3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
b'GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
molecule tags Transferase/transferase inhibitor
source organism Pseudomonas aeruginosa
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
1RVDA 4QJ5A 1CJUC 1YR7A 5FPYA 1KZGB 1G1MA 1SQ5A 5JZVA 5TXGA 3AF4A 1PUJA 2AFIE 4S35A 4V03A 2ZRJA 1E2NA 1IN7A 5K8IA 1F2UA 3SBEA 2D74A 4OHXA 3KFXA 3LO5A 5AJXA 1T8UA 5C1BA 2F43A 1TUEA 4G0NA 1IY0A 1R0ZA 1P2UA 1GNPA 2FFHA 4R9UC 3ZS8A 4A92A 2BBWA 5F9FA 5BN4A 4IOMA 4JVLA 3A36A 1TF2A 1TL7C 1MO5A 1SVOA 1H8EA 1JJ7A 1P62B 1S9DA 4RD2A 1TUIA 3CWZA 4I81A 3RWMB 2PZEA 3DO6A 1XJCA 2P6RA 4GDFA 4QM6A 3C41J 3R8FA 1D6JA 3UWKA 2FDCA 4D82A 4Q03A 2QBYA 1CP2A 2WWWA 5CDFA 4I1SA 5FL7A 1P4SA 1ZM3A 4HB2A 5EJEA 4CGZA 1L4UA 4KODA 5EXSA 2OV2A 4WZ6A 1P3JA 3SE0A 4IW3B 2ZRDA 3H84A 4AWXA 1XU4A 1AIPA 4KLZA 4KITB 2QI9C 2NPFA 4QKQA 1S1MA 3K09A 5CB8A 4UXIA 4PAOA 5JHHB 1GILA 2F55A 3CNNA 1KSFX 3NBFA 3SYNA 1T5IA 3O8DA 5DN6A 2HLDA 4WBSA 1N6KA 1AJEA 1QVAA 4PC1A 3T1QA 2W83A 4LJ5A 4WZAE 5KSZA 2V55B 1F60A 1TX4B 3I32A 1KI9A 4MRSA 4KFRA 3PEUA 4LUCA 5DN6D 2BC9A 2RHMA 2J9RA 1SXJB 2C2HA 4MYCA 3D6TB 3AQ4A 1KI6A 4PFSA 3FTQA 3TE6A 1IJEA 2R6CA 4CEJA 1ZBDA 4LJYA 1RRPA 1G3MA 2G1JA 2I3BA 2CL0X 2ZRCA 5FL7D 2O8EA 1LFDB 1B23P 4G3XA 1UADA 4RD1A 1ANKA 3QENA 2ORWA 4AYXA 2WWYA 4F93B 4EJSA 4PTLA 3VNVA 2ZYTX 4MRRA 3TSOA 2GEUA 2WWFA 4ZIRB 2ZRFA 4LC0A 4YONB 1U0HC 1E1RA 4DT1A 3AV0B 2GWHA 1N5KA 3SJBA 2QP4A 4BFYA 2JDID 5FH9A 5FUWA 5JJLA 5B64A 4E03A 1KSHA 1YQTA 3SHFA 5EZ6B 2F3TA 3LW7A 3EC1A 5DH9A 2JIZD 2ZXUA 2O0KA 4A4DA 2ZAMA 2C8VA 2H7VA 3ZVNA 2WICA 3KKNA 4ABYA 1DAEA 4XSGA 4DEYA 1WCV1 1CR0A 1EK0A 1NMYA 1T5LA 1G3QA 4HLUC 3REFA 4PQYA 3KTAA 1TU3A 4C7OA 5C18A 3LWNA 5EUQB 1KI4A 3K1JA 2J45A 4BRUA 1KK0A 2A5YB 4D0LB 3THOA 4D4MA 1UM8A 3M6AA 3ONWA 4M1SA 3KXKA 3QF4B 4LK2A 1E98A 3BFKA 3IGFA 4QNRA 3W3ZB 5CLLA 1NN3A 2W2TA 2PCJA 3O47A 4PC2A 2EFGA 2FSFA 4EFMA 2ZJZA 4AIIA 1QHYA 1OB5A 4LJAA 3QQ5A 1T3LA 1E0SA 2V7QD 4Y0VA 4AI6A 1KMHB 4IOLA 2J0UA 1NSTA 2YWEA 1UDXA 1SVWA 2ZI9A 4XOIA 3PUYA 5C4GB 4F4CA 4B34A 1NI3A 2OO7A 2JLWA 2B92A 3NDBB 2AXNA 4PO9A 1LVGA 1SVIA 2DPXA 1CJVC 2AKYA 4S2EA 5FPTA 1FL9A 2JLSA 4B75A 5L8VA 3D3QA 3HU2A 4EFLA 2IYZA 2QQEA 3M0EA 1ZW6A 4QHSA 4C7OB 3CRW1 5CJ2A 2B6HA 1Z29A 3EWAA 4AKHA 2OFWA 1DAGA 1S8FA 3K9NA 2N42A 1GKUB 1OFUX 2IYWA 3AVPA 4CEHB 3AVXA 3NBZC 3K0EA 1JXMA 2A30A 3FKSA 2YJTD 1N6PA 1MV5A 3LQQA 5HTKA 3EZ9A 4BFUA 4LYJA 5KPJA 1AS2A 3AP3A 3KQLA 3BRWD 4KFUA 1D9ZA 2ZS7A 2A5GA 1MABA 3VX4A 1GL6A 2ZQ5A 4HZUB 3TW4A 4R98A 2REBA 2Q21A 3OEHD 1XCGB 3T61A 4FMCF 3MWLA 4C0SA 1NMXA 4DUGD 1NBMA 1TU4A 3VR3A 4P4TA 5DE3A 4PZZA 4JLJA 4C0AC 3AUYA 3QOFA 3K53A 4KO8A 2J0UB 2ZE8A 3EPLA 1U98A 1H8HD 4EAQA 3S1AB 1R0WA 1WF3A 1Z22A 4TL8A 3ZIAD 5JSZB 3KJHA 3LAWA 3VKHA 2K5UA 1KI6B 4BWYA 2WTUA 2CCKA 3GJ8A 2HUPA 3GQBA 1GRNA 1SHZA 1CF4A 1GTVA 2Q0HA 1G3IA 3H0KA 2XJ4A 3NXSA 4JBYA 4GBMA 4V0ME 3MWKA 1W7AA 3NHBA 3OHMA 5FTNA 1KJYA 4HI0E 1ZM4A 3VFDA 4U00A 4P4SB 2ZANA 1DEKA 2H17A 1VHTA 4JLKA 1WRBA 1P5ZB 1E1QA 4TT3A 2ZR9A 4HDOB 4EPWA 2GETA 4Q4JA 3AF2A 2VRWA 4UNPA 5E7MA 4BLPA 2CCGA 3SJAA 1N6OA 2ZYUX 3VTKA 2P2LA 1OH8A 3GFPA 4PZLA 3ZJYA 1C4OA 5GJVC 1OYWA 3AKCA 3CH4B 2CE2X 3RNLA 4ZDIA 5H1YA 1OIVA 4RZ3A 5J4YA 1E4YA 2VHTA 4AD8A 4KCGA 2RMKA 3LVQE 1EXMA 3UK6A 2NGRA 1E2KA 1OKKD 3SQXA 5AUQA 2BKUA 2H5EA 3HU1A 4M9QA 2XEXA 1II0A 3O8BA 3QKSA 1DADA 2C99A 3PUVA 4QGGA 1N5IA 4L16A 1A4RA 3IQWA 4A2QA 3TH5A 2QM7A 2JATA 3AF0A 5JWOA 1E2DA 1ZJ6A 3S1AA 1JECA 2J0VA 2XITA 4H1UA 2WJYA 4NYMQ 4P0TA 3W5JA 3MFYA 1YRBA 1SVLA 2WSMA 1XF9A 3TLXA 1G5PA 1N2CE 2OHFA 3WRYC 2ZEJA 2A7QA 1T0HB 3KUCA 1N3BA 2YHSA 4LCBA 1NN0A 2CJWA 4TZ0A 1T91A 2ZYVX 4DEXA 3FGNA 3RS0A 2OEPA 1W0KA 2C77A 4RFSB 5AJVB 1G8YA 1XMIA 5AUNB 1N5JA 1H8HA 3TRFA 2OLJA 5DSZA 1YE8A 4EPVA 1DARA 1ZVQA 3VHLB 5GADl 1HYQA 1JBKA 1G6HA 2D4HA 4KU4A 5EXTA 4BASA 2C9YA 2WSSA 2JLYA 2P6NA 3IDQA 4FMBB 4WOPA 4CEHA 4II7A 3CIOA 1IQPA 1G3RA 2C5LA 4JIMA 2FPKA 5FOTA 2GDJA 3AKYA 1ZM2A 4WAUA 1XBTA 1NP6A 3AVQA 4ZKDA 3IEVA 2KE5A 2MMGA 4FMDB 1GL9B 5EP2A 2QQ0A 3GLIE 3GEEA 1NSFA 2ODWA 4AC9A 3EARA 1ZRHA 1Z8FA 3LLUA 3SYKA 1HURA 2CCJA 3NTUA 2FH5B 5F98A 3WY9A 1EFRD 4PZYA 1M2OB 3FKSD 3MLEA 3RRYA 4TYNA 4URXR 4HUTA 1HY3A 1YR6A 3MRSA 4NKRA 4Q1BA 5EE5B 3QF7A 1VG9B 3FMIA 2BBSA 3K0AA 1DAHA 2A5FA 4TQUS 5HE8A 4AG5A 6Q21A 1ONBA 2ZRMA 2ZPTX 3QXSA 2Q3MA 3V4FA 4B47A 4DZZA 3W8RA 5FBLB 1IJFA 1WBBA 1VG1A 3B1YA 1WBDA 1Q3TA 2LWIA 1UKVY 3QPWA 1JR3A 1Z0IA 3W8NA 2GVDC 2R65A 2QROA 4HB4A 1CLUA 5EUMA 1U90A 1QRAA 2WPDD 3QEOA 3ZVRA 4ARZA 3W5IA 2HT6A 1ZINA 3FYHA 4X8MA 4D4LA 4RD3A 3WNCA 3K09C 3BC1A 3T1VA 2GEVA 5P21A 4TZ6A 4TMKA 2LKDA 3QKRA 4IEEA 2FPMA 2B8WA 2GJKA 3ZZTA 4DCSA 3HPRA 4GFDA 1AS3A 2O8FA 3KB2A 2OM2A 4Q4AB 2IYQA 2G6BA 2GZAA 3KTAB 3RWOA 4GNKA 3JVVA 4TYPA 2ZR0A 2GJAA 2BM1A 2IEZA 2A3RA 2BIFA 1OIXA 3QXXA 1BOFA 2ANCA 2Y8EA 1OYYA 4JZKA 4C0BA 2ZSDA 2B7CA 2QPAA 1RYFA 2ZE7A 3GJ6A 5CDFE 4JKYA 1XB2A 4Q7KA 2VHJA 4HDQB 4YQFA 4LJ4A 1E9AA 1TEXA 5FTMA 4KFTA 2ZJ8A 3QVVA 4C0HA 4QHYA 2CLDX 3FHTA 2WAXA 4C9BA 2WWXA 2QE7A 3L0SA 3BS4A 1U94A 2UKDA 4R2HA 4ZDKA 3CF2A 2C9CA 3CKLA 2ERXA 1KDOA 1E1RD 3DM9B 4K8OA 4PHFA 3VR4A 3K70B 3GJ7A 4AG6A 1EFTA 2BMFA 4TLEA 4QGHA 1IXSB 1Q1EA 1Z6GA 5IK2D 1QHHA 1R6BX 1W48A 2BMDA 1ZNZA 5IRCD 4ZI2A 3EPHA 4M1OA 1E79D 2LKCA 3X1YA 2D7CA 5LDDC 4LBVA 2DFNA 1P2VA 3L8YA 2YKGA 1IN5A 3VMFA 4H9GA 1VCMA 1KY3A 4GT1A 3K0CA 2CL7X 3JZMA 1XRJA 4UQOA 3A37A 4DSOA 1XD8A 4LC1A 4HLUA 5G3ZA 2ZIAA 2H57A 1NG1A 1W4CA 2ZVQX 2NO1A 1AQUA 3VQTA 3EX7C 2C78A 1OSNA 3GLGA 2P0EA 1U8YA 4Q9LA 3RSLA 3W3AA 4B3GA 2R62A 2BM0A 4B71A 1GKYA 4HB3A 3VR1A 2MSEB 2P65A 4YC7A 3A4MA 5JBQA 1U0LA 2ZJ5A 2OBLA 3ZD6A 1JNYA 4M53A 4ON9A 4WA7A 5CITA 1XMSA 1K5DA 4HUQB 3P4YA 3HU3A 1TQDA 4QBIA 2FEOA 4KXFB 5A5GA 1XP8A 4V02A 4JLNA 3C14C 5IHPA 2GF0A 2PT5A 3V9PA 1M34E 5DGXA 3FKQA 4GPTA 3BH6A 2Z83A 4GZMA 4A6PA 2G0NA 4W9MC 2EYQA 1VIYA 5EP4A 4XWOA 2WAYA 2PJZA 1Z2CA 2GXQA 1X86B 3TSZA 4BLRA 3Q72A 1R5OA 5TB5A 1IN8A 3JZAA 2REOA 3TVDA 4PAMA 5HCNA 1DO2A 4A0GA 1KJWA 1XXHA 1PLJA 4JVMA 1XMVA 5B57C 1JEDA 4GOXA 2HJGA 2Q3FA 4KJZA 2P67A 1YZTA 5JI2E 2FJUA 4YMSA 1N0UA 3TBKA 2WBLC 4BFSA 2BDTA 2XX3A 5L3QB 4FMDF 1GZSA 2C95A 1NL3A 3CR7A 4B3BA 1NVVQ 2IUUA 3WMGA 1KK1A 4RFVA 1NIJA 4Q9JA 3TAUA 3PEYA 1E94E 4QC2A 1L7VC 4IFEA 4GMDA 5KNDA 1VG0B 5TVKA 3EASA 2KBFA 621PA 2J7KA 1W1WA 5DYIA 5KDDA 1A82A 2FNAA 3QBTA 2KI5A 3GLGB 4AKEA 4WZBE 1DTSA 5KPDA 5AUPB 1P9WA 1T4GA 2IS2A 3F0TA 2WKRA 1KNQA 3NDPA 4PX9A 4YXWA 2JLRA 4KYIB 4JBWA 1SXJE 1I2MA 2ODEA 1E9BA 1VYUA 3K0FA 4LHVA 4DRZA 2CVFA 2J3EA 1JPNA 1JXOA 2YWHA 4TMWA 1QG4A 4G01B 5C2JB 1F2TB 4DLSA 2JJ2A 1MT0A 4EFNA 1R8SA 1OE0A 2F1HA 3KL4A 1E2JA 2OG2A 4Q01A 3DPUA 1R0XA 1FMJA 5CK4A 2GXSA 2H16A 4OK6A 1UKZA 2QORA 3QI2A 2NTYC 2W6JA 1XXHB 4MQBA 4QJ3A 2O0HA 1TPZA 3RABA 4Q4LA 3M4YA 2GVZC 1RRCA 1IAQA 2IXFA 4O0MA 1DO0A 2FF7A 3N2IA 2FGJA 1OH6A 3GJ0A 4X8LA 1IY1A 221PA 3I73A 1GUAA 4OQFA 3L8ZA 2JLVA 1NKSA 1Z07A 5F2EA 1FX0A 1Z06A 4HLQB 2BEJA 3OEEA 1XZPA 2CNWD 5G40A 2VP0A 4EPRA 3TKLA 2EWVA 2GJ9A 2JASA 2UZIR 4WXRA 3E5HA 4EPXA 4M1KA 4NONA 4WIAA 3W90A 2XSZA 2QN6A 4WW0A 4NTZA 4HDCA 1NKTA 3TAHA 2RH5A 4RZ2A 3LY5A 4PQRA 3L43A 3CONA 3DKVA 1DAMA 4XIGS 1KDPA 2WJGA 1GIAA 3KKQA 2QAGC 1W47A 5EE0A 1Q20A 1XEXB 5HKKD 4A15A 1KZ7B 5J5CA 4YMTA 2YWGA 5D3MB 4R71A 1CR4A 4ZO4A 3OAAD 1BMFD 1ESMA 2IYVA 3U7EB 1M7GA 4TSFD 1ZD9A 4RCZA 4JL5A 5K8LA 3QKRB 1X3SA 1TQ4A 4Q1FA 1QHIA 4IXNA 1A1VA 2CJWB 2HDNB 4B3DA 5FUVA 2JJ8A 3U7HB 1U8ZA 3ZGXA 1KK3A 3EZFA 1ZD8A 3C8UA 4Z8XA 4X8OA 3UG6A 4TTRA 3U2QA 1X8LA 4ARZB 1T9HA 1S1CA 3RS4A 2XOKA 3A1SA 4CT5A 1Z0AA 3C5HA 3PXGA 3LBNA 1DAFA 2R6GA 4FMCB 4MGKR 2EW1A 2D2EA 4PPNA 4Q4JB 5KDLA 5G53C 3B78A 4GRAA 5HZKA 1G5TA 4P3YA 4ZV4A 5FOXA 2WIAA 3HR8A 1GKIA 2JJ1A 3IHWA 4Q21A 4FN5A 3A1VA 2XNDA 3Q7QA 2QPTA 2QTFA 1BS1A 3N2EA 4B6EA 3GJ3A 3RAPR 3D31A 2W0MA 1D2EA 3B85A 2VHQA 1QHGA 5AJZA 1VCNA 2DR3A 2IXEA 2QUZA 2DWOA 3BIFA 4Y0AA 2NQ2C 4IVQA 4NCJA 1P6XA 1GRRA 3ZDQA 4UNRA 4QJ4A 2GBLC 3BFVA 1EFCA 5J4KA 3F3YA 3LH5A 1OV4A 1BMFA 2O5VA 3PEVA 3H2YA 3LBHA 3OAAA 1II8B 4IHQA 1EGAA 2ZRNA 2FSHA 1DAIA 2ODBA 4F4JA 4AY2A 4HLDA 2V1XA 3EXAA 4DKXA 2XZOA 1X8KA 2F1IA 1VKJA 4RVCA 4FD2A 4W5JA 1P2TA 2AD1A 1R10A 4EIWA 1Z63A 2XXAA 2Z43A 3CNOA 5E7JA 2J87A 1K5GA 3SOPA 4BZPA 3REGA 3FFAA 2X2FA 2YZ2A 4GOJA 2IYYA 4N0EA 1G19A 3IIJA 3OEED 1OJLA 2AN9A 3QKSB 4DCNA 1KO8A 1GNQA 4JJKA 4EKDA 2O0JA 1OFHA 2DFKB 1G8PA 4Q1AA 4M8NE 3WMFA 4MDEA 4I99A 2Q3HA 1G17A 1XZQA 3V4RA 1OB2A 1YZQA 4JYBA 3I62A 3R8CA 4OI2A 4BEJA 2WVJA 1MABB 3NG1A 3UWOA 4AYTA 1ZCAA 2H92A 1ZNXA 5IDVA 3THXA 2OE2A 4RD4A 1G8GA 3KJEA 1AKYA 2QAGA 5FTKA 1OPXA 3WYFA 3E70C 1CJKC 3SR0A 1FTNA 4LHZA 3FWYA 3VHXA 5JEEA 4C30A 1UKYA 2IK8A 4NYIR 1TQ6A 1VCOA 1EX7A 1KMHA 2AD5A 2QMHA 4OI1A 1W2GA 2A78A 2VTKA 1E2FA 2OBNA 2YINC 2OFOA 5H68A 5E4FA 2ZROA 4ASUA 1GSIA 4IOJA 2XOKD 3CX7A 4LYHA 1Z0JA 1G18A 3ASYA 1RRFA 3T5GA 2BVNA 2ZRBA 3CNLA 5HPYB 1PZNA 4Q4HA 4B76A 4TYYA 3IBYA 3K9HA 3KQUA 2Z4SA 1KO1A 4BFZA 2YWFA 1ZUIA 2EWWA 2I4IA 3SN6A 5JS8A 3AB3A 4PHTA 3VKWA 3KQNA 4MA4A 1NF3A 1XDBA 3OF5A 2H1LA 1TADA 5BYKA 4LHWA 3U44A 4A8JB 2NPIA 3LV8A 2CHQA 3K70C 4P32A 2Z6VA 3B60A 5E3HA 3X1WA 1K8RA 2BMEA 2Z0MA 3MD0A 3NH6A 5FL3A 4DDVA 1E9EA 1KO5A 2D62A 3N5CA 3RVBA 2AL7A 4GZLA 2FU5C 2A5DA 5HR5A 3KXLA 1I4LD 2GKSA 4NP6A 4ESHA 3PFIA 4UXHA 2PL3A 2WIBA 2J41A 4JVNA 2RHDA 4W5WA 4ZDJA 2AKAB 4BZXA 3R9XA 4D6PA 2EFEB 1G3UA 2HYIC 2XSZD 1NRJB 3IBGA 3CRRA 2QPOA 1UPTA 3EZ6A 1YR8A 3A1TA 3T15A 2FMXA 4R2IA 1YZUA 2W0SA 4QHTA 4QBGB 5KYKA 1E2EA 4JS0A 1P9RA 2FWRA 3I3SR 1JQJC 4M1YA 3KX2A 2R2AA 3MCAA 3H86A 3F5FA 3WHLA 2CHGA 2VYFA 3BB4A 1X1SA 4ITRC 3KQKA 1R0YA 4QXAA 5JLJA 5D3QA 2NMVA 3KXIA 4LV8B 1JAIA 4C4PA 1O87A 2IWHA 2V8OA 2W6JD 1FFHA 2XTNA 2AFHE 4DWJA 2J0QA 2JAQA 4CZ2A 1RJ9A 3U60B 2VHCA 4MYHA 3RRMA 2PMDA 2CHVA 4MUBA 3GJ5A 2ATXA 1CR2A 1LNZA 3EIHA 2KJQA 1Y63A 2RGNC 4KVGA 4Q00A 2IA5A 5L3SA 2QT0A 3PJRA 2ZI7A 4D25A 4OHWA 2AWOA 1RW4A 2XNSA 2ZRGA 1GNRA 2DFTA 3LW8A 3PUZA 4O2RA 5JCZA 2ZRLA 3ND8A 1LV7A 2BV3A 2P5TB 4OQLA 4JBXA 3O8RA 1J99A 1C9KA 3LLMA 1U81A 2OXCA 3B9PA 4MGIR 1XMJA 1RE0A 1SVMA 3Q8XB 4V0OA 4IFBA 1KAGA 2YOFA 4C0QC 5GJBA 1IN6A 5JMTA 3A6PC 2BKEA 5FBVB 3R9WA 1GRQA 2QBYB 3RS3A 4DLWA 4BFXA 4DC9A 4P4UA 4Q7LA 3TMKA 2QRZA 1Q21A 2E87A 1W0JA 4KV9A 4I4LA 4P33A 4MGYR 5FPSA 5JRJA 4FINA 3EPJA 1DOAA 1GFIA 4KSCA 4B2LA 1AN0A 2PH1A 3TUZC 3EA0A 1F3OA 1VTKA 4Z8YA 2Q9BA 3LX8A 3MWYW 3IIKA 2FE4A 5EXXA 3TR5A 121PA 3QBVA 2OBMA 4DIDA 3DEFA 2PLRA 2WJHA 4MH0R 4B74A 2XB2A 4D4JA 1GP2A 3WXMA 2WWIA 3Q5EA 4HAUA 5LD2C 4US0R 1CJMA 2FZ4A 3U44B 2RGGA 5KOYA 2XXAB 3OFNA 4V0NA 2JGNA 2BBOA 1XTSA 3N70A 2IT1A 4YDSA 4OHYA 3QXCA 4XD7D 2J0SA 2WKPA 2IYLD 1SXJA 3QEJA 3PENA 4ZPXA 4DDUA 2KWIA 1XPRA 1GVNB 1ELOA 3QE0A 4F92B 2QU8A 4A82A 1N6RA 1CEEA 1RFLA 5JSZA 5CYPA 1NBME 3PIRA 5AUOB 1NVXQ 4CYMA 2QZ4A 3IO5A 2HT1A 4OK5A 5G41A 4AKGA 3CX6A 5JWRA 2QM8A 5JECA 1ODFA 3EPKA 4A2PA 5FOWA 2ZS9A 4LOAA 3SYLA 2DHRA 1V43A 1EFRA 3LRPA 4DSNA 1QZXA 1Z6AA 2OXRA 4NDZA 4V0LA 1R5BA 1E79A 2OCYC 1RRGA 5DHAA 1Z2AA 1YR9A 1T3SA 3P26A 5IK2A 3ADCA 2AX4A 4IOKA 4NYJQ 1QDEA 3AF3A 3CR8A 8OHMA 4EJSB 4IDNA 3U6BA 2CXXA 4LRWA 1QHSA 2WKQA 3ZQ6A 1T8TA 2J7PA 2GCOB 4LWZA 4JLAA 1XD2A 2PMKA 4ZKEA 4TMXA 4BFTA 1UAAA 4DVGA 1MR3F 1P9NA 2CK3A 3IILA 1AGPA 3NIBA 2VSXA 3B13B 4B2IA 1KYIA 3LNCA 1W0KD 1G7CA 2YOHA 1E96A 2V3CC 3TNFA 1SKYB 3BGWA 3UKDA 2AK3A 3KKPA 3BWDD 1Z28A 4W7SA 5BXQC 721PA 2J46A 3EIQA 4LYFA 4NCNA 2JLXA 2H18A 2F3RA 5FPHA 5FUYA 4ZCLA 4FWIB 1I4DD 1YKSA 4PPFA 4MKFA 2ZSEA 2P6UA 4MRVA 2NIPA 4MKGA 3X1DA 2RGAA 1II8A 4LBZA 4MRPA 4OKSA 1M6NA 4EDHA 1Z6YA 2IUTA 1R8QA 3TIFA 2OUKA 2QA5A 4MYUA 1NN1A 2D2FA 2YC2C 4PC7A 3UANA 4JLMA 1NY6A 1XEXA 2QRNA 4B3CA 3J81k 1NN5A 3CO5A 4Q7MB 1S96A 1GWNA 3FPAA 3VR2A 2O8DB 4HAZA 4BLTA 4LJ7A 2EFCB 3SEAA 1Q57A 1U8AA 3DVLA 5GJWC 3KZ1E 4UJ3A 1EFUA 4FCVA 3PITA 4N0DA 4RY2A 5FBWB 4HLCA 2WPDA 3MSXA 1D5CA 1S3SA 5UKDA 2WMNB 2ATVA 1OXSC 4E07A 5L3QA 1KI2A 4XVUA 3B9QA 4YMWA 4DLTA 4MDFA 2ZR7A 3DHWC 3IO3A 3ZQJA 2ZETA 2XTZA 4TT3D 2FSGA 2ZJOA 2REXB 3ADKA 3DKPA 1IM2A 2FGKA 1ZYUA 1W4RA 5EZ5A 4WXPA 1OW3B 1X6VA 4U5XA 5HCIA 1TTTA 4Z1MD 3PCRB 1E2IA 4FI3C 2PCLA 4DDWA 3LXXA 3VU9A 3VR5A 5KUTA 2F1RA 1YRAA 1UBEA 3GCGA 1L8QA 1PLLA 2F43B 4QGAA 1HT2E 1NJGA 4M9XA 3U6KA 5FOUA 3I5XA 4B32A 4G5OA 3BBPA 4DB2A 3RS7A 4KLNA 2V6JA 2IWRA 1OH7A 4K46A 1UDWA 2WSSD 3ZIAA 3CPHA 2IHYA 1CTQA 4LHYA 5JRZA 3G0HA 5FR2A 3BORA 3TQCA 4U7DA 3TR0A 3P27A 5LBIA 4E5UA 1NLYA 1F5NA 2TMKA 1FUUA 2NO9A 4L9SA 2QMUA 1N25A 1GAJA 3L0IB 4F38A 4Q1CA 1VYVA 1VG8A 4ACAA 2X2EA 4TL7A 1NBMD 1U9IA 2AR7A 4OI0A 1OF1A 4XSHA 4IJMA 1T6NA 5A0FA 3SJCA 1EWQA 2BEKA 4D0GA 1RC8A 2F1JA 1VPLA 3QKTA 1J8MF 2X19A 4QNMA 1YZKA 2O8CB 3RRZA 1SVSA 1E99A 2GAOA 3KKMA 3K0SA 4M1WA 1E0KA 2VPPA 1KO4A 1W46A 3EA5A 2XZLA 2W2VA 3TW8B 5ELXA 4Z1MA 3T34A 1JR3E 2WJJA 4OL0A 3KB1A 4UXJA 5TV2A 4NMMA 2GCOA 2MMCA 1D2NA 2EYUA 1XTQA 4KAXA 1Z3IX 2WZQA 2D3WA 3HJNA 5CLQA 1G9XA 1OKKA 3OZXA 4XJXA 4CVNA 3KFVA 5FTLA 1CJTC 3TUIC 1II9A 4URWR 4OJKA 3CRVA 1KKLA 3VU9B 1KTVA 4LJ9A 3ZYCA 5GVRA 3PR1A 1ETUA 1Q0UA 3A8TA 1M7HA 3C7KA 4POAA 4DSUA 2GILA 1SKQA 5FBRB 4UJ5A 2GXUA 4GOKA 4IDQA 1U2RA 3DZDA 4UNNA 2QSYA 3GLIA 3NEJA 3GJXC 1E1QD 4PQFA 2EVWX 3BH0A 3BAFA 4ILEA 1U99A 1IN4A 4JLBA 1W2HA 4FW9A 3FVQA 5TMPA 3AH8A 4NBSA 4KYUA 4L9WA 5EE3A 4GI7A 3SU8A 5JEDA 2ZJ2A 3PEWA 4LY6A 1YZLA 3B5JA 4M2LA 3G5UA 2H8KA 5TDHA 3GPLA 1Q22A 3ZLJA 2PX0A 1UFQA 4JMPA 3X2SA 2BWJA 3O8CA 3T5DA 1MO6A 2QAJA 2ZI6A 2IHBA 2ZVPX 5E7IA 1W36D 4BUJA 5GVSA 1DBSA 2CDNA 2YC4C 4KSBA 3W6OA 1UBCA 3HDTA 2YOGA 5BW8A 1SZPA 4F4IA 4IVPA 4PC3A 4A1FA 4O25A 2G83A 3ZZUA 1KY2A 2JIZA 4MYTA 1HE1C 4A0RA 4W5HA 3SFZA 4B2PA 2PT7A 2J7PD 3AP2A 3KJGA 1G21E 1P60A 1QBKC 4Q66C 1P72A 2A2ZA 5DI3B 4TQ9A 2W58A 4DCVA 2KB0A 3EZ7A 5IT5A 3T06B 2NO0A 1HTWA 3OEHA 1KSGA 1E69A 3IIMA 2MSDB 3DM5A 5G3YA 2UZ3A 1LF5A 1I4TD 4B6FA 3WNBA 3QPVA 3QVUA 4BRWA 1NMZA 3AKDA 1KO7A 1JEEA 2QENA 1KDRA 3RS5A 1WQ1R 2CL6X 2DCUA 2RB4A 3RDPA 3A1UA 1BO6A 3TK1A 4D4KA 5L3RA 1GITA 2VHUA 3CZQA 1PLKA 3V00A 4JKIA 4XVQA 2OT3B 1N6IA 1WE2A 4DHEA 5BWMA 2C98A 4KBGA 4BEBA 3VR6A 4DXAA 1VIAA 1AK2A 2EFDB 1Z47A 2V4ZA 2JLUA 3F8TA 5CK5A 2KSQA 3B7GA 3PUXA 1IONA 4EUNA 4OYHA 1MO3A 2DWQA 3FMOB 2F9MA 4AKIA 1HT1E 3B2EA 3QUSA 3FE2A 4XD7A 3U5ZB 1E0AA 3LQRA 1W36B 1JR6A 1JB1A 4XH9B 5JI3E 2O8FB 4N3NA 3FHOA 1E6CA 3OFND 2V7QA 4X8HA 3E2IA 1US8B 2HLDD 4C0LA 5HZHA 1X8JA 2GA8A 1Q44A 4JT2A 3FMFA 1JPJA 5EP1A 4DLRA 4Q4HB 3ZD7A 1WXQA 3BD9A 3QXHA 3NVAA 3WYAA 1BYUA 3MMPA 3R20A 1B0UA 2VLIA 1AZTA 2IL1A 4O3MA 2G77B 1CIPA 2IYRA 1JI0A 5CIQA 1Z0KA 1AGRA 4PXAA 3LXRA 4ZIRA 2GK7A 4BZQA 4IDHA 1W0JD 5J4HA 5LB2A 1KHTA 2WJVA 3TQFA 2NOAA 2GEDA 1G16A 2QGNA 2WMOB 2C96A 2R6AA 3LFUA 1H8ED 1ZD1A 2ONJA 1KI7A 2ZRKA 4Q7JB 3ECCA 1UJ2A 4TL9A 2QL6A 2AXPA 1C1YA 3EIEA 3K0CC 3AEZA 3B1ZA 5EE1A 2JDIA 1E2MA 2RGNA 3BOSA 1RPZA 1E2QA 3UMSA 4F91B 4Q19A 4RCYA 1MRNA 4TWZA 4CEJB 2B21A 3GLFA 1M1YE 4B35A 4A9AA 4LZZA 1XCMA 3QNUA 2HYDA 1ZMXA 3WRXC 1Q1ZA 2J5XA 4G5QA 4BE7B 2NZ8A 4TLCA 2R6DA 4YDHB 3HP1A 1E2HA 3D8BA 1J8YF 1NVWQ 3BFXA 3KJIA 4HAVA 2VIIA 3SI7A 5DISB 3DMDA 4B3XA 2GCNA 3A4NA 2QNRA 3ZS9A 2ANBA 2PZGA 3LX5A 2GBLA 1Z08A 5CM8B 1Z6XA 1VCIA 1CULC 4D2IA 4CT4B 5CM9C 5D3MA 4Q18A 3CZPA 5FTJA 4IKEA 4BQSA 1XPOA 1S2MA 3WP0A 3X1ZA 2AK2A 4HSEA 2IS6A 4BGDA 3DOFA 1P73A 4GSYA 3DMNA 1XJQA 4PAQA 4HATA 2IF0A 4NZYA 5TY0A 5DHFA 2WOJA 1Z6TA 4KFSA 4TLBA 1T0JB 5KSOA 2ZJBA 3AVVA 3AVUA 2JCSA 3ICEA 2IYSA 5F3WB 2FV8A 2ZM5A 1KSJA 1AM4D 2PBRA 4OI4A 5J40A 1KGDA 1N6NA 3IEUA 3U3KA 3VAAA 3WMEA 2B7BA 5DIFA 1G41A 3R7WA 1XCPA 1OHHA 2FG5A 3KKOA 3U4QB 2O8BB 2X8AA 1G7RA 1G20E 5DLQC 1LS6A 1OFTA 4Q9HA 2ZYWX 3SHWA 1G5RA 1AKEA 3GLHB 4PPQA 4A6XA 3L82B 5J47A 2EU8A 1NG9A 4OK3A 1FZQA 5JFGA 3WYGA 4J0QA 3B1XA 1GM5A 5GJCA 2ZUDA 1VYTA 4ZCIA 5FI1B 2W2XA 2CMKA 3GJ4A 1MKYA 1VHLA 1ZM7A 4DJTA 3P1JA 4MUAA 4NL4H 3RC8A 1X1RA 3PV0A 3C15C 4FCTA 2QP9X 4A8JA 5FPKA 2FFBA 4DBLC 1ZNWA 2GJ8A 4NU0A 2IC5A 5KNCA 3K9GA 2RCNA 3NBYC 1FP7A 3NEYA 1P61B 4JLDA 4K81B 4YLGA 1RKBA 1QG2A 2GHIA 4OQMA 3RHFA 1F2UB 2GAAA 1KK2A 2ZITA 4HEJA 1CBUA 2IF2A 2UVQA 2J1LA 3MAAC 3CX8A 3OIYA 3C16C 3MUFA 1E9FA 2Z5FA 1R2QA 2ORVA 4QBHA 1YHNA 2FFAA 1HQYE 3SC3A 1FPMA 1XJ0A 4ASUD 4R7ZA 1XWIA 2CVHA 2Q6TA 4HYYA 2SHKA 1XD2B 4RSGA 1KKMA 2JLQA 4JVSB 2ZUCA 5J4LA 4UNSA 2WHXA 2QTVB 3I72A 1EWRA 1QVRA 1XNJA 3AVWA 3A1WA 3UXMA 3WBJA 4GMXA 3GLGE 5LPNA 2ZAOA 4IRUB 2ZSAA 3GFTA 2XGJA 1DG1G 1A2BA 1XTIA 2VA8A 1YZNA 1JALA 1UBGA 2VP4A 2FEMA 2ORIA 4RZXA 4TMZA 4JL8A 3SNHA 3T35A 1JAHA 3H1TA 2YV5A 1FQJA 5H8WA 3CF0A 1MH1A 1FTSA 2HXYA 3CH5A 3A4LA 2W6IA 2PX3A 3OE7A 1SXJC 4TQAA 4HUQA 4I1UA 4PO1A 3U3RA 4DSTA 2GK6A 3QJYA 1DE0A 1AZSC 4BECA 3I8SA 4LGMA 4A8JC 5A4JA 2OILA 4BPBA 4D26A 4ZCMA 5K8UA 3K70D 1KMQA 4MGZR 3RS2A 5SZJA 1W4AA 4LHXA 3NC0C 1AQYA 5DI3A 2ZRPA 3GEHA 3RC3A 2LCFA 4M4SA 1E2GA 4IDOA 1IXRC 4UNQA 3L2OB 4M0LA 1SVKA 1CU1A 3EC2A 3OIWA 1L4YA 4TL6A 4GP7A 4V0KA 1GDDA 1SKYE 1HEIA 4PSVA 3AUXA 4G1UC 1ZM9A 2WWGA 1PJRA 2YNMA 4QFMA 4PSKA 2ZS8A 1L2TA 2PEYA 4OBEA 3IPXA 4RFSA 3U3MA 4D80A 3THWB 5B58C 3SQWA 3CPEA 2BCGY 2FA9A 4Q47A 1DG3A 1TMKA 2EFHB 3GP8A 1G8FA 1LW7A 3A58B 1D9XA 2Q9CA 2R44A 4QGFA 1E0JA 2BMJA 5CJPA 2D06A 1KI1A 2PLFA 1P2SA 2N1BA 3BE4A 4DCTA 5JJKA 3CPJB 1KJZA 2KBEA 4Q9IA 2VEDA 2QEQA 4V0MA 1W4BA 2PZFA 1OH5A 1S9HA 1WMSA 2VH5R 3WBKA 4B43A 2DWPA 3EAQA 3FOZA 2GZHA 2ZU0C 2N46A 3MG9A 1OLOA 2XNDD 1OXXK 1ZU5A 3I8XA 3B8HA 4QRHA 2F6RA 1Q3HA 3PUWA 4US1R 5JWHA 2JJ1D 4ERNA 1ZC4A 3LDAA 1FX0B 4F7WA 4IXMA 4JLVA 1FOEB 4G5SA 4GL2A 1TQ2A 5LD2B 4PO8A 4BFVA 2OCAA 4ZDWA 5H70A 2XTMA 5KSPA 4DLZA 1JJVA 1EFHA 4TYQA 3SJZA 4L8GA 1XFAA 4TYWA 1CRQA 3OIVA 1Z0FA 2ZSFA 1P75A 4N1AA 4AURA 4NH0A 1F2TA 1ZUNB 1HUQA 1QF9A 3ETLA 3L0OA 4Z54A 2BHRA 3T12A 4TSFA 2ZI3A 3B1VA 3PG5A 3UATA 3DDCA 2YVUA 3CBQA 1OXTA 4I1VA 5C4MA 2ECKA 2ZE5A 3BH7A 3ND9A 4LBWA 2ZRHA 4RZUA 4M1MA 4EQ6B 5HKKA 1YVDA 2VL7A 3GLFE 3NH9A 1COWA 2VBCA 3G82C 1LTQA 2IX3A 4A0HA 3NWJA 4UKDA 2OSBA 4CIDA 2G9NA 2ZJAA 4M9ZA 4DLXA 4OQNA 1E32A 4TLAA 3QG5A 2EQBA 2XZPA 5AK0A 1NJFA 3Q3JB 2GCPA 5BN3A 5E95A 1UBFA 1DELA 3UPUA 1E9DA 3P4XA 3WHKA 1NLZA 4YMUA 1J7KA 2IYTA 4FXPA 4B48A 1V5WA 3X1XA 5EP3A 1Q1QA 4TTPA 2CK3D 1OXUA 1WDTA 1TNDA 4JLPA 1CXZA 4URVR 4RKEA 3MJRA 3ADBA 3ZVMA 4MITA 2HF9A 3W6PA 3K0AB 3QXJA 3WP1B 4L15A 4LV5B 2A5JA 3L0PA 2X77A 1A2KC 2BCJQ 5J4VA 1PVOA 2GRJA 2VP9A 4TLDA 1G4AE 2JJ2D 1OIWA 4EPYA 3THXB 1EESA 4AK9A 2I1QA 4OJQA 2OESA 5BN5A 2MSCB 5JS7A 4A36A 1PUIA 2V9PA 4C2TA 4G5GA 3U4QA 2GESA 2AHOA 1HV8A 4EPTA 1KOFA 1Q1BA 3PVSA 5DO9A 4YXWD 1HQCA 4US2R 3LVRE 1XD9A 1QHNA 1G4UR 2CEAA 1VECA 2NO7A 4NCKA 4M1TA 5EQTA 5SZHB 4NYJR 2HEIA 3DOEA 3LBIA 5KDOA 2D7DA 3Q85A 2GJSA 3ZVLA 1RYHA 1KAOA 5KNBA 2ZE6A 4LPSA 2OAP1 2FZLA 3LD9A 1WA5A 4JT4A 3KUDA 2FSIA 3QSYA 2VP5A 2ZI4A 3QG1A 1GOTA 3RANA 4XWKA 1W49A 2RAPA 1N0VC 3GEIA 3I4LA 4A2WA 1SXJD 3FFBA 3Q5DA 3NHAA 3EWSA 2GNOA 4NYMR 3U3JA 4EQ6A 1E2PA 5B30A 3GLIB 5C46F 5SZKB 3ZZ0A 1CS4C 4L4UA 3RSOA 4PSAA 4Q02A 3I1FA 4ZI3A 1IHUA 2OCPA 3OIUA 2ZTSA 3SBDA 1XPUA 1W44A 4RJLA 1KI8A 3AM1A 4QBFA 5CYOA 2J59A 5DYGA 521PA 2HV8A 2ZRIA 3B1WA 4XWAA 1N0WA 1UKEA 1E9SA 1LS1A 2R8RA 1YJ5A 2O8EB 2A9KA 2FOLA 1HE8B 1KDTA 2OZEA 4G5RA 3AF1A 3CUEF 2QMEA 3HPQA 4Q5IA 1IY2A 1NVUQ 2DYKA 2O8BA 1UF9A 3MGCA 2V1UA 1HH4A 4O2LA 2HCJB 3IHLA 4LPKA 1E3MA 4DCUA 3I61A 1DAKA 2ZU6A 2C9OA 2IBMA 1D2MA 3HYRA 4LX0A 3TVTA 1EX6A 2G0TA 3FB4A 1LY1A 5M04A 3VNUA 4B3FX 1BKDR 4LJ8A 5TARA 2WWHA 1N6LA 1G6OA 1US8A 3BXZA 5L3SB 4DB4A 3C4JA 4Z51A 1QHXA 1VMAA 2WM9B 3I5YA 3CW2A 2HF8A 1MO4A 2C04A 1XTKA 5AR1A 2O52A 2VQSA 4TTQA 2VP6A 4B73A 1BIFA 3QY0A 1M74A 2OLKA 2PJRA 4ESVA 4NYIQ 3GFOA 2FN4A 1A7JA 4NCHA 2F7SA 1K6MA 1XEWY 4HZUA 3CF6R 4U02A 5AJWA 2B8TA 3HYTA 3H4MA 2BJVA 4LBYA 3BERA 2F9LA 1Z83A 4DDTA 4B44A 1M8PA 2XB4A 4HAWA 4LDJA 1W5TA 1BH2A 4CF7A 1G64A 4M9SA 4YMVA 3SDZA 4JL6A 3AGPA 4LYAA 1H65A 2QE7D 821PA 1QHHB 4MKHA 4IEIA 3UG7A 3NBXX 2RGBA 5JHGB 4CDGA 3JVUA 2WOOA 4B33A 5CIWA 2BOVA 2ODNA 3R7WB 5KO2A 1YZGA 3HR7A 2CLSA 2V6IA 1J70A 2GF9A 1P7CA 2Q9AA 4NE2A 4CEIA 4P4SA 3OESA 5EXPA 2IS1A 2R6FA 5FBQB 1TEVA 2PEZA 2NZJA 4PR0A 3SS8A 1COWD 1DPFA 2OAQ1 2HCBA 3DZ8A 4BLOA 3SZRA 4XTCS 4IVRA 3VX3A 4TMVA 1DVRA 3AVOA 1FQKA 2IYXA 3R9IA 3TGPA 4KVAA 1TF5A 1DS6A 4NHOA 2C03A 3FDIA 3AP1A 3HWSA 4PPGA 1WB9A 2ZI5A 2RGCA 5AWFC 2ZRAA 4JJZA 3TJZA 1JR3D 2ZSBA 3NC1C 2XJ9A 2IW3A 3PQCA 2NO6A 4PHGA 3IKJA 3QF4A 3K8YA 1ZP6A 3T1OA 3AVTA 2AWNA 1LB1B 4L5BA 3GLHA 5BQ5A 1IBRA 4I1OA 1CR1A 2CLCX 3FHCB 4JSTA 4DT1B 1N5LA 3CM0A 5FR1A 2FFQA 2ONKA 4XVRA 4JYCA 4BLQA 4FWTA 1SHKA 3P20A 5SZIA 1Q12A 1Y3AA 4PC6A 2CE7A 3BB1A 2I1VB 1UEIA 1XXHE 4D0NA 1OFIA 1ZC3A 5DNYB 4ACBA 3THYA 4LSGA 1MOZA 2V54A 1NY5A 1ZAKA 5ANRB 1S0UA 2OCBA 1RZ3A 2OFXA 4KBFA 4M22A 1KIMA 2O8CA 2QMOA 3AVYA 1W36C 2QP3A 4OHVA 3D7MA 4DLVA 1RIFA 1U0JA 2VF7A 5HE9A 4WVFA 3IPYA 1JQLB 3C5CA 4Q1EA 1YU9A 1ZUHA 1BYIA 2GZDA 3EZ2A 3RRNA 5L3VA 4CRWB 2ERYA 1NIPA 4E22A 4QG7A 3Q9LA 1ZIPA 3AKEA 3ASZA 4CW7A 1FUKA 3U7GA 1I2DA 1XEFA 1R5NA 3K0FB 421PA 1T3HA 4P31A 2QTHA 5KHOC 5FI0B 1XX6A 2YYZA 4PANA 4HZIA 3U61B 3LA6A 3IQXA 2NG1A 3E1SA 2L0XA 4NPHA 5KSYA 1ZNYA 3MWJA 3CRMA 5KTYA 2BJWA 4C0JA 1RJ9B 3FMPB 3EW9A 1O3YA 3CB4A 1VDZA 3RLFA 4H1VA 1GG2A 1NNEA 1UEJA 2GXAA 3GLFB 3ADDA 3THWA 3MJHA 1TAGA 1XTJA 4EJSC 2X1VA 3U7FB 2DBYA 2RGEA 3TSWA 4JSYA 4Q1DA 3BK7A 2VO1A 2VSOA 4TMTA 1NVVR 3BJIC 4NCIA 3EG5A 2ZJYA 4RKFA 4TN1A 1S3GA 4XTRA 1ZIOA 3ZH9B 3GD7A 1F48A 2BBTA 4OHZA 1HA3A 5FFMA 1J90A 1E9CA 1S4QA 1U9IC 1PV4A 5JCPA 2VSFA 2R9VA 5CB6A 2G3YA 5KU1A 2HJVA 1ESNA 2XAUA 1E4VA 4FCWA 4HAYA 2ASEA 5EE9A 1KI3A 2CBZA 2P5SA 4LJ6A 3WNDA 5FUXA 5LB4A 2RGDA 4HB0A 1EG7A 3B82A 4M21A 4AYWA 2QSZA 3B6EA 3I92A 3W34A 4PHHA 3M1IA 2ZREA 3DL0A 2WV9A 3BB3A 2G1KA 4OQXA 4Q4AA 2JA1A 3T1TA 1ZCBA 2GTPA 2Z4RA 4LV6A 1W5SA 4MRNA 1G7TA 2DY1A 4IDPA 2JLZA 5BYJA 1ZU4A 2VF8A 2HXSA 4Q48A 1FW6A 4LI0A 4DLYA 3KDSE 3P32A 3CWQA 2FX3A 2E1RA 3QPUA 2VP2A 4DUGA 2ZUBA 4GP6A 2IYUA 4KHZA 1TF7A 4HAXA 1D8TA 3NKVA 4KI0A 3GLHE 2RGXA 3W6NA 1M7BA 1FNMA 3QKUA 1SULA 1J2JA 1Z0DA 1AA9A 5FOSA 4CEIB 3AGQA 4JLOA 4C2UA 1OT3A 3THYB 4DIEA 2FPLA 4QM7A 2IUSA 4RD0A 2QG6A 1G7SA 3TUJC 2DB3A 5JJIA 2QAGB 1FP6A 1IXZA 1XTRA 3U3OA 3SFVA 1E9RA 3UMFA 1GL7A 1OHHD 2DFLA 2G88A 1NLFA 1MRSA 2IXGA 3K9LA 2P3SA 3RYTC 3CRQA 4URZR 4MKIA 2CNWA 1CKEA 2RKOA 1OXVA 1F6BA 2W6ID 3OE7D 1R4AA 1A5TA 1R7RA 3GMTA 4QL3A 4A0FA 4C3ZA 5FOVA 3UMRA 1FNNA 4RD6A 5F9HA 5B2ZA 3QIAA 2JEOA 3KQHA 1WP9A 2IS4A 3IUYA 1CRPA 3VKGA 2QT1A 1FMLA 4D81A 3UIEA 2IEYA 1AS0A 1G8HA 2W00A 4BFWA 3Q7PA 5K8TA 1Z5ZA 4FIDA 1KNXA 2O8DA 4URYR 1N6HA 4BLSA 4QOSA 1IOZA 4C0KA 4URUR 1XEWX 3W9YA 5IF9A 2E9SA 4Q9KA 5AJYA 4E09A 4DLUA 3CLVA 1E2LA 5DI9A 3ICQB 1G291 1LF0A 2WJIA 2QY9A 1SGWA 2QGZA
chains in the Genus database with same CATH superfamily
5BVGA 1LD3A 2Q8QA 1SQ5A 1RWNA 2H54A 4P0QB 3AF4A 3NYWA 3NNSA 1YQDA 2AFIE 1L4GA 4EG5A 2W4IA 1E2NA 2WMDA 4JI3B 5K0JA 2H08A 3SBEA 4ZVUA 2WP8J 4KL8S 3OQBA 3UO8B 1JWLA 4ZZ3A 2PV7A 1PTJC 3L7JA 3PZRA 2HSZA 3D3EA 5DWVA 2F43A 1EQ2A 4GKKB 3HEMA 1P2UA 4KQHA 1GNPA 4FFBA 1W5BA 2BBWA 3VJMA 4K86A 4JVLA 3W8EA 3A36A 1TF2A 1HLGA 1TL7C 1WO8A 3ZV3A 1MO5A 4RK6A 5C0OE 1RI3A 1RACA 1RTTA 4ARCA 4I81A 2ZT5A 1CZOA 1ZK0A 1Z36A 1NULA 1ZLXA 3HB0A 1E5VA 1VE9A 1ADGA 2BFCA 2JVJA 3C41J 1L5KA 1S2GA 1YCGA 2BGTA 2P27A 3A6FA 3TMYA 4ES6A 2WWWA 3EUAA 3CX3A 1T2VA 4QA9A 4B4OA 1PV2A 1PKXA 3SEZA 3RJMA 4DHWA 1AKWA 3CE9A 3H1AA 2H85A 5EXSA 1V96A 3DFZA 2OCGA 3G85A 4GYKA 1VXOA 2VT3A 5AVKA 1UMCA 1QGAA 2WP0A 1XU4A 4KITB 1MVOA 2QI9C 2ID4A 2NPFA 1S1MA 5CB8A 3KXPA 3H5TA 1GILA 2GUWA 5I7OA 1CPYA 1U0SY 5GV7A 3CNNA 3T9FA 1P5RA 3NBFA 4JNKA 5I7UA 3D7RA 4M88A 3UBMA 4MA5A 5I4BA 3CVVA 3OI7A 2N75A 3ETGA 1N6KA 4IJ6A 3L4KA 3AC0A 1H0KA 1QVAA 4PC1A 2XODA 3FIUA 3R3HA 1OU0A 1A8PA 3F6RA 3ITKA 4LJ5A 4EW2A 4RA9A 5J3JA 2V55B 1L4LA 1TX4B 1KI9A 4MRSA 1A0OA 2VJMB 4OXXA 3PEUA 5AIAA 3HLYA 2GZRA 1T36B 3HRHA 2DT8A 4NDNE 4YJHB 1KMCA 1RMTA 5F51A 3AW9A 4L2IA 5C8YF 3UNXA 2ILVA 1YQEA 3D6TB 3AQ4A 3TX6A 2NADA 3FPEA 1QX3A 3FTQA 4I7EA 4K05A 2GYUA 2PD3A 3A6ZA 5DWQA 1ZBDA 4HDSB 3GELA 4DG9A 4LJYA 3CEAA 3F73A 2HXGA 5AESA 3I0MA 3GIWA 3D4OA 4BS9A 5FL7D 1X1CA 1LFDB 2VDWB 3DXFA 4EYOA 1B23P 4MWEA 4IIGA 4G3XA 2ZYRA 2GKGA 1HQKA 2Q49A 3GJQA 1SZCA 2BF7A 3CFYA 1IMOA 2PSJA 1WULS 2RJ3A 1O9GA 2G63A 3DMTC 2WWYA 4F4DA 4BVBA 4DCJA 4CM8A 3VZCA 4YCCA 1CDEA 1V35A 2O6LA 4PTLA 4EJSA 2NSHA 3SBXA 1UMCB 1XVVA 4K9RA 1A9OA 4EHDA 3Q0TA 4OLHA 4FOLA 2VYND 1M2FA 1J21A 1L0BA 3FROA 4IQ8A 1NHWA 2QVYX 2SECE 5A9TA 1E1RA 1UDCA 3AV0B 2H48A 3C48A 3PC3A 4LRXA 2ILTA 5ECYA 3LHIA 5KAPA 1BX3A 5LCXA 1QTRA 2QP4A 3UT5B 1F9AA 1FBTA 5FH9A 2X4IA 5J2TB 5FUWA 4E6PA 4CM4B 2G4CA 3OSZA 4J03A 2IEIA 3O9MA 3A1NA 1KSHA 5DWDA 1YQTA 1W94A 1WEKA 2XBUA 5GM2A 4E03A 1XQ9A 2V7TA 3EC1A 3OKCA 3QEKA 4RACA 2VH2A 3UVEA 2P0YA 2ZAMA 3KFLA 3PD0A 3U0VA 1GPAA 1DAEA 3JW8A 1T4CA 1WCV1 1EK0A 3V4ZA 1JDUA 3PFFA 1EA7A 1KH3A 1QLWA 3DBVO 4KYVA 3REFA 3WL7A 4BIMA 2WJ4A 4DA8A 1CHNA 3ORQA 4R8MA 2COUA 3BIJA 4MOWA 2XE4A 4PTYA 4WCVA 2C3MA 1BJKA 4MVJH 1HFKA 3LZDA 3W77A 2NU8A 3LIPA 4ZYTA 1K7EB 4GO1A 4UU0A 3OZVA 5U4XA 5ES4B 2HHHB 3BMNB 1UM8A 4GLLA 4MS1B 3ONWA 5LBTA 5HRAA 3KXKA 1S7CA 4JFAA 2I6XA 4ER5A 2Q5IA 3IGFA 4F5DA 1IXYA 3D5EA 1O94D 1RCTE 5CLLA 1L5OA 5TGTA 4CMGA 2DQKA 4EFMA 4Z4HA 3W6UA 1T5SA 1T15A 5AOAA 1UXHA 3DE6X 4ISBA 4Y7CA 1T1RA 2ZPAA 2OHJA 5CYGA 5JC1A 3QQ5A 2XEDA 4BX8A 3UHPA 1E0SA 5GVRA 3V7YA 1KMHB 3ZKWA 1QS0B 4IOLA 4V24A 1UDXA 4FDVA 3ZWYA 4XOIA 2CWWA 3PUYA 4F4CA 4XGKA 1NI3A 1L7AA 4Z3KA 5C5DA 3NDBB 1LVGA 4C0XA 1CJVC 2AKYA 4BNNA 1TQ8A 1XAIA 4D92A 2XMBA 2O3RA 3FGPA 3IJ5A 4FGZA 4K6OA 3RU9A 4TV9A 3NHKA 3KKKA 4D8YA 2QQEA 4Z99A 2CLFB 2M98A 3FGZA 4E12A 4C7OB 2XMSA 5CJ2A 4AX8A 4V38A 2B6HA 3DKIA 2NU9B 3RBZA 5KTNA 4WOJA 5H80A 3VDNB 1YJCA 1FJHA 1T4CB 4O33A 1CZKA 1GKUB 1YQQA 4XPIB 1UM9A 2VF2A 2DSNA 1FRVA 3AFNA 1ZK2A 3OTWA 4TTJA 2A30A 2XCUA 4YAGA 2YJTD 1MV5A 3MJFA 3OHPA 3AV3A 1YFZA 4ZJPA 1AS2A 3O38A 2B8NA 1YE5A 2OV4A 3JARA 3TOVA 5MN6A 1D9ZA 1F0KA 2HO5A 3B51X 3BWVA 5HQ3B 2O8VA 1GL6A 2JBWA 2QRGA 3MZ0A 4G0MA 4QYMA 5ULLA 3S2ZA 1YZFA 5FAXA 2REBA 4FIZA 1UPCA 1R4MA 1GQQA 1XCGB 1ZIDA 5J63A 5B3JC 4C0SA 2C2KA 2G04A 4PNHA 2CNDA 4O1IA 1IK4A 1RM5A 3DBOB 3VR3A 2E18A 2BEWA 4P4TA 1ZH4A 3WNVA 2ZZNA 5DE3A 2CY0A 4JB3A 3W7VA 2J3MA 4C0AC 1V47A 4RC9A 3T3OA 4OXQA 3MTJA 1JU9A 3K53A 1KQFA 2Q3LA 3FNGA 3ZHTA 1MCZA 5CNMA 1U98A 1ABBA 1BX0A 1H2YA 2BGJA 2C5SA 2FR1A 2I67A 4XFKA 2AC4A 4OP1A 1G5IA 4HD8A 3D2AA 5JSQA 1OH5A 4TSRA 1LFAA 3VKHA 1Y0BA 2BFFA 3GZNB 1IHDA 3K30A 3SBOA 1DKUA 1V16A 2EOAA 5E4TA 2WTUA 3GJ8A 1CDDA 2D00A 2JVKA 5F64A 3VO2A 7ABPA 2DLNA 4UNIA 3TPZA 3GUHA 3RRXA 3M1YA 3WK8A 1GADO 2WTMA 1FRQA 1V4VA 2XJ4A 1HE5A 3LGSA 5FEUA 3NHBA 1XRPA 4ZQBA 3T9CA 5FTNA 5F3RA 1PKEA 1CQJA 2B94A 4HI0E 1SKAA 3TOXA 3LECA 4GKJB 3II6X 4RANA 3EXG1 3WGTA 3EQ7A 3VFDA 4U00A 1CD5A 5D3KA 4DCOA 4LF8B 4L72A 2WU1A 5KWVA 4XCXA 1O96B 2EATA 4JLKA 2RDMA 4HL6A 3K8ZA 4HDOB 5NULA 2DGDA 2ZTUA 3IS3A 3MLAA 4LZWA 2VRWA 3OJEA 5E7MA 3TW8A 5JAPA 2ZCJA 1ZMOA 3UT5A 3GEPA 2Y68A 4GI2A 4L5CA 4U2GA 4PLTA 3TIVA 3VTKA 4B31A 4BO9A 1YUBA 1XDZA 2AXQA 4PM4A 1MGPA 2FZ5A 1V9CA 3RNLA 3B3FA 3NHSA 5H1YA 5J4YA 2VHTA 4LDZA 4AD8A 2UUCB 3NT5A 2C7VA 1C8LA 1FLDA 1EXMA 2IHUA 3TLYA 3CJTA 1EHCA 4C7MA 3ZJTA 2BGWA 1NLUA 4M8LA 1V4NA 4AUKA 1U9YA 1U2DC 1BWRA 4YP1A 4DUYB 2IH4A 3P94A 1UOPA 5AUQA 3I6ZA 3WRWA 3HU1A 2XEXA 2W37A 3OFKA 4EG1A 2C99A 4N76A 3V8MA 1J49A 3KHUA 1A4RA 1CX9B 4A2QA 3A9TA 2QM7A 2JATA 3DAOA 4CR7A 1W35A 1QHEA 1ZJ6A 3VSBA 1H0RA 2J0VA 1NI4B 2XITA 4AS1A 4EFDA 2EZ8A 1QCCA 3TLXA 5BURA 3EMDA 4MK4A 5FV4A 3V7WA 2A7QA 3O8NA 3RHSA 4DQKA 4RK4A 1ODIA 5K1ZA 4PYIA 2Q8PA 1TC1A 2QN1A 5LNK6 2J32A 3DOCA 2G36A 2QRHA 4DEXA 3H11A 3FGNA 4I4TF 3BHIA 3C5EA 2OEPA 4OFWA 3HYNA 2C77A 1M1YB 2C92A 2W4MA 3DR5A 1WU8A 1I6WA 3ND5A 4RFSB 2OLJA 3THSA 5DSZA 2WWRA 3NHMA 5JAIA 3I0NA 1N2IA 2RD2A 1YE8A 4R2LA 1HYQA 1JBKA 2D4HA 3KD2A 4G84A 2H6EA 1Z9BA 2C9YA 2XMDA 1PV1A 5HMLA 6REQB 1C9DB 4CIVA 4DCGA 1EWTA 4BB6A 1YSCA 4OXKA 3AKYA 1ZK4A 3IP7A 1PTJA 2QTWB 2MIIA 1ZM2A 3NO4A 1XBTA 2GN9A 2PYDA 4ZKDA 5L9AA 4H7PA 1UJBA 1GL9B 4QGSA 2QQ0A 1H1DA 1ZLYA 2BKVA 1U0NA 3A6KA 3GLIE 1AUOA 1WOYA 3LLUA 3SWWA 3AI2A 2W22A 3G8AA 3HMKA 3JRXA 5F98A 3FPSA 5EFOA 1FDTA 1M2OB 3MLEA 1H94A 4PVCA 3RK4A 3RRYA 2WYWA 1Y9AA 3V1TC 4URXR 3DMYA 2R7MA 1YR6A 3PF9A 4JQOA 4NKRA 4IX1A 3RAJA 3ZV7A 4AWBA 4R6XA 1IQRA 5KU7A 4RL4A 2BBSA 2ODPA 2ZSIA 4NECA 5U4QA 5K3OA 4PYQA 2I4TA 1ZOLA 2Q3MA 5ESWA 4B47A 3W8RA 5FBLB 2J3DA 1IJFA 1O6GA 1ZD5A 5IKXA 3EFOB 4EMSA 1WBDA 3NVDA 2IOFA 1KMIY 4G1EB 2OQ2A 2GN6A 4GRDA 2XQKA 1OMOA 4AY6A 4MMZB 1MHTA 1WVIA 4HB4A 2I9KA 1U90A 2WPDD 3D2CA 2C9BA 4BQRA 1DHRA 3W5IA 4HR7A 1ZINA 3FYHA 3KB8A 3MS7A 1DL5A 4HCJA 4JVOA 1NFFA 2CHFA 2C9MA 1MW9X 1QOZA 3T1VA 4B87A 4R3WA 2GEVA 1WD5A 2QR2A 2LKDA 4IEEA 4X92A 2FPMA 3A6EA 2DMRA 4WNYA 1K3UB 1NONA 2B8WA 3H1GA 4JWTA 3VSAA 3UEOA 1ZGGA 1W85A 4MAMA 4X1YB 1GSOA 4GFDA 2O8FA 3KB2A 2IYQA 2BGIA 4LVOA 3NPMA 1A98A 1CUVA 5T64A 3RWOA 4GNKA 1C3LA 2PGAA 2ADOA 3DUFB 3DWIA 2BM1A 1D6SA 2OG1A 4JROA 4I6JA 3BIXA 3UJDA 1DWUA 3NWBA 5JARA 4C4ZA 3DDNA 2IJGX 4ZYYA 4EYSA 3TLMA 5EZYF 4C0BA 1KYXA 4XOUA 3DNPA 3IJEB 4X1IA 1L5ZA 4JKYA 4F9TA 3GWGA 3GJTA 2X5XA 4I66A 4EG0A 1PL7A 4Q7KA 3WTCA 4YQFA 3ZU4A 3MCWA 1TEXA 4B8ZA 2WQ7A 4MPTA 2X4GA 2ZJ8A 5KNLA 3ZV4A 5ECGC 4LRSB 1ZAYA 3GPCA 5JXWA 2PGDA 3HBAA 3ZDBA 3FHTA 2C5FA 1Z88A 1LJUA 2CD7A 2WWXA 1MAHA 4DQVA 3BS4A 2XCSB 1U94A 2AE1A 1JFFA 1WKBA 3PGJA 3BIOA 1NYRA 2PRSA 1Q0PA 1LU9A 3D0RA 2HHCA 3DBRA 3IVXA 2QVBA 4PCAA 3V1LA 4WZBA 3A1CA 3U40A 1E1NA 4CLDA 2GBGA 3S2GA 5AM2A 1Q0SA 3DM9B 4G1FA 4E2XA 5KI6A 4NIMA 3EE6A 1EFTA 2IITA 2VYCA 3OTOB 3EVBA 2K2QB 4ZODA 3VTFA 3AW8A 3UUEA 3EPHA 1VGVA 4ZI2A 3JYPA 2JANA 3N2GA 4M1OA 3BDVA 2LKCA 4NRDA 5C8XA 2OGUA 2VDPB 3WDSA 3X1YA 3LYAA 5LDDC 2DFNA 3L8YA 2V97A 4MV7A 4YV7A 4JQZA 2J3IA 3KOMA 3QUTA 3FLEA 3M7IA 3E5RA 4KQCA 3X43A 1RC1A 1VB5A 1VCMA 2C2WA 2G17A 2FSPA 2BDUA 4M76B 4UQOA 1I6KA 3RU7A 2K87A 3A37A 2PKWA 3QHPA 4ALLA 1XD8A 2J0EA 1NX6A 5T4BA 3MYRA 1XYVA 9ATCA 1KARA 1P17A 2DECA 2X58A 3I9V1 3VGJA 1SC3A 1ML4A 4FGSA 4W8OA 5KYTA 1PIWA 3EX7C 1N78A 1MPTA 2C78A 3GIDA 1JDNA 5I9SA 4DA7A 1T8SA 5DNWA 4QVIA 3DE2X 1YNSA 1XP5A 3GLGA 1U8YA 4Q9LA 1N5OX 4RBNA 1P5HA 1X8XA 1LJLA 1P2FA 2R62A 2BM0A 2PYIA 4JLWA 2QX9A 4L78A 4UU8A 4OGLA 3VR1A 1FDOA 3VOTA 2OZKA 1U0LA 3WFZA 2ZJ5A 4D44A 4DBLE 1JA0A 1S2OA 2XCOA 2OBLA 2O0MA 4RSHA 5CYFA 1JNYA 1VP9A 3SICE 4ZXPA 4ON9A 5A7FA 4FFOA 1K4MA 1XMSA 4JC8A 4UTXA 3E4DA 4TYNA 4ML3A 1B6TA 4NF2A 4N39A 3W4JA 5I9LA 2R8BA 1V25A 3KCQA 4L76A 4WKGA 1T6BY 2P2CA 3PYLA 4KXFB 1JHPA 3W0LB 4EOGA 5J2UF 1SC9A 2V7PA 3C14C 4ZP1A 3EXFB 3OJCA 5IHPA 3V9PA 1M34E 3FKQA 4W9MC 3BH6A 1IATA 3WMWA 2VZLA 1VIYA 4E2YA 4XWOA 2WAYA 5KWEA 3HXMA 5EGSA 2J6IA 2GXQA 1X86B 1YBAA 1PT9A 1RJEA 1TCCA 4BLRA 3GG2A 1NX9A 5AOBA 3JZAA 3M2TA 2REOA 1PJBA 3A11A 4X62B 2W2MA 4ZZIA 4N6NA 3VZQA 1XMVA 1M2VA 3TECE 3JQEA 1ORHA 2HJGA 3NFRA 3PJGA 4O0LA 1HZZC 1VHWA 4MYSA 4YMSA 1N0UA 3KDAA 1OT5A 2XX3A 1BX1A 2UUPA 1NL3A 1I01A 4KE6A 2PX4A 1P1RA 3R24A 5MFPA 4UREA 4OMCA 4QC2A 4IFEA 3ZE0B 1WG8A 2CJXA 3PFCA 1LPMA 1M0EA 5J2UA 1VG0B 4K03A 4GM4A 5TVKA 4FZJA 1RVV1 2H7XA 2J7KA 2VK2A 3AOEA 5FRDA 1P7WA 5KDDA 2BZ1A 4WD3A 3QBTA 3RJ9A 5KMGB 1EP3B 4WZBE 1DTSA 2R4TA 5AUPB 4QUGA 2DG2A 3GNSA 5LXTA 5KPDA 2IS2A 1A5ZA 1ZITA 2WKRA 4NZ9A 3DUFA 3F74A 4KYIB 1SXJE 2F3PA 5ALNA 1GARA 3CEHA 1AHPA 2P4EA 3PTAA 4B3RB 4OA8A 4HTFA 2J3EA 4LKOA 1JPNA 1JXOA 1Y4UA 2YWHA 1QG4A 3I6IA 5C2JB 1M0SA 3JASB 4FOTA 1RLIA 1W8IA 1E2JA 1P2BA 2HTFA 1MTOA 3T7KA 4B84A 4D9BA 4OK6A 1KPHA 1WKVA 2NTYC 4BGEA 1XXHB 1FMCA 2CL5A 1X7DA 4OYLA 3B12A 5DT2A 2Z3ZA 2PRZA 1XRSB 4PEVA 3Q6MA 2IXFA 2JCXA 3KS9A 2VXYA 5JMPA 2FW9A 4IJQA 5FX2A 3UAZA 5DDIP 2H0QA 1SEPA 2WWTA 3SC4A 1CY4A 1J2UA 1G0OA 4URFA 4UTVA 3L8ZA 3AF6A 2Y67A 1NKSA 3Q7SA 4WINA 5I9TA 2I2WA 1Z06A 3EIWA 2I7TA 3QVWA 4XB1A 1SUFA 3W3AH 3UMMA 2IOQA 4LWOA 5G40A 3BK2A 3FY4A 4FONA 4EPRA 1W9HA 5DV9A 1XCLA 3W5BA 2GJ9A 3OWXA 5YASA 1FZTA 2XD4A 2H7CA 1O6CA 3KZNA 4EPXA 2YZGA 1IZ9A 4NONA 5LL6P 4YGXB 4ZEMA 2DTXA 3E7PA 1AH2A 3A7DA 2WVAA 3P9CA 4HDCA 5JW6A 1WAMA 2Q4EA 5DCUA 4BNJA 3A05A 5JH7B 1G6Q1 4PQRA 6YASA 1IAVA 4QQNA 2CLKB 4CGYA 1L5QA 3K5WA 1BE6A 1MP0A 4XIGS 1KDPA 3KKQA 3DDWA 2E89A 1XL1A 5COAA 4BNDB 4YMTA 2YWGA 2JAWA 4J4TA 4NV1A 3BILA 5D3MB 3F2VA 1CR4A 2IYPA 5BYAA 3AERA 5KYXB 3COVA 4ZO6A 1W88B 3U7EB 4ZO7A 4WA8A 2E2WA 1DRWA 3HY6A 1M7GA 4J76A 3NGLA 5CGZA 4Q4DA 4B09A 2ZBQA 1ZH2A 4JL5A 1CRZA 3MERA 1U0RA 1EFDN 3A6LA 1TQ4A 2CVQA 1QHIA 3HN6A 1JPVA 3QIVA 4IXNA 4RTLA 4L4RA 2CJWB 4BNZA 5CCDA 3WIDA 3MVEA 3U7HB 3M1AA 1U8ZA 3NTRA 4J9VA 1P8JA 4M0DA 5C8YA 4EF5A 1V8OA 1BAPA 2A1UB 2E1PA 3BFPA 3QWIA 4X8OA 1O94C 1H6CA 3H6KA 3R3VA 5FBZA 3VPDA 4AJIA 4OHRA 1O6ZA 2I4NA 1NVTA 1UMKA 1LPPA 2XOKA 3C6KA 1RYZA 3V1UA 3PEFA 4DAEA 2ZWOA 2DWCA 1DAFA 2FDXA 5IN5A 3LDUA 3QEMA 1T1SA 3EXHA 3OSUA 4MGKR 5HIMA 4QWMA 5DYNA 1TCBA 4WECA 1CUUA 4GRAA 4RLSA 1G5TA 2C8JA 4P3YA 3ELDA 2ZTHA 5FOXA 2WIAA 5DGDA 2JJ1A 3IHWA 1THMA 4ZWNA 1YB6A 4LF9B 1RWKA 3MGAA 2RKBA 5JNLA 3ZGYA 3H1EA 4RORA 2WFLB 3IAEA 4LZAA 3H2HA 1EGVB 2J5QA 3RSFA 3D31A 4YHBA 3V4LA 1D2EA 1EIZA 1ZGBA 3QTTA 5L51A 1N1EA 4DUPA 1MUUA 3OWOA 4MRAA 2DR3A 2IXEA 3EOZA 3O73A 3V4PB 5F78A 2QUZA 4HNUA 3GNQA 4YCMA 1G5HA 4NFLA 4TTIA 4UVHA 3GBVA 1D2RA 5E2AA 4NG5A 3BM5A 5AQEA 3S7TA 3KOXA 1I5OA 1GRRA 2D7JA 5I4CA 4N5HX 4YJ3A 3R74A 1Q1NA 2I76A 1ZOIA 2CLLB 2H52A 3S70A 1TZKA 4QOHA 1TMYA 5B3LA 1YA6A 2VXOA 5J4KA 1RCFA 1NUTA 3AY3A 2X8JA 4ITVA 2R751 3N7AA 2O5VA 4HDSA 5JATA 3H2YA 1OAOA 5K0GA 1II8B 3SSOA 1U2GC 3IUJA 4IHQA 1WV1A 2R7NA 3FUCA 3ORYA 5JPCA 4HFMA 4MQEA 3PUKA 4D41A 4AY2A 5HX7A 2CDRA 1VPDA 1U3VA 3TEFA 1KDZA 2V1XA 3I5UA 3A4TA 1SCQA 5AHXA 3TI9A 3GLUA 3QA9A 2F1IA 1VKJA 4UM7A 5MN5A 4RVCA 2PZKA 1YIAA 1P2TA 4CV3A 2UV8A 3A70A 3K5HA 4QWWA 4H6XA 1LDBA 5CDGA 3EFBA 1K5GA 1C8BA 2WYUA 2ZIWB 3RGWS 4K9SA 2PUBA 3FFAA 4YAWA 4GOJA 1Q7TA 2IYYA 3DDHA 5CA0F 2M6LA 2EKDA 2BMWA 4UE3S 4AAYA 2FMUA 1RE1A 2H06A 3TZLA 3TFWA 3F6EX 2O0JA 4V1CA 2A9VA 1G8PA 3QVKA 5DVZA 3FHLA 4MDEA 3SQLA 3L05A 4RMIA 4I99A 4GI1A 3V4RA 2B4YA 5LOVF 3WGGA 2FQQA 4OI2A 5AKXA 1JEQA 2WVJA 3WS7A 1MABB 3UWOA 1ZCAA 2H92A 1WD7A 4DOMA 2OE2A 3THXA 1G8GA 2DUWA 3O26A 2QAGA 3K1TA 4GQBA 3SSAA 2C0QA 3V6LA 5IVDA 1LWOA 3SR0A 1M6VA 1FTNA 5HM6A 1R6AA 1VFPA 1U2GA 1OWLA 4LHZA 3EY9A 4OQEA 2JPDA 2NAFA 2I62A 2IK8A 1GZDA 1R0SA 2VAXA 4NYIR 4FFLA 1VCOA 1NU6A 1TTPB 5KHLB 1EX7A 2FG7C 4OI1A 1HI9A 3F67A 5H68A 2WYIA 2OFOA 1Z2PX 2PVCA 4GXTA 5EHIA 1FMFA 2W2NA 3I83A 2R1TA 2OORA 2O4UX 3HKCA 3UKJA 1Z0JA 1G18A 1RRFA 3E48A 2BVNA 2AZDA 5IJZA 3ZE9A 2V6FA 4H0NA 1PZNA 2AOWA 4R5MA 3E84A 4QRDA 2PKYX 4I5DA 1JKXA 3RUCA 1FP1D 2VUHB 1RXCA 3OZRA 1LTKA 2GWRA 3JZIA 3CHYA 5JS8A 5JVDA 3FPLA 3VKWA 1F4PA 5TF0A 3KT0A 1XDBA 1V8DA 2ZWMA 3ONVA 3USES 3N2KB 4IGKA 2H1LA 2XQVA 3GL9A 1BCRA 4LHWA 2V9ZA 3JQDA 3EISA 4ZYWA 1N92A 5I5EA 1PVOA 5JJCA 1CQXA 4AQYB 3ZY6A 1NJ1A 1F9EA 3GMIA 1KO5A 3TQQA 7YASA 1VKOA 4X7RA 2YWJA 5CFMA 4DG8A 5K0ZA 3KXLA 2G9RA 5E9AA 1AHHA 4ETWA 1ODCA 1RXEA 1RKXA 3PFIA 2WB4A 4XJVA 4H4DA 4ESHA 1VJRA 4EY6A 4ZDJA 2RHDA 3PGKA 4BZXA 5HQ3A 2F00A 4PG5A 1FLNA 1T9GS 2VJOA 1D2CA 2O14A 4WNAA 2EFEB 4CL0A 4PBSA 1NRJB 1ZHHA 1OAOC 3CH6A 1T0BA 2DHQA 3CRRA 3SLKA 4CMEA 3K2IA 1NM5C 3IP5A 2FMXA 5SY9A 3O4VA 2HC9A 4A10A 5KYKA 3HJGA 3K31A 3VBCA 1R6DA 2AZMA 1P9RA 4F60A 3I3SR 1FY2A 4LY3A 4UU7A 1RHMA 3NP9A 1QIGA 4MW0A 5GWXA 3MCAA 2HQOA 3C98A 5HKOA 2Z58A 1LX6A 3F5FA 4WUTA 1MIOB 1NSYA 2X8LA 4WN9B 3BB4A 4YCBA 3RG8A 3HFSA 3ECSA 4ITRC 4MR7B 4TWIA 5FPPA 4ZN6A 5BUCA 1KZ4A 2CSUA 3KQKA 1PHRA 2NMVA 4FR0A 5KC8A 4OREX 3HVRA 3H16A 2C5HA 4BCBA 4XIIA 1O87A 1KXJA 1RZVA 2IXDA 3OOHA 3V46A 2G1UA 5FWYA 1ISRA 2V8OA 1TYCA 5GAJA 4DWJA 4CZ2A 4KGZA 1RJ9A 4LGYA 2I3DA 5JCOA 2CHVA 4L4ZA 1MTZA 3K15A 4Y2HA 3DJYA 2MYUA 2VPYA 1CR2A 3TSYA 1LNZA 5A62A 1OH8A 3EIHA 2E0IA 5KTRA 4WFQA 3OQOA 1GQSA 1OGJA 2RGNC 3DB1A 4KVGA 4Q00A 4EFKA 5AW0A 3DEAA 4GKAA 2IA5A 1J5EB 1OWOA 2WIGA 3DBHA 3J7TA 4OHWA 2AWOA 1RW4A 3IBTA 1W6UA 2IY8A 1PX0A 1TO6A 2ZRLA 1W2WB 2BV3A 1SBYA 3MTDA 4HPXB 4PAWA 4OQLA 3UUFA 4L2IB 5DPMA 1D04A 3VDMA 5KOJB 4BBPA 3L01A 4MGIR 2EIXA 1M8KA 5I4IA 2G5GX 1RE0A 1V37A 1XUOA 4CV0A 5EMLA 3FCAA 3A6PC 4YUVA 4F8EA 2JGAA 4OHUA 1PT7A 1TU0A 4H7IA 2YXEA 4DLWA 3QFSA 1KJNA 4HWSA 1V3UA 3AZPA 1ZQ9A 2MSWA 4Q7LA 3SHQA 3GDWA 3TMKA 3KETA 1Q0TA 3DTVD 2E87A 1PQUA 3DV2A 4HZGA 5FPSA 3M8KA 2Q1YA 1PGQA 4HY3A 2QVLA 3WWZA 4KSCA 4MW9A 3HA5A 5FFFA 4OLJA 3EA0A 3EH2A 5IASA 3Q3HA 3QP9A 4Z8YA 4ZAWA 2EGHA 3ZX4A 1IWBB 1QFXA 3LX8A 4I19A 5K09A 2PS1A 1AQNA 1YXMA 1A5SB 2FE4A 4GOLD 4DREA 1NVKA 1D1TA 3ESXA 3HV0A 3IVAA 2BL4A 1VSBA 4ENTA 4HMOA 4MKXA 4OU4A 5ALTA 4H3SA 4HAUA 4ILKA 3B1FA 5FLEX 4IR7A 3RC1A 3U44B 3AEYA 3C87A 4RELA 5KOYA 4GWGA 4ADSG 4G6ZA 1K92A 4ZHSA 3UMBA 5JNRA 4ND7A 1J0EA 4YDSA 3IPAA 3H3FA 4G5YA 4J0IA 4Y2YA 1KZ6A 3T99A 1DKQA 3FUUA 2X5JO 4OSPA 1PAUA 1UMDB 1V8PA 3O3OB 3ZY3A 1GT6A 3PENA 5JROA 1XPRA 1N36B 1JIVA 1GVNB 3H83A 4Q16A 1WDWB 1ELOA 3WADA 1GPBA 3RTCA 2HK6A 1GG8A 4G56A 3BJEA 3TLZA 3Q88A 3ICWA 4HK4A 4E4RA 1QV7A 2PRKA 1ULSA 2H3HA 2DJIA 2PZLA 3LSYA 3ABSB 3PIRA 1EM6A 3WNZA 1KFJB 5CDTA 3IO5A 4BMOB 8ATCA 3DXXA 3RSQA 2W2LD 4HGNA 4G1MB 5FBWB 4OK5A 4Q9AA 5G41A 4D43A 3W5HA 1ZY2A 3J7AC 2QM8A 1ADYA 2WM3A 5JECA 3EPKA 1BXKA 3GPBA 1C3VA 4FFNA 3DNFA 4MV6A 5DXAA 3NBQA 1DCTA 4GQAA 1T4MA 2ZZMA 1XLWA 3SHTA 3AR4A 5G0UA 2DHRA 5CAEA 5I6DA 2LNDA 3N2GB 2WLTA 4BNIA 5CX1B 2OXRA 4V0LA 1NQUA 1R5BA 2W6CX 3KYDB 1EB9A 4WKNA 4B7AA 4S0XA 2PH5A 2RAFA 4EW3A 4L0CA 2D5BA 1YR9A 3DGFC 3P26A 4TV9B 5IK2A 4C5AA 3ZE2B 1WUTA 5LZ4A 1ND6A 1YR3A 3OIFA 4NYJQ 2AIRA 3KDPA 5CMLA 2GZSA 5HIJA 3JZFA 5A3QA 1UWVA 2OB1A 4LSWA 3UHAA 4XM0A 4EJSB 2AJDA 1J8FA 2XW6A 3DLTA 1VLHA 2EBUA 3LYLA 3TCXB 2CXXA 3U6BA 3PT5A 2WKQA 3KSRA 1XROA 3CLRD 1MO2A 2P30A 2NPOA 2OP0A 1RWVA 3FWZA 2O07A 2PMKA 4JLAA 5G1NA 3RKUA 4DJFC 1FP2A 1QRSA 1RJDA 1MR3F 1IWPB 4EVSA 4FBLA 4L6AA 4XFJA 1LW6E 2JKYA 4W63A 4B2IA 1NTOA 4PGFA 1AKVA 3H7AA 2P3LA 3H2KA 3JZDA 1E96A 1DBIA 4O2BF 3ZY2A 2EBWA 3OQVA 2HCFA 3JTMA 2HV9A 3BGWA 2QTZA 4F6RA 721PA 1IBLB 4IHJF 5H3HA 4DLAA 5B1IA 2FLWA 5AHOA 2JLBA 2J9ZB 2H18A 5FPHA 3NATA 4NSNA 5CHEA 4CPDA 1E3QA 3SYRA 1SUCA 2OHGA 3B52X 4PPFA 4S04A 1Y7TA 3QUCA 1IRXA 1MX3A 4RPLA 4O02B 2RGAA 3GF4A 4LBZA 4AJ4A 4HDRB 2W4QA 2J3KA 1ZXBA 1M6NA 2GPWA 1Z6YA 1R8QA 2TRSB 4KRYA 1NXWA 1L5HA 5LMZA 3W8DA 2D2FA 2PQ0A 3QE2A 1T2AA 2IHVA 1XEXA 2OK7A 2QRNA 4KIJA 3J81k 1NN5A 2O8DB 1QANA 1S96A 3FPAA 5C1OA 1DIOB 3E2PA 1WHSA 3C3WA 3U1BA 1OOEA 1Y4DE 4MYRA 4BLTA 1MT3A 2QTRA 3B5EA 3GC6A 2EFCB 5JS1A 2RARA 4RVFA 1Q57A 2Y76A 3O8LA 4ZVSA 4J91A 1IG0A 1DQYA 1YCHA 2MDTA 1Y7PA 2OV6A 4B6JA 4FCVA 1N8KA 4N0DA 4UTPA 1UZAA 4JENA 5HIIA 2WPDA 1DIBA 4PPYA 4J16A 1NI4A 5UKDA 4EHNA 2WMNB 4BNMA 1FVOA 1KPGA 4FLFA 3WIOA 1D4ZA 5SYAA 3FDFA 3DBLA 4DLTA 4YI3A 5I5GA 5ABPA 2ZJOA 1CRWG 4ZCSA 3WQHA 1KOJA 5GIPE 4I0WB 5E6RB 1FYXA 1ZYUA 1FDWA 1W4RA 3D6HA 4XD2A 5EZ5A 3VO1A 2MHCA 2O54A 1IVYA 3N2NA 3U0BA 1XMXA 3L1UA 3NHPA 4QPJC 5HZMA 1AMNA 1D0IA 2PCLA 3LXXA 4KK3A 3E9MA 1PWZA 5KUTA 3I9NA 1UFVA 1YRAA 1UBEA 3INTA 1L8QA 3DE0X 2XDQB 4IYRA 4C7JA 2HWYA 3A2LA 5A6SA 3GOQA 3HWWA 4GPD1 5C8YB 1V1MB 3BBPA 4IIXA 3RV3A 2B82A 1GUFA 1G8AA 1C0IA 1NM5A 1UDWA 2WSSD 2I65A 1K5PA 3CPHA 4K46A 4LHYA 2CW5A 1P39A 4ZHQB 4R6WA 4DMMA 3M83A 1DC3A 4H77A 5AHRA 4YB8A 3E9YA 4NOMA 5K05A 3UV3A 1F5NA 2TMKA 1FUUA 1NUUA 2C2ZA 4IXDA 1MFPA 1GDHA 3L0IB 1Y1PA 3EXHC 3AM4A 4UVGA 1JLRA 4ACAA 2Q2QA 5JAQA 2X2EA 3VR3D 4TL7A 2ZP1A 2WDZA 3NDJA 2R2GA 4OI0A 1OF1A 3CMMA 4ER6A 2OV3A 4XSHA 3VI4B 3G8DA 3I9V6 4OUDA 2GYVA 2WHQA 3HABA 1JFVA 2BEKA 1VPLA 4ZT3A 1J8MF 3AEKA 2O7QA 1PJCA 1Y1LA 3K92A 3KOYA 1SVSA 2GAOA 4MI1A 1TJ4A 4JI6B 3RRZA 4EHLA 2JH3A 1E0KA 1KZYC 3DE4X 1KO4A 1W46A 3T9EA 2PUJA 2QJWA 4G65A 3PJEA 4JQYA 2VSYA 4PQGA 3FPBA 1XDUA 1JR3E 4ZO9A 3ZOKA 1A71A 1NJ5A 1SCBA 2VJQA 1GZ4A 2WF8A 2IOHA 1GAEO 4JUCA 1Z3IX 4KAXA 1L3IA 5EKDA 4R0MA 6CHYA 4XJXA 3KFVA 4DF3A 3Q7TA 3F78A 3TUIC 4F6CA 3QLJA 1E1CA 1W76A 1II9A 4QYIA 5FUQA 4GC9A 4I8DA 4OJKA 4DGQA 4GRIA 1KTVA 5CCEA 3ZGZA 4FKMA 3GX1A 2HO4A 2QS9A 1Q0UA 3C7KA 5FBRB 2C2YA 4UJ5A 2GXUA 1W29A 1I3OA 3DZDA 4FE4A 3OU7A 1JHXA 3A6JA 1AGYA 3BL6A 1JG2A 4LISA 2QN8A 3T9DA 1PQPA 3GLIA 3AONB 4U2KA 1MOPA 3C6BA 2GBPA 4G1BA 4JYZA 1J25A 3L1IA 4ILEA 1KEKA 1BOOA 1BWPA 2IYAA 4JLBA 2JGDB 3M9XA 1IN1A 3C6ZA 1I7PA 4L9WA 1ZO8A 3L9WA 3T54A 5F33A 4GEGA 3VTZA 2ZUEA 1AO3A 5JEDA 1NYLA 5BPHA 3HZRA 1X7XB 4JITA 3B5JA 2M1ZA 4N0QA 5JALA 4I8XA 1LK5A 2H8KA 3VHRA 4MV9A 4MR8A 9LDBA 4WTOA 1GGJA 1PWHA 1SH7A 4OFZA 4YT2A 1MGOA 4RTOA 3IDAA 2VJBA 4EHKA 4B7UA 1XRMA 3DT9A 4CU2A 4FNAA 1NVDA 3A31A 1G66A 2ZI6A 3D7NA 3FNQA 3GJYA 4RGBA 5IXSA 4QECA 1CIVA 2YXPX 1GA6A 4K3UA