3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
3TVTA 1XF9A 4A0FA 4HZUA 2C95A 1BYIA 2VHQA 3HR7A 5DYGA 1P7CA 5LB4A 4M8NE 1WP9A 1J8MF 2RGAA 3AP3A 2RCNA 1OF1A 2FOLA 3KXIA 4DCSA 4EIWA 1WE2A 3OE7A 2WPDA 4GOJA 3R8CA 3GLFB 4DSNA 4CDGA 4H1UA 1MABA 3B9PA 4PHGA 1NBME 5BN3A 4W5JA 5FPKA 3MJHA 2BMDA 2C9YA 5TY0A 4CEHA 4QBHA 2D62A 4M1YA 3B6EA 3LVQE 2J0VA 2ZEJA 5TVKA 2ORVA 1S0UA 5FOUA 3MG9A 4IHQA 3SS8A 4ILEA 4BEJA 4YMTA 1FQJA 4EFLA 3AEZA 2ZE7A 4CT4B 4KBFA 2FNAA 4DEYA 3E70C 3VKGA 3K0SA 4LJ5A 1N3BA 4U00A 1W49A 4WXPA 3U7FB 1JR3A 2OUKA 2QZ4A 4TMWA 1NNEA 1R6BX 5EUMA 1P2VA 3DDCA 4LBVA 4UNSA 1OH7A 4Z54A 1Z28A 4FN5A 1XJQA 1W4BA 4XJXA 1WCV1 2CHVA 1Z63A 2ANBA 4DUGD 2ZRHA 3QG5A 4GT1A 4X8HA 4WBSA 1CR2A 2FSGA 1RRFA 3CBQA 3M0EA 4BZXA 1FMLA 1LF5A 3P4XA 1N6RA 5GADl 2H7VA 1UJ2A 3AF2A 2XB2A 1Q22A 5L3SA 1JXMA 5FBWB 2A7QA 1OHHD 1FOEB 4C0LA 4D25A 1E9SA 3LRPA 4DLZA 3RS4A 2UZIR 1T9HA 2AK3A 1O87A 4Q01A 4DCNA 4DEXA 2OCYC 2QPTA 1UAAA 2IS4A 3WBJA 4A2PA 5EP4A 4B3CA 3W3AA 5G3YA 1ZMXA 2QAGA 3QXSA 5JEEA 4Q00A 2C77A 4ZCLA 4UJ3A 4BLSA 4TTRA 1SVKA 4IJMA 4XWKA 1R5OA 3V9PA 1HA3A 5FBQB 1VCIA 3KKNA 3THYA 2MMCA 4TWZA 3TR5A 2Z4RA 4OKSA 1J7KA 2XJ9A 1A4RA 3IIMA 3LAWA 2CK3D 2O0HA 4QHTA 4TSFD 3CRMA 3K09A 4ON9A 4WAUA 2VLIA 3SFZA 1BYUA 2V7QD 3HYTA 4QGAA 1NLFA 1Z6XA 2H92A 4LWZA 2WV9A 4JLVA 2PLFA 4LDJA 3SJZA 2AWNA 3WMFA 2ZPTX 3IUYA 4FCVA 1BKDR 1OXXK 2XXAA 2IXEA 4A92A 4LBWA 1W36D 3K70B 2O52A 2RGXA 3EZ7A 4M53A 4AG5A 3QVUA 3THXA 1RKBA 5IK2A 4C4PA 3QKTA 3DVLA 2CJWA 4NCHA 1SKQA 1IY1A 1YJ5A 3TW8B 1LW7A 4TYYA 2E9SA 4F4CA 1ZD1A 2KBFA 3P26A 4CEIB 4B3FX 1KI7A 1UF9A 2O8DA 1LFDB 3TSOA 4HEJA 1SXJB 4QBIA 4JLDA 5IF9A 3B8HA 4X8MA 3I62A 3ECCA 2BHRA 2I1VB 3ZZTA 1FP7A 4LBYA 4QBGB 4LHYA 4EPWA 2ZREA 2GJAA 1F2UA 1U0JA 3WNDA 1E2QA 2SHKA 1UDXA 2BOVA 2WJGA 1AN0A 4A8JB 4FWIB 2HF8A 1A2KC 4XVRA 5CDFA 1OIXA 5JHHB 3K0FA 1XCMA 1TL7C 2W2VA 2AFIE 4JVLA 4LYJA 2WWIA 3QF7A 4IDHA 3K0CA 3TE6A 3EX7C 3DPUA 2REXB 3IKJA 2X19A 4RD4A 2RKOA 3CRVA 3R9WA 3BFKA 1T8TA 5AUOB 3B5JA 3QXHA 4DRZA 4GNKA 3U6KA 2BEJA 2BCGY 1GNRA 4BFYA 4GZMA 2OE2A 3CRW1 1YR7A 4QGGA 3GLIE 5JI3E 1R0WA 2KE5A 2O8BB 5FL7D 3SBDA 2HLDD 2WJVA 3DKPA 1HQCA 1N2CE 1R0YA 2Z5FA 3JVUA 5AUPB 1PZNA 2GJ8A 2YWFA 4M21A 5B58C 2KBEA 4A0HA 1TADA 1YE8A 4JL6A 4L16A 2IWRA 4B3DA 3EPKA 3LXXA 4NONA 4D0NA 3OIVA 3TUJC 2YV5A 4ABYA 1Q0UA 1M7BA 1SQ5A 1YRAA 2GILA 3HP1A 3WMEA 2PEYA 4Q48A 4PX9A 2QSZA 4KXFB 4NYJQ 1X1SA 1C1YA 4WA7A 2ZYUX 3U44B 3WHLA 4BQSA 4YMWA 2FE4A 1W36C 4B75A 2W58A 3WYFA 4Z8XA 1E3MA 2ZSDA 1HTWA 2HJVA 3T61A 1GG2A 3V4FA 1AZSC 3FKQA 3FVQA 4ZO4A 4GP6A 3H84A 3FMFA 2XNDA 5J5CA 5A4JA 1XXHA 2XSZA 1KY2A 2ODNA 2G0NA 2VSXA 4R9UC 3TAHA 3DMDA 2ERYA 1X6VA 3K9HA 3UIEA 5TARA 4Q4JA 1E2JA 4B76A 1D9XA 2WWYA 2F1HA 2BEKA 4LCBA 4NYMR 3NHAA 4RKFA 1KO7A 3QG1A 3SC3A 3HU1A 1VYUA 3GD7A 3NC0C 5F98A 5E7MA 2CVFA 3QKRA 2JIZA 1OYWA 1GVNB 2EFDB 4E22A 5B30A 3LV8A 2GWHA 2A5DA 3TRFA 4NCKA 5JJKA 3X1DA 3ZVNA 1NMYA 3Q9LA 4DSTA 4ARZB 1FUKA 2KSQA 2QM8A 4HAXA 5CB8A 2VH5R 1VHTA 2ZYWX 4AG6A 1TTTA 1PUIA 4HLCA 3D8BA 4HSEA 1S96A 4H1VA 4W9MC 5DN6A 2P3SA 1ZC3A 2HLDA 4O2LA 4JLPA 2F1RA 1JECA 1MO5A 1W4RA 2BDTA 4A9AA 2AHOA 3EC2A 5EJEA 3U60B 1RFLA 4I81A 3A1UA 1OE0A 4WZBE 2AXNA 3DHWC 4JVNA 3WHKA 1F2TB 1W2HA 4A2QA 3TR0A 2QTHA 2E87A 5KO2A 4KFTA 1M7GA 5KNCA 2NO6A 3C5HA 5K8IA 2IW3A 2DFNA 1E2FA 3T1QA 4ZDJA 2VBCA 1GKYA 4KVAA 3BAFA 2MSEB 1XEFA 2ONKA 5JEDA 3PEWA 3AM1A 1ZAKA 2ANCA 1R4AA 1NVXQ 2FWRA 1Q12A 1W47A 2BBTA 3GCGA 4PO9A 4YDSA 3T1OA 4TMZA 2ATXA 4Q66C 4AI6A 4HDOB 4ZDWA 3Q7PA 3WMGA 2IYZA 4FD2A 1JR3E 3EG5A 2LKDA 1GITA 4CEJB 2J0UA 2BMJA 2RH5A 3GLHA 4PQRA 4TMVA 1P61B 3MLEA 4FIDA 3CPHA 4LV5B 4PO8A 4MGZR 1T3HA 2P2LA 3IHLA 3M4YA 2QP4A 2QE7A 1BH2A 2B8TA 1XEWY 3H0KA 4DCUA 4AIIA 4F91B 4GRAA 2OAQ1 3CX6A 4BFUA 4DIEA 4G5OA 3U44A 2QAGC 2IEYA 4MUAA 4EJSC 4LPKA 3ZH9B 1NMZA 3F5FA 1XTJA 3LX8A 1KGDA 5KDLA 4GL2A 3REGA 3C16C 3TQFA 1YZKA 4PFSA 4C3ZA 2C5LA 3Q8XB 2IK8A 1S3GA 2QSYA 2V7QA 2WICA 1KI1A 5E3HA 4LYFA 4LC0A 4R71A 5JMTA 3A4MA 3R8FA 2YVUA 1KZGB 2R8RA 2VP0A 2GKSA 1H8ED 1OH5A 5EE9A 1JXOA 4YMVA 1D2MA 2IXFA 4RZ2A 2LCFA 2WWHA 1EFRA 4V0MA 5DH9A 5FR2A 4CVNA 1Z47A 4TYNA 2JA1A 1LF0A 1ONBA 2GDJA 1JNYA 1EFUA 2CLDX 1RW4A 4C2TA 4Q1DA 3AKCA 2XITA 4YQFA 2NGRA 3G0HA 3TH5A 1JJ7A 3VU9B 3KL4A 2GEUA 3CM0A 3KTAB 3PUVA 5LB2A 1DAIA 2W0SA 2QMHA 2YOFA 1P9WA 4G01B 4PO1A 2GCPA 4D4MA 621PA 1CRQA 2PT5A 3GLHE 1IBRA 5EXXA 4B71A 2YHSA 2GA8A 1FX0A 4ZPXA 2PJRA 3IEVA 3CX7A 2K5UA 1G18A 1XCPA 3MAAC 3T5GA 3AVQA 3CF2A 4RD3A 5LD2B 2ZXUA 3IIJA 1LS1A 3JZMA 1F2UB 1JAHA 2A2ZA 4RZXA 4U5XA 4DLXA 1NVWQ 3L8ZA 3WNBA 3AH8A 3OEED 4ZDIA 3LBNA 1QHYA 3K1JA 3S1AA 1Z0IA 3W6NA 5JSZB 2WIAA 1ZCAA 3A37A 4F4IA 4PC1A 4U7DA 1RRGA 4KI0A 2J59A 5JRJA 2G9NA 3QQ5A 1W0JA 2ZI9A 3IBGA 4IEIA 1J70A 2IXGA 3PQCA 1SXJD 2RGNA 2WJIA 3BFXA 4FXPA 4G1UC 5L8VA 3I5XA 3ICQB 1EFCA 1UKEA 3EA5A 4HI0E 4TL8A 2GRJA 3CONA 3GMTA 2AKYA 3LBHA 4YONB 1B0UA 1YZGA 2EFHB 1VG0B 1XU4A 2XXAB 4BFXA 5DNYB 1BMFA 5D3MB 4GBMA 3D31A 1MOZA 2FDCA 2A9KA 4Q1EA 1DEKA 2H16A 1P5ZB 1WMSA 1DG1G 1IJEA 4JL5A 2IYQA 3DM9B 4PXAA 1NVVQ 2FPKA 3QKUA 4KCGA 5CLQA 1EK0A 1UKVY 1XTRA 2I4IA 2O5VA 4M0LA 3U7HB 2JLQA 2VIIA 4M22A 1G3UA 2W6JD 5TB5A 4LJ7A 2JLRA 2YOHA 2CK3A 2Q3MA 1FX0B 3PV0A 1MV5A 1CJKC 4IVPA 1DBSA 3AP2A 5KU1A 5LDDC 2AXPA 3MWJA 1X3SA 3OIWA 1W0KD 3EA0A 3V00A 3K70C 5C46F 3UK6A 3VNVA 4ASUD 2EWWA 2XZLA 2GCOB 3C4JA 3X1XA 3DOFA 1Z6TA 2ODWA 3SZRA 3DM5A 4IXNA 4N3NA 4XD7A 3BIFA 3OIYA 2H57A 3LO5A 2PLRA 5HTKA 1JQLB 5L3SB 4V0LA 4AKIA 4AWXA 1OKKD 1N0VC 4QGHA 4UQOA 4EJSB 3T5DA 1SVIA 3RS2A 1QHGA 4MRRA 1SHZA 1E2HA 4V0KA 1XPOA 2I1QA 3ZLJA 3WYGA 2BBOA 3NDBB 4RD6A 1EESA 1E96A 1XTQA 1XPUA 1QF9A 3PEVA 4A8JC 1U90A 3FB4A 1UEIA 1E2GA 1S1MA 5AJWA 1GNQA 1T5IA 4BZPA 1KIMA 4KO8A 1P72A 3NDPA 4ARZA 3AVTA 4IOMA 3LX5A 2ZR7A 2GZHA 3ZZ0A 5IK2D 1FL9A 1WA5A 4PAMA 3QNUA 1KAOA 4Q1AA 1GKUB 4FCTA 2QN6A 5DN6D 4XTCS 1SGWA 2WIBA 3MWLA 3RRYA 4R7ZA 2HXSA 5JJLA 4C0HA 2RMKA 3A1VA 3CF6R 3GQBA 3W90A 2PL3A 2J87A 5CIWA 3SFVA 5HR5A 2IS6A 4RFSB 1TU4A 3RAPR 1OFTA 1MRNA 1XNJA 3O8RA 4XTRA 5FUVA 2OFOA 3MWYW 2WZQA 1S3SA 4CZ2A 4CGZA 2YOGA 3AVYA 1KI9A 3RWOA 2PJZA 2RGEA 4IEEA 1HQYE 2W6IA 1UEJA 2WBLC 1N6NA 2ZJOA 4D81A 4IKEA 3KQKA 1WF3A 2O0KA 1AQYA 1CKEA 5LD2C 3Q5DA 1E2PA 2PZGA 2C04A 4Q4AB 1Y63A 5BXQC 3RLFA 2BJWA 2W6JA 5KSZA 4LJ4A 2OBNA 4BE7B 3U7EB 4G5QA 3NIBA 3I1FA 3SN6A 4MRVA 3PVSA 2AL7A 1E2NA 2C99A 3CPEA 3QXXA 2VF8A 4C0SA 4Z1MA 2F55A 3SQXA 2QAGB 3VHXA 5CK5A 2FSIA 2JAQA 5K8TA 3RRNA 1SVMA 2V55B 2QRZA 3A36A 2C03A 2W2XA 4KODA 4RJLA 3PG5A 4HB3A 4BLRA 2XZPA 2KJQA 3P20A 1DPFA 1TQ6A 3TW4A 2WKQA 4KFRA 1OW3B 1OXUA 1LV7A 4DLSA 4FI3C 1HV8A 3LD9A 4DWJA 4HUQA 1J2JA 3VNUA 1M2OB 2F3TA 1G9XA 1ZCBA 2F9MA 1P6XA 3CNLA 3F0TA 3H1TA 1OH8A 4EPRA 2BBWA 1XFAA 3PFIA 2XAUA 4Q47A 4C2UA 4OQNA 4D0LB 4OI0A 3VKHA 2H8KA 2PCJA 4F38A 4DC9A 2BCJQ 1HE1C 3KX2A 2ODEA 2BKUA 1AS3A 4JYBA 5F3WB 1KI3A 1KNXA 3RNLA 1NIPA 4BFTA 4IOKA 2WMNB 4P0TA 4ZI2A 1NN3A 4KLNA 4EPYA 1UM8A 1ZVQA 4D4LA 4FCWA 1N25A 1LNZA 4OI2A 3GPLA 1XEXA 4S2EA 2ZI4A 2ZSEA 1QHHA 4M9ZA 1PLKA 2JLWA 1AK2A 2F43B 4FW9A 1WQ1R 1MH1A 3K0EA 3U2QA 3U3RA 2CBZA 1M8PA 4URZR 1NG1A 2ZI5A 3CRQA 4WZAE 2F3RA 3DZ8A 1G3RA 5G53C 4A0RA 3A1SA 1KI6A 3TK1A 1A7JA 1KK3A 3SYKA 3O8CA 2O8DB 3AF0A 4A1FA 2V6IA 4HB2A 4XVUA 4V0ME 4BFVA 3AVVA 1FTSA 2B7BA 3S1AB 1P62B 5FPSA 4WIAA 3IIKA 1Z83A 2MSDB 5BQ5A 4QKQA 4PSAA 4QC2A 3IO5A 3GFTA 2CHQA 3E5HA 4RFSA 2OLKA 2MMGA 3LQRA 4PPNA 1QHHB 4EJSA 3IEUA 1B23P 2HJGA 1G291 1R8QA 4JBXA 2ORWA 2FFBA 2IL1A 4NCJA 3PJRA 3RS0A 2IEZA 5DHFA 4ZKDA 2J45A 1YZLA 1NY5A 2ZRDA 1KK0A 3RSLA 4E09A 2ORIA 2DYKA 5G41A 4O0MA 4P32A 2HYIC 3QEJA 1CR1A 2O8FB 4JLNA 4HDQB 4ERNA 4HZIA 1XTKA 3NBFA 2VP9A 5HKKD 2FV8A 3THWA 1GUAA 3EZ2A 3P32A 4MYTA 1QBKC 2J1LA 1NJFA 2NMVA 4EKDA 1IN6A 2R2AA 4TL7A 4B48A 3QSYA 2RHDA 1CIPA 5DLQC 3RANA 3FKSA 2GHIA 1XD2B 2B21A 3IQXA 4HLDA 1NJGA 2NOAA 4F7WA 3KZ1E 4KU4A 1SKYE 2EYQA 4RFVA 3BWDD 3ZVRA 3W6OA 3Q7QA 1RIFA 2C8VA 4DIDA 3AB3A 3GLGB 3X1YA 4B43A 1PJRA 3MFYA 1RVDA 4DBLC 4K46A 2GK7A 1Z5ZA 4MKHA 3U4QA 1GILA 1E9CA 2YYZA 3ASZA 4I1VA 2ZJBA 3OE7D 2XSZD 4PC7A 3CPJB 1KSHA 1SZPA 1Q20A 4BFSA 1T8UA 2FG5A 2A3RA 2WOOA 4UXHA 4XSHA 2F7SA 2OBMA 1U0LA 3T06B 5BWMA 5C1BA 1OHHA 3EPLA 4IFEA 2QGNA 4DJTA 3KKQA 4D0GA 3EPJA 1G1MA 3NBZC 1ZM7A 1UBCA 2ZYVX 2ZU6A 1W2GA 1S9DA 1EWRA 2ZRBA 2P65A 1I4TD 4CEJA 5FTLA 2E1RA 3ICEA 1YR9A 2ZVPX 3N2EA 4CYMA 521PA 1EFHA 1NN0A 4DLYA 2G3YA 4DUGA 1VYTA 1H8HA 2QA5A 3L0OA 2BC9A 4GFDA 4Q18A 2IYRA 3EIEA 4EPXA 2R9VA 2ZJ8A 4O25A 5J4KA 2CMKA 1DE0A 1MO6A 1Z0JA 3FHCB 4NCIA 2GK6A 2XTMA 2GTPA 5CIQA 3SJBA 3I3SR 3TKLA 821PA 3ADDA 2C98A 4LGMA 1U9IA 3GEEA 4X8OA 1GNPA 2VQSA 1XX6A 2JLSA 3RABA 3ZZUA 1JPNA 3B9QA 4FINA 2QU8A 2VO1A 2P0EA 1E2MA 2XTNA 2IS1A 4DLRA 3EPHA 5FUXA 4B3XA 4JLMA 1KDTA 5GVSA 3WP0A 1F3OA 2FEMA 2VP5A 5HCIA 1YR6A 3U4QB 3LDAA 2OLJA 2GBLC 1T6NA 2B92A 2V4ZA 2PBRA 2FPLA 5J4VA 2OCPA 2AX4A 5JZVA 2JEOA 3TNFA 4IOLA 2ZAOA 1NMXA 1XP8A 2A5YB 1MO4A 4W5HA 3LLMA 3OFND 3K9GA 3K9NA 4MQBA 1G20E 3VU9A 1HT1E 3PUXA 1E4YA 3KQHA 3KQUA 1VHLA 2WAYA 4LHVA 4WW0A 3BC1A 4B47A 4A8JA 3B1WA 3EAQA 3GEIA 4LOAA 5EP2A 3V4RA 2QP9X 5AUNB 4WVFA 4ACBA 2RGDA 4M9SA 2ZUDA 4URXR 4OI1A 2QNRA 4JBYA 3VR2A 2JATA 4ITRC 2VA8A 2EFCB 2QE7D 4TT3A 1KZ7B 4RD0A 5DI3A 3C41J 4DCVA 2P6UA 5KTYA 2QBYB 2R6GA 1SVSA 1E99A 2ZRNA 3CRRA 3EASA 5L3QB 1ZNWA 1COWA 1IN4A 2PZEA 4OK6A 1EG7A 1MR3F 4LC1A 4NL4H 4TLEA 2WWFA 3C15C 2IWHA 5BYKA 3X2SA 5IDVA 2VYFA 3P27A 3SDZA 4MKFA 4V03A 2QT1A 1DO2A 3GJ4A 1P3JA 1ZYUA 4TZ6A 1NKSA 2GJ9A 4KBGA 3FDIA 1ANKA 4MH0R 1NBMA 1U8YA 4US1R 4B74A 4C0JA 2OSBA 4NTZA 3QI2A 4P31A 5SZKB 3QY0A 2GNOA 5H70A 2D7DA 4DDVA 3HU3A 2X2FA 2B7CA 5JWHA 2G1JA 1SHKA 2XJ4A 1E2IA 2UVQA 4PAQA 2VPPA 4Q4HB 4U02A 3RC3A 2BM0A 1L4YA 2OAP1 1CU1A 2ZI3A 3IGFA 4GP7A 3OFNA 5KNDA 1EFRD 3KB1A 2IYWA 3KFXA 4XWAA 3OEHD 4Z51A 4YXWA 1DAFA 2GBLA 4L4UA 4LJ6A 4N0DA 2OHFA 1TQ4A 3LVRE 4HYYA 4M4SA 3GLHB 4AK9A 1Z08A 1ETUA 1U8ZA 3X1ZA 4ASUA 5C18A 5B64A 3KKPA 3BFVA 1TX4B 3CH5A 4LI0A 4NPHA 2AK2A 2IF0A 3BORA 4KFUA 2XGJA 1ZUIA 4LUCA 3SYLA 2OBLA 4NHOA 5TXGA 1FW6A 2CDNA 1HYQA 2G6BA 2PZFA 5CM8B 1KMHB 2A5FA 4FMCF 3ZD7A 2REBA 3T35A 3L0PA 4AYXA 4LJYA 2RGCA 4IRUB 1ZIPA 3DEFA 2FU5C 2VP6A 4YMUA 5JJIA 1U98A 2XX3A 2OESA 2ODBA 1ZU4A 1WRBA 2GXAA 2HT1A 3HDTA 3ZVMA 4QHYA 3GLFE 1DELA 3FOZA 1T5LA 2EFGA 2OT3B 3CX8A 3CR7A 5FTKA 1COWD 3EZFA 4XSGA 4B33A 4QJ3A 5FBVB 3NVAA 1OH6A 4ZDKA 2J5XA 2RGNC 3A1TA 3R20A 5FR1A 1KMQA 1TMKA 3EXAA 1G8FA 5FOWA 4TT3D 2FEOA 1DVRA 3E2IA 2OCBA 2Z4SA 2Q0HA 3PEUA 5G40A 4G0NA 4JLJA 2GF9A 1IXRC 4AYWA 4LZZA 3GJ5A 4C9BA 1G17A 4BPBA 2VHCA 3AP1A 2AR7A 4GMXA 5DISB 1U81A 3UXMA 1KO4A 4LYHA 1OXSC 4XH9B 3OF5A 4Q1BA 1E9RA 1PLJA 2O0JA 3LNCA 4RY2A 1UFQA 3EZ6A 4BLOA 3KQNA 4KFSA 4M1OA 4PZLA 3G5UA 2O8EB 3RYTC 4L9SA 2QEQA 5CLLA 4DHEA 3DL0A 4L5BA 3OEEA 3RS5A 4UXJA 5JS7A 1NF3A 1GL6A 3ZIAD 1KNQA 2L0XA 1NVUQ 1WXQA 3QENA 3WYAA 2D4HA 4NYJR 3B82A 2HDNB 2DB3A 4XVQA 1R2QA 2VL7A 1QG4A 1KJZA 2XOKA 3WXMA 2BWJA 4B2PA 2QQEA 1Z0KA 5KSPA 2IHBA 2D06A 2FH5B 1QZXA 2GXQA 5HCNA 4FMBB 3EARA 3LBIA 4ACAA 2C78A 2JJ1A 4OI4A 2QT0A 2VHTA 1S8FA 2CEAA 3C7KA 4QJ5A 1R10A 2IYVA 4KSBA 3FFAA 1UBGA 4D6PA 1W7AA 4MA4A 3CNNA 4JSTA 4E03A 1TU3A 3TMKA 4F4JA 2FGKA 2R6CA 2ZJYA 4B2IA 3NHBA 1ZNZA 2QG6A 4NMMA 1OKKA 2G0TA 3QBTA 5J4LA 1QDEA 3FFBA 3W5JA 3BBPA 3JVVA 2CL6X 1W44A 4IDPA 4OHWA 5EE5B 3H4MA 2OEPA 5CB6A 2CVHA 4ZCMA 1IHUA 4BLQA 4EFMA 3CO5A 1IOZA 2FMXA 3DMNA 4P4TA 1E0JA 3CWZA 4MRNA 3SU8A 5IHPA 1N6LA 5JCPA 1XD2A 1N6KA 2IYSA 5JBQA 2ZRFA 1W36B 1KI2A 4W7SA 1V5WA 2QTVB 2WWGA 4HUQB 1D2NA 4POAA 3PCRB 2P6RA 3I8SA 2HCBA 4DB4A 1E32A 5H68A 2Q6TA 1I2MA 1N6PA 4TYPA 3T34A 2JLYA 1IN7A 3H86A 5J4HA 2RAPA 4HLUC 4K81B 2D3WA 2CNWA 2GJSA 2O8FA 1N6IA 2VHJA 4EAQA 4PC2A 4EQ6B 4CEIA 4JLOA 3KJIA 4IVQA 3LY5A 1GAJA 2OXRA 1F5NA 4B44A 3FGNA 3UKDA 4NZYA 3GP8A 1GDDA 4AC9A 1OV4A 3L8YA 3ND8A 4M1KA 1KO1A 1YHNA 1VG1A 3ZIAA 4C0AC 1MRSA 4C0BA 1NN5A 4IFBA 2GXUA 2ZJ5A 4JVMA 4LJ8A 2YWGA 3TUIC 3NBXX 4Q1CA 4D80A 1L8QA 3IPYA 1VCOA 2D7CA 1U2RA 2AD5A 3D7MA 2DHRA 2FA9A 3L82B 2Q21A 3Q72A 1R5NA 2VSFA 4JKYA 3I5YA 1G8PA 1CR4A 2BBSA 2OZEA 4KJZA 1IM2A 2XB4A 1KTVA 4C0KA 3U6BA 4KAXA 2IYUA 2EFEB 3THXB 1XXHE 1OIVA 4KYUA 1II9A 3HJNA 4QM6A 1KK1A 1DAKA 2NO1A 5E7JA 5FI0B 3KKMA 2CNWD 2RGBA 3NEYA 4RCZA 3RRZA 4CEHB 3UWOA 5JI2E 1N5IA 3BH0A 3UG6A 3GFOA 4Q03A 2GEVA 2ZI6A 5JHGB 2ZRIA 4B32A 2FZ4A 3OESA 4DLWA 2REOA 4V0NA 2D2EA 2ZRAA 2OG2A 2ZRKA 3FPAA 2ERXA 4MYUA 3AVPA 2GAOA 5AJXA 4DB2A 4QL3A 2QORA 1GL7A 5GJCA 1II8A 2CCKA 4LSGA 1OB2A 1Q21A 5CYPA 4I4LA 2CLCX 1U94A 3C5CA 5AJVB 1Z3IX 4D4JA 2BMFA 4FWTA 3RWMB 2X8AA 1QVAA 3VHLB 1WBDA 4PHHA 2EQBA 1JB1A 5FOSA 1HY3A 2QM7A 4G5RA 2R65A 5KSOA 1SVOA 4TQ9A 1KKLA 2P6NA 1G6HA 2R6FA 2QI9C 4FMDB 2JDID 1MO3A 2OV2A 3WP1B 1KKMA 3T15A 3B1VA 4O2RA 1G3MA 1SKYB 2AN9A 3W8NA 3FYHA 2X1VA 2EU8A 1CR0A 3QKSA 4HB4A 1OXVA 4C0QC 1E9AA 2V1XA 4QG7A 4JMPA 4Q9IA 3U3OA 2ZI7A 2IA5A 4TSFA 2G77B 4URUR 2O8CB 1G8HA 2BVNA 2ZITA 1XTIA 4NYIR 3NC1C 2GZAA 3THOA 2HCJB 3LA6A 1HT2E 1JR6A 4V0OA 4HAWA 2ZU0C 1BMFD 2DBYA 2PMKA 3K9LA 2A5JA 3EW9A 1CRPA 3NXSA 5KPJA 4JJKA 3L2OB 5GJVC 4EQ6A 3B1ZA 4V02A 3FMIA 2G88A 2EW1A 2QAJA 1FQKA 1KI6B 3SE0A 2ZJZA 3CWQA 4P4UA 3GLFA 1YR8A 2B6HA 3EIHA 4Y0AA 3A6PC 2YNMA 4JKIA 2Z43A 2ZQ5A 1YZTA 3GJ0A 4Q7JB 1A82A 4AKEA 1P2UA 4HZUB 5EXSA 1XWIA 1G41A 1DAEA 2P5SA 4II7A 5K8UA 5JECA 4OQMA 4A6PA 1FZQA 1TQ2A 8OHMA 3OZXA 1GSIA 3TGPA 1KK2A 3PUYA 1GRQA 4GZLA 4TYQA 1TUIA 1A5TA 4MRSA 5SZIA 3BS4A 2WVJA 1X8LA 2HUPA 4OQFA 2ZETA 2R62A 1ZU5A 5DI3B 1E6CA 1ZUHA 3RDPA 3NG1A 1KSJA 1OFUX 4Q19A 1R0ZA 3VR5A 3THYB 2Q9CA 2W83A 2ZIAA 3CR8A 2EWVA 4RZUA 5CITA 4MYHA 4BRUA 1KJYA 5ANRB 1N5LA 3QF4B 2HEIA 1IAQA 1JPJA 2CL7X 2ZSBA 1Z29A 4RD2A 3CZQA 4PC6A 3N5CA 1K8RA 4DLVA 1VKJA 4DSOA 2CLSA 3BH7A 2DFLA 4BGDA 4HAVA 5IT5A 4DKXA 2IYYA 3J81k 1RRPA 2NG1A 2YJTD 3VAAA 2CCGA 2ZJAA 3BB4A 4NDZA 5TV2A 3ZVLA 1G16A 1NLZA 2FSFA 2QL6A 3TVDA 5JRZA 2XZOA 1RZ3A 2CXXA 5FOXA 4RSGA 4QXAA 1KY3A 4B3BA 2O8EA 2JCSA 4J0QA 2QP3A 1IY2A 5E95A 3EC1A 2BMEA 1TQDA 3NH6A 3FE2A 4DXAA 3D3QA 5M04A 3K0AB 1UKZA 1ZJ6A 4HAYA 3IILA 4JT4A 3CF0A 4BZQA 3W34A 4A0GA 4LHZA 4RD1A 4B34A 2QGZA 721PA 3G82C 4MUBA 2O8CA 1DAGA 3B2EA 4OL0A 1M6NA 2DR3A 5C4GB 3GJ8A 3HWSA 4EUNA 1P73A 4NCNA 1ELOA 1HUQA 2W6ID 2FJUA 2XEXA 1JJVA 3K70D 4MGYR 3MSXA 1RYHA 3I8XA 1VIAA 1UBFA 4YLGA 2PEZA 4PTLA 3WBKA 4QM7A 3VR4A 3NH9A 3O8BA 4JLKA 5AWFC 3P4YA 2FZLA 3B7GA 4IOJA 2GVDC 3O47A 3T1TA 4A36A 2FFHA 4I99A 2IUUA 2Q3FA 1W0JD 4Q02A 1K5GA 1CJVC 2BV3A 4M1SA 1P60A 5HPYB 3LH5A 1E79D 1XDBA 1ZM4A 2DWPA 3B1XA 3TLXA 4Q4LA 3ND9A 4O3MA 5KNBA 3M6AA 4H9GA 4RZ3A 5HE9A 1XBTA 4DDUA 3PXGA 1J90A 4NYMQ 3QPUA 3W3ZB 4LV6A 3BOSA 1E2LA 2IYXA 4IDNA 2QY9A 4Y0VA 121PA 4YDHB 3PIRA 3R7WA 4L15A 1O3YA 3OEHA 1AGRA 4PHTA 1NL3A 2IYTA 2PCLA 1CXZA 2YZ2A 1XCGB 4QFMA 3SBEA 3KJGA 4OJKA 3SEAA 2GVZC 1R8SA 5EZ6B 4TMTA 3N2IA 4GSYA 2J9RA 1OFIA 5DHAA 3U61B 3BGWA 1WB9A 1F60A 4HAZA 5GJBA 4Q4HA 5JWRA 1OLOA 2WAXA 4A15A 1G8YA 5K8LA 3VR6A 4XD7D 3WNCA 1VCNA 3KXKA 5CDFE 4IDOA 1DOAA 1FNMA 1W5TA 2QPOA 1FNNA 2ZRPA 1IXZA 3IDQA 2NZJA 3QPVA 1M1YE 4WXRA 1W0KA 1X8JA 4OBEA 1E1QD 4HUTA 1FMJA 1DS6A 4XIGS 5FPHA 1E2DA 3UMRA 4PQFA 2ZE6A 1LVGA 1TAGA 2QRNA 3I32A 4LY6A 3TSZA 3UG7A 1NSFA 2NIPA 4DT1A 2IX3A 4PQYA 3QXJA 1XPRA 1CULC 4PPFA 4YXWD 1Q1ZA 3FHTA 4IW3B 1GRNA 3I72A 3I73A 1VCMA 2GEDA 2J41A 4LK2A 3GEHA 1JEEA 1F48A 3AKEA 4US2R 2ZSAA 1XMJA 2DPXA 1ZM2A 3REFA 2AKAB 2QPAA 2A30A 3LFUA 1VYVA 3ZQJA 2V1UA 3LLUA 2J7PA 3T1VA 3ZQ6A 4DVGA 2OM2A 1J8YF 4ESVA 3U5ZB 1YRBA 5FTJA 1U99A 3AKYA 1ZD9A 3I4LA 1CJTC 4MKGA 3ZD6A 2IUSA 2WHXA 3UMFA 3QPWA 1UPTA 4YMSA 3R7WB 4OYHA 4R2HA 2OCAA 5FFMA 3L0SA 1MKYA 3AF1A 3DO6A 3TUZC 1P9RA 1PLLA 2JDIA 3H2YA 5EQTA 4MDFA 4C7OA 4BLPA 2QENA 3ZS8A 4D82A 3HPRA 4GOKA 2D74A 5FOTA 3PUZA 1IONA 4EPVA 5B57C 4AYTA 2J7KA 4UXIA 3ZGXA 1E1RA 5C2JB 5CK4A 3UMSA 4Z1MD 2YC2C 1HH4A 2Q9BA 2W0MA 3M1IA 1SVWA 2JJ1D 4N1AA 2F6RA 2FGJA 2EVWX 3FMOB 4D26A 2J0SA 2GJKA 2ZRJA 3GLGE 2H1LA 1SVLA 5FTNA 3KTAA 4ZCIA 2FN4A 1F2TA 4JIMA 2IT1A 2R6AA 1X8KA 1KHTA 1I4DD 3BERA 4ZV4A 1QG2A 3B60A 1OPXA 5EP1A 1S9HA 4W5WA 1GKIA 2I3BA 2UZ3A 3C14C 1VDZA 3TJZA 3UWKA 1E9FA 3LW8A 1L7VC 5EXTA 3BB3A 2WKRA 1II8B 2ZS9A 2G1KA 3MGCA 3BRWD 2WSMA 4PPGA 4TN1A 1SXJA 3KXLA 5FL3A 4DDWA 3GJXC 4Q9LA 1HURA 1D5CA 4K8OA 3LQQA 1N6HA 2A5GA 3EWSA 4HLUA 4BEBA 1FPMA 4A4DA 3VR1A 4TZ0A 1II0A 3KUDA 1E0SA 4G5SA 5DO9A 3RS3A 2YKGA 2V54A 1D6JA 1NN1A 1K6MA 2WJHA 2YWHA 1ZM3A 1EFTA 4D4KA 2J46A 3A4LA 1XMVA 3NBYC 2YWEA 2ZTSA 1NLYA 2ZROA 2F43A 1IQPA 3QBVA 2JLXA 1CEEA 2NO0A 2HT6A 2XTZA 4DDTA 1Q3TA 1ODFA 3QVVA 5J47A 1DTSA 3HU2A 1CF4A 1US8B 4UKDA 3QKSB 5TDHA 3R9IA 1ZM9A 4UJ5A 1G3QA 1XB2A 2JGNA 2ZS8A 1L4UA 4KHZA 4M1MA 2CJWB 1EWQA 1L2TA 4TL9A 1E9BA 2W2TA 4PR0A 1G3IA 1U9IC 4OHVA 4PZYA 4EFNA 4AKHA 1P2SA 2AFHE 4JBWA 3A58B 1AIPA 1TEXA 1ZP6A 4QNRA 1M7HA 5FUYA 2PX0A 3K0CC 1J99A 3CIOA 1T3LA 2A78A 3RVBA 3U3KA 4B2LA 2J0QA 1ZC4A 1C4OA 1JI0A 4P4SB 5FBLB 4B73A 1Q44A 1JBKA 4OJQA 3SQWA 4P3YA 5CJPA 4X8LA 5DE3A 2Q3HA 1AKEA 4IVRA 2NTYC 5J4YA 2DY1A 3SYNA 2IBMA 3AF3A 2JLUA 1SXJE 2WPDD 3KJHA 4TMKA 5FUWA 4OK3A 5BYJA 1S1CA 5CM9C 4M9XA 3GLIB 1XMSA 2BIFA 1HEIA 4HAUA 1TF7A 4B35A 2ZE8A 4PC3A 4XOIA 5P21A 3UATA 1E9DA 3A1WA 1NG9A 1ZIOA 5KUTA 3ASYA 3FWYA 2NZ8A 3SHFA 1KO5A 5UKDA 3DZDA 1Z2CA 3VX4A 2CE7A 4F92B 3CLVA 5HZKA 4LHWA 2VP2A 3P1JA 1CJMA 5BN5A 1G6OA 2ZM5A 2LKCA 3KUCA 3AGQA 1M74A 1XEWX 5FPYA 2WSSD 2PH1A 5FTMA 1Q1EA 2NQ2C 5E4FA 5JWOA 1JQJC 1AS0A 4R98A 4EPTA 1PUJA 1XTSA 5LPNA 1HE8B 5KYKA 3AUYA 1G5RA 2ATVA 4MGKR 4OK5A 3FMPB 3W8RA 4E07A 2C2HA 2F1JA 1QHNA 4BASA 1Z07A 1GM5A 4LPSA 2CE2X 2V3CC 2BM1A 5E7IA 3BJIC 3K09C 4DZZA 1YZUA 1AGPA 1G7TA 3K8YA 4Q1FA 1CLUA 1NVVR 2H5EA 3IBYA 1ZRHA 4NYIQ 5DGXA 3ETLA 3VKWA 5JSZA 2IS2A 2DFTA 1VECA 5BN4A 3AV0B 2FFAA 3MD0A 2NPFA 3AGPA 3KJEA 2N42A 2QBYA 1AA9A 4TQAA 2JJ2D 4QJ4A 1TF5A 2GAAA 2ZRMA 2YC4C 4PSVA 3TAUA 1LY1A 1E0AA 1GOTA 4R2IA 4F93B 5EP3A 2GZDA 3PITA 4GOXA 3BE4A 1XZPA 4MITA 2ONJA 1KYIA 4JZKA 5C4MA 4WOPA 1ZW6A 2J3EA 4LX0A 1G21E 1KI4A 2ZRGA 1ZBDA 4NU0A 2ZR9A 1D8TA 5BW8A 3OAAD 1G64A 2ASEA 2W00A 2WJYA 5FI1B 1X1RA 4QRHA 4ZI3A 1GL9B 2JLVA 3Q3JB 1P4SA 2BKEA 1BO6A 1AKYA 2H18A 1X86B 2GCOA 5SZJA 2ZE5A 1OT3A 4L8GA 4P4SA 1YKSA 2DCUA 3OIUA 5J40A 4MDEA 2WWWA 3AKDA 4QBFA 3IHWA 1ZNXA 2EYUA 5EE3A 3IQWA 2V8OA 2IC5A 3WRXC 4NE2A 1U8AA 1W48A 1ZINA 1OJLA 2MSCB 1VPLA 3AVWA 4Q5IA 1K5DA 2ECKA 3CZPA 2KWIA 1RC8A 1Z0FA 2H17A 3R9XA 1AQUA 4PSKA 1AZTA 3CNOA 1G19A 1R0XA 1AS2A 2X77A 1JEDA 4URYR 4CT5A 1BS1A 3AVXA 3LXRA 4YC7A 1SULA 1KMHA 2N46A 4ZIRA 3JZAA 4JLAA 1P2TA 3B78A 3QUSA 1MT0A 4KVGA 4TQUS 4MYCA 2CHGA 5JLJA 1T0JB 4DT1B 1V43A 1ZD8A 3DOEA 5B2ZA 5A5GA 4Q4AA 1UBEA 4MRPA 4DLTA 1E2KA 5EXPA 1N6OA 3KB2A 1Z06A 2WTUA 4TMXA 2DFKB 4AY2A 4BFWA 4LJ9A 5AR1A 4S35A 5D3QA 4BWYA 4Q9JA 4URWR 3O8DA 2OO7A 4NH0A 3MWKA 2G83A 1YVDA 4NBSA 2WOJA 3OHMA 1DO0A 1JAIA 5DSZA 1AM4D 3VX3A 4G3XA 1G4AE 3NKVA 2IUTA 1VG9B 2ZYTX 2Z0MA 4L9WA 3KDSE 3FHOA 2FX3A 3VR3A 1IY0A 1OSNA 2ZR0A 1PVOA 3ADKA 4N0EA 1GIAA 4D2IA 1RE0A 5ELXA 1G7RA 4C30A 4MKIA 3ONWA 3Q5EA 4CF7A 4GPTA 1GWNA 4QOSA 2PT7A 221PA 2J0UB 1D9ZA 3L43A 3N70A 4PHFA 3B1YA 1Z8FA 3NWJA 1Z22A 1S2MA 3PR1A 1I4LD 1JR3D 2AD1A 4PPQA 5JS8A 2F1IA 3AQ4A 4A6XA 2RGGA 1QVRA 1FUUA 5AUQA 1E4VA 3L0IB 3NTUA 1TEVA 3D6TB 1NBMD 5GVRA 4JS0A 3AUXA 1FTNA 3ZYCA 2Z83A 2WKPA 5KHOC 3QXCA 2ZUBA 2B8WA 4JYCA 2WM9B 1YQTA 3TSWA 3SJCA 5L3VA 2CL0X 1F6BA 1W1WA 1RPZA 3RSOA 3W6PA 3SNHA 2CCJA 1KSFX 3K0FB 5EUQB 3CKLA 3GFPA 5HZHA 1VIYA 2D2FA 3QKRB 1OYYA 4G5GA 2VRWA 1US8A 1WBBA 2HYDA 5DIFA 2VEDA 2WJJA 3SHWA 1RJ9B 2V6JA 1CP2A 2J7PD 3F3YA 4WZ6A 2P5TB 4B6EA 3QEOA 4IDQA 4B6FA 2GXSA 5CYOA 3QIAA 5AK0A 1Z6GA 1WDTA 4LBZA 1GRRA 1PV4A 3RC8A 1BIFA 1EXMA 4US0R 4TYWA 3K0AA 1H65A 2FSHA 4KSCA 4TLDA 2IYLD 3SI7A 1D2EA 2XNSA 3WY9A 1KDRA 1TNDA 4M1TA 1Q1BA 1OFHA 4Q7MB 3LW7A 4HLQB 2PMDA 3KKOA 2VHUA 3VTKA 1KJWA 3TQCA 3KQLA 5FBRB 1E1RD 3T12A 4Q21A 2NO7A 3Q85A 4AD8A 1Z6YA 1G4UR 3MUFA 4Q4JB 2RB4A 2ZS7A 1H8HD 5CJ2A 1XMIA 2FFQA 3GJ7A 1QHSA 4ZKEA 1A2BA 1XJ0A 5DI9A 6Q21A 1N5JA 2OFWA 3BXZA 5FH9A 2RHMA 2R6DA 4M2LA 2WWXA 4BLTA 1YZQA 1KDPA 1XXHB 4DLUA 2OILA 1Z6AA 4I1UA 2N1BA 5KPDA 4OHXA 5EE1A 3TBKA 5L3RA 2C9OA 3X1WA 1W5SA 4BFZA 2BJVA 1CTQA 2NPIA 1NRJB 3QE0A 4CRWB 3ZS9A 4RVCA 4AURA 1Z0DA 5EE0A 1AJEA 5H8WA 2XOKD 4Q9KA 3B13B 2VP4A 4ESHA 1M34E 5GJWC 5JCZA 3SJAA 2WSSA 4LYAA 4I1OA 3ADBA 1EX6A 1T3SA 3U7GA 3PEYA 3GLIA 3GLGA 5F2EA 1T0HB 5FPTA 1LB1B 4E5UA 2UKDA 4Q7KA 4URVR 3I92A 1E9EA 1E79A 4OQXA 3EIQA 2ZVQX 2PX3A 2JJ2A 4RKEA 4UNPA 2QMEA 4JJZA 1RYFA 2KB0A 2QMOA 3GJ6A 3NEJA 2P67A 3DKVA 4JL8A 4CW7A 1QHXA 1TF2A 4OQLA 1UKYA 3W9YA 2ZRCA 2C96A 1I2DA 3CUEF 4KYIB 1W4AA 5JFGA 3IPXA 2AWOA 1KAGA 3THWB 5F9FA 1OXTA 2ZAMA 1XZQA 3VMFA 4RCYA 2QROA 4FMDF 1IN5A 3RS7A 4QGFA 5F9HA 5DYIA 3K53A 1N0UA 4CIDA 3AVOA 1CBUA 4HATA 1Z0AA 1DG3A 3BB1A 2V9PA 2F9LA 4IXMA 4LRWA 1R5BA 5FL7A 5KOYA 1XRJA 1U0HC 3RRMA 5FOVA 3FTQA 1W4CA 2ZRLA 3A4NA 4LHXA 3KFVA 5IRCD 5EZ5A 4KLZA 1EX7A 1XEXB 4JVSB 5A0FA 1NKTA 2LWIA 2XNDD 3QJYA 1VMAA 1BOFA 4PAOA 2JLZA 4GMDA 5AJYA 4AKGA 2QTFA 2TMKA 2X2EA 1VG8A 2Z6VA 1TUEA 4BUJA 2DWQA 1VTKA 4PZZA 4UNRA 4Q9HA 3BK7A 1QRAA 2FPMA 1KOFA 1E0KA 1NI3A 2JASA 1YU9A 2WMOB 4UNNA 2GESA 1ESNA 2JIZD 1XD9A 4I1SA 1E1QA 5KDDA 4GDFA 1DADA 5SZHB 1KO8A 4A82A 4LV8B 1W46A 2ZANA 1NY6A 1P75A 3SR0A 5G3ZA 3E1SA 4HDCA 3FKSD 4OHYA 1LS6A 1FP6A 3AF4A 3ADCA 1IXSB 4GI7A 2HV8A 1GTVA 4B3GA 3VQTA 1A1VA 1G7SA 1CS4C 3PUWA 1NIJA 1G8GA 1IJFA 1XD8A 1KI8A 1T91A 2NO9A 2O8BA 2QQ0A 1Q57A 1UDWA 1LTQA 5AJZA 3LWNA 3QOFA 3CW2A 3MCAA 3SOPA 1DAMA 1ZUNB 3BH6A 1Q1QA 1R7RA 1Z2AA 1E94E 1E2EA 5LBIA 3U3MA 2ZJ2A 1EGAA 4C7OB 1CJUC 3U3JA 2QMUA 2GETA 2R44A 3BD9A 1E69A 3WRYC 2GF0A 3HPQA 4BRWA 4DCTA 1SXJC 1P9NA 3MRSA 4P33A 1Q3HA 1C9KA 4EDHA 1G7CA 3A8TA 2KI5A 4UNQA 5D3MA 4BECA 1ESMA 1H8EA 2C9CA 2FF7A 3OAAA 1IN8A 1Y3AA 3EWAA 3IO3A 4JLBA 1GFIA 2Q9AA 1G5TA 4JT2A 3W5IA 1OIWA 4XWOA 4M1WA 4Q7LA 3EZ9A 4NP6A 4KV9A 5KSYA 1OB5A 3ZJYA 2VTKA 4LJAA 3PENA 4A2WA 4DSUA 4TLAA 4ZIRB 1TPZA 1NP6A 3C8UA 2GCNA 4PANA 1T4GA 4NKRA 4QNMA 3F8TA 1JALA 3CH4B 3ZDQA 5L3QA 4Z8YA 1GZSA 4JSYA 5H1YA 3I61A 5HE8A 4M9QA 3GJ3A 2OXCA 2HXYA 2ZUCA 1UADA 3CB4A 3MJRA 1FFHA 3QF4A 4TTQA 4KITB 3MMPA 2ZSFA 1YZNA 2VSOA 1GP2A 2IHYA 3UPUA 1RJ9A 4HB0A 5HKKA 1G5PA 2YINC 1DARA 3TIFA 4TL6A 3HYRA 4FMCB 4TLBA 4TLCA 5KDOA 1N5KA 2QUZA 1KDOA 4QHSA 4OHZA 3AVUA 2JJ8A 1N0WA 1NSTA 1MABB 3UANA 1QHIA 4TTPA 1DAHA 3HR8A 1E98A 4MGIR 3RHFA 1RRCA 2OFXA 2HF9A 2Y8EA 1ZNYA 1S4QA 1KSGA 421PA 3B85A 3VFDA 2VF7A 1XJCA 5TMPA 2IF2A 2DWOA
chains in the Genus database with same CATH superfamily
3ITKA 4BNNA 3KT0A 3JYPA 1CHDA 5TQ2A 3E8MA 3RTDA 5DXJA 3R3UA 4EG5A 2BEUA 1U8CB 1M2VA 1T4BA 3GPCA 3SSOA 3AP3A 3Q8MA 1OF1A 4KN5A 1QNLA 1XZBA 4YCAA 4BX3A 3JD0A 4UOZA 2WPDA 4GOJA 1KP3A 2OXFA 1E7SA 1T5OA 1YQEA 4HGRA 3JTMA 3U48A 4DSNA 4JI8B 2B1RA 2WLSA 3G2JA 1NFRA 5C8VA 2JLBA 4O33A 4YCDA 3GLUA 4CEHA 1T9ZA 4KIUA 5TY0A 2HMSA 4M83A 3CB2A 4M1YA 4PGMA 3EFOA 2XIJA 4K9QA 1B2LA 4L07A 1I0LA 4ALIA 2CZCA 5I4CA 5TVKA 2A88A 5IBCA 1E92A 2NZWA 4BEJA 4N9QA 3RYHB 3GOHA 1ZH0A 4ND1A 1OX6A 5C8XA 4DYDA 3LT0A 4KO2S 1RWKA 2XF8A 4BMSA 4Y1RA 5KOHA 1LSSA 1YKFA 3E70C 1UIRA 1N2SA 1BROA 3ICCA 2W2KA 1YRWA 4LJ5A 1OZAA 1GQYA 2Z8YA 1NRIA 4OL9A 3PX2A 2Z5LA 4U00A 5DHQA 1WXIA 3EK2A 1VL5A 3G6KA 3L41A 4I08A 1KH3A 5ECWA 4BVBA 1P2VA 3DDCA 4DA9A 4UNSA 1Z8HA 4FN5A 4YMHA 2FLKA 4CQLA 4E14A 4N6NA 1E1MA 4HWPA 4BV2A 5LXTB 3QVTA 4DKJA 2OMKA 4DDHA 5IVIA 1RM0A 1E6MA 1TW3A 2H7XA 4IKPA 3BXFA 3QG5A 4L3VA 2VNHA 2FWBA 4MB0A 1HQKA 1R6TA 3A05A 3QVGA 4WBSA 3VSEA 1CR2A 2OXIA 4QBKA 5I3CA 4F2DA 1QJCA 2ZOSA 1OASA 1PFVA 1RAAA 2VQ3A 4MP6A 1LF5A 5L7WA 1G8MA 1N6RA 2YFHA 3EXHA 4LXUA 4ZO6A 4ESOA 4P3OA 2XB2A 1BGVA 1J0BA 1JXMA 5FBWB 2A7QA 2IZZA 4S1VA 4JU8A 4KE8A 4MX8A 5IDWA 2OXEA 3B2QA 1V37A 4U2DA 4Q01A 1T9HA 1UQRA 2OSVA 3SBOA 4DEXA 2PMWB 3UUWA 3UM9A 2C0CA 4BHTA 3T7CA 4Q6BA 3S2UA 1Y5LA 4B3CA 1QGUA 2PGNA 4ENVA 1ISFA 2VF5X 4FX2A 5G3YA 1ZMXA 1G2OA 3QXSA 4FJ1A 3Q10A 2C77A 4QELA 2WV7A 1C9JA 4UJ3A 3QVWA 4U9UA 3RUEA 4BLSA 3EDQA 4PZAA 4XOUA 3K5PA 4PYQA 3Q7RA 3TCXB 4KR7A 1GZUA 1I3OA 5FBQB 5T64A 1VCIA 1KYZA 4Y98A 4F3NA 1J7KA 1H1LA 1U6IA 3ITEA 4JUCA 4MOWA 3V80A 3VZRA 2XJ9A 4G8BA 4C3VA 1A4RA 4BC1A 2J0EA 2R6JA 4IF6A 2F4NA 3LAWA 3EVBA 3SIRA 3GHHA 3NORA 2HRBA 4TSFD 3LBYA 4LQLA 4W5RA 4X63A 2NUPB 4TRJA 1BYUA 2V7QD 4WBNF 4X9XA 1CUUA 5CLHA 2DQZA 4QGAA 1NLFA 1Z6XA 3GYBA 3U40A 2Q07A 1E3WA 1VSVA 1V2GA 3RVLA 3SJZA 4MWSA 2COUA 1GTL1 2ZPTX 4GGPA 4FCVA 4YDRA 2W2MA 4HBZA 4P84A 1ZH8A 1D2RA 3GB9A 4ZYLA 1F51E 3E58A 2HLHA 3IBSA 4LBWA 2O52A 3JWJA 2EGGA 3EZ7A 4M53A 3T3PB 3CSUA 4AG5A 2XNKA 3IPCA 1XCOA 5IK2A 4C4PA 1M67A 2JGJA 3DVLA 1IY1A 3LCUA 2WIGA 2G7MC 3NW9A 4E30A 2A0FA 1QCDA 5A7FA 2E9SA 4B6PA 1WU7A 1ZD1A 2XA1A 2O4UX 3ECSA 4FXOA 3WNQA 1KI7A 3C0KA 4Q05A 5KCMA 2RK4A 5EUCA 3CKKA 2BE7A 3KU1A 3BE8A 1SXJB 4KWEA 4QBIA 5IF9A 4Y2UA 2FAXA 3ECCA 3L7MA 4EHHA 3I62A 5AKGA 3I9OA 3ZZTA 3U1TA 1FP7A 2AFVA 4GLLA 4WOBA 4QBGB 2ZW9A 4EPWA 2ZREA 3ZDRA 4BJ1A 1X1DA 3D8RA 2C2OA 2VZ8A 2ZRQA 4A8JB 1L3CA 4DXHA 1NJ2A 3ZDFA 1XZAA 1F14A 5JHHB 3FCEA 1VHJA 3I8OA 3IURA 3L6RA 4UBKA 4AJ4A 2PXHA 4RVHA 2W2VA 4X45A 2AFIE 2B1IA 3DMPA 1PWYE 4GI3A 4N3AA 4XIIA 3T3HA 3UT6A 3JYHA 1T0PA 3L6CA 4HQFA 1U7UA 3RUCA 1DJOA 2V96A 1H3EA 1E7MA 1EWTA 1IULA 4R8VA 4LZLA 3UOGA 5AT1A 4DRXA 4MLDA 4WDQA 2RKOA 3Q12A 5TR9A 3BFKA 1R9MA 1BU8A 4RKWA 3MBKA 5HIMA 1T8TA 5DWVA 4YI3A 1AF7A 3RC1A 2O5RA 1C7FA 2WFLB 1I1NA 4NENB 3EYAA 1C7IA 2BEJA 4D5GA 1Z8DA 2UYYA 2RDMA 1GNRA 4B3JA 1Y8QA 2OE2A 2XW6A 3I6IA 5T41A 1YR7A 3QWHA 3CU5A 4PLVA 3CT6A 1R0WA 2KE5A 4JXJA 3R5TA 5FL7D 2JFXA 1RBMA 2QLMA 5JI3E 5LQNA 2YDYA 1AG9A 4FFNA 4BJ6A 5B58C 1RYZA 2WEKA 2YN4A 2YWFA 4FZRA 4GM0A 2EW8A 4R51A 4EVQA 5LP6A 4B2YA 3IXLA 1TJ3A 1I0ZA 4YAFA 3WHIA 1UPUA 1MAVA 1NJ1A 1ODSA 2CVZA 4X20A 5AOVA 4RPKA 4OATA 1YHZA 2F2TA 4NDAA 1DTEA 2XDQA 3TUJC 4W1SA 3ILSA 4E08A 1M7BA 3HP1A 3PHJA 4FKMA 3DYBA 2QSZA 3ULKA 2QXUA 2EGHA 3P2MA 1XQWA 3TGWA 3WHLA 1VL6A 1FNSA 1VKRA 4PLPA 2C59A 4ZT3A 3VISA 4O1HA 4AF6A 4FZVA 1VM6A 2W48A 5HFAA 1UR5A 1W36C 1OZ0A 2W58A 3CN7A 4K2AA 1E3MA 3TLGB 2M9MA 2HJVA 3T61A 3KLNA 2HU5A 3FKQA 4OQQA 1D6SA 2WFZA 3JCZA 4GP6A 5CLIA 3H84A 1YS2X 3UXYA 4BYGA 2XNDA 3O0DA 1J2YA 3L5OA 1JLLB 4LXTA 1V5FA 1SCIA 4BFLA 1Q2UA 3QBDA 2FOIA 2XSZA 2TYSB 3WV5A 4BNDB 4WXMA 3ZCSA 4R9UC 3TAHA 2CYCA 1F8FA 3NDRA 4EENA 5BSMA 4K0KB 2IVZA 4IHAA 2ZCUA 4AQYB 4Q4JA 2ZYIA 3A27A 4GU5A 4UMEA 1IEWA 3X43A 4PICA 1D9XA 2FCRA 2ZTMA 1HYHA 3A6ZA 5JAMA 5K0ZA 3O4HA 3QG1A 3HU1A 1VYUA 5F98A 3E53A 5E7MA 4BVJA 3PE6A 1H2YA 5IWCA 3IOEA 2JIZA 4IDCA 1CDDA 1OYWA 1GVNB 2EFDB 3L7AA 4E22A 3LV8A 1JR4A 2GWHA 2A5DA 4FK8A 4QARA 4X85A 1TM7E 5JJKA 5I9IA 3ZI4A 1GFZA 1TYZA 4DSTA 2XUDA 4AZ3A 1SZJG 2J3MA 2KSQA 3H19A 4L85A 5BSKA 4IUYA 2GBGA 4WKBA 2H59A 5A3VA 1PUIA 1TTTA 3DR3A 1PT5A 3GLKA 4HSEA 4WHMA 3VMMA 3D1VA 4JEIA 2C2WA 2WE7A 3LYAA 2AHOA 3H7IA 5MDHA 2FPRA 1RAIA 4CTMA 2XUPA 3F7TA 1IBLB 1LA2A 3UKJA 5E1DA 5HILA 3ZHRA 3CTMA 5IYZF 1OE0A 1ZA1A 4AXBA 4C89A 1FCJA 1FDTA 5HEKA 5I45A 3WIUA 4C7BA 4RIGA 1O8BA 4BCDA 4FONA 5E4JA 5GTDA 2DEUA 4MA5A 4ROTA 1ZJWA 1H9CA 4B3MB 3CNHA 3NQ41 3IHKA 4RTSA 3DTNA 5KO2A 4MZXA 1M7GA 5HIIA 1U28A 2A5LA 1NPDA 2IW3A 3PF8A 2DFNA 2QRKA 3WGNA 3T1QA 1TZ2A 2C82A 2VBCA 1IIRA 1I01A 2QRVB 4O4IB 1X2BA 4HRVA 4REQA 4V2UA 4ZQIA 3IB3A 3AM1A 1ZX1A 3ZYZA 1NVXQ 1XGKA 3QX8A 1XDUA 4OYRA 3SEFA 3WNZA 4BU0A 1KVUA 3UJBA 3WMGA 2E18A 2XAAA 4FD2A 5T7BA 2ACEA 3AEQA 2SBTA 3TEMA 2PRKA 3RTEA 5F3RA 2WF8A 2I4MA 5EKSA 2BFAA 5CA0A 4ZYVA 5CNIA 1I6KA 3VPBA 2RH5A 4TMVA 3UPDA 1KMCA 2BGRA 2XB8A 3MLEA 4UCFA 4PO8A 1Y6QA 3NTVA 4MGZR 3S81A 2GUGA 1KARA 3A6GA 4X6UA 2D0PB 2AN4A 3EY9A 3M4YA 4NJMA 2QP4A 3DKIA 1KJ9A 3J7TA 1LRKA 1HL3A 3EVFA 4G0MA 5C80A 3JQBC 3QOYA 3H0KA 4K5QA 4TKZA 2CZGA 3CSSA 3UTCA 1ESDA 4QICA 1UZLA 1G4HA 3H5NA 4Z2YA 4EG3A 2KHZA 2K7FA 2OAQ1 3CX6A 3F67A 4GGMX 3L6DA 1V0JA 2G04A 4MUHA 5IJ9A 2QVYX 5CXSA 3JWGA 3QFFA 1CQIB 5I7AA 1WZCA 1JQAA 3F5FA 1AY0A 4OSEA 5H3HA 5I7VA 3OZ7A 3REGA 3C16C 4NY1A 4ODIA 3NANA 2QL7A 3OJLA 2PE5A 1JBEA 1H4QA 2JJYA 2GZ3A 4C3ZA 2NSLA 3CLTC 4H18A 3I2IA 2ZWIA 4FNGA 4G09A 2DUNA 1ATZA 5E3HA 4LYFA 2OVBA 2PK3A 5JMTA 3A4MA 5L7TA 4XYMA 1CZKA 5DCUA 3BRQA 3M2TA 3H1PA 5EE9A 4UPVA 3QITA 5EWLB 1P7ZA 3CXUA 5FR2A 5GP1A 5IT0A 1EFRA 1CQJA 1EZ1A 3DOCA 1FF9A 1D4ZA 2QTZA 3DEAA 3ANTA 1A96A 3OJWA 3T7KA 2YHUA 3VZBA 2BFEB 2F3SA 1ZD5A 2OZLA 4E2XA 1OI7A 1LF0A 2INGX 2V45A 1EFUA 1P4HA 1RW4A 5AIBA 5I7OA 4KXMA 2XVMA 4NJEA 3AKCA 3LLCA 4Q9DA 1T4DA 4K9SA 3FLMA 1V8PA 3ACCA 5FI5A 3UMVA 3TDMA 3VXKA 4KR2A 1BXZA 3DE0X 3H3FA 4M38A 2O1WA 3AQIA 2QMHA 2RG7A 4G01B 4NARA 4ZQGA 5JTTA 3MCZA 5JZMA 4D4MA 1NXXA 1CRQA 3AIMA 4H6WA 1IBRA 3ABSB 4B71A 4E7OA 2O54A 1L7XA 3KD3A 2YWRA 1I6LA 1VZ2A 2GA8A 1FX0A 3SXUB 3IEVA 1D7AA 4RKYA 3CEJA 5JBIA 5L6MB 2EDCA 2HDOA 2AQHA 1GGMA 4ZC1A 3RRBA 4RD3A 3H97A 2HDWA 2AB0A 2FDXA 3RD5A 3JZMA 5E1MA 1AD2A 4L0CA 1XVVA 4I6EA 1OVGA 2YY6A 4GKBA 5EXDA 2PO5A 2B94A 3Q2OA 1NVBA 4IHJF 3A6DA 3AH8A 3HXMA 1EB9A 2X9QA 4KNVA 3DLIA 3RVJA 3K1JA 2IPXA 1XRLA 1Z0IA 2J3DA 3BXOA 3GFQA 3S1AA 4F4IA 1XKTA 3OH8A 3QOXA 2O7RA 3D7LA 1W35A 5JANA 5IEBA 3AI7A 1SCUA 1SN7A 2G9NA 2DWUA 3LOPA 1W0JA 2ZI9A 3DXFA 5IHXA 1WZUA 3WKDA 2IXGA 4G1UC 5E8RA 4J49A 3AJ8A 1UKEA 3EA5A 3E3AA 1J56A 1E1YA 1QFJA 2GRJA 1W5BA 3L8EA 4YONB 1WAMA 2OM6A 2R8ZA 3NUZA 3F6SA 5NLLA 4PIMA 4LGYA 4ZI5A 4BVFA 2EFHB 1VG0B 3VDRA 1PNRA 3NT5A 2WZDA 4J0EA 4E5YA 2PUHA 5FWNA 2OMEA 2XE7A 3MQ2A 3WDMA 2GAFA 4FQ5A 1IC6A 2WU0A 4B7CA 2A9KA 4AZVA 3UOWA 4EI7A 1I3KA 4LF6B 4MR7B 4J0JA 1F4LA 2VF2A 2H16A 1AMUA 4MCHA 1F1BA 2X40A 3K9BA 1ODKA 3R3VA 1M33A 1WMSA 5BN5B 3TBFA 1Q7CA 2IYQA 3P9XA 3T94A 2FPKA 4KCGA 1A9YA 2R1VA 5J59A 4BNUA 4PN7A 3P4UA 2XMSA 3SDBA 2YYSA 2O5VA 1GAQA 4S05A 3RTAA 3U7HB 1BG6A 3CFYA 1I4OA 2ODPA 2YYAA 3V1NA 4D46A 3ZCUA 3Q40A 5E9QA 5I9SA 3V7WA 4E13A 2Z1DA 2YOHA 1XAHA 3OZIA 4ZOAA 4GAEA 4PZEA 3PV0A 4O4JF 1MV5A 1HM5A 1SU8A 3AP2A 5KU1A 1RHUA 3K0SA 1X3SA 2BH9A 1LPBB 2P6PA 3OIWA 4W63A 2OV8A 2XNJA 1TJ4A 2D1QA 3V00A 5AVQA 3UK6A 1NWCA 3UQZA 2EWWA 3ZZNA 4RLSA 1Z6TA 4KTVE 4DCPA 2WJ4A 2R8XA 5AVZA 3NASA 1KU0A 5ALLA 4N3NA 3PNVA 3PT5A 4W8OA 1QH8A 1VBNA 3ETHA 2J4DA 3QWBA 1M5RA 1MOSA 1ZN8A 4AWXA 1U2PA 3GC6A 3O93A 3UCFA 3NP9A 2W43A 4PTYA 3EGDB 3K1TA 1SVIA 1G5FA 4B8WA 4EWLA 3DTVA 4O6VA 2JL1A 4M7RA 1DBPA 4RLHA 2RHRA 4D45A 2ISCA 3DAHA 1CY8A 1FS6A 4BO7A 1K2VN 1XPOA 3ZLJA 2WB4A 1H5UA 2BBOA 3IE2A 4RD6A 5ALOA 4J90A 1XTQA 2QYSA 1QF9A 3AM3A 2VDUE 2C1XA 2O0MA 1DX6A 3BK2A 1J8DA 2APJA 4OXRA 1EUQA 2Z95A 2RH9B 1RXUA 1ULAA 2BONA 4IZ6A 4MR7A 5JS6A 3COYA 2ZR7A 2GZHA 3HKEA 4LJSA 5C52B 5FWYB 3G6WA 4IIJA 1FL9A 3A2MA 3DLAA 3GRCA 3KUKA 4JCOA 5JFTA 1GKUB 3ORQA 4XTCS 4D3SA 2XMPA 4AZSA 5I7HA 4BNHA 4R7ZA 4YJ2A 1TDJA 2CLEB 1K0FA 2GN1A 2O7NA 2RMKA 3CF6R 4WCVA 2PL3A 2IXBA 1KGSA 3SFVA 2DWCA 5AW3A 2EBHX 4D3DA 2A0UA 4OFWA 3L0ZA 3ON5A 4PU0A 3FKJA 4TLMB 2FZVA 3E22A 2QJWA 4I5FA 3O8RA 4CZ2A 1S3SA 4H1WA 2YOGA 1ZISA 4CGZA 3S28A 3RWOA 3BSSA 2PJZA 2BFBB 3HB7A 2WSYB 4IINA 5CGZA 5A4DA 2WBLC 2VQ6A 1SELA 3SYMA 2B82A 1DQSA 1WF3A 1OREA 4MI9A 4Y6QA 3WI7A 1CKEA 3V8RA 2NYVA 3TO5A 5LD2C 4A16A 3D0KA 4Z7JA 1Z35A 2ST1A 2IQIA 4WRRA 2JFOA 2WWRA 3ODGA 5DGDA 1L7MA 3RLFA 1PR4A 3FVTA 5BV1A 1EWKA 3BMQB 3NIBA 3DGFC 4XKJA 5B7QA 3PVSA 4GBGA 1DWPA 2DLNA 1YDGA 2C99A 2JFHA 4ER5A 8ADHA 3WR5A 3OKPA 4Z1MA 5EIOA 3VC3A 4B79A 3PP8A 5LMCA 4EMTA 1K4KA 5CK5A 5K8TA 3L6OO 2QRZA 2PH3A 2W2XA 2A3NA 2AR9A 5BMVB 3DLBA 2JD1A 5KYUB 2GHTA 2PXCA 4IGEA 4HDKA 3PK0A 2XZPA 4MV7A 3OECA 4CT0A 3TW4A 4CGYA 5K1ZA 1JKXA 1SCQA 1OXUA 4DWJA 4LSMA 4HL6A 3AUSA 1U0GA 4CCSA 1P1HA 1VKHA 4QEDA 4FYPA 1G9XA 4B40A 2P2SA 2F9MA 5JSFA 1P6XA 1NI5A 2C94A 5EWJA 3TX2A 3UYLA 3HEMA 2OORC 1Z7EA 5FAXA 1XLUA 4Y2SA 4EPRA 1L5HA 1XFAA 2P9YA 3PFIA 3SZOA 5BV0A 1JU3A 1R5JA 2GLTA 2XGSA 1E7RA 1NW8A 1H69A 3C1UA 4DF3A 4QUGA 3QW2A 4POOA 5KREA 4ZYZA 2LTAA 1SOVA 2ODEA 3FBTA 3FNIA 5DULA 5E6UB 3UK2A 3QMMA 1EVJA 2C54A 5IN5A 3JPYA 1A5ZA 4HHEA 1OYOA 3G9UA 4IOKA 2BGLA 2SNIE 3PZRA 4NOLA 3UQYS 2O07A 2WT4A 1JFSA 2XIQA 3Q7IA 4A91A 4D4LA 4MPPA 4FCWA 4ZQHA 4K87A 4ZHQF 1BA2A 3BGSA 1FYXA 5B6JA 5KVQA 1TYEB 5LYJB 5H16A 2IUFA 4C08A 1PLKA 2F43B 2Q5JA 1E3QA 1R6VA 3LOQA 4RVDA 3K0EA 4RTJA 4OX9B 3HCNA 1UM9A 1M8PA 4AECA 4C7KA 3QEBZ 4GLFA 2JD0A 2WT8A 1FFSA 3CRQA 3TLCA 2F3RA 4A0RA 1G3RA 4F0JA 4KNYA 4KIWA 1TQ8A 3TK1A 5M7EA 3LS2A 2A1IA 1S2OA 1UMCB 3GG9A 3AC0A 1Y80A 3PHCA 1KS2A 1P0PA 1U5BB 1WY5A 1YI0A 2V6IA 2ZBEA 4QASA 4RPJA 4XVUA 2J3QA 2HHAA 1FTSA 1O95D 4OM8A 2NYAA 2B7BA 2W11A 1P62B 2FKNA 5CX1A 2P6OA 2I1LA 1XTBA 3IIKA 5BQ5A 2H1CA 2QR5A 4PSAA 4UE3S 1JJAA 2CHQA 2FX2A 4RFSA 3KAKA 2OLKA 3DWIA 1JEAA 2Q6OA 1SIUA 1Q17A 5JS1A 1KR2A 3LQRA 4KOAA 3VPFA 2VAXA 1OFVA 2Y05A 4GDMA 4ZVPA 4DY6A 1R8QA 4G5HA 4JDPA 3K1ZA 3FPGA 2FFBA 3A9WA 3V4OA 2IEZA 1O5IA 1SB8A 1D6MA 3MJSA 5AXBA 3DUFA 3PQDA 1MAAA 1USKA 4MW2A 5LA6F 4CPDA 1R9GA 1RWVA 4FGJA 3Q7TA 2QTNA 5G2OA 2IV3A 2J45A 3V46A 1IVYA 1KK0A 1TCBA 2ORIA 2DYKA 3DS8A 4JBNA 3RH0A 4KZPA 2XE4A 1G2PA 2FPXA 3CQ9A 4JLNA 4BKQA 1QWOA 4WMLA 4ERNA 6ABPA 1RI3A 4MVJM 1EFVA 3KPJA 2PTGA 4MIEA 2J6CA 4CL2A 4MHSA 4DV4B 1WTCA 2B8EA 3P9QA 4EKDA 2IOFK 4TL7A 3KDAA 4MMYB 2BAGA 1GN8A 2XVYA 4KSYA 3AW9A 2TMGA 3IRUA 5KYKA 1CIPA 4OQDA 2WUWE 4WZBA 1NHWA 4R7GA 2D0DA 2GHIA 4DLBA 2B21A 5HUJA 3MMZA 3OLQA 3ZV3A 1TFRA 2RKWA 3HABA 4PXSA 4RH0A 4X00A 4BNMA 5BORA 4B85A 5A02A 4YA6A 2C88A 4RFVA 4Z49A 3JAKA 3W6OA 1QHEA 1RIFA 3THSA 3PNOA 3X1YA 4B43A 1CQWA 1CERA 3S2IA 5DM60 5HKBA 1X14A 3VPCA 4V39A 2PYDA 1NI4A 1YR1A 1QKJA 4LF8B 4BNTA 1ZXLA 3H7AA 2YJ5A 4CQLB 1GILA 4I1VA 3NAMA 3FZNA 1A5SB 2O8NA 2ZK7A 1JTEA 3HFJA 3OE7D 4Z0NA 3ZN2A 4J0FA 2FUG6 4DTIA 2DVMA 3CPJB 1SHLA 1KSHA 4RTKA 4Q4DA 2BH2A 1EQUA 1T8UA 5K7SA 1CUWA 4KH1A 1E60A 4UXHA 4NBVA 4CDNA 1K75A 4IX9A 4DG8A 5MFPA 2OBMA 1XDSA 5C1BA 1OHHA 2WU8A 1DCFA 1JLLA 2FW6A 2LR0A 4RGBA 3QELA 4DJTA 1SBTA 4P53A 1U11A 5IKPA 2A1TR 2ZIZA 3KZKA 2YCBA 1RLMA 3RG2A 4CLXA 5LOVF 3P9YA 5J4YA 1WSBA 5EUBA 4V3BA 5KTSA 2ZU6A 5LMUB 1W2GA 4BS9A 1C3VA 4AX4A 3UUGA 2P65A 2XUAA 3NWPA 4H2DA 4INZA 9LDBA 5F7JA 4ZMBA 2YICA 1CC1S 3KV1A 5CDSA 2ZVPX 5A3RA 3SVLA 4P54A 2EKPA 3CVOA 5AW6A 1DT3A 1USUA 1V3UA 3LT1A 1VYTA 5DRTA 3L0OA 4JBHA 5DHUA 2JIDA 2IYRA 2X2PA 3F6EX 2IDJA 5BYAA 2R9VA 4ARCA 3HJHA 2CMKA 4NCIA 3DXXA 3JR3A 4OGWA 5CIQA 3TKLA 4TRRA 5KJEA 4ED9A 3ADDA 4PQEA 1IWOA 4ETMA 2C98A 4MVJA 4LGMA 1U9IA 4N3GA 4U4AA 3GU3A 4ENUA 5BWOA 1JG6A 3H17A 1FVFA 3IQEA 3BTVA 4MS3B 4FYKA 1JLSA 4C29A 4EHDA 2EJBA 1XELA 4IV0A 3NYQA 5LXTF 1XX6A 4RF2A 5LQSA 1PTKA 3VSDA 1TA0A 3ZZUA 1P5RA 4CODB 4FINA 2QU8A 4FT2A 1C2TA 3WFZA 1QQ6A 1ADJA 4IHKA 2SKCA 4KQMA 3VH2A 1C7EA 1RQPA 1XA3A 3I0NA 3O94A 4H6XA 4OKIA 1KDTA 5GVSA 3G0OA 3ZDAA 4BKRA 3E7PA 3F6RA 2VNSA 1YR6A 3LDAA 1OLSA 4YJFA 2CDRA 4UATA 2WF6A 4NBRA 5IKEA 5SV2A 1DUSA 1MG5A 1UBTS 2YH2A 4RWEA 5JZVA 1PJ3A 4NULA 4IAOA 5A62A 4HXGA 1TO1E 3MWGA 3AJRA 3DE3X 3LKZA 1NA5A 2PUEA 1LDGA 3KVYA 4W5HA 2I4OA 4IQGA 2C3PA 4L4RA 1EP2B 3K9NA 1UJ4A 1ESEA 3JQCA 1TJ5A 3GDHA 3TD2A 3REQB 4QVGA 3KQHA 3KQUA 1WCWA 4AO8A 3BC1A 1OBOA 4A8JA 3DA8A 3PXCX 4LOAA 5NULA 4FHFA 3AFGA 1LTHR 3TQQA 3QOWA 3LDFA 2QTGA 3T3GA 2CUNA 1V35A 2RGDA 1FQWA 2FSVC 4J75A 4J4BA 1JVBA 1DKUA 4QDTA 5K4AA 3AEUB 4ARSA 2V4UA 4JJIA 4X44A 1E6WA 4WNAB 2QYOA 1G20B 1KZ7B 4G4GA 4RD0A 3C41J 2X86A 2XRZA 4Y2GA 1Z26A 2ZRNA 3CRRA 4ZJUA 1DEOA 4GIBA 2PZEA 3LQYA 1EG7A 4YJ3F 3ITNA 4DV3B 3EXFA 3U16A 1J2RA 2XMRA 2IWHA 3X2SA 1YZVA 1RXEA 4JI6B 4E4RA 3DMGA 1WNTA 1AQNA 2J3HA 4R8LA 4MKFA 4HWGA 3CEPB 3GFRA 3L4BA 1N0IA 1ZYUA 3JQ9A 3FSGD 5CH5A 1QRDA 4OXYA 5IFLA 1NBMA 1KXJA 5CHYA 3UB4A 1FJGB 4MAAA 5DTMA 3UHAA 1TKAA 4P31A 2GNOA 4FUQA 3LUKA 4MO2A 3AESB 3HU3A 2X2FA 4LGVA 1R66A 1PGOA 1SHKA 2DULA 3KWJA 2VPPA 3TN7A 5DP1A 2BM8A 4OFBA 4JV5B 1G98A 1CU1A 1AQIA 2HO4A 2VYVD 4AZTA 5KNDA 1EFRD 2E48A 2AJTA 4PLTA 1VE1A 1GKKA 4WGGA 2EOAA 5DNCA 4YXWA 1E6KA 2DQKA 4FIZA 4E4TA 4L4UA 4AAYA 4EG0A 5LNK6 2HA7A 1ZY2A 4DM7A 2B78A 3O1HB 3VR4D 3LVRE 2QN1A 4HYYA 4DA4A 3LUBA 1P4RA 3M34A 1NUPA 2F17A 3L7DA 4AK9A 5F7ZA 4G97A 3KKPA 4WFKA 2FEPA 3IBCA 3C8HA 3IDZA 1LKZA 2W6ZA 5M2QA 3ROPA 4LI0A 4NPHA 5LYJA 3ZWKA 2XECA 3BTSA 3FUCA 1K08A 1QOQB 1WSDA 1Q6ZA 4BAGA 2OBLA 3S40A 4HR7A 5HTOA 1SC1A 2MYPA 3KSUA 3WWCA 1FW6A 4UQPA 5CM8B 5B58T 4FOSA 5T4HA 1G9TA 4W6ZA 2WNIA 3T3EA 2A5FA 4ZT7A 4KDRA 2B1GA 4FMCF 3STHA 3EB9A 3T7TA 3KUUA 3WIOA 1HK7A 4J94A 5A2QA 5JRDS 3L0PA 2WTAA 1FSPA 1NVFA 4LJYA 4RTMA 2C2KA 2C42A 1ZIPA 3DEFA 5KYXB 1JKJA 1MO2A 3HCEA 1U1IA 2OQIA 3HXPA 1Q2XA 2OESA 1D5WA 1EUDA 1XZJA 2ODBA 1NOJA 2DKOA 1OWPA 2CHUA 1C41A 3AINA 2HT1A 4N18A 3N6VA 3WZMA 1IMOA 3ZVMA 4GVXA 1CYDA 5FBVB 1KJIA 1BZYA 4G67A 3EZFA 1BFKA 1IBKB 4M54A 3R20A 1FDRA 4LEIA 1KMQA 2XKKA 2CFCA 1G8FA 1BWSA 1E58A 4CE6A 2GEJA 2QRJA 1HFKA 1L5OA 2Z4SA 2YW9A 3JASB 4YAUA 4ZOQI 1AXEA 1VL0A 4LZZA 4AYWA 4C9BA 1G17A 5DM70 4GI2A 4L72A 4YJGA 1T8RA 4MW7A 1QLWA 2AR7A 4R16A 4TTIA 4D9NA 4B4WA 3AJDA 2VRBA 3PLAE 4ROSA 5AM4A 2WTNA 4XH9B 1W93A 1E9RA 4IJ5A 3LNCA 4RY2A 1MRZA 5IN4A 4C87A 3KQNA 1IZ8A 2Y71A 3JATB 3ZE9A 3ZCQA 4M1OA 3RF7A 3G5UA 1Y9DA 2ILTA 4L9SA 5HWSA 4M88A 1R1DA 1OFGA 5LPNA 4IF4A 2QNIA 4YN3A 4R01A 3DF9A 2JFNA 1NVUQ 2L0XA 1I7PA 1K6JA 1JMKC 1L5WA 2I62A 4HMPA 4UD2A 4WCFB 3MT8A 3QENA 2A9VA 4YECA 3IMCA 2FG7C 3RS9A 3V7NA 3ZY3A 8ATCA 2O8VA 1O96A 1E8DA 3B82A 3PC8A 3SSNA 5MGBA 2VL7A 2AJBA 1QG4A 4JXXA 1ZCFA 4P98A 2FN8A 2OK7A 1Z0KA 1Z4OA 1A7AA 1O6CA 1ORDA 2J9XB 1E66A 1W1IA 4IIYA 5BNTA 2B0CA 1FFEA 1RIIA 1XEAA 2G4CA 3JYOA 3KQOA 3NJRA 3PB3A 5HCNA 3RKSA 2XA2A 3EARA 3LBIA 3K20A 3T52A 2PUGA 2JJ1A 2Q2OA 2DAPA 1LPMA 4Q9NA 3MTAA 1KJQA 1ULTA 1CUZA 1XZLA 2DFVA 3L07A 2HQ1A 2ZP1A 1DV1A 3HEAA 1LX7A 3ND5A 3LT2A 4N82A 4R6WA 3GIWA 2I54A 3MSCA 1R27A 1BXRB 4LE1A 4MA4A 5LZ8A 1E62A 4E03A 5JASA 3HADA 3B3AA 5KINB 2FGKA 2PBLA 1ZNZA 2H1HA 4NMMA 2WC1A 3QA9A 1QDEA 3CTPA 4MVXA 1ZJJA 1ZEMA 3PE4A 1O5TA 4YWHA 4OHWA 4MUJA 4D9CA 1FFCA 3ZGLA 5CLJA 1VE7A 1IZ0A 4ZCMA 2QTCA 3N6XA 1EUYA 3TLMA 4D92A 5CVDA 3CO5A 2EBFX 2FMXA 3QWAA 5K8JB 1E0JA 4UCXA 3SU8A 3BCRA 4J0DA 1XD2A 1N2OA 4E1BA 2H4YA 2ZT5A 4XLLA 3H0EA 3VNSA 2ZRFA 4HNRA 4B0OA 4CDMA 4NBNA 5AVWA 3NHZA 1V5WA 2B35A 2QTVB 1T1GA 4EVIA 5KCZA 1RR6A 3IMKA 5H68A 1RYMA 3EUAA 2FN9A 5B6PA 1N6PA 3T34A 2OCKA 3KHKA 4I55F 1NUHA 2NUTB 4O02B 4HLUC 4Q4CA 2D3WA 2W42A 2GJSA 4Y7DA 5F4BA 4GX5A 5F1KA 1XZKA 2LPMA 4PC2A 4J8PA 4J9VA 1E1DA 4CUKA 4LFAB 4E6PA 3EXEB 1F5NA 1YVUA 1LJ8A 4XLZA 3LPMA 1V5EA 3AFOA 3ZHUA 3B36A 5KVCA 2XE8A 5EQFA 3DZHA 3U7QA 3EEFA 5T3UA 1OV4A 1SKMA 5JJ5A 1A2OA 1WEHA 3FGZA 3DBLA 2QUBA 4KTTE 1YHNA 2XTAA 3CZ4A 3ZWVA 1Z5VA 4GC9A 4C0AC 1VSUA 5ALPA 1KFKB 1L5KA 4BEVA 1WW3A 4BMCA 1LRLA 1FP1D 2BFFA 3VVBA 1F7VA 1JF8A 2YWGA 4FE3A 2UUCB 5J23A 1E1KA 4D80A 1V39A 2FTKE 1L8QA 1A0OA 3T7DA 1VCOA 1RMQA 2DHRA 3G3EA 3OJXA 1R3DA 4I1IA 1MNAA 4FR0A 1VLVA 3VDXA 3KVOA 2XVZA 3BQMB 4OXQA 4KJZA 2DR0A 2ZCVA 2XB4A 1E6LA 4WDRA 3H13A 3PNPA 4X61A 3LSYA 3UMJA 2A86A 2PVPA 4J7CA 2DUJA 2IYUA 1CETA 1VZ3A 3Q3VA 2BR5A 4IIDA 5KWSA 3KOWA 4L27A 2WIDA 5C7YA 1PEDA 5AW4A 3B5IA 1Z9BA 1Z36A 4ZP1A 3GZNB 1OUMA 5BVGB 1DEAA 2EATA 3D2CA 1DAKA 2NO1A 1ONSA 5FI0B 3M6UA 3RRZA 2RGBA 4IIJB 2A1TS 1O6FA 4PWYA 3DFZA 4OLHA 1S2NA 4EG6A 3UWOA 5JI2E 1ZGBA 5K4HA 4IGFA 3GFOA 4U2EA 1CJCA 4D8XA 4B32A 3PDUA 3NUQA 3ZWCA 4C7XA 3K8QA 4AZWA 1N5MA 5SYAA 5BUCA 2ZULA 1C1HA 1GV0A 1GTG1 3L4BC 4ZEXA 1RZRA 1ULHA 3FYCA 1TJNA 2OUIA 3OHSX 3Q15C 3ROZA 3VJLA 2QORA 1GL7A 1II8A 5ELLA 1JA9A 3KZMA 1FMTA 5CYPA 4I4LA 5AJVB 1L8LA 2DECA 3GLTA 4FGUA 2BMFA 3URKA 1T24A 4DR7B 3RWMB 2X8AA 4DAEA 1KRXA 4LVOA 1P2DA 2VJMA 1XNRB 1QB7A 2GK4A 4ZT6A 1JB1A 1Y8CA 4YP9A 2RK6A 4G24A 4G5RA 5J3JA 1J33A 4CBVA 3M83A 5KSOA 4BO1A 1KKLA 4LX8A 4HK4A 1G6HA 2JDID 3OTIA 4MSUA 4NEGA 4QFCA 3DBVO 3WP1B 1W73A 3A26A 2Z2JA 3PJEA 1RC1A 4Z4EA 3LUCA 4O2RA 1G3MA 2Z56A 4LDPA 4TTAA 5GM2A 3WK4A 3WNDA 2J5BA 1E2UA 1LBSA 5DM2A 3QKSA 4HMOA 1OXVA 2EKDA 4RTOA 1G59A 1ENZA 2V1XA 1YUNA 2YQZA 1ND6A 1RRKA 1E3LA 2VAVA 4HDAA 4JMPA 3U3OA 4YV2A 4LN1A 4TSFA 3DDWA 4EHFA 2G77B 2UYQA 1G8HA 2QTMA 2Y1XA 3BMXA 3NC1C 3U49A 1BGXT 2X7HA 3NT2A 5F76A 3THOA 2GM4A 3LA6A 1HT2E 3HDQA 3GT4A 3I9V6 3CZMA 4HAWA 2ZU0C 2GPBA 2EEPA 1SJ9A 3FFTA 5BNIA 2PMKA 3MC1A 1GZHB 3FYSA 4JKOA 1ZHFA 4W1RA 1ADFA 2PR2A 3EW9A 2UYGA 2HD4A 4E32A 5COBA 3UT5B 1SUPA 4CI0B 3L2OB 2Y1GA 4EQ6A 4V02A 1C3OA 5AOBA 2VDJA 2OKCA 3EGXB 4XFKA 1KI6B 3UOAB 4P4UA 2B98A 3EIHA 5JT1A 4U7JA 3RNOA 4RK0A 2VK2A 3I0MA 2R84A 3I9MA 2JPDA 2ZQ5A 1UBLS 2A8YA 1KZ1A 1RWWA 4DJJA 1P2UA 1NYLA 3GRZA 3M1LA 1NX6A 4N7MA 4YCCA 1SMKA 1XWIA 4OY3A 2CXTA 3I9KA 2PUT