4ZSJA 5JZNA 4CLIA 2C5OA 5IQCA 1V0OA 3GCPA 4A4LA 4JX3A 3OXZA 4XEYA 5T3QA 3RPYA 5C1QB 3QX4A 3VUMA 3H30A 1GZOA 4RMZA 1YI6A 4RZWA 2WQNA 4D0XA 2R3HA 5D11A 3I1AA 3R00A 4PL4A 1P4FA 5TO8A 5HU9A 5EYMA 2PU8A 2QD9A 4BCFA 5CF5A 1H25A 2CGUA 5EI6A 4A9YA 4HVDA 2HY81 4Z3VA 2FA2A 4MNEA 4WIHA 1YKRA 2B9JA 4W8EA 4YZBA 2P2IA 3BX5A 3LJ2A 3MGYA 4K8AA 3UP2A 4DH3A 2B0QA 4JR3A 5BVWA 4FBXA 5AP2A 3M42A 4B4LA 3CQWA 3PXQA 4GT3A 3R6XA 5AV1A 5D7AA 4C58A 3V6SA 4X3JA 3FHRA 4UX9A 4PF4A 2VTRA 4WRSA 3ZFXA 2HXQA 1XBBA 2V7OA 2HCKA 4KIKA 3NCZA 3F6XA 3F3VA 3LFQA 3VBYA 4GRBA 3LFDA 4IM3A 3FMEA 5AAEA 1ZMVA 3PSCA 4YMJA 2JDSA 2W1DA 1L8TA 3EFLA 3F2NA 4FV6A 4O0UA 4E5AX 3FZRA 3E62A 4OT5A 4AG8A 1BYGA 2GS7A 3LFAA 3VF9A 4G9CA 5EG3A 3LAUA 2REIA 4O2ZA 4RA5A 3Q4CA 5E4HA 3U4UA 4BCKA 4I92A 5G6VA 3LFNA 4M7IA 4BTFA 1PXNA 4FKIA 4RIXB 4TYIA 3IO7A 4CV8A 4H3QA 4EHEA 4EHZA 5CZHA 4C0TA 2WIPA 4ZZOA 2YM3A 3MW1A 4QTEA 1RDQE 1Q5KA 1ZXEA 3FMDA 3C50A 3QWJA 3DXPA 4ENYA 4LMNA 4MWIA 4MCVA 5IKWA 2J6MA 5EW8A 5A4TA 4O7RA 4CFNA 4FTOA 3D83A 4GS6A 3ZHPC 3PYYA 4TPTA 3Q4ZA 3NYXA 2UW5A 4ZTNA 4FG7A 5HHWA 4MF0A 2RKUA 5AR7A 2ZB0A 4A9UA 4ZTHA 5M07A 2JD5A 2YJSA 3P78A 5FM2A 1Q8TA 2X6DA 2A0CX 3DK7A 4M3QA 4U3ZA 2CNUA 3MTFA 4KB8A 4UMPA 4RC2A 5IU2A 5JFXA 5CY3A 1H24A 3C4ZA 3IG7A 4FSUA 5G1XA 2LGCA 4CVAA 3GEQA 4WT6A 5M53A 3CXWA 1MRVA 4JG6A 4QTBA 5L2QA 5L6PA 3MPAA 3R8LA 3QLGA 3QCSA 3SXFA 1OB3A 1NW1A 4RT7A 4A07A 2BAJA 2UZOA 2BR1A 4EOJA 1M7NA 3QRIA 5K9IA 4EONA 3V5TA 4PPAA 2R3PA 3NRMA 5DIAA 2BAQA 2ETKA 4ZLZA 2ITNA 5HGIA 5I5ZA 5GHVA 2WAJA 3Q2MA 4JQEA 2PE2A 4YJQA 3LFFA 4JOAA 4G3FA 2C5XA 5ANGA 3S0OA 1T45A 3QQLA 3TUCA 3VNTA 2QNJA 3IOKA 4C4IA 3MIYA 5JRQA 3DBDA 4XHKB 3Q9WA 5M51A 2OF2A 4FIIA 4MX9A 1XHAA 3KRWA 5AIKA 3MH0A 1VEBA 1R78A 4E6CA 4BCMA 3F82A 4GH2A 3U8WA 4FTRA 4RA4A 4C3PA 2R3RA 4WUNA 2HZ0A 2UZLA 3MY1A 5JK3A 2CKQA 2KULA 4MD7E 3VBQA 4NZWB 1J3HA 2P55A 1M2PA 3H9RA 4LFIA 4RC4A 4YO4A 1OIQA 3QYWA 2Z60A 2IW8A 3FMNA 1JNKA 2UW8A 4F7JA 4BRXA 4RJ5A 3ID6C 2BDWA 1IA8A 3QCQA 5EI8A 3RAWA 2PUNA 4TN6A 2OU7A 2Q0BA 4BCNA 2B7AA 4F6UA 3QF9A 4CMUA 4FTLA 2EUFB 4R78A 4IZ7A 4F9YA 4G3CA 5J8IA 3TKIA 2OLCA 1F3MC 5CASA 4HCUA 3U87A 3DBFA 2YJRA 3ZC6A 2X39A 4X2GA 5CSXA 3MBLA 3EQGA 4H36A 2X8IA 4B8LA 1Y57A 4JDJA 4M84A 3UVRA 4ASEA 3P7BA 4RLLA 1Q3DA 2UZTA 4JDKA 5CI6A 2IZTA 4L44A 4QNYA 5CAPA 4OTDA 1SNXA 4FEXA 5HIDA 4AOJA 1CTPE 3GB2A 5JQ5A 4QTDA 1OL7A 2Z8CA 4G16A 3UOJA 2WQMA 4JDHA 2BRHA 5DG5A 3W2OA 5AA8A 3QL8A 4EK5A 5H9BA 5ANIA 4OTQA 4BWKA 4KIQA 4U3YA 1JSUA 2CDZA 3MH3A 3BGQA 4MVFA 5KMIA 4TTHB 3FYJX 2VWVA 3FC2A 4JBVA 4BKJA 1OM1A 4X6RA 5EQPA 5ANDA 3GXLA 1IG1A 3DKCA 3PXKA 4U7ZA 1OPLA 3O51A 4S30A 3R1SA 5E8UA 4CV9A 1OBGA 3PPZA 1W0XC 4L7SA 4YZ9A 4BKYA 5DHJA 4ANMA 3FBVA 2FVDA 2YIRA 4AS0A 1VYWA 2VX1A 3EJ1A 4CFWA 4CRLA 3NUAA 2WZJA 4U9AA 2I0YA 2J90A 4TYJA 3ZTXA 3G15A 4RVMA 2E9UA 1YXSA 4BI1A 5BMSA 3PRFA 4XUFA 3PJ3A 2UZEA 3F7WA 4FSNA 1F0QA 4FKPA 4WG3A 2RFDA 3DDPA 3KRLA 4IWPA 3PA3A 3DS6A 2WD1A 3OT3A 3U54A 3MS9A 3FMLA 4DG0E 5CLPA 2UW3A 3KF4A 4KINA 2ZDUA 4BWXA 3KFAA 5FDXA 2JIIA 3HA6A 2R4BA 5D7VA 2XKEA 3DKOA 3W33A 1YXVA 4A4OA 4AFJA 2I1MA 5HG9A 2JITA 5HTIA 3TZMA 1A48A 4JDIA 2RFEA 3O23A 3GOKA 4EYMA 4ZLYA 4P90A 5DBXA 4K1BA 1BL6A 3KY2A 3QX2A 4BDGA 4YC6A 1YQJA 3QTUA 4FKGA 4LUEA 5I3OA 5I9UA 4CD0A 1PXOA 4EH9A 3JR1A 4IB5A 3R21A 5ITAA 2XKFA 1RW8A 2IN6A 3E5AA 4E4NA 3LFSA 4G3EA 4N57A 3S4QA 1E1VA 2OIDA 2GNHA 1TQPA 1YXUA 4U97A 4EUUA 3L9MA 4U81A 5ANJA 4HGEA 4U44A 5DLSA 2VNWA 1WBPA 2OJGA 1F5QA 4KIOA 5HO7A 4CFXA 1KSWA 4FTQA 2DYLA 5JH6A 4BDHA 5GZ8A 2AC5A 2F7ZE 1H1WA 1R39A 4RIYA 3BBWA 4JVGA 4NH1A 3U6JA 2BIKB 3LM0A 1YWVA 4DFYA 3JYAA 3TTJA 2YAKA 3E8DA 3OY3A 4FTNA 4M13A 4YPSA 1J1BA 4R5SA 1GJOA 2W17A 4H1JA 5HD7A 3CGOA 5BUEA 1V1KA 4JAIA 3Q32A 4HGLA 2QVSE 3KXMA 4UMQA 5HCZA 3NMUF 3AD5A 5F1ZA 5LVNA 2X7OA 3HNGA 4QMWA 4QT1A 5BQ0A 5K4IA 4RJ4A 2YHVA 3TEIA 3KXGA 3RM7A 4TKSA 1KE9A 4MNEB 3ORIA 5AV2A 2R3IA 4HCTA 4I41A 4FKOA 5CEKA 5EQYA 1YI4A 3NW5A 3BQCA 3AG9A 2BALA 2B9FA 2V62A 2A19B 4FNZA 4HOKA 2E9OA 4JBPA 4RJ3A 3JUHA 3ULIA 4BGHA 2FB8A 5L3AA 2VO6A 3COHA 2JLDA 3ITZA 2BFYA 4M0ZA 5C8KA 4MWHA 4EL9A 4IMYA 4O27B 3TM0A 1UU9A 1Z57A 2VWWA 2GFSA 2OJIA 2OH4A 2BPMA 1WCCA 2QOFA 3POOA 4LL5A 4EH2A 4C4EA 3ZO2A 4GKIA 2X4FA 1ATPE 5CXZA 5JFWA 3QZGA 1FQ1B 5A4EA 1MUOA 4WD5A 1Y8GA 4IX6A 3NPCA 3P4KA 3TV7A 2FSLX 5L2TA 2OJJA 3QHWA 4U41A 2VGPA 2YACA 3DZOA 4H3PA 3DA6A 3AMYA 3HMPA 4QMLA 4O91A 4KD1A 4EZ7A 3HDNA 2QOOA 4MAOA 3VRYA 1Q99A 3RTPA 1H4LA 5FXRA 3E3BX 5IEYA 3KF7A 4K2RA 1ZYLA 4C4HA 4EOMA 4F9AA 5D10A 2Y7JA 3TUBA 3QYZA 4IAFA 4QO9A 4PP7A 5A6OA 3BLQA 3WZJA 2CNQA 1LEWA 3ENHA 4N0SA 3KCFA 3K3JA 4XRJA 4MD9E 4APCA 2W5HA 5B0XA 3PP0A 4EH7A 3BPRA 3CJFA 3RPRA 2CCHA 5HCYA 3QC4A 3HUBA 3DZQA 5AM6A 4EC8A 4E3CA 4MXYA 2XH5A 3KULA 3OEFX 5M4CA 3D2IA 3MFTA 4AP7A 4DEEA 3P0MA 3ODYX 3QD0A 2VWYA 4JJRA 3VIDA 3ZDUA 3ZLWA 2VX3A 3COKA 3LMGA 4RWKA 2QU6A 4IHPA 3HVCA 4LMUA 2VWIA 4FSWA 4RVLA 5GZ9A 4BDIA 4E1ZA 1ZMWA 2BKKA 5AR5A 3FY0A 2OZAA 1XKKA 2XYNA 3DNEA 4O7WA 4PP9A 4P4CA 4ACMA 1B6CB
chains in the Genus database with same CATH superfamily
3NZ0A 3QRJA 2BFXA 1FVVA 2IZSA 3TKHA 3RWQA 2EB2A 2F49A 4DEIA 3R02A 4FNWA 1OUKA 5IEXA 3G6GA 5LQFA 3QTQA 5EFQA 2XK8A 2BRNA 4NJ3A 4IX4A 4J98A 2IJMA 3BHYA 4EBWA 3UNKA 2GHMA 4MTAA 2P4IA 3BBTB 3R1YA 4AX8A 1UKIA 4FOBA 3QRTA 4E6DA 3JPVA 4MF1A 3W0QA 2BMCA 1ZZ2A 4FK3A 4FZ7A 5C8MA 3GP0A 4Y46A 4YBJA 2GMXA 1YRPA 3P5KA 5KBRA 4FE2A 2PZYA 2BZKB 1YHWA 4ZMEA 4YJRA 2HZ4A 2YCSA 5I0BA 2B52A 4O0SA 3GBZA 4D5KA 3R8ZA 2O0UA 2RG5A 4E6AA 1BMKA 5LWMA 1GIJA 2YABA 4WOVA 3BKBA 1CDKA 3VN9A 2VGOA 2YERA 4DFLA 3I0QA 5HBHA 5IZFA 3KB7A 3FXWA 4NK9A 2PVJA 4DH7A 2GHGA 3PE1A 3SD0A 4W4VA 4NIFA 4JQ7A 3W1FA 4AAYA 4ACGA 3NFFB 3MVHA 4XG9A 2BZJA 4FIFA 3ZZWA 4JI9A 1GAGA 1JOWB 4UMTA 1IAHA 3QTSA 1PXLA 1WZYA 3DU8A 5AP3A 4C59A 2J51A 3BHVA 2UVYA 1U5RA 3CLYA 2XIRA 3BE9A 3L1SA 4G3DA 2PPQA 4JBOA 3VBXA 4N6YA 3R9DA 3TIYA 4DINA 2B53A 2PVHA 2H96A 3A61A 4RIWA 4F0FA 5JGAA 3R7OA 5C27A 4GL9A 4FF8A 4XBUA 5ETFA 3IW5A 3L8SA 4IVDA 2WELA 4XP0A 5H8GA 3RALA 4FOCA 4D1SA 1VR2A 2V0DA 3ORPA 3ZRMA 5GZAA 3FXXA 4ZAUA 1Q8UA 3CE3A 3W18A 2WOTA 2C3KA 4FT0A 4BCIA 2IW6A 5AX9A 2ZV8A 4QMZA 2WIHA 3LCTA 2I0EA 2ITZA 4XMOA 3Q9YA 4PX6A 1JBPE 5HEZA 4A9SA 3GU4A 4EK8A 3A2CA 3GFWA 5A4LA 5EM5A 1Q4LA 4GT4A 4TYHA 4UZHA 2H9VA 3O7LD 4H39A 4BBMA 1ND4A 3CSVA 3GCQA 4GFMA 4EOIA 4FV2A 5IA2A 3NW7A 5AUXA 2OF4A 3TJCA 4JG7A 5C4KA 1O6YA 1LEZA 2X4ZA 2XS0A 1WBOA 4O7VA 3DBQA 3GC8A 3MVLA 4DT9A 3NW6A 5AP0A 4ASZA 1YDTE 4GFOA 2X7GA 4O0VA 3CY2A 5AUWA 3ZO3A 1OIRA 3RK5A 2OG8A 4IC7A 4YU2A 3EH9A 4PDOA 5FRIA 3AKLA 3PJCA 4QMOA 4O6EA 3UDSA 4BF2A 3HMOA 3V3VA 1BL7A 3AD6A 4NU1A 4FKVA 4KWPA 4TY1A 4B6LA 3HRBA 2XNBA 3VS0A 4O7ZA 5AR8A 2J4ZA 2UW4A 4IAIA 3HX4A 2NNWB 3S2PA 3NAYA 3FLSA 5CNOA 4F99A 4DH5A 2WEVA 1H08A 5D1JA 1AGWA 4UMUA 4GEOA 1ZLTA 4X3FB 2XB7A 1G5SA 3CCNA 3LW0A 5FXQA 2C6EA 3I5NA 1CKJA 2XNPA 3AXWA 4FNXA 4YC8A 3DJ7A 3ZUVA 3RINA 4D28A 3R01A 4YC3A 2PZ5A 1LP4A 3GENA 2ZMDA 5AMNA 3P7CA 2GHLA 5AUVA 4OTRA 5TE0A 4O1PA 3BYOA 3RBWA 3D7TB 4BHZA 2P0CA 3HP2A 2XJ0A 3IDPA 1YI3A 5CSWA 4KBAA 1A9UA 3QQFA 3BWFA 5CAQA 3ZBXA 4CT1A 4BCQA 3AKJA 3ZSIA 5IQFA 2BDFA 5DFPA 4MXCA 4F09A 4ZY5A 5L2WA 5E8SA 3A8XA 4YSJA 3SXSA 1ST0A 2IVUA 3KQ7A 4H58A 4D2SA 2O8YA 4HNIA 5I9YA 4EH5A 3CY3A 2RFSA 5IQIA 3VUHA 2VAGA 3QQHA 2ERZE 5KMOA 2QOQA 3DTCA 5HE0A 3HV4A 4FT9A 4OTHA 3ZLXA 4X2FA 4DFZE 4PTCA 4N6ZA 3ZO4A 3UIMA 2JAVA 4DFXE 2GPHA 3OCTA 1NVRA 2FO0A 3R2YA 1ZWSA 3R7GA 3QQUA 1CMKE 1FGKA 4MEDA 4O0WA 3D5VA 4EOLA 3PE2A 3KGAA 3Q2JA 4FIHA 5E1SA 5CEMA 5HI2A 3ZXZA 1W2FA 3RAHA 4BY9E 5DWRA 4ZSEA 4H1MA 2PL0A 3OC1A 4O4EA 2FSOX 2OW3A 2WQOA 2YEXA 4W4XA 4BBEA 2GCDA 5KMKA 3AC2A 4P5QA 5JFSA 3R9OA 1OMWA 4FL1A 5GNKA 3TV6A 2C6OA 3QBNA 4PY1A 4HNFA 2C6MA 3DY7A 5CQUA 1MQ4A 3NNVA 4AZEA 3V5JA 1Z5MA 3EOCA 4IVBA 2YIWA 3BELA 3PXYA 5EDPA 3Q9ZA 5HE2A 2LAVA 4FVQA 3TI1A 3BHTA 3LMHA 5HBEA 4FSRA 2VN9A 5CU6A 3R7EA 4NEUA 3EYHA 2ITOA 4GFGA 3LCKA 4EOSA 3HAVA 3KMUA 4FG8A 3R8PA 3CTQA 3F61A 3LOKA 3UYTA 2VO0A 3EMGA 4AW2A 3SG8A 4R3CA 4Z55A 3AOXA 2HWOA 3RK9A 2BROA 2VUWA 2ZV2A 3DJ5A 4GUEA 5I4NA 1I09A 3CGFA 3F69A 4UB7A 4BYJA 2YLEA 2X9EA 3I60A 5A6NA 2P2HA 4WBOA 2UW6A 1ZZLA 4IBMA 4OBPA 2UZWE 4BFMA 3EKNA 2C5YA 1PXMA 4YJSA 5ETAA 5CAVA 3TV4A 4O7SA 5J7HA 3P9JA 5GJFA 4EZ3A 2G9XA 1YDSE 2OICA 2JBPA 4LV5A 2WMAA 4A9RA 3FSFA 2XNMA 3RVGA 3LKMA 4QPSA 3VS3A 4LV8A 5DEWA 4NYEA 4FV7A 5H8BA 3ZZEA 4C37A 4FTKA 3WZEA 3L8VA 4C34A 3FMKA 3HV6A 4UXQA 2Z7LA 4CZUA 1PYEA 4O82A 2OKRA 4UBAA 1KE7A 3MH1A 3TZ8A 3HKOA 2PVMA 5CI7A 4DCEA 3O17A 3E63A 3D5WA 3W2QA 4AA5A 1XO2B 3AMAA 5A9UA 2VTAA 2XNEA 3R8VA 1UA2A 2GDOA 3QGWA 4M8TA 3W2PA 4XJ0A 2XKCA 3FL4A 5IH5A 2IO6A 3DAKA 3MPTA 4ZXTA 3LHJA 4I94A 4I6LA 2ZVAA 3ZU7A 3EN5A 2GSFA 4BDFA 3WILA 4EEVA 5AUUA 2ETRA 3LPBA 2ERKA 4Y5HA 5CANA 3EHAA 4LL0A 5B7VA 2W7XA 3GCVA 4WG4A 2C1BA 3BGPA 1OI9A 5JSMA 2DQ7X 4RZVA 1XQZA 4W4WA 3MIAA 4XH6A 4CT2A 3IW6A 3EYGA 2B9HA 3A4OX 3IW4A 4NCTC 4F9BA 4FVPA 3U6HA 2C6DA 4IACA 5ETIA 5LMBA 4IAKA 5K0XA 3A7IA 3UC3A 1FOTA 4MXAA 4IVCA 4CMOA 4ZP5A 1E9HA 3CC6A 4AOIA 2WMBA 3RJCA 4APPA 5C8NA 3LZBA 1OL5A 1TVOA 4GMYA 5A4QA 1UU8A 2VTNA 1K9AA 3GI3A 4QP1A 4F08A 3ACJA 3MVMA 2PUIA 5BYZA 2Y4PA 2JFMA 4TYGA 3K2LA 5ACKA 1OKYA 2O64A 2XVDA 2J9MA 4M68A 4JNWA 3NDMA 4PMMA 3ORTA 4QEBA 2ZB1A 2P3GX 1WMKA 3C4FA 3CIKA 4FTUA 3ORNA 4EK6A 2C68A 4FJVA 3HRCA 4AXAA 3F66A 2WFYA 5LARA 4YJVA 2GQGA 4ZSLA 4CZTA 5CU3A 4OR5A 4LM5A 3V5PA 2WMQA 5HX6A 4UYAA 3UVPA 3TZ7A 4F6SA 1ZY5A 4DBNA 3DXNA 4YR8A 5HKMA 5HTBA 1H1RA 4G6NA 5LVPA 4U0IA 1Q61A 3KL8A 4GK3A 1STCE 1M2RA 4BZOA 4X2JA 2X2LA 4XV1A 4IAAA 4FVRA 1SVHA 4I22A 4D2WA 2VTOA 4NW5A 3L9LA 3HGKA 2F4JA 4L01A 4QNAA 3W0SA 4RQKA 3LLTA 3POZA 4ANNA 3CD3A 4O0YA 1Q8WA 4C4JA 5LMKA 2ITQA 4XG6A 1XH4A 5L8JA 4RX7A 1ST4A 2W1HA 2YWPA 4JG8A 1K3AA 3KK8A 2O65A 2PMOX 3EQIA 4KAOA 4M15A 3TIZA 4F7LA 3K54A 5DE2A 4FSTA 4K18A 2X8DA 4PMTA 4EK4A 1WBTA 1CSNA 1ZOHA 3V04A 3V5WA 5AAGA 2R64A 3OWPA 5M08A 2PVFA 1Q8YA 2GNFA 4O0RA 1DM2A 5LVLA 4FKQA 3IS5A 5FG8A 2O5KA 2OFUA 2V7AA 3NNUA 2FSTX 4IAZA 1JKLA 4JX7A 3V5LA 4G5PA 2W5BA 2WTIA 4GKHA 4D9TA 2JIUA 2H8HA 5HVJA 2QLQA 5KZ0A 4BKZA 5K3YA 1PMUA 2GQSA 1H26A 1FMKA 4YPDA 3SVVA 3KVWA 3LXNA 4BTMA 4ITIA 3KU2A 3UP7A 4IEBA 4GK2A 4Y95A 2XRWA 3NIEA 1UNLA 3GC0A 2NYAA 4FZ6A 3BHHA 1JKSA 2IWIA 2WEIA 2C5NA 4MKCA 4PQNA 4U42A 2W1ZA 4X3FA 4C36A 4D2VA 3PLAE 4OTFA 5AUZA 4BDCA 1JLUE 2C6TA 2VO7A 4C2WA 5E1EA 3R9NA 1YHSA 4ZIMA 4FEUA 2OBJA 3HMNA 2ACXA 3QTIA 4PPBA 4EWHA 3KRRA 2WGJA 3BLRA 4ZJJA 3TT0A 2XAMA 3EB0A 3ORXA 2XNOA 3Q52A 3SX9A 5JKGA 4FL2A 2CGWA 4CGAA 3NS9A 2ZJWA 3L9NA 4BDDA 5E92A 1PMEA 5HG5A 4YHFA 5AP4A 4ERKA 3LM5A 4IJ9A 2BZIB 2PMLX 5T68A 4J99A 4NM5A 3GU7A 5AADA 5JGDA 4O86A 5GINE 3OVVA 5LCKA 5DEYA 1B39A 3G2FA 3Q96A 4M0YA 3SKCA 2GU8A 4CYJA 4F70A 2O2UA 4CNHA 2ONLA 5LXMA 3RNIA 4RJ8A 4I21A 4M69B 4YNOA 2UZVA 3UC4A 1JKTA 3VHEA 2OI4X 4XCUA 4DT8A 3FLZA 1FVRA 3AC1A 4GYGA 4TNBA 4YJOA 3C7QA 5EHLA 2W9FB 4S32A 4L45A 3OEZA 3PXRA 2V5QA 3BIZA 3OWKA 4G6OA 4IDVA 4G5JA 4RWLA 4QPAA 4TYEA 1M17A 2EXCX 3TNHA 4BWPA 4D0WA 4BBFA 5FTQA 3UO6A 2XNNA 3TACA 2BUJA 2GS6A 4XV9A 4YLLA 5BVOA 5IQBA 4MBIA 2C6KA 5HVKA 4L42A 2ZV9A 4HGSA 3H0YA 1M14A 5DOSA 1SMHA 3UPXA 2QOHA 4G6LA 3GNIB 3R73A 2OIQA 4ZOGA 4BTJA 2RGPA 3LCOA 1BLXA 5EOBA 4DGMA 4C3RA 1J7LA 4JBQA 4RIWB 1OGUA 3BYMA 3WOWA 1OIYA 4O6LA 3G9LX 5FM3A 4B99A 3ATTA 4WSQA 3CTHA 5B2LA 2ITUA 2Z7QA 3BZ3A 4QYHA 5AP6A 4BCGA 4ACCA 4BCJA 4MHAA 5F4NA 3PTGA 4XP3A 1Y6AA 2CPKE 1H0VA 1KV2A 4PL5A 4NIFB 1W8CA 3PG3A 4YNEA 5AFVA 2IVVA 1YWRA 1OKZA 3R71A 1G8SA 4IZAA 5CU4A 3NYOA 5C26A 4KBKA 2OGVA 5CX9A 1PXIA 4O4FA 2QOCA 4PL3A 4R8QA 3HV5A 5JRSA 1UNHA 3QZIA 4FTCA 4IFCA 2F7XE 5FEDA 3T3UA 2QG5A 4OGRA 1ZAOA 3S95A 4QP8A 1W82A 2FUMA 1S9IA 2B1PA 4O1OA 5LWNA 2PULA 4O4DA 4NUSA 2JKOA 3NUXA 3UDBA 3TZ9A 4DEGA 4DLJA 4L53A 3KCKA 5DPVA 2X0GA 2E9NA 3IGOA 2J2IB 5A54A 5JMSA 4L3JA 3T9TA 3ZFMA 1H8FA 3C9WA 4LGGA 3PDTA 2XBJA 3T9IA 2BIYA 2R2PA 3A99A 4RG0A 4M97A 3PWDA 1ZYJA 2BVAA 3RNYA 4OT6A 4OBQA 2I0HA 3VBWA 4Y85A 4ANQA 2WU7A 5CZIA 3UGCA 3UE4A 2W4KA 2HWPA 1G8JA 3OBGA 1WBVA 3MH2A 4J52A 3NUNA 1BI7A 4JRVA 4UMRA 2OZAB 5HNIX 4G34A 1APME 2ZOQA 3HV3A 3JY0A 4OBOA 3T8OA 2R3FA 2Y6OA 4WHZA 5E8ZA 5I9XA 3I6WA 2J50A 3ORMA 4RVKA 4HPUE 1H01A 1V0BA 5BVNA 2HW6A 2WMTA 3FJQE 4NFMA 3EL8A 5EYKA 4D2TA 5IDPA 5HTCA 1OPJA 5J87A 3FQEA 3OTUA 5M55A 2XK6A 5DT4A 3IKAA 4S33A 2V22A 5HICA 2QCSA 3IONA 2WTKB 3KULB 2VTIA 2NRUA 4X2NA 3O8PA 4TWOA 1BI8A 2F2UA 4WO5A 4U80A 3SQQA 5M06A 2WMRA 2R5TA 2HIWA 2R0IA 4IVAA 3KXHA 3VWAA 2QOKA 1M2QA 1K2PA 2ITYA 4IW0A 4TZRA 4QMYA 4C2VA 3QZFA 4AT3A 3R8MA 1XBCA 3KMMA 3P23A 2OXYA 3V8TA 2H6DA 2CLXA 4FSYA 5BVDA 5HX8A 3BI6A 4KNBA 4TRLA 4BHNA 1S9JA 1X8BA 3W0MA 4FSZA 4FV8A 4LRMA 1GIHA 4BC6A 4H05A 4KS8A 1WBNA 3ZBFA 3SGCA 4AXEA 1REKA 4KIPA 2G2HA 5CXHA 3E8CA 5M4UA 2F57A 4I4EA 4AQKA 4HYIA 3E3PA 4AF3A 4IAYA 5CWZA 3UMXA 5JT2A 4PDYA 4A4XA 4EI4A 4V05A 3ZXTA 2JDVA 3LMIA 4X0MA 5DNRA 3QQKA 2PZIA 1PXJA 3G0FA 4S31A 4WG5A 3DNDA 3GU6A 3PG1A 3D94A 3FE3A 3OD6X 4ACHA 2J0IA 3Q04A 5AEPA 2R3NA 1J7IA 4RQVA 2P33A 4GUBA 3WZDA 2UV2A 4ARKA 3O0GA 5IQAA 5EYDA 2XJ1A 4K9YA 3FI4A 4R5YA 3OROA 5AP5A 3RKBA 5IA3A 3R8UA 5ANOA 5KBQA 3OMVA 4OTIA 3FZOA 4FIJA 4ALWA 2G15A 4OAUC 4I20A 3F2AA 3NNXA 1JWHA 3BV2A 5E8XA 2XEYA 4AZVA 3U55A 3EQPA 5KE0A 3O71A 3RHXA 3PXZA 3PIZA 3CJGA 4H3BA 2A2AA 3UZPA 3EFJA 2QURA 3NUPA 3NX8A 4NKSA 3P08A 4J7BA 2VRXA 2XCHA 2J0MB 2WMSA 4FUYA 4ZTMA 1PY5A 2ZAZA 4BGQA 4BI0A 4X6QC 2W99B 3CEKA 5E8WA 3VS6A 3IW8A 4FV9A 4AN3A 2OH0E 4AN2A 4EJNA 2AEGA 1URWA 3GCSA 4HZSA 4W4YA 1ZOEA 4KBCA 2R3KA 3QUPA 4JAJA 4B0GA 2UVZA 2W4OA 3HL7A 3OTVA 3PY1A 3NNWA 3D2KA 2PE0A 4K11A 4EOKA 5K4JA 3C5UA 3COMA 3JVSA 1U5QA 4ZJVA 5FUTA 3G51A 4D2RA 2ITVA 2R3JA 2VTJA 3D9VA 3M11A 1W98A 3QC9A 4RIYB 5B2KA 3DK6A 1Y91A 4G9RA 3NUSA 4J53A 2Z02A 4AA4A 4WKQA 4EQUA 4F4PA 2E9VA 4BCHA 3QLFA 1WBSA 2PHKA 4ZTRA 3UODA 2UZBA 2WNTA 1GZ8A 3BE2A 4GV1A 2QO9A 1XH8A 4Y72A 5EW9A 2CGXA 3II5A 3UIBA 4FV3A 4QPMA 4F9WA 5IUHA 2XA4A 1QCFA 2O3PA 3QALE 3FL5A 3DDQA 1H07A 4NFNA 4K33A 3L8XA 4Z7GA 5M56A 5HNBA 1PRYA 2VTLA 4EOQA 4XX9A 3K5VA 5ACBC 5KMJA 3AC8A 4GJ2A 3NVMB 3PPKA 3MYGA 2OXXA 1ZYDA 2VWXA 3DGKA 4FT5A 3K3IA 5AIRA 4AOTA 4Q9ZA 5L6OA 2NRYA 3EQHA 5FP6A 5LCJA 3WYXA 3IK3A 4ENXA 2W06A 2QU5A 3ALNA 2W0JA 3E87A 3TYKA 2WMVA 4KRDA 4M66A 3AGLA 3EQBA 4I6HA 4N4SA 3CP9A 4X21A 2CKEA 3Q4TA 5KUPA 3O96A 3N4UA 3ZLYA 3ZM9A 2QOIA 4EYJA 4I5PA 3W2RA 2GS2A 3BL9A 1AD5A 2BRBA 3MA3A 3MV5A 4ZY6A 5KO1A 1GY3A 3G0EA 2J0KA 5HE3A 2R3QA 4L8MA 2OIBA 4I5CA 3W8QA 4PV0A 2JDRA 4IIRA 1R3CA 4BZDA 3HMIA 2QG7A 4QP9A 2XRUA 3CR0A 1FMOE 5HNGA 3OUKA 3EN9A 1NA7A 3R04A 5AP1A 2ITWA 3SV0A 2W05A 3BQRA 3H10A 3PY0A 3DLZA 3GOPA 4QMTA 4TXCA 1UKHA 1G8AA 2FGIA 1OL1A 3PVWA 4WA9A 4AZWA 2QKWB 2WMWA 4DG2E 1UVRA 4FV4A 2XARA 3N4VA 3IQ7A 4G1WA 2CSNA 2QR7A 4YGAA 2IVTA 3F9NA 3PVUA 4AT5A 3ERKA 4YZDA 3SRVB 3Q5IA 1H1QA 2PVYA 4FA2A 4O83A 4PMPA 3D5XA 3RWPA 2OSCA 3E92A 5E8TA 3ZRLA 4C35A 3LLAA 2VTQA 5K5XA 4I1ZA 2XK3A 3FMMA 5C4LA 1OGYA 1P14A 4O0TA 3GFEA 4CTCA 5CAUA 1QPDA 1CKIA 4DTKA 4NM0A 5CSVA 3DV3A 4GSBA 3G9NA 1OITA 4G31A 4W9WA 2IPXA 1RJBA 3WBLA 2XIXA 3VS1A 3RAIA 3ENMA 3RZFA 1TQMA 3E88A 3A62A 4JQ8A 1NT2A 3WF8A 3PUFC 1W83A 4ZS0A 3C0HA 4KKHA 1YWNA 3VS2A 3VULA 3VO3A 4ONAA 5J9YA 3DQWA 4CXAA 1R0EA 3OOMA 2RG6A 2WB8A 1Q24A 2CGVA 5L4QA 5KNJA 3A7JA 1OKWA 4C4FA 1KUTA 3AGMA 4DC2A 1O6LA 4ERWA 5DYJA 2C47A 3R9HA 2IZRA 2C0TA 2Z7SA 3L8PA 2CKPA 4DH1A 4AFEA 1H28A 1O9UA 3G5DA 4DGGA 1PMNA 1ZOGA 3W16A 3VUGA 1OKVA 4D4VA 5FTGA 4YTIA 3AQVA 4IFGA 2QC6A 1KE6A 2YN8A 3E8EA 5KZIA 4QQCA 3EQCA 1XMLA 3BCEA 2JBOA 4XLIA 4XYFA 5EM7A 2HK5A 2WTVA 5BUJA 2PWLA 5F9EA 3NIZA 5AV4A 2CNVA 3AKKA 4DG3E 3UDZA 3VBVA 4HZRA 4R7HA 4FKSA 3WF7A 4YJTA 4OTGA 4ALVA 2UW0A 4PDSA 5CALA 4YTHA 1P2AA 4PWNA 4BZNA 1QMZA 3PXFA 3A60A 4JLCA 2J5EA 2ZMCA 3LJ0A 4XRLA 3QHRA 5IDNA 3H9OA 3I0OA 5EQEA 5IH6A 4CCUA 4ANBA 4FV1A 5CEQA 2YAAA 4R7IA 3PJ2A 4DYMA 5AR2A 1JVPP 1LR4A 4ANOA 2HENA 1GZKA 2WQEA 1GOLA 3N51A 3QAME 3A7GA 5HCXA 5HIBA 5IUIA 4AZSA 4O4BB 3C0IA 3ELJA 1JSVA 4LDTA 5IG1A 5AV3A 4E20A 4FEWA 4FODA 4MBJA 4O7YA 1REJA 2C3IB 1LUFA 5HORA 2Y9QA 3L9PA 4LG4A 2PY3A 2VD5A 4CMTA 3LFBA 5CEIA 4FI1A 1IASA 2B54A 4I6BA 4MBLA 5AJQA 3HLLA 3OXIA 5DRBA 4RIXA 3R2BA 4FZDB 3RPVA 3I7CA 4BIDA 2YIYA 4ZLOA 2RFNA 2CMWA 1U46A 3QTZA 4R3PA 5GJDA 4GG5A 5C03A 3VRZA 4DGNA 4DHZA 4M14A 3SA0A 4FTAA 3AT2A 5I9VA 2WTCA 2JAMA 2PK9A 4I3ZA 2QKRA 3VJNA 3MI9A 3I7BA 2NPQA 1MRYA 5HQ0A 3TDVA 3B8RA 4WUAA 4L9IA 4EUTA 2ONLC 2CLQA 5CEOA 1Y8YA 4TYHB 4IC8A 4U79A 4S34A 4QYFA 3OS3A 3F3ZA 2A98A 5LVMA 4CKRA 3CS9A 4CYIA 2JKMA 5EM6A 3RM6A 2YDKA 3OF0A 3VQUA 2HZIA 4EOOA 3O8TA 4U5JA 5DR6A 2C0IA 3QXPA 4FGBA 5BPYA 3UBDA 3QTXA 5ANEA 3UO4A 2EWAA 4CKJA 2WTKC 3FV8A 3R1QA 3HP5A 1LPUA 3KN5A 4YZCA 3R7IA 4HGTA 3UNJA 4EHGA 5IMEA 3HMMA 1SVEA 4II5A 4S2ZA 3PIXA 3ZUUA 2ZM3A 4DHFA 3F3TA 2GTMA 5ETCA 3ETAA 3TDWA 5AP7A 4RRVA 3CKXA 4X3FC 5J5SA 1QL6A 3FQSA 3OFMA 5AAFA 3VUKA 4M12A 1SZMA 3G33A 2XK4A 4FEQA 2WPAA 4MXZA 4PTEA 2I40A 3OCBA 2QHNA 2HZNA 4DEAA 5AUTA 4I6FA 2WOUA 2WU6A 2IVSA 3D14A 5DMZA 3EN4A 2XM8A 3GU5A 3H0ZA 4IWDA 3NWWA 3B2WA 5HIEA 1IA9A 3WE8A 4LUDA 4AE6A 3A7FA 4QYEA 3P5JC 1NXKA 4QTCA 4FKUA 3E93A 4MUQA 3GCUA 2R7IA 4OW8A 3W2SA 5HLWA 1UV5A 3HZTA 5BVEA 3GC9A 2I0VA 5HBJA 3KN6A 3KC3A 2UW9A 3QKLA 2PSQA 5AR3A 2IG7A 5KMNA 2NO3A 3LCSA 3NUYA 1JKKA 1XH5A 2C69A 3MFSA 4BI2A 4O7LA 1EH4A 1ERKA 1YXTA 3NR9A 2R0UA 3LVPA 4BDKA 4E7WA 4AZFA 4RJ6A 1Q41A 4ITHA 2BCJA 3FMHA 2JGZA 2PVRA 3KA0A 3KK9A 4Y5QA 3QRKA 2XYUA 5FQDC 5F20A 5J7BA 3ML1A 3H9FA 4GG7A 3B2TA 4GVJA 3R30A 3WIKA 4J97A 3WF6A 2PZPA 4ZK5A 1SVGA 1YHVA 3VF8A 5M4IA 5E9EA 3NAXA 1PF8A 4C7TA 4DEHA 1WFCA 2ZM4A 3JXWA 1W7HA 3MWUA 1R1WA 4R3RA 2BRGA 1WVYA 3FC1X 3FYKX 5DH3A 3PUPA 3UZTA 2VTPA 3OY1A 3JS2A 4LGHA 5M4FA 3VS5A 4BR3A 2PTKA 2Z2WA 3F5PA 4IQ6A 3T3VA 5CQWA 3C13A 2SRCA 1XJDA 2OO8X 3A4PA 4UWBA 4BN1A 3Q60A 5J9LA 3O5AA 2BILB 1Y6BA 3NLBA 2JEDA 4I24A 4C33A 4YLKA 3MTLA 2G2FA 2W4JA 5A14A 5IQDA 3C4XA 2HYYA 4P5ZA 3UTOA 4ASDA 2QLUA 2ZFYA 1MQBA 4U6RA 3FZTA 3MY5A 3FLNC 3SC1A 4AXFA 5HD4A 4FMQA 2QR8A 3N9XA 2VWBA 3I6UA 4CTBA 5LVOA 4WNPA 2CN8A 3SOCA 1G3NA 3QD3A 3GU8A 3UNZA 4QMSA 3DB8A 3DCVA 3HA8A 5C01A 3W55A 4FKWA 3SW7A 4YJPA 4J96A 2W1IA 4U40A 4TWCA 3ZC5A 4Y73A 2EXEA 3EFKA 4QP3A 5CS6A 2HOGA 3TJDA 3QZHA 4D9UA 4XG3A 1DS5A 5CVHA 4RFMA 3QQJA 5CAOA 3M1SA 4FNYA 4TW9A 4A06A 5BUIA 4NCTA 1WVXA 3HYHA 5CNNA 5AM7A 3GQLA 4LQMA 3RCDA 4C02A 2FYSA 5E91A 4P2KA 2X1NA 2C0OA 4ID7A 3GQIA 4FGRA 1URCA 2A27A 2BTRA 3FWQA 4I23A 5HU3A 5FBOA 2QO7A 1MP8A 2ITTA 4EJ7A 3LFCA 5GIPE 4JS8A 4J95A 4QQTA 2IW9A 5L6WL 4QYYA 2WO6A 3OOGA 4KABA 3QGYA 3HECA 3LFEA 4F0GA 1VZOA 1CM8A 3ALOA 4L3LA 3QRUA 4MXXA 5EW3A 2YM8A 3UQFA 3FI8A 4EBVA 1OECA 2R3OA 3FPQA 4MH7A 5I9WA 5K0KA 5M44A 4QQ5A 1KE8A 5FDPA 1J7UA 5IA1A 3QKKA 4BL1A 3CTJA 4X7QA 2UVXA 5A4CA 1GZNA 2W1FA 3SXRA 2R3GA 4RSSA 5FEQA 3JVRA 3FLQA