3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
molecule keywords Thymidylate kinase
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
1P9RA 4ZDJA 3CNLA 1YZUA 2A2ZA 2VF7A 3VU9A 2J0QA 1J8YF 4D6PA 2IWHA 1ZCBA 3LDAA 3W5JA 1FUKA 4TL6A 2X2FA 2B8TA 4IDHA 2ZVPX 4QHTA 3NTUA 3G0HA 2QTFA 1Q44A 3VNUA 1P3JA 4E22A 3NKVA 1QHYA 2GWHA 4TQ9A 2GXSA 4QG7A 3OFND 1AS3A 1S0UA 4X8OA 5CM9C 3QPVA 1XCGB 3CRW1 1GTVA 1KO1A 1T0JB 1V43A 1FL9A 2NO9A 4Q1EA 1Q1QA 3UWOA 4DJTA 4DUGA 5IK2D 1KJWA 3UXMA 1RYHA 4Y0AA 3U2QA 2OT3B 2QY9A 4UJ5A 5FUVA 1VYTA 4HAYA 1G19A 1E6CA 3W8NA 4BFZA 1GNPA 1XTRA 2GCOA 5IF9A 1ZRHA 3AVTA 1Z6XA 1S8FA 3U7GA 3OFNA 3U4QB 3LQRA 4LV5B 2VQSA 5BN4A 3A6PC 1NJGA 3K8YA 4P31A 3G5UA 4OQFA 4RD1A 2ZRLA 4KVGA 4CEIA 1W5TA 2BM0A 4C7OB 4NCHA 2FZ4A 1VHLA 1U99A 1XEWX 4GNKA 3QEOA 3ZVRA 2W58A 1U9IA 5LPNA 4BZPA 4PANA 1GITA 2CHGA 2YOFA 3L8YA 2YV5A 3NIBA 3THYB 1ZUIA 2ONJA 2ZRAA 2OBNA 4GMDA 3QF4A 3CO5A 3UG6A 2P6NA 4EAQA 1ESNA 2QA5A 2QSZA 1XMIA 1P72A 3L0SA 4IDQA 5JHGB 3SZRA 1T9HA 2PMKA 3EZ2A 3SI7A 4URWR 1CJVC 1RVDA 2O8CA 2Q9AA 1E2MA 4GRAA 4ABYA 2HLDA 1UEJA 4Q1CA 1PV4A 2WSMA 3K53A 2GEUA 1N5JA 4CVNA 3TVTA 1ZW6A 5BN3A 4P4SA 4B32A 3IUYA 1G4AE 4CRWB 2ECKA 1OXVA 1KO7A 4OHXA 1T3SA 4F4JA 2O52A 4DVGA 1Z63A 1G21E 4FW9A 1XPRA 5E3HA 1E2EA 2GXUA 4P4TA 4D4KA 1GKYA 2V55B 4V0OA 2Z6VA 1AS0A 1VPLA 4Q7JB 4WVFA 2OEPA 1TF5A 1G7CA 1UBCA 1IM2A 3CRRA 1ZC3A 5LD2B 3ZH9B 2OLKA 5EE5B 1VCIA 4P4UA 3PENA 3H2YA 4L5BA 5A0FA 3TSWA 1Z6GA 3QXSA 1E2DA 3LBHA 4LY6A 4Q19A 2Z0MA 1P73A 1VIYA 2WOJA 3VR5A 3BH0A 2KSQA 4Z54A 2XJ9A 1EX7A 3LFUA 3O8CA 5FPHA 5SZJA 1OKKA 1HE8B 3SN6A 1ZYUA 3WMFA 2X1VA 1CRPA 4FIDA 4DUGD 2RB4A 4B3DA 4D26A 5KDLA 3UMSA 1XTSA 1US8A 1OB2A 1X8JA 1AZTA 5EP1A 4N0DA 3BGWA 1FP6A 5P21A 3KQHA 3N5CA 5FR1A 1VG0B 3PFIA 3AEZA 5CB8A 2IYRA 4A4DA 3GPLA 2O8BB 1Z6TA 2G1KA 1GL9B 4LOAA 1G18A 4OJKA 2ATVA 4EQ6B 3PIRA 2WAXA 3GFPA 3M4YA 1L2TA 1PVOA 4JSTA 1E4VA 1JPJA 3GFTA 5CK4A 1TF7A 4RFSB 4TN1A 2ZU0C 3CZQA 4LPKA 1J70A 4QJ4A 2XXAA 4KFRA 2QAGC 4P33A 1NKSA 3D7MA 5DI3A 2PX0A 4EJSA 1D2NA 2HYDA 1NMYA 1KZGB 1QG4A 5KU1A 4M53A 3KKPA 4C2TA 2WPDA 5DE3A 1ZD1A 1NMXA 5JBQA 2R6FA 1II9A 3FE2A 1IHUA 4JLKA 4XSGA 4DLRA 4CEHB 4PPNA 2F6RA 1XCMA 2F55A 2CK3A 2FFAA 2RGAA 4FXPA 3GJ8A 4ZCIA 3W6NA 2FFQA 2Z4RA 3K9NA 5A5GA 4ASUA 3SQXA 1E2LA 1ONBA 1XXHA 2Q9BA 4V0MA 4YXWA 1AZSC 4US1R 1XJ0A 3ZIAD 1N6PA 3K9LA 2WJYA 1TU3A 3KJGA 3H4MA 1M7HA 4PC6A 3AH8A 4KODA 4O2RA 3C4JA 2IYLD 5EE0A 3R7WA 1RRFA 1IJEA 3RRNA 3ZQ6A 1OH5A 4YC7A 4JBXA 4UXJA 3VMFA 2GRJA 3THOA 4NYMQ 4QNRA 4PAOA 2CHQA 1BIFA 3I5YA 4FWTA 2PX3A 2AL7A 1PLKA 2YOHA 3DM5A 3F0TA 5EE1A 3RC8A 3TAHA 4GP7A 2JJ1A 2PZEA 2C99A 2WWWA 2WWFA 3E1SA 1HUQA 3ADDA 3JZAA 2BJWA 3OESA 3N70A 3ZDQA 4CT4B 2QBYB 1A1VA 3OE7A 2BV3A 3TW4A 2ZIAA 2B92A 3D6TB 1F5NA 2VHJA 2VHCA 3B5JA 4QOSA 4US0R 3QUSA 1KHTA 5IK2A 4XVQA 4DCVA 1EFHA 1IAQA 2QN6A 2JJ1D 4DB4A 1G8FA 5FBLB 3EWAA 4HLCA 5EXSA 2GCOB 3QPWA 2CCKA 4HUQA 1R5NA 1ZP6A 2F1IA 2J46A 2R62A 4OK6A 1AA9A 4OI0A 3RC3A 1R8QA 2J5XA 4LC1A 4YDHB 1YE8A 1VIAA 4MYUA 5KYKA 1JR3A 2V9PA 1CR2A 4US2R 2VRWA 3O8BA 4XVRA 3WYFA 2XEXA 4HAUA 3FFBA 4II7A 2A30A 2D3WA 2ZYUX 4HLDA 4BWYA 1R4AA 2JAQA 4NCNA 2OFWA 4LBYA 3SR0A 1HA3A 1JAIA 1M8PA 1NBME 1G8HA 5H1YA 5H8WA 2ZAOA 3Q5EA 2O8CB 3BB1A 4MKIA 1DAMA 2IS4A 1MV5A 2AWOA 2H17A 1U81A 1Z83A 2LWIA 1HURA 3B9PA 3A4LA 3DOFA 4MRRA 2XZOA 4YMVA 3GP8A 2JLZA 1OH6A 2GAOA 4ZCMA 1E98A 2FSFA 4NYJR 5DLQC 2IL1A 2C8VA 3G82C 1MOZA 1YQTA 5JJIA 2C5LA 3HU2A 4N3NA 2G1JA 2HJVA 4NPHA 3RRYA 2FEMA 4F4IA 1TQ4A 1E2FA 5BW8A 4IOKA 2PJZA 3WHKA 5FFMA 4V02A 1XF9A 1ZD8A 2N42A 2ZE6A 4D0NA 3FYHA 5CIWA 5AK0A 2ZI3A 3Q5DA 1P2UA 4D80A 4DCNA 1RJ9A 2ZUCA 4XJXA 4M9XA 5KSPA 4XTCS 3GCGA 2DYKA 2ZYWX 1RW4A 3WRXC 4A2WA 4HDOB 2ZI5A 5FPTA 1OKKD 2GILA 3DEFA 1NVWQ 5H68A 3K70B 3GJ6A 521PA 4C0HA 3R9WA 1AM4D 4XVUA 3D3QA 3HR8A 2DCUA 1N5KA 4TTPA 3EC1A 4V0ME 5K8UA 3W6PA 2NZ8A 3OIVA 2YWHA 4UNRA 4AG5A 3PEYA 1DS6A 1KGDA 4EPVA 4BRWA 1T8TA 4RZ3A 2PEZA 1QHGA 3R8FA 2O8FA 1QHNA 3UWKA 4DLVA 3KJHA 4QGGA 4JBWA 4LX0A 3T34A 5DN6D 4QFMA 1DVRA 1QRAA 1KK1A 2D74A 1RPZA 5GVRA 1IN6A 1ZINA 3QKSB 4M1KA 3A1UA 1GKIA 4DSUA 3AP3A 3LY5A 2ZJ8A 4U00A 1Q1ZA 2A9KA 2XX3A 5EP4A 3SFVA 4C0BA 4C3ZA 1D9XA 3MD0A 1H8ED 2OCBA 3ZJYA 3BC1A 2OAP1 3P4YA 1JQJC 1R0XA 1OH8A 1R7RA 4TMTA 3MWYW 1HTWA 2CLSA 1G7SA 1AS2A 3HR7A 4HB0A 3A58B 8OHMA 1HH4A 3GJ5A 1KI8A 3RSOA 3ECCA 3GJ0A 4PAQA 5FH9A 1MRSA 1PLLA 4U02A 1W36C 2O5VA 3SJAA 2A78A 3QXJA 4M9SA 3BE4A 2J7PA 2QU8A 4IJMA 3W34A 2AKYA 2VP0A 1VTKA 1H65A 2FZLA 4R2HA 1CF4A 3GEHA 4YXWD 2HF9A 4CYMA 4UJ3A 4M9ZA 4C7OA 3K9HA 5DH9A 3OHMA 4W7SA 4QBIA 3KFXA 4Q1AA 5AUQA 1J7KA 1DARA 2ZRMA 4ACBA 2PT7A 4JBYA 1Z07A 1YHNA 2PJRA 4JLMA 1A2BA 1S4QA 3NBYC 3EARA 4LPSA 1ZNXA 2D62A 1D9ZA 4RFVA 1W0JD 5CM8B 3KQUA 1WMSA 2J3EA 4D81A 4DCUA 4FMDF 1T91A 1GL6A 3E5HA 4ZV4A 3AVOA 5L3VA 1F2TA 4Q4HA 4MKFA 4RKEA 2FA9A 4URZR 3WRYC 4G5QA 621PA 3BXZA 3C15C 4P4SB 5KNDA 2OCYC 4WIAA 3TR0A 4M1TA 4F92B 3R9XA 4KFSA 4ESHA 3B60A 1YR8A 1J2JA 1N6NA 4FCVA 4NBSA 5DI9A 2BIFA 2YZ2A 3L2OB 3LV8A 4BEJA 3FOZA 1GRNA 4KHZA 1CKEA 3TJZA 3I92A 1TQ2A 3L8ZA 2F7SA 4UXHA 4P0TA 5B64A 4A8JB 3AM1A 1II0A 1KO4A 1Z0JA 3KL4A 3FWYA 2OSBA 1D2MA 3PUXA 2ZYVX 4ARZB 2AHOA 2AN9A 2FWRA 5HE8A 2ZJZA 2YYZA 4NKRA 4BPBA 1CS4C 4G01B 5GJBA 4NHOA 2QPAA 2O0JA 5LDDC 2ANBA 3X1XA 4A82A 2IHBA 4DEXA 1T8UA 1UKYA 2CJWB 1EWRA 1M1YE 1G8PA 3CRQA 5J4VA 5JWRA 3T1TA 4UNNA 4C0AC 4LYFA 4BLOA 4QC2A 2AK3A 3L0PA 4PO1A 2HUPA 2DR3A 4F93B 3U4QA 1EXMA 1G9XA 3B78A 1NG9A 3CX8A 1JXOA 2QQ0A 3GEEA 4QBFA 1H8HD 5TARA 4PC1A 3S1AB 3BB3A 3BAFA 1E2QA 2ZS7A 2G88A 3WY9A 2EWVA 2A5YB 3OAAA 2ZUDA 3FKSD 2AD1A 3U3MA 4TT3A 3CWZA 3M6AA 4MGKR 4PPQA 3TBKA 4DCSA 2G0NA 1Y3AA 2L0XA 4JMPA 1PZNA 4Q01A 1G6OA 4LBVA 2H18A 4JLVA 3AGQA 2VO1A 1R0YA 2ZRCA 2IYQA 4BLTA 2J87A 1GKUB 3LBNA 3MWKA 3EPLA 1CXZA 1MRNA 2QRZA 2BVNA 3ZYCA 1JXMA 5EE9A 1OFIA 3LAWA 1NF3A 4D25A 3DZ8A 4OI4A 1LB1B 1XB2A 2ZPTX 1XTJA 4ZKDA 2DWPA 2BHRA 1UJ2A 2JIZD 4MYHA 4NYMR 5J4YA 3PUVA 4DLTA 2UZIR 2ZR9A 4M0LA 1F2UA 2JLUA 1W2HA 2JLWA 3W5IA 3HDTA 4KBGA 1SKQA 4IDPA 1BO6A 3VNVA 5DGXA 1SVOA 2ZRPA 1EFCA 4X8MA 2WJJA 4A0FA 5GJWC 1ZM9A 2WOOA 1KNXA 2BBWA 4Q66C 2I1VB 1W5SA 1KI4A 1P61B 5JHHB 2GHIA 2VPPA 4A0HA 1NI3A 5D3MB 1OT3A 4EPRA 3P27A 5F98A 5ELXA 2B6HA 5AJYA 4BRUA 2RKOA 4GI7A 4TQUS 3SJZA 3RS0A 2CCJA 5J4HA 5GADl 4BZQA 4L16A 3Q8XB 2PL3A 2V4ZA 3PXGA 1IN5A 1F48A 2OHFA 1H8EA 4IOLA 2P6RA 2C98A 2DY1A 3ZGXA 2IT1A 2H57A 2F1JA 1XX6A 4JKIA 3ONWA 4EDHA 1SVKA 3A36A 3QKTA 4L8GA 1W47A 4PFSA 3QKRB 4C4PA 5LBIA 1CJTC 4OHYA 3DO6A 5L8VA 1WDTA 1CLUA 2D2FA 3IIKA 2PT5A 2J59A 3NH9A 4V0KA 4G5SA 1F6BA 3H86A 2OO7A 3D31A 1N6IA 3KJIA 3BD9A 5SZIA 3IBGA 2QPOA 3NC0C 3F8TA 4NU0A 2FN4A 5G40A 421PA 2XXAB 2ANCA 2PLRA 5FTJA 1IONA 2RGCA 2XJ4A 3T1VA 1ZM7A 5HKKA 3SQWA 3EZ7A 2BCJQ 1SVIA 2BM1A 2N46A 5KOYA 2BMJA 2V6JA 3NDPA 4RZ2A 2HV8A 5C2JB 1FTNA 5KTYA 5GJVC 1Q3HA 4AK9A 4XWAA 3ZQJA 3QF7A 4JJKA 5BQ5A 2Q9CA 2KBFA 1M34E 4XWKA 1JJ7A 2G9NA 5JEDA 4DRZA 3LW8A 3IEUA 4BUJA 1XP8A 3CM0A 1G5RA 3P4XA 4RVCA 3JVUA 4XSHA 1W2GA 3GLIB 5JCZA 1LNZA 1OB5A 1TNDA 1QHXA 3KJEA 1FUUA 4E03A 2BOVA 4KJZA 1ZBDA 2ZJ5A 5AJZA 3SYKA 1NBMD 3KXIA 5BWMA 1XMSA 1P7CA 2CK3D 4JLBA 5EJEA 4TYYA 1OXXK 3DMNA 1MKYA 1G41A 1R10A 2O8EA 1FW6A 4LJ4A 1XDBA 1YZTA 2VIIA 1FZQA 1Z0AA 4JKYA 1CR4A 1J90A 1O87A 3ADCA 3ZVMA 1JPNA 1JR3E 4NCKA 4RKFA 2QUZA 3MJHA 4Q9LA 1FQJA 4BLQA 4NCJA 3W3ZB 3THYA 2VP4A 1KMHB 2RHMA 4JT4A 4HUTA 2DFLA 1OYWA 1ZMXA 2JDIA 2VTKA 4TQAA 5ANRB 4BQSA 3TNFA 2EFCB 1XNJA 1N6OA 3A37A 2ZRFA 2AX4A 1XZPA 5C4MA 3MLEA 3HU1A 3K09C 2ZEJA 4B43A 2YKGA 1KDOA 4FI3C 2YVUA 5FBVB 3B82A 4OYHA 4PSKA 1SQ5A 2R6CA 2CE7A 1HY3A 1OSNA 2XNSA 2ZROA 2BJVA 4Q9KA 3LRPA 2WJHA 5FTNA 4AY2A 1GAJA 2WV9A 3HP1A 4BFUA 1KTVA 1XEWY 5G3YA 2AK2A 2VSFA 2JJ2A 2BKUA 1W4AA 3VKHA 2J0SA 4YLGA 1FNMA 1LW7A 2ZXUA 3AKDA 1YR9A 2O8FB 1E1QA 1EFUA 3ZVLA 4PC2A 5FL7A 1SVSA 2KJQA 2ZETA 5FI0B 5JSZB 1XTKA 4KLZA 2GJ9A 3DOEA 2RGGA 4RD0A 2QE7D 3REFA 4CEHA 2MSCB 2ZRIA 4C0JA 1J99A 3B9QA 2B8WA 2OLJA 3FKSA 5FOTA 2QAGB 2OUKA 4IDOA 2W6ID 2FF7A 2VSOA 1FFHA 2I1QA 3WBKA 2CMKA 4GFDA 4M1SA 3U3OA 5CDFE 4TYNA 2ASEA 4RD3A 4TLBA 4LJ9A 4B3CA 4DKXA 1Q1EA 4URUR 2ATXA 2GETA 1CR0A 2OFOA 3BH7A 3BFXA 4QL3A 4TMZA 2DFTA 2GVDC 1VDZA 1XEFA 3IHLA 1JBKA 5CLLA 2QPTA 2Q6TA 2JLVA 4HZIA 2NPIA 2Q0HA 3VR4A 1BMFD 3T35A 3SU8A 4Q4AB 2IYSA 2R6DA 1CULC 4O2LA 3GLFA 1M74A 1E1RA 1G8YA 1E0JA 2HYIC 5F3WB 2FGJA 1UKVY 2RGDA 1Z6AA 2IYVA 4A6PA 4AURA 2AXPA 4H1VA 1XWIA 2F43B 2QROA 3UKDA 1SXJC 2V8OA 2GBLA 4Q7MB 3NBXX 1SXJE 4A8JC 3QXCA 2ZM5A 5IHPA 5JRJA 1MO6A 4V0NA 1I4TD 4IVQA 4FD2A 4DIDA 4NMMA 2ZYTX 3LVQE 5LD2C 2BEKA 3KQLA 3RRZA 4JLJA 1VCMA 2W0MA 2FEOA 4M1OA 4I4LA 3MRSA 4B71A 1ETUA 1TF2A 1ODFA 4OJQA 1ZU5A 3VHXA 1KK2A 1DAFA 3LXXA 4IEEA 4FCWA 1OH7A 2GK6A 2MSDB 1E9CA 1BYIA 1Z6YA 1G3IA 3K70D 1A2KC 2QP4A 5E95A 2C9YA 2VP5A 3W90A 2XGJA 1AQYA 2ZSBA 2C04A 3AKYA 3Q7PA 3QOFA 3ND8A 5DI3B 4TLAA 3K70C 3QE0A 2CL6X 4K81B 3TAUA 4JL6A 1GNRA 3QKUA 1ZM4A 1Q22A 1UKEA 2XTZA 4W5HA 4BFYA 2F9LA 2R65A 2QMUA 2QG6A 2OXRA 2QP3A 2H16A 3ADKA 4E09A 1LS1A 3A4NA 1GOTA 4L9SA 4C0KA 2Q3FA 3QKSA 2BEJA 2QMHA 4ON9A 3RS5A 4LHXA 2YWGA 1LF5A 1GL7A 5FPSA 3AVUA 1ELOA 4MA4A 1T3LA 3TRFA 5KO2A 1E79A 1ZM2A 1E9SA 4B34A 1S1CA 1Z8FA 1N0WA 4JVLA 2GXQA 1QG2A 4U5XA 3UATA 2W6IA 2HCJB 3QBVA 3B1VA 2WKRA 4QGFA 3BRWD 2FFBA 1Z2CA 4ERNA 1ESMA 4JT2A 1YVDA 1TUEA 3R7WB 4PQFA 1CBUA 4UNQA 1UM8A 1E0SA 3HJNA 1E96A 4M1MA 4Z1MA 2OCPA 2F1HA 4CEJB 4Q9IA 1NN5A 2VL7A 2SHKA 3Q3JB 4GT1A 1T5LA 1G16A 1QVRA 1ZNWA 2J1LA 3BS4A 2CVFA 4KLNA 4QBGB 2VP9A 3RS2A 1WB9A 1JEDA 4W9MC 1CJUC 1VKJA 3CW2A 4OI1A 2FOLA 2FPLA 2ZAMA 4TMXA 5J4LA 2B7BA 5F2EA 1NMZA 1BMFA 4PHGA 5JI3E 3QIAA 2QMOA 5DSZA 3ZIAA 2BMDA 4ARZA 3BFVA 2HEIA 1UBGA 4LRWA 4Q47A 1KJYA 3P20A 1W7AA 1XMVA 2W2VA 3PV0A 4ZO4A 3K1JA 1G5TA 4DLYA 2Q21A 3I3SR 4B6EA 3EX7C 4RSGA 3QG1A 3WHLA 4QHSA 1G6HA 4QGAA 4NTZA 5E4FA 5CLQA 2LKDA 1A7JA 2AFIE 4LZZA 3K0CA 2XSZD 3AUXA 3U5ZB 3TQCA 3RS7A 2X19A 4CW7A 1FP7A 2O8DB 3LX8A 2GZHA 2GJKA 1G3QA 2XZPA 1KSJA 1M2OB 3AKEA 1DG1G 3GJ7A 4HAZA 4CT5A 4C30A 4HUQB 4Z8YA 4P3YA 3AF4A 1GVNB 3DPUA 1OXSC 1F2TB 2MMGA 4I1UA 4Q4HB 1KO8A 5FI1B 1IXRC 2YNMA 1EFRD 3RS3A 1JB1A 4JIMA 1KI6B 3UIEA 2NO7A 3GLIE 1EWQA 2EW1A 3GLHE 3I72A 3THWA 2ZE8A 2FV8A 2TMKA 4GMXA 4ACAA 1P75A 3EPHA 2R9VA 3QQ5A 4C9BA 1G7RA 3VAAA 2R6AA 4A15A 5F9FA 4V0LA 2C9CA 3GQBA 2GCPA 2J0UB 5JI2E 2QMEA 2ODEA 3UG7A 4HLQB 3WNCA 1B0UA 3HPQA 3MWLA 3GLHA 4PHHA 3R9IA 1WA5A 4YMTA 4Y0VA 2NTYC 4OK3A 3ZZ0A 5B57C 4ZDKA 5AWFC 2REOA 2DWOA 5TB5A 1NY6A 4IVPA 3GJXC 1LFDB 1WXQA 3FFAA 2EYQA 5KPJA 2IF0A 3N2IA 3WYAA 4A6XA 1RE0A 4TL7A 2OE2A 4WZBE 3CR8A 2PLFA 1DAGA 1HT2E 4JL8A 1BH2A 1K5DA 2ZS8A 5FOVA 1R5OA 5DHAA 4KO8A 4NCIA 3TH5A 1OFUX 3MFYA 1AN0A 2IXGA 2XB4A 4KBFA 2F3TA 3MWJA 4BFTA 4QBHA 2CNWA 3QG5A 3S1AA 2WSSD 5G53C 2OXCA 2Z43A 3T1QA 5DYGA 1SKYB 5CITA 1Q1BA 1G3RA 2P65A 3GJ4A 5D3MA 4RJLA 4EJSC 3ZVNA 3NBZC 4MKGA 4A0RA 3P26A 2XZLA 1Z29A 2QE7A 2A7QA 3BWDD 1YR7A 4Q21A 3T5GA 4BE7B 1Z28A 1NN0A 4R2IA 4MGZR 1RFLA 1CJMA 2VHQA 3KTAA 2BKEA 3I8SA 2JATA 2D4HA 1C4OA 4KI0A 4LJ8A 4V03A 1AK2A 1XEXB 3K0AB 1U8AA 3AKCA 2IUTA 1XXHB 2W00A 4FINA 4AKIA 5C1BA 1YU9A 1NVVR 4LI0A 1R0WA 4XIGS 3AGPA 3RLFA 4PPFA 1U98A 1Z0FA 4MYTA 4G1UC 3E70C 3GJ3A 2R44A 2CBZA 2VBCA 4AD8A 4OQLA 3ZD6A 2NGRA 1Z5ZA 3TE6A 1JR6A 4O25A 1TADA 1W4BA 2ZU6A 3CPJB 4MQBA 3F3YA 1DELA 2QSYA 4Q1BA 3X1DA 5G41A 4OQNA 1DO2A 4B3FX 4L9WA 1QDEA 4HLUA 3B13B 2A5JA 1NSTA 1DAIA 1WBDA 5E7MA 1G20E 1X1RA 2W0SA 1ZUNB 3EAQA 3MUFA 3SNHA 3L43A 2O8EB 1X1SA 5KNBA 4KFUA 2CLCX 1SHZA 2FE4A 2P2LA 3KB1A 2BMFA 4BLPA 1GSIA 2IXFA 3T12A 3EG5A 2P0EA 3DDCA 2R2AA 3CRMA 4DDUA 4LCBA 2NQ2C 1KK0A 1VG9B 4TLCA 3N2EA 5DISB 1TEVA 1E0KA 2QRNA 5GJCA 1E9RA 4JLNA 1L8QA 1KYIA 1P4SA 3QI2A 3U7FB 3C5CA 5FTMA 2ZRGA 1KZ7B 5AJWA 3D8BA 1UAAA 1AGRA 1GZSA 2GJSA 4IXNA 5FUWA 2ZITA 2XOKA 1P2TA 3C7KA 3AVVA 3LNCA 1E2IA 4JLAA 1MO3A 2WAYA 1COWA 1UDWA 4HB2A 2X77A 1SVMA 3MGCA 3HWSA 1KJZA 2FFHA 4DT1B 5L3SB 4JVNA 1EK0A 2ZE7A 3IQWA 4NDZA 3BBPA 1RRPA 3BH6A 1G4UR 5DHFA 1KO5A 3IGFA 3U44A 2DBYA 2B7CA 3LA6A 3U6KA 3EA5A 4IOJA 3KKOA 3GLGA 5FOWA 2OESA 1T0HB 5BYJA 4FMCF 2GTPA 4I1VA 2WVJA 1VYVA 2ZJAA 2E9SA 3TSOA 3CZPA 3B1ZA 3WXMA 3LWNA 4S2EA 5B58C 2ZR0A 1VG1A 3GFOA 4LHZA 1R0ZA 1HYQA 2VP6A 1E94E 1QHHA 1EFTA 3M0EA 2AKAB 1A82A 2QQEA 2XNDD 3GLFE 3DL0A 4DSTA 1FX0A 3HU3A 1P9WA 5HKKD 1L4UA 3CF0A 4OHVA 3NC1C 3SYNA 2WMOB 1DPFA 2FSHA 1JALA 2KE5A 5JWOA 3CLVA 4GBMA 1DTSA 1C9KA 2V6IA 3BK7A 3WBJA 1EX6A 5HTKA 5DIFA 4EPYA 1Z0DA 1GNQA 2OG2A 2WM9B 4A8JA 5JSZA 1OW3B 1VCOA 3SHFA 4PC7A 4A2QA 4D2IA 3ZS9A 1D6JA 3AP1A 4DEYA 1ZUHA 2HXYA 4BEBA 2GAAA 4UKDA 1K8RA 2UZ3A 4Z8XA 2D2EA 1G291 2RMKA 3K0CC 1RJ9B 2UKDA 4KYIB 3VX4A 5J47A 4YMSA 4XWOA 1KMHA 1AQUA 3AV0B 2CJWA 4H1UA 1KSFX 3IILA 2R8RA 1FQKA 4D4MA 5KDOA 1KI2A 3TMKA 1KIMA 2GJAA 3TGPA 4MRSA 1F60A 1S2MA 2IXEA 1OJLA 1G64A 4GDFA 2ZTSA 3MSXA 1G1MA 2ORVA 3A1VA 1YKSA 2ZRNA 3EC2A 2WWYA 3IEVA 2WPDD 4I81A 4KV9A 2ZQ5A 2MSEB 3GEIA 4HZUB 1JECA 1X8KA 3RVBA 3RYTC 1GIAA 4LHYA 4RD6A 4CF7A 3PUZA 2IYTA 2ZJOA 1OIWA 1VCNA 3KKQA 5FUXA 5E7IA 1S9HA 4LJ5A 4EPXA 3V4RA 2ZRJA 3CPEA 1E1QD 3SS8A 2NO0A 3A1SA 2RHDA 5KSOA 4HAVA 4JVMA 2AR7A 2CE2X 2V1UA 4G3XA 3FHTA 1Q12A 5EQTA 4B74A 2QGZA 1XMJA 2GBLC 5HCNA 2QEQA 1NNEA 2P67A 3UMFA 5CIQA 5JLJA 3LLMA 3T1OA 2ORWA 4PAMA 4PQRA 3SEAA 4A1FA 1II8A 2ZRKA 1XTQA 3T06B 4LJAA 4B76A 4LYJA 2XB2A 2G0TA 4PHTA 4R7ZA 2PZGA 2GESA 2J7PD 2GF0A 1W46A 3PVSA 3FMIA 2ZS9A 4TWZA 4A36A 2R6GA 1KMQA 4G5RA 1IN8A 1DBSA 4UNSA 1OHHD 3TVDA 5AJXA 2HT6A 2WIBA 3BB4A 4DWJA 3ZD7A 3H1TA 1S3GA 1V5WA 3A1TA 4EPWA 4D0LB 4LDJA 1TAGA 2XSZA 3K0FA 2WBLC 3QENA 4NZYA 4LYAA 5CYPA 2NO6A 1KSHA 2FMXA 5JWHA 1P5ZB 1HV8A 5JCPA 1NJFA 4YQFA 3PR1A 1TU4A 3SOPA 4BECA 4E5UA 3I61A 1WBBA 4AYTA 1I4LD 4R9UC 5KSZA 1KDRA 4EFNA 3C14C 1CR1A 4LV6A 3VTKA 3WYGA 3B7GA 4NP6A 2D7DA 221PA 4MGIR 1NIPA 3CNNA 5AUOB 4IFBA 5EZ5A 5GVSA 4MUBA 4QKQA 2C95A 5FOXA 3SHWA 1FMJA 2BCGY 2DFNA 3KDSE 4C0LA 4PO8A 1CU1A 1R2QA 2IUSA 2H1LA 4DLSA 1D5CA 1B23P 1W0KD 1TQ6A 1GILA 1P60A 5TXGA 2W6JA 4B3BA 3AQ4A 1R8SA 4JLOA 4Q18A 5L3QB 3CX6A 1E2GA 4B47A 1U2RA 4B73A 4K8OA 1TUIA 4RZXA 4WZAE 4BGDA 2QP9X 3EASA 4NL4H 2BC9A 3TKLA 4POAA 1TEXA 1UF9A 4ZDWA 3X1YA 1NP6A 1OLOA 4XOIA 2WMNB 4IKEA 5HE9A 2C77A 4CDGA 4TYWA 3DHWC 4Q4LA 5L3RA 3LBIA 3ND9A 3KXKA 3QBTA 2GZDA 4TTRA 2HDNB 1XD2B 3EZFA 2YC2C 2REBA 1FNNA 1LF0A 2G3YA 2JLQA 4WZ6A 1UFQA 4AKGA 2IK8A 3SYLA 1WCV1 2GEDA 1JNYA 1JR3D 3SJCA 5TMPA 5TDHA 2WWHA 1Z0IA 4G5OA 2V7QD 4HYYA 1W4CA 1KI6A 3OEHA 4GZMA 3OZXA 4KCGA 3VHLB 1RYFA 1OFHA 5AJVB 1T4GA 5F9HA 1PUIA 1S9DA 5IDVA 1JEEA 2RGNC 3KQKA 4QJ3A 4M21A 1RRCA 4LK2A 4FCTA 1Q3TA 2OCAA 4IOMA 4Q1FA 3E2IA 4TLDA 3L0OA 5B30A 4LWZA 4MRNA 5AUNB 1ZNZA 2F43A 3GD7A 3WMGA 4PC3A 3K09A 1IOZA 3VR6A 2J0VA 4JVSB 1E2NA 1CIPA 1OE0A 3O47A 4AYWA 1GP2A 4PZZA 1IN4A 5E7JA 5CDFA 3IIJA 1TX4B 3GLHB 3RWMB 2CXXA 3I32A 4ZIRA 3U61B 1Q21A 4DDVA 5FOUA 4TMKA 4B3GA 5EUQB 4C0SA 1DO0A 4XD7A 2VEDA 4O3MA 1VYUA 2ZVQX 3P1JA 2BMEA 4KU4A 2G83A 1YZLA 3QXHA 3LD9A 4MDEA 3DKVA 3KB2A 3VR3A 1PJRA 1IXSB 2C03A 2YHSA 1E79D 4Q7LA 3RNLA 3AF3A 3IPYA 2V54A 3CKLA 3SBDA 2JLSA 4BLSA 2IF2A 1XBTA 2JLRA 1YZKA 4KVAA 4JZKA 1P9NA 3EIHA 4IEIA 4AIIA 5JZVA 4JLDA 3ADBA 3OIWA 3I4LA 3Q72A 5FBWB 5SZHB 1XD9A 5CJPA 3ZZUA 1P6XA 3UK6A 4PSVA 1OXTA 2FG5A 4Z1MD 3TSZA 3THXB 3K0AA 1I4DD 1R5BA 3U3RA 4E07A 3I62A 2GJ8A 2V1XA 1T3HA 1YZQA 4GSYA 4QHYA 3EPKA 3PUYA 3CBQA 5J4KA 2LKCA 2WWIA 2CEAA 2ERXA 5DN6A 4C0QC 3VKGA 4TMVA 1U8YA 3EIEA 2VLIA 1L7VC 3DM9B 4ESVA 3CWQA 2C96A 3SDZA 2GZAA 1N6RA 1Z0KA 3BERA 3BOSA 4OK5A 3RANA 4DDWA 1KY3A 4M1YA 4B2PA 2W2XA 4Q9JA 1LY1A 3LLUA 2YWEA 5UKDA 4DC9A 4TL8A 1NBMA 4FMCB 1GDDA 2GEVA 1YRBA 1UBEA 1I2MA 2BBOA 2HLDD 3U7EB 3WP1B 1XPUA 2NO1A 2EFDB 1P2VA 4OQXA 2CLDX 2DB3A 4KITB 3X1WA 1LTQA 2KB0A 5KHOC 3U44B 3WNBA 2W83A 4AKEA 3UMRA 2IC5A 2P5SA 1E2HA 3RWOA 2ZUBA 121PA 1ZJ6A 1ZVQA 2O8DA 1NKTA 1ZNYA 2HXSA 1KDPA 1W1WA 4WAUA 1IY2A 2BDTA 1ZIOA 4K46A 1XEXA 2VHUA 4LHVA 5M04A 2QT1A 4UQOA 2B21A 4RY2A 3AVQA 1CJKC 4PHFA 1G3MA 2J7KA 3OF5A 4MRPA 4Q48A 4TMWA 4DLZA 3JZMA 4LC0A 5LB4A 1YZGA 3Q9LA 3R20A 4JL5A 3U3KA 3C41J 721PA 3ASYA 2OBMA 4NH0A 2QAJA 1E4YA 2RGXA 4OKSA 5BN5A 4MDFA 1KK3A 2OM2A 2E1RA 5TY0A 4H9GA 1W44A 3TLXA 1X3SA 1SKYE 5FUYA 4AKHA 4GOJA 3W3AA 4FMBB 1EGAA 1U90A 1EESA 5HR5A 5TVKA 4UXIA 1W0KA 3V00A 2FSIA 1HE1C 4YMWA 4LV8B 5KPDA 5FL3A 3NHAA 4OL0A 2JDID 4PPGA 1MH1A 2XITA 3RABA 1NVXQ 4OQMA 2E87A 3CPHA 4MH0R 1ZD9A 3U3JA 3Q7QA 4AG6A 4RCYA 5D3QA 2EFEB 4RD2A 4LJYA 1UEIA 2RAPA 5J40A 3IPXA 2I3BA 4LGMA 1XD2A 4PZLA 4F4CA 4D82A 3NG1A 4U7DA 1DADA 1FX0B 4GPTA 3LXRA 3U60B 1JQLB 1X6VA 2A5DA 4Q02A 3DVLA 4MRVA 3B8HA 2F9MA 1OXUA 1G8GA 2DWQA 3AF1A 4PQYA 1Z06A 3V9PA 5DO9A 1E2PA 1U9IC 2O8BA 3PEUA 1GG2A 2FJUA 1Q20A 5HCIA 4BFXA 1SVLA 1GWNA 4TZ0A 3KZ1E 2QGNA 1M7GA 1K6MA 4G5GA 4LYHA 2QT0A 5K8IA 1SXJD 3QY0A 5FL7D 5CK5A 3W8RA 4DBLC 3RSLA 2P5TB 4D0GA 3CIOA 2ZREA 4M2LA 2CNWD 1KY2A 2ZI4A 3MCAA 3CH4B 4PZYA 3TUJC 3OEED 4X8HA 4PTLA 3LO5A 1WQ1R 3QJYA 4B44A 5JFGA 1UBFA 3EZ9A 4HI0E 2K5UA 2CL7X 4P32A 1ZCAA 5FR2A 3X1ZA 2KI5A 2QAGA 4F7WA 2GF9A 3DZDA 2EFGA 4B2LA 2WKQA 4KAXA 1MR3F 2HT1A 1SXJB 1WP9A 3H0KA 2ZJ2A 1E9EA 4B3XA 4BFWA 4HATA 4NE2A 4WOPA 4ZIRB 4ZI3A 1HT1E 1MABA 1XFAA 4CGZA 2OAQ1 3OEEA 2HCBA 3ZZTA 3L0IB 1UKZA 3HYRA 4DSOA 1QF9A 3OIUA 1E1RD 3W6OA 2WKPA 2ZR7A 2DFKB 2IYXA 4HLUC 2IWRA 3OIYA 2BBTA 4URVR 2EFHB 3NDBB 3GLFB 1LS6A 3AP2A 4CIDA 2IX3A 2QTVB 1T5IA 2HF8A 1IY1A 3FHCB 4G0NA 2J9RA 5BXQC 2XTNA 1W36D 2ZJBA 4LBWA 2XNDA 1E9DA 5C46F 3KKNA 3V4FA 3PJRA 1SGWA 2CVHA 2J0UA 1D8TA 2JIZA 4IFEA 2QZ4A 3AVYA 2P6UA 4ZKEA 4CZ2A 1E0AA 4ZCLA 4AC9A 3QEJA 3JVVA 3PUWA 2GNOA 3THXA 1NLYA 3NBFA 3NH6A 3I1FA 2YOGA 4Q03A 2QENA 1KKLA 4GZLA 4J0QA 4ZPXA 5EXPA 2BBSA 4N1AA 3TIFA 2OV2A 1VHTA 2XTMA 2I4IA 4TZ6A 3RDPA 1XRJA 1U0JA 1E9FA 1MT0A 2NIPA 1NL3A 4TSFA 1XXHE 2WIAA 2GKSA 1N0UA 2Q3MA 1HQCA 3MMPA 4FN5A 4HAWA 1KNQA 5KSYA 5H70A 3PG5A 3DMDA 3FKQA 3SBEA 4QJ5A 1IY0A 3K0EA 3P32A 4DT1A 5L3SA 4ILEA 3QVUA 1P2SA 3L82B 4Q00A 5TV2A 2FU5C 2J41A 4EFMA 1XU4A 1SHKA 3H84A 1G7TA 3U6BA 3VU9B 1S96A 2ZSAA 4EJSB 1PUJA 3RHFA 1DAEA 2GDJA 2PCJA 3OEHD 2HJGA 1I2DA 1TL7C 2IBMA 5EE3A 5C18A 1CRQA 1E3MA 1Z22A 1KOFA 2N1BA 5EXTA 4AWXA 1XTIA 2VYFA 3KUCA 3A1WA 2IEZA 2C78A 2IYZA 1KSGA 1AKEA 4NYJQ 2RGNA 1DG3A 1HQYE 3NHBA 1X8LA 2ERYA 4GOKA 3QPUA 5JEEA 2D06A 2WICA 1WE2A 4CEJA 1NG1A 1A5TA 1JJVA 1KAGA 1VECA 3SJBA 2RGEA 3IDQA 1N6KA 4AI6A 1DAHA 1S1MA 2FPKA 2H7VA 3T5DA 1DE0A 3FVQA 1U0HC 3K0SA 2CCGA 1W49A 1XZQA 4NYIQ 1NY5A 2KBEA 2JA1A 4IW3B 1AGPA 4B75A 2MMCA 2Z5FA 4L4UA 4DLWA 2IS1A 2RCNA 821PA 1NVUQ 3NXSA 3O8DA 2EQBA 2AD5A 1Q0UA 3CONA 4W5WA 2WZQA 2IW3A 2ORIA 4OHWA 2H5EA 4MGYR 4MYCA 5B2ZA 2EWWA 2IS2A 2UVQA 4BASA 2QTHA 5DYIA 4EPTA 1BKDR 4AYXA 2GA8A 2OFXA 3CX7A 1T6NA 4PR0A 1CEEA 4LHWA 2JLXA 2CL0X 4MKHA 1WF3A 3W9YA 3O8RA 4IDNA 4M8NE 4A0GA 3GLGB 5A4JA 5AR1A 5EZ6B 1ZM3A 3QXXA 5HPYB 5JRZA 4LJ6A 1RZ3A 3CR7A 4WBSA 1GRQA 3PQCA 2EVWX 1F3OA 5EXXA 3B2EA 2QM8A 1BOFA 1GM5A 1QHHB 1NIJA 2IHYA 2NOAA 4EQ6A 3TR5A 2ODWA 4Q5IA 2H8KA 2ZE5A 3VFDA 4NONA 4CEIB 3NEJA 4XTRA 4QNMA 5FBRB 5SZKB 1N0VC 2RH5A 4DSNA 2PEYA 2GVZC 4TLEA 2ZSFA 1AJEA 5FTKA 4IRUB 3THWB 3OE7D 2LCFA 2Z4SA 1YRAA 3CF6R 5C4GB 1G17A 1N25A 3ZS8A 1R6BX 5FBQB 3DKPA 5L3QA 3KUDA 1O3YA 4NYIR 1XJQA 1W4RA 4TTQA 2RGBA 3GMTA 3MAAC 4URYR 3U7HB 4RD4A 5FPYA 4OBEA 1M6NA 1II8B 1Z08A 1H8HA 2CHVA 2O0KA 3IQXA 4R98A 1UPTA 1P62B 4BZXA 1E2KA 4DHEA 2QORA 4FMDB 1DOAA 3T61A 1NLFA 2C9OA 4N0EA 4OI2A 4LSGA 4W5JA 4PXAA 3KX2A 4GP6A 1AKYA 2V7QA 4TT3D 3EXAA 3NWJA 1J8MF 4Q9HA 1XCPA 3IKJA 5LB2A 3TUIC 4ASUD 5FOSA 2GK7A 2FNAA 4QXAA 1Q57A 4BFSA 3LH5A 3FGNA 3Q85A 4B33A 1XJCA 1OHHA 4EFLA 1W48A 5JJLA 1SVWA 4TL9A 1RIFA 2AXNA 2G6BA 1EG7A 4KSBA 1IXZA 2VF8A 4HZUA 2OZEA 3PEWA 5JJKA 1FMLA 3BIFA 4MUAA 3ICQB 4BLRA 2IYWA 1N2CE 3KQNA 1PLJA 2ZSEA 2Q3HA 3B1XA 1AIPA 4M1WA 3WMEA 1Z3IX 3BORA 1NVVQ 3ICEA 1IBRA 3KTAB 2KWIA 2ZI9A 2QBYA 2WJVA 3CNOA 4M4SA 2W6JD 3F5FA 2OILA 3IBYA 1IN7A 2BWJA 3VKWA 1GUAA 1OIXA 1OIVA 5K8TA 3FHOA 2ZI7A 4XD7D 3A4MA 3IHWA 2NPFA 4XH9B 4B35A 2ZI6A 3SC3A 4EIWA 4QM7A 3I8XA 1A4RA 2PBRA 1Y63A 4KXFB 6Q21A 4QRHA 4TYQA 4LJ7A 1E9BA 2O0HA 4F38A 1OV4A 2JGNA 4Q4JA 1ZU4A 1KI9A 1OF1A 1QZXA 3R8CA 1U0LA 2XOKD 1HEIA 1EFRA 4RFSA 3VR1A 2C2HA 3BJIC 1XPOA 2FH5B 3CUEF 4ITRC 2VSXA 1NLZA 3EWSA 3RRMA 1ZAKA 3SE0A 4A92A 3QSYA 1G5PA 2AFHE 3FPAA 1JAHA 3KXLA 5DNYB 2WWXA 2A3RA 3HPRA 1NRJB 3A8TA 3EIQA 4WXPA 3WNDA 4M9QA 2VHTA 5CJ2A 1NSFA 4DLUA 5JS7A 2YINC 1MO4A 4Q1DA 5CB6A 4D4LA 1QHIA 3ZLJA 2JASA 1E32A 3BFKA 3REGA 4DZZA 1ANKA 3T15A 5KUTA 3LW7A 3TK1A 4RZUA 1N3BA 2GCNA 2ZRHA 3FDIA 1UDXA 5HZKA 2CDNA 4ZDIA 2ZRBA 3RS4A 1N5IA 3K9GA 1G3UA 1KI3A 2J45A 5CYOA 2JEOA 1CTQA 2ZRDA 4QGHA 4Z51A 5IRCD 2DPXA 1QHSA 3IO3A 1JI0A 2WJGA 1BS1A 4WXRA 4TSFD 3TW8B 3OAAD 4EKDA 1DAKA 2FPMA 2G77B 4YDSA 4OHZA 3FB4A 1VG8A 2A5GA 3CF2A 3KKMA 3VR2A 1RC8A 2Y8EA 2QL6A 3K0FB 2F3RA 2X2EA 2IUUA 3VQTA 3AF2A 3AVXA 2JLYA 4X8LA 3X2SA 4UNPA 2NG1A 4R71A 3HYTA 1XD8A 4WA7A 3QF4B 1K5GA 2AWNA 2H92A 1N6HA 3AUYA 4D4JA 4DCTA 4QM6A 4YMUA 2X8AA 1LV7A 2Z83A 3TQFA 3AVPA 2ODBA 3B1WA 2QM7A 5AUPB 2ONKA 2IEYA 4JLPA 2WTUA 4MITA 1VMAA 2PZFA 5JS8A 3FTQA 4HDCA 1N5LA 2EYUA 1ZIPA 1KDTA 4B6FA 1YR6A 3CB4A 2IYUA 2NMVA 4HB4A 3NVAA 4KFTA 1BYUA 3RAPR 2FX3A 2VP2A 1IJFA 1M7BA 4JJZA 5G3ZA 1FTSA 1GRRA 2PH1A 3QNUA 5KDDA 4PX9A 1X86B 3MJRA 2W2TA 4URXR 2FDCA 1OPXA 2QI9C 1L4YA 4HB3A 3WP0A 1KI7A 3ETLA 3PITA 2IYYA 2ODNA 1LVGA 1OYYA 2OBLA 4I99A 4LBZA 5K8LA 3C5HA 1Z2AA 1TTTA 1YJ5A 1U94A 4O0MA 1KAOA 1W0JA 4S35A 3AF0A 3B1YA 3IO5A 3LQQA 4KSCA 3AVWA 4TYPA 1NN3A 2JJ2D 2WWGA 3FMPB 4HAXA 4HEJA 3UPUA 3B6EA 3PCRB 2JCSA 4DXAA 3CRVA 1QVAA 1E69A 2FGKA 2XAUA 4DB2A 4DIEA 2YC4C 1SZPA 1E2JA 4PO9A 1MABB 4F91B 2V3CC 3J81k 1US8B 2GXAA 1D2EA 1IQPA 5JMTA 3ASZA 3EPJA 2A5FA 2F1RA 2QNRA 4HDQB 1Z47A 1RRGA 2ZANA 1TQDA 1YZNA 4JYCA 5EP3A 5J5CA 3PEVA 4HSEA 3C16C 1DEKA 1TMKA 3IIMA 3FMOB 4B48A 2YWFA 1F2UB 1OFTA 3I73A 2IS6A 4B2IA 4FWIB 4JS0A 4GL2A 1GFIA 3LX5A 1FOEB 2NZJA 1COWD 3QKRA 4IVRA 4WW0A 1ZC4A 3EA0A 3EW9A 2PMDA 2VH5R 3M1IA 4DLXA 5BYKA 5JECA 2WJIA 5KNCA 4IHQA 3MG9A 3VX3A 4ZI2A 4C2UA 1NN1A 5FTLA 4BFVA 4I1OA 2PCLA 3UANA 2REXB 4Q4AA 3EZ6A 4JSYA 4A2PA 2FSGA 1FPMA 1SULA 3C8UA 3AB3A 2ZSDA 4GOXA 4M22A 5IT5A 4L15A 1KKMA 2D7CA 1WRBA 4JYBA 3QVVA 4RCZA 3LVRE 3I5XA 2DHRA 2JJ8A 1U8ZA 2VA8A 2ZJYA 1MO5A 1KI1A 1N6LA 1RKBA 1E9AA 2WSSA 4KYUA 4I1SA 1SXJA 3NEYA 1C1YA 4EUNA 4IXMA 1QBKC 3KFVA 1UADA 3SFZA 1E99A 5FPKA 4YONB 1S3SA 5HZHA 2YJTD 3FMFA 3GLGE 3B85A 1W36B 2WHXA 1CP2A 2P3SA 3CH5A 3TUZC 4Q4JB 5EP2A 1TPZA 4LUCA 4Q7KA 4A9AA 2EU8A 4PSAA 4DDTA 5EUMA 2IA5A 3GLIA
chains in the Genus database with same CATH superfamily
4Q24A 2ZJ3A 3RRJA 1L4FA 4LZWA 4A0SA 1QCYA 1UXOA 4LDNA 5IKMA 4YV2A 1SZCA 1WCIA 4EHHA 1PK7A 1QK4A 4IDHA 2ZVPX 2G08A 2ZYAA 3MM4A 3NTUA 4XEHA 4ZOLF 3RFCA 3VNUA 1OV6A 3FYSA 2DUUA 3W9SA 1KRXA 2GA9A 1Q83A 3NKVA 3QWFA 1JDTA 1GZVA 1T5TA 3WIBA 1W2WB 4QG7A 1H2WA 5BV1A 3OFND 3IAM1 4EW1A 3HO1A 1DFGA 5CM9C 4X8OA 1TQ8A 4JWKA 4DANA 2I2XB 2GM4A 3L84A 1ZXLA 2HWWA 1BTOA 3DLPX 3GN2A 1NJSA 1Q1QA 3ZX4A 1U1CA 3RK1A 5A4FS 4RL4A 4K03A 2DHCA 4GU5A 5IK2D 3GEBA 1KJWA 1TM1E 2IHUA 2ZDHA 4Y0AA 2OT3B 4NMLA 4UJ5A 5BSEA 3KSAC 1Q17A 2IQIA 1VL8A 3PIIA 5FUVA 5C1PA 4HAYA 1U7WA 4NEQA 1GNPA 1KPGA 2CDBA 3CUUA 2VJMA 4H35A 4OP3A 1S8FA 3QE3A 3U7GA 2IHZA 3PX7A 3U4QB 4LCJA 4DA0A 1NW7A 3VISA 3MTIA 5BN4A 2XRMA 4F97A 3A6PC 3TZQA 2P77A 2PX2A 4RPJA 2ZTUA 4RH3A 4XDHA 3BKXA 2Y4NA 2ZRLA 4MMYB 4KVGA 3LT5A 5C32A 4CEIA 1W5TA 2BM0A 2A4MA 3H1PA 3MTAA 4RA9A 4NCHA 2FZ4A 4H59A 4HX2A 4WUTA 4V0QA 5I6DA 1VSQA 2D8MA 4C88A 1FP1D 1OTXA 3DW3X 5GOTA 2JZCA 3V8QA 2PY6A 1OY1A 1R6XA 3EVDA 3I2JA 4QT4A 5LBTA 2YOFA 1RACA 2DFPA 1O7JA 1FVFA 4I3GA 3THYB 2ZRAA 2Q6LA 2M98A 2GI4A 3IAXA 4MWBA 1K3TA 1ONOA 1ZK2A 1J2UA 4I9HA 3UG6A 4EAQA 1YFJA 1G98A 3M1YA 4KAJA 3A2KA 4YI3A 4DCCA 1MAWA 1P72A 4EELA 1HLFA 1T9HA 3EZ2A 3ITKA 4MS1A 4NBVA 1O5TA 2E0IA 4V3BA 2B9VA 3SI7A 3RKUA 1FJ2A 2MSWA 3R4CA 3L6EA 1E2MA 2R60A 3UMJA 4ADSG 2YFKA 4EW3A 3FR8A 3RUFA 1XMOB 4NCAA 4GRAA 3FYDA 1J09A 5F7JA 3CVYA 1UBTS 1GR1A 1UP6A 3JD0A 1FMFA 2MSNA 4NS4A 1YQ9A 3BXPA 2E49A 2QVLA 3RJMA 3G0GA 1ZW6A 3ANSA 1IMOA 1KY5A 3BE6A 1PDVA 5G2OA 5JC8A 1L3IA 4F4JA 2O52A 1KJJA 4DVGA 1QWSA 1CUSA 4FW9A 1XPRA 3D8HA 2FN3A 3OCXA 4ZVUA 4HT3B 1XRQA 3QBDA 5EPEA 4D4KA 4JI7B 1UFRA 4IYRA 5HHTA 3D6FA 1AS0A 3ZNQA 1MA3A 4WVFA 4BJ5A 3NJ4A 4UAJA 3AG5A 1TEZA 2VVTA 1T34A 3ZH9B 5EE5B 1F5SA 5DHQA 1VCIA 2C8JA 4P4UA 3CEMA 5MF6A 2UZ4A 1FDUA 1RADA 1AF4A 4UM7A 2L69A 4WINA 1E2DA 2G4CA 1ENYA 4IUCS 4JI5B 1V71A 1VIYA 1S3IA 1GZDA 4YRFA 3P0JA 3K9WA 3OHSX 4DGQA 4EENA 3GZNB 1B00A 4YPOA 1U63A 2AFHA 1AHNA 1T35A 3LFUA 2NU8B 1RWPA 4YJGB 5FPHA 1RWQA 5SZJA 1ZYUA 4FHDA 1A9XA 3HXTA 1RKVA 2ZRQA 4LDQA 5KDLA 3LUCA 3R6WA 4AX8A 2VTBB 2YZNA 4FE7A 4XPIB 2R7MA 2YZ7A 5P21A 5FR1A 2V0CA 3E3MA 3IYLW 3ND7A 3D2BA 4BQPA 5BPHA 4P7FA 1QMPA 3GPLA 5BPFA 5IXYA 2CD7A 1EFPA 3RVSA 4EUFA 1QNLA 4OJKA 1H0HA 2AZTA 3A32A 3GFPA 1L2TA 2HU7A 1M6VA 3MNFA 3PIRA 1C14A 2AN1A 4GX1A 4IG4A 1E4VA 1JPJA 4OB6A 3GO4A 1QG0A 5CK4A 1U31A 1USGA 4TN1A 3HEBA 1SUPA 4QJ4A 2QAGC 2BUBA 1HKUA 3OIFA 1NKSA 4UMFA 1GCUA 3MTBA 3ISVA 3ZUGA 5DI3A 2IZ0A 1KY4A 3R0ZA 4GICA 2OMEA 5JD3A 2HYDA 5KU1A 1KZGB 4YJHA 3ZNNA 4RQUA 1PHPA 3FVWA 1WXXA 1YQUA 1AHIA 1WW2A 3GWGA 5EJGA 1R18A 1A9RA 1IIBA 1KAEA 1IHUA 4DLRA 2PXXA 1OVMA 3E4DA 3E9MA 1ZK1A 1ISSA 2VC2B 3P52A 3UJPA 2ZWVA 1XCMA 3SJUA 4DCJA 2CK3A 3EQZA 2FFAA 3HBAA 2WE8A 4ZCIA 2KM1A 3W6NA 3LQ4A 3VPXA 1CETA 4ZGGA 4Y8VA 2RGWA 3K9NA 2QV0A 4H31A 4TS3A 5T41A 5DM0A 3SQXA 5IXSA 1AZSC 4G2NA 3TQSA 5TIIA 2P30A 2HRDA 2E4XA 4YAEA 2P9ZA 4YRPA 4CU5A 5D00A 5LZ2A 1Q3KA 3AU8A 4PC6A 3TECE 1MB2A 4Q6WA 1PEDA 4P7JA 4ROSA 1IJEA 3N2LA 4B4DA 3OZEA 3TTVA 4KXNA 5IKXA 4S0ZA 1JILA 2P3QA 2VJAA 2Q6KA 2GRJA 3QUTA 1C4KA 1CUGA 1SK8A 2ECPA 4JXKA 4NYMQ 3THOA 4L3WA 2CHQA 2IXTA 3I5YA 3PLRA 5EE1A 4MR7B 3CTPA 1OBVA 5F2KA 3V1MA 2OORC 3O5AA 4N01A 2JJ1A 4LDAA 4ID3A 2C99A 2I7VA 2WWWA 3FCAA 3L6BA 4RJIA 2AQHA 2BMWA 5CVVA 1GPNA 1Y9JA 1VJDA 2GT1A 1P7PA 4CM4B 2ATCA 2EATA 3N70A 2QBYB 5B3AA 1D0SA 3NM6B 4XM2A 5KNDD 2UDPA 1O58A 1KGSA 4ROTA 1F5NA 3DOJA 2GPBA 4XUDA 2FJ0A 4MQMA 4JI4B 3QUSA 2E85A 2VRNA 1VHDA 1XUOA 2CWWA 2I9PA 2NM0A 3JCZA 3V7FA 5GONA 1EFHA 2JPDA 1L7MA 2JJ1D 4DCVA 1G8FA 3IUQA 1JLHA 2EG9A 4BUZA 4JB3A 4DDMA 5LR6A 4AUMA 1OWNA 4X44A 3QEAZ 4CIXA 2R62A 2VDQB 4FWBA 1AQLA 4GRIA 1CEYA 2H48A 1AA9A 2XF2A 3LUKA 5C8YB 1A9ZA 1JQBA 3LK7A 3O2SB 4LC1A 2GBGA 1YE8A 3CISA 3HH8A 4RZSA 1TKRA 1NXPA 2EKDA 4LI3X 4MYUA 3HLYA 4PG6A 4YMGA 1J00A 3DKKA 5KYKA 2J5BA 4CKWB 1QP7A 4IKPA 1JR3A 2X42A 5HM8A 5E1BA 4HDMB 3ST7A 1QKJA 3WOVA 4A8PA 1C0PA 1CEXA 1QMGA 3FG9A 2YW9A 5HJ2A 3RIGA 2PL5A 4II7A 3CZCA 4GDMA 4JQYA 5JYBA 5TMPA 2ZYUX 4BWYA 4MLPA 3O4GA 1AC5A 4QTXA 5H8WA 1JAIA 4G1CA 3HDVA 2DH5A 3BB1A 3HCEA 4BCBA 3DD1A 4UTVA 1HTTA 2FW8A 3JAWB 3HWWA 4OQDA 4EH1A 3UV6A 1RPAA 2ATEA 2YXEA 5EZYB 2PRYA 2IFTA 4JBLA 1Z83A 2LWIA 3A1EA 3DOFA 4GX0A 1Z8HA 4QU9A 3GP8A 3JR3A 3Q41A 1M0SA 2VK4A 3UAGA 4B45A 4PNEA 3S8YA 1Z4NA 2BHTA 3M4JA 1ICEA 1E98A 4H7KA 4Q3DA 3WLTA 1WD7A 4CKEB 2AFIB 5I7SA 3I42A 4BIIA 3GPCA 4ZOBA 1WDKA 2C8VA 1NV9A 4QU5A 4BQOA 4F84A 4BRSA 1SUSA 1YQTA 3JU3A 4DR2B 3SF8B 2C5LA 4LJKA 1EM6A 2ID4A 4RLFA 1SOVA 3FSRA 2QRVB 2G1JA 5EXDA 2F4NA 2Y1FA 3NXKA 4HRYA 1P1BA 1TA9A 3G5MA 2IOFK 1TQ4A 2FHSA 2X0RA 3VDXA 1JYFA 5EMKA 1ZH8A 5F7OA 4PINA 1QIMA 2GJ4A 5JDCC 2X3YA 1PJZA 3NFRA 4CL3A 1NBWB 5GZ1A 2G9QA 1LX7A 1K6EA 4YP6A 4N4AA 3B1JA 4D80A 1H66A 1NYTA 3OBIA 1RJ9A 2GN4A 3TXYA 4GGOA 4WDRA 2J32A 2PWZA 7AT1A 2BGKA 2ZYWX 3WRXC 2FETA 3OJOA 3LGAA 3OTHA 1OKKD 3Q15C 2O2IA 3O3NB 2X0FA 1LK7A 4JBNA 4XUEA 5H68A 3BZWA 4YJ2B 3R9WA 5HYVA 1CFZA 1N5KA 1UXKA 2QXYA 3EC1A 2WKWA 4U63A 1MOSA 4V0ME 4WLNA 3OIVA 3UB2A 4KZPA 4AG5A 2A4KA 2HSEA 4UUAA 1K8XB 5A7GA 3UGTA 3TQIA 4BRWA 2PEZA 4EY5A 1VIMA 1QHGA 3P0EA 2OLEA 4TTSA 3TPZA 2NWQA 2XPCA 2YFHA 4CQMB 4IKOA 5KJCA 1YBMA 3E48A 1L5HA 4QFMA 3CR3C 1RPZA 2FY8A 1IN6A 5IASA 3D0KA 2YMMA 4BB0A 1J1UA 3EJWA 1NI4B 3WG9A 4M1KA 3RAFC 3LWBA 1E8DA 4IDDA 3PTZA 1PYDA 3W4KA 3T5TA 5K0FA 4LJLA 4ZJZA 4TV9A 3LY5A 1R27A 2Q3BA 1Q1ZA 2XX3A 3BL5A 1Z8DA 2X9GA 3MD0A 2XMPA 2Z2YA 3IXLA 4IP0A 1L5GB 1HFJA 4YRKA 1ZFNA 1R7RA 3HB1A 1GTRA 4EAAA 3MWYW 5C7OO 1HTWA 3B8EA 1G7SA 1SU8A 2PPLA 3HR7A 4FU0A 4RVSA 3EGIA 3EEIA 1KI8A 1XNHA 2P27A 3GJ0A 3RSOA 3ZJ5A 4PAQA 2COEA 2BF7A 2WZDA 4NU6A 4U02A 3TIVA 3FTCA 4MW9A 5E6UB 2QTLA 5JMWA 2IBTA 3QVGA 3FZYA 4GE3A 2O5VA 3SJAA 1YDEA 3T3PB 2IZ7A 3QXJA 4RORA 2XXJA 4EEXA 4L72A 2FK8A 3OPVA 3SZGA 3NWPA 4HS4A 3KSRA 4D74A 4DARA 2GTHA 1TDJA 1V6SA 4DR3B 3B5IA 1U2SA 1WW8A 3HKEB 4OMDA 4HJRA 3H5TA 3I0ZA 4WZBB 4C7OA 4P35A 4QELA 4LXUA 3UFXA 1B8VA 1QAOA 4GQAA 5C4IA 4FHCA 3NM4A 1DARA 4KPUA 5DWQA 5HMMA 1WDWB 5A62A 4RV5A 3N3BC 3G59A 1NDUA 3C1TA 1Z07A 2AMFA 5CAEB 1TI7A 2QIPA 5JC1A 1A2BA 3SK0A 2NO5A 1S4QA 3H65A 3KJFA 3QFFA 4TROA 4JR0A 4LPSA 4Y9SA 1R6TA 5LQMA 3ORQA 1Y7LA 3RARA 1W0JD 4ITUA 2YJNA 2X2OA 1WMSA 4D81A 4YRAA 5JY1A 2PYDA 3AL0C 4Y30A 3TRDA 4FMDF 5BV0A 3GMIA 4G2TA 3E5HA 4PYJA 4ZV4A 3CEHA 3DHVA 1XRMA 2C7PA 2J30A 1GPKA 3HL0A 2FA9A 3QV2A 1UPCA 3ABRB 4PIPA 4DDKA 4ED9A 4DV6B 1RABA 4MRAA 2NUBA 4DJAA 1IDN1 2QL9A 4LYEA 3E9DA 5KNDA 2PD4A 4WIAA 3IELA 4M1TA 1M2FA 2VDOB 4F92B 1WULS 5HJ5A 1NDQA 1T1JA 4XIJA 2NUPA 4RTQA 2YUIA 1DTWB 1VMDA 2BIFA 2GLXA 1HQDA 3ESXA 3L2OB 3O0DA 3PDJA 3LIPA 4WVLA 1GRNA 5EOVA 4DLLA 2ODPA 2JAHA 1WSWA 3MS2A 4BIMA 1NW8A 4Y0NA 4D99A 4RJTA 3WBBA 5B64A 2DT5A 3AM1A 2WZBA 4KR3A 4ZT2A 1PFWA 1WZ2A 2XODA 2ZT5A 5A71A 1DWQA 3HCDA 1D7AA 3DCYA 3PUXA 1PCXA 4ZODA 4YASA 2PXAA 2FWRA 1BDHA 2P91A 3COZA 1ZPDA 5CFOA 1WNFA 2GFIA 2VDNB 3CNQS 2PFKA 5KYUA 1AKWA 1C0EA 3GHYA 3ZKAA 4MWZA 2RBKA 1XDZA 3L93A 3O9ZA 4F1WA 5L7TA 2YICA 1YASA 3HVUA 4GD3Q 3D8SA 1PGPA 4A26A 1HDOA 3DEJA 4O1HA 1UMCB 4S1TA 4MWSA 5DNDA 2O1WA 1GTJ1 2XDQA 3CRQA 3K5IA 3AYZB 1JIVA 4BLOA 1C1HA 2C7QA 3P9SA 4Q7QA 4D92A 4BXOA 2HUPA 3WIVA 2RBEA 3M70A 1EWVA 2VHVA 5H7XA 4B8YA 1JXOA 2JKVA 1ZH6A 2QQ0A 5JD5A 2QX4A 4PC1A 5EJ6A 3MTQA 2R8OA 3S1AB 3BAFA 4EGSA 4IIEA 4WPGA 3RYCB 3AHGA 2G88A 2H51A 2FK7A 3KHUA 2A5YB 2R4UA 3DCNA 2Y1KA 3IVXA 2Q1WA 3JR7A 3RODA 1G9TA 4ND8A 4ZFNA 1X7YB 3AR4A 5DHRA 5ITSA 2QTMA 3U3MA 3LDFA 3FNHA 1A9SA 2ZCJA 2PQ0A 3K8QA 3EDYA 4MGKR 5CW1A 4C03A 1XLVA 1H9BA 1GQ2A 2XTAA 2XYGA 2WI8A 3BX1A 3RSZA 5B3JC 4LF4B 3ZDFA 1PZNA 1H5QA 3BTOA 4ZEXA 1P1IA 1XZLA 3AR5A 3D7NA 1IK4A 5LQAA 2ZTMA 2W8BB 2I7TA 4GOLD 4L07A 2J87A 1ADJA 1HE5A 2YRWA 3LBNA 4PGFA 4YCAA 3ZY2A 1PFVA 3CHYA 2HRRA 3R0JA 1SD1A 2QRZA 2YWXA 3IL2A 2BVNA 2JCXA 4GQBA 4L57A 1NVTA 1PL8A 1E5QA 1Q1AA 5AW0A 1NF3A 2B1RA 3PKJA 3DZ8A 3D8NA 3NASA 1XB2A 3MMZA 4G1FA 1UIMA 2I6UA 3V2UA 4MWTA 2AW5A 4ZKDA 4JXZA 1DWUA 3TMAA 2CUTA 2DWPA 4K1LA 5FA6A 1EXNA 1MORA 3TDMA 3UJ7A 4BV2A 1VE5A 5FV4A 3LLVA 1XG5A 4H17A 4YREA 1F2UA 1T2DA 4L9RA 1UZNA 5LP6F 2ORED 4EWLA 4HQRA 1L5NA 1U9CA 3VNVA 2B99A 5ECYA 2FDXA 1EVJA 3LK6A 3PSAA 3TO5A 2WJJA 4X0EA 4A0FA 2AYYA 5GJWC 5BQ3A 1V6CA 1Q16A 2DRIA 3H6KA 4M8LA 5JHHB 2PTHA 3NTLA 2VPPA 3OZDA 4MS3A 4R81A 4A0HA 4TVSA 5C7IO 1I13A 3P27A 1BMQA 3FBTA 3S8EA 4MEJA 5JZOA 1KS9A 1P7WA 1U4NA 2XNHA 4PONA 1C7JA 5J4HA 3UVEA 3PPVA 1TJPB 3DE4X 2PL3A 2X6TA 3GI1A 2OO3A 2JFFA 2Z3ZA 1N4AA 4F2HA 3PLAE 4PCLA 3MT9A 2OGUA 1RJDA 4IOLA 5E1MA 2C98A 5TT0A 4QTZA 1FRFS 3SQLA 5LQRA 4PLZA 4V2UA 1RBYA 1XX6A 3IQFA 4KAFA 4PBRA 1CERA 4D5EA 5C52B 2EQAA 5LOVB 3Q7EA 2BHLA 4AS1A 4NAVA 1K06A 4PFSA 4AO8A 3U80A 3OUUA 3JSAA 2E4YA 5LBIA 1GZ4A 4B7XA 3ZR4B 5IZCA 2TMGA 2I8CA 4E88A 5L8VA 3OO0A 5KWEA 4RA9B 3JQAB 2EF0A 2HCTA 3NH9A 5ALQA 5I01A 3V97A 1F6BA 3H86A 4YQZA 2X0JA 2OO7A 3PL5A 5C5IA 3VRHA 1V0JA 3BD9A 4DUZB 3MGAA 1NQAO 3IBGA 4MUYA 2BDUA 3O38A 4YUWA 2QRJA 3WSVA 1EE1A 1BS2A 4LN1A 1TFUA 3ZU3A 4CN9A 1ECLA 3CNBA 4ZTZB 2EJBA 1EMDA 1TW2A 1WL8A 2XJ4A 1N75A 2RGCA 1BH6A 1AGYA 4H60A 4IGAA 4EA9A 1ZM7A 3K2BA 1YB4A 2G40A 1I6KA 1R9NA 2H2WA 3OT1B 2BM1A 1SY7A 3QPAA 1EJBA 3JASA 3ETEA 3RC9A 3NDPA 1PSWA 4GPD1 2DETA 4JUAA 4MVJE 3KEGA 1FTNA 5HBGA 5GJVC 1Q3HA 5KTYA 1H2FA 1M2HA 2VZ0A 2JNWA 3ZQJA 3CRZA 3D7SA 4XWKA 2KBFA 2VA9A 3N2NA 2G9NA 2DQZA 3HVKA 2BFAA 1Q5PA 3IEUA 4BUJA 3KV3O 1XP8A 4MV0A 1SBIA 1BXGA 4XB1A 1SBNE 3SZUA 4G67A 3RYFB 3P4XA 1ORVA 4W6QA 5A2GA 3OCCA 1U02A 2VHEA 4IHAA 3RPEA 3S3TA 4R1LA 3UAYA 3DNPA 4O2BF 3VYUB 3W5BA 1I94B 4NXMB 2Q4OA 1P44A 3SHVA 1EGMB 1FUUA 3GWZA 3JQ9C 3LA8A 5GQSA 2BOVA 3L02A 3IP1A 3VYRB 3FETA 4E3ZA 1I6MA 1IHYA 2PH7A 1N2CB 1GXSA 3L7MA 4WY2A 2G1PA 3CS3A 1RAAA 4TKLA 4TYYA 1R4MB 2GZRA 1MW9X 1ONNA 4G1VA 4ALIA 4O4JA 4I2VA 1O87A 4JOQA 3W6ZA 2DM6A 1YWGO 3LRXA 2DKFA 3O1HB 4JT8A 4NCKA 4RKFA 3U4HA 3N7UA 5K8CA 1QQAA 4QUAA 2PMEA 1XAJA 4Q9LA 2QZ9A 3NTXA 2V97A 2L82A 3E35A 3CZMA 1KMHB 4JT4A 1IC6A 2C7GA 4HUTA 4TQAA 5ANRB 4ONEA 2EFCB 2FHPA 1NBIA 5E2IA 4BEVA 1IPFA 3A37A 3RB8A 2KPOA 3MLEA 2ZUEA 5LMNB 1DOHA 5CM2Z 3ZBPA 2O7SA 3DHEA 5K45A 3NAQA 2GEFA 1GTZA 1PVVA 4GLJA 2VJNA 5C37A 2GKGA 3C74A 3NIGB 5FBVB 1R12A 2AEJA 1KEZA 3ZDRA 4KREA 1EP1B 1SQ5A 4MAAA 4Y98A 3QFRA 4GLOA 2YN2A 3HKBB 4YUVA 1QGZA 2GPNA 2QVXX 2Y0DA 1F20A 1NPDA 1G63A 2CVZA 2HNAA 3LRPA 3UEOA 3UCFA 4BP1A 4C4RA 4HX9A 5FTNA 5I5EA 1GAJA 4FFOA 4RNCA 1H05A 2ACVA 1KTVA 1NM5A 3DE3X 2AK2A 2VSFA 3AO0B 5J2UA 2NT4A 5AHRA 2DULA 4EVIA 5C9ZA 3VKHA 1S8AA 5DP1A 2M6RA 5I51A 1V3UA 3AKDA 3A9WA 3FX2A 1HE3A 3AXSA 4R9NA 1CT9A 2Y9PB 3EIOA 3OQJA 5I9TA 2PUFA 4C6TA 4F5ZA 5F7ZA 4OQQA 2QE7D 1NBAA 3BMQA 3GLIB 1YQXA 2LV8A 2MSCB 2IX9A 3ZW9A 3A4IA 1ZH2A 3E9ZA 5G0WA 1J99A 1EAMA 2ZQYA 1Q0RA 2W6ZA 2ZIVB 3B9QA 4EMUA 3ZDXB 2QAGB 3OCZA 4TT8A 4AMBA 2W6ID 2FF7A 3DOCA 2R84A 2I80A 1V6AA 2O3SA 3OQBA 1Y6ZA 2YZMA 1P81A 3NKFA 4R8KA 2ASEA 3WLKX 4RD3A 4TLBA 4LJ9A 5EVJA 2NXWA 1NVDA 4ZEWA 1L8LA 3MK31 4IJ5A 3JV7A 3AI3A 4URUR 1F06A 2HFKA 2FKAA 3RT9A 2PO7A 4UVGA 2QUIA 3EW7A 1VDZA 3INRA 4FT4A 2NTEA 1ZRMA 2BISA 2H4FA 4QO7A 2GCEA 2JLVA 4NWIA 4X3PA 3R7FA 5AW8A 5IUNC 3VR4A 4LF9B 1YZVA 3Q6NA 2ECFA 5LFAA 1KOGA 1BMFD 3T35A 4X64B 4FONA 3ZHTA 1GA4A 1TQHA 4FDUA 3B52X 1E0JA 2ZJ1A 1ORHA 4DAOA 2RGDA 2VDVE 3LKBA 3LOUA 1R66A 2WU8A 2AXPA 3LUGA 4KQFA 1XWIA 2GN1A 2G6TA 2QROA 3SHQA 3T9BA 2BEWB 2GBLA 2V8OA 3AFHA 2HDWA 1SXJE 1A5SB 3L92A 3WKEA 1X87A 5D7BA 5JRJA 2PS0A 1MO6A 2R00A 1IHPA 2OHHA 3GN1A 2HWKA 4GYKA 5HIMA 1ZISA 3NDRA 3L7OA 4D3ZA 2ZYTX 3P0RA 5LD2C 2BEKA 1WPRA 2Z58A 4I46A 4D96A 4UMDA 2W0MA 4HQOA 3UT5A 2H2DA 1Y1SA 4PBTA 4LXIA 5CBPA 1ETUA 3WDMA 3O1LA 4OJQA 3N05A 1U7TA 3JRXA 4QOEA 4RWEA 3GHHA 1U7HA 2MSDB 1KEEA 1ABBA 3UGJA 2F8LA 4HWRA 2B69A 3HRHA 1Z6YA 4X90A 5TF4A 3WL6A 3FPLA 5EVCA 5C8ZA 1XVIA 2QT9A 2YVKA 1U7UA 2QP4A 1PT6A 1DEOA 3HCFA 4MZXA 2VP5A 2WA1A 5E95A 3BWYA 4BTVA 5B7GA 16PKA 2ID9A 4DW8A 1UPAA 2C04A 5BR8B 4BYGA 1JKJB 3UJDA 4CN8A 4BDTA 2IITA 4FBMA 3OCYA 1DX9A 1XAHA 1AX9A 3LC2O 2HSWA 3TAUA 4R2JA 5HRCA 4J16A 4EY8A 3K8ZA 4IIGA 4FNOA 2QG4A 5KHAA 1Q22A 1XMXA 3ENKA 3MCWA 4B75A 2O8VA 2F9LA 2R65A 3WICA 4BFYA 1DMSA 2OXRA 1LS1A 3A4NA 4CIYA 1NUHA 4LHXA 2O23A 4ZT4A 2WTEA 1ELOA 4CTKA 4MA4A 5KO2A 1P4HA 3KELA 3ZWYA 3F7TA 2Z1DA 4B34A 5BSHA 1S1CA 1Z8FA 1N0WA 2BFDB 2GXQA 4KQ6A 3UATA 3CMMA 5K3BA 3T9EA 1E92A 4NOMA 2HCJB 2WINI 1I36A 1F6WA 3B1VA 4YHHB 4QGFA 2FFBA 1DIOB 1QFXA 1ESMA 2I2DA 1A96A 1I4WA 4NPAA 3GLQA 1WHSB 3AERA 4YRDA 5BSRA 4C0XA 2G07A 1E96A 1KL7A 4KZKA 5EKSA 4ZAYA 4XFDA 1K7SN 3TB6A 2FEXA 2PSDA 4NG4A 3C8DA 3DXFA 1VOTA 2W22A 1N7IA 3EIWA 3EXFB 4GT1A 1QVRA 1ZNWA 2J1LA 4KLNA 2J0EA 4NNPA 4OG2A 1RYBA 4QBGB 3U40A 3D81A 4RMNA 1NUPA 3UXEA 4DMGA 1MJGA 2FOLA 1W88A 2ZAMA 4OGKA 4TMXA 5J4LA 2XRZA 4WJLA 3ILYA 2X0DA 1GXSB 5JI3E 3T5AA 1ARZA 2QMOA 4BNZA 2O8NA 1X1QA 2BMDA 1ZGHA 3ZIDA 2D1YA 4QO8A 3I53A 2BH9A 3P20A 1XMVA 1Y48E 4YGXB 1IUPA 3O8LA 3CH6A 4ZO4A 3H18A 3I3SR 4MYRA 1JN0A 4B6EA 1GZ3A 3EX7C 4RSGA 4MTLA 1LPBB 1QZZA 1RXYA 3SC6A 1JSLA 5FWXB 4QHSA 4QGAA 2YNMD 3HBJA 4CNQA 4HBZA 5CB0A 3CJQA 4FFBB 4C04A 4UTNA 1P2GA 4UEQA 3SS9X 3TD9A 4YJ2A 4GKKB 3HDQA 1FP7A 1PUXA 4B4KA 4KUEA 1WTCA 2GZHA 2GJKA 1G3QA 1C0IA 1KSJA 1PWHA 2HRZA 4KXMA 4ZVQA 4CT5A 4C30A 4HUQB 5GZ3A 2NNLD 2XUHA 3SVTA 2GD2A 3V1KA 1OXSC 1PL0A 1U1DA 10MHA 4MPPA 5ARCA 2CUNA 2VJYA 1IXRC 5BRNA 2ZBPA 4U7JA 1KI6B 1PJCA 4ZXFA 3UIEA 5KOJB 4BU0A 3M5CA 2Y71A 1TCCA 3LRTA 1A5BB 4H7HA 4R1SA 4UHEA 4R16A 4HQLA 3RTEA 4PNPA 4AJJA 4AS2A 4YRTA 1EUCB 4J0FA 3THWA 5HK8A 2IELA 2NUPB 2FEKA 1ULHA 2FV8A 4Z4IA 4R5MA 4EHJA 3KVRA 3DBHA 4GM0A 1JSXA 3WFIA 2QRVA 4CKXA 3EPHA 3OPNA 2GM9A 3QQ5A 3RU9A 1SCQA 4GQIA 1G7RA 5BO5A 1DKQA 3T3DA 4M9CA 1O1YA 1GFSA 4V0LA 2C9CA 4Y2QA 1JEAA 2IVZA 2J0UB 5LOVF 2AW3A 5JI2E 3E22B 2JHAA 2WWRA 2B4KA 1FUEA 4FOPA 4QATA 5IKPA 1Z5PA 2Q7XA 2Q8PA 4ZWNA 3HPQA 4GWLA 3GLHA 3IUEA 4PHHA 2E18A 1UAGA 2PGOA 3OQIA 4HAIA 1C7QA 1Q7CA 4RMJA 3R9IA 4YMTA 1OBOA 1ZO8A 4ZDKA 3K6SA 5C0OE 5DCYA 4J7AA 4ARBA 4KDEA 6PFKA 3IPCA 1GHTA 4A6XA 1RE0A 4WZBE 1T0BA 4LGCA 3GP3A 3C3JA 4IM7A 2AJBA 3UW3A 4ARSA 2RAUA 3ZQKA 4D9EA 4L3OA 1A4XA 3TH5A 2AMYA 5AYVA 1OFUX 4J6EA 1AN0A 2BSXA 3RRFA 4DABA 3MWJA 5I8PA 4FUQA 3ICCA 2R3SA 4HNAA 4ZU1X 1YE3A 2P65A 4GS5A 4X1OA 2QX9A 5JXHA 4EF5A 2W2QA 4MKGA 3LT1A 2POQX 4TXMA 3P26A 5KBYA 1TAUA 3HY6A 5EQFA 3QIVA 2FRDC 3URKA 1SPXA 1RLMA 1YR7A 1KXZA 1QH1B 4BE7B 8GPBA 5AHXA 1NN0A 1FVXA 4IZOA 1MH9A 1X14A 2KHZA 4QAQA 5L7YA 2C2WA 4ER5A 2ZSJA 1G2OA 4LJ8A 4WQMA 3LCRA 2H54A 1U8AA 4UE6A 5A3JA 5HOEA 3ZI0A 5E2BA 2W00A 3M82A 1P5RA 4P4LA 5C1BA 1E4EB 4NOKA 4JR1A 2PH5A 3RLFA 1YCDA 4PPFA 1M2EA 4E2FA 4MYTA 3O26A 7ABPA 3PRHA 3EXHB 3M6IA 1IFXA 2Z1NA 2CBZA 1I1OA 3ZD6A 1E4OA 5CHYA 5CG2A 1N33B 3CE6A 2HREA 2V7TA 1SH7A 3WYCA 2GS9A 1FTYA 1XK7A 4K9MA 4D41A 4CE6A 4MQBA 4QXPA 1DKPA 5MN4A 1BJTA 2Q5FA 1GRVA 1CY1A 1NZFA 2GPTA 3CT4A 3FDZB 4HDKA 4UM5A 3X2FA 1DO2A 1LK5A 1NUUA 4I66A 3R7AA 4B3FX 3ESDA 1PT9A 3G2KA 4PLPA 4LEIA 1CRWG 5E7MA 2O6LA 4ME6A 1TA4A 1M2GA 2OGSA 4PIVA 4X1YA 1I32A 1OYOA 2GBCA 5CNJA 1MPTA 3KB1A 3K71B 3T12A 3FZGA 3O8NA 4IL5A 2P0EA 2JGEA 2PGJA 5AHWA 4CUKA 5A4DA 5KC8A 5IHXA 3EFEA 3DBIA 1LH0A 3DBVO 3C6MA 2NQ2C 1KK0A 3WGHA 1XV5A 5IDXA 5KOIA 3N2EA 3V2GA 4M7PA 2QRNA 5FT9A 4RLHA 1XK6A 1I2CA 1Q84A 4PYRA 2G63A 3KCQA 1NR5A 1P4SA 1JXQA 1WHTB 1W9MA 3EF3A 5FTMA 5AJWA 4ZHQA 5MDHA 2IH4A 3QFSA 4OAPA 1KYXA 3C3YA 4W8GA 1UAAA 3E2MA 4HQ6A 3PC6A 2XOKA 1BX1A 1Z39A 1C7ZA 2X6RA 3CBGA 3N0RA 5FADA 2UUBB 3OLZA 4DMCA 4MK4A 1EP9A 2Y93A 1CUAA 1MO3A 5FLEX 2X77A 3BCRA 3TF5A 5FI3A 5ITVA 1KJZA 2FFHA 1EIZA 1PR0A 5F9MA 4CFSA 4DT1B 2ZE7A 4N18A 3OA0A 3BBPA 4OM8A 4WT7A 3ZU5A 3CKYA 3LUAA 1KO5A 3UYKA 1Y9AA 2QV7A 3PD1A 4Q3KA 4DQDA 3CLSC 4K5QA 2ALJA 3T7AA 4YCNA 3BWCA 4IOJA 3GLGA 3ZYZA 1DJMA 4L75A 3ZHUA 4FMCF 1QAQA 3RREA 4Z4FA 4UE3S 1MXHA 5F3RA 1A5ZA 2W6PA 1NQ5A 2XHZA 3JY6A 2E89A 3C7DB 1VG1A 2OUIA 3GFOA 3H2BA 4BB6A 1HYQA 5KJ1A 1QUFA 1E94E 1ZG3A 2Y76A 4FSDA 5IFKA 1SWWA 2C5HA 3M0EA 5LDGA 3REOA 1A82A 2FW6A 4ZALA 3TJMA 3FNRA 4D02A 4DM4A 4JEMA 5MGBA 3DL0A 4EG7A 4I3FA 4PG8A 3RTBA 1DBPA 4UCFA 4DSTA 2C7OA 1U7DA 1VB5A 4BTLA 3I34X 3FAZA 5A5DA 2HJHA 1T25A 2EHJA 2FDRA 4Z4CA 5HKKD 3BM5A 3SYNA 3FM9A 3ZQ4A 1FY2A 1Z82A 2FSHA 2OOSA 3GDFA 3SXJA 1IBMB 5JWOA 3CLVA 2QTVA 1DTSA 3EWIA 1VPEA 2Z6UA 5HTKA 5B3JA 1Y82A 2H5IA 4KMOA 3WL4A 4A8JA 1TTQB 2WM9B 5A5EA 4R31A 3I5XA 4M0MA 2AE1A 4EHKA 4YXFA 4DUYB 1EB9A 1LJ8A 2BTOA 2YR0A 4RKQA 1ZUHA 4DSAA 2FZ5A 3GJTA 3IAUA 1ZY2A 4FGWA 4RPIA 3BXGA 2UZ3A 3R09A 2PUBA 3LLSA 4M46A 3GFVA 1N2EA 3FDJA 3E9YA 5E4JA 3K0CC 5B6IA 1T36B 1RSZA 3CRNA 5J47A 1KAMA 2I67A 1KYQA 3CG4A 4F2WA 1V7ZA 1GQRA 1KMHA 3HKCB 1RCFA 4EY7A 2O7RA 2HMVA 4XQ9A 1KSFX 3IILA 4D4MA 2OP0A 2PMWB 2QW1A 3Q8WA 2E4AA 4R4JA 4IH4A 3ZE9A 3SSNA 4YAKA 5LOVA 1C50A 3TMKA 3UGKA 3TGPA 4DR7B 1PKEA 3BJZA 3OJLA 2VZEA 1BCSA 3HJTA 3I8OA 4FQ5A 3UPDA 1ETHA 1QX3A 5FKJA 1G64A 4GDFA 1DQYA 3MSXA 3WVNA 3C85A 4ZZIA 2ZRNA 3EH2A 5JCOC 4LHSA 2PNJA 2WC1A 2WPDD 3U3DA 2MSEB 3WLPA 5CEFA 3DA8A 1AQJA 1U0NA 1WDLA 1X8KA 2VNHA 5GM1A 1V7QA 3EAGA 3RYTC 1XDSA 2NYVA 4LHYA 3WWZA 4RFLA 1Y37A 3G0DA 3H9GA 2NXCA 4NE7A 3HA3A 4W9NA 4L5CA 3V4RA 3OZWA 2ZRJA 4Y2SA 3SX0A 1RYYA 3SDSA 2NO0A 1GCAA 2LNDA 3T1NA 4I08A 5KSOA 3EMKA 1L4NA 3I4FA 2VQEB 4JVMA 4G85A 3FHTA 2PSSA 3FTDA 8AT1A 1CZUA 1XMJA 2ZYSA 1L7RA 2HJRA 2PGNA 1LDEA 1E77A 5CMLA 3I9KA 3NRBA 1H3EA 3DMHA 3FPJA 5CIQA 1QU2A 5JLJA 2I6GA 3RGGA 4PAMA 4Q0MA 2QJTA 1E3SA 3DH0A 5G1NA 4PQRA 4CM8B 1XTQA 3RIHA 4ZAZA 2IJGX 2XKAA 4ZEVA 2VKQA 1J07A 2Y05A 4TXHA 3HKDA 3KG2A 4P53A 4LJRA 2XB2A 2XVXA 1FRQA 4R7ZA 5DBEX 2RHHA 2M2IA 1RBZA 2FPUA 1JQEA 3WGMA 3ISJA 1E1CB 4F1JA 4TWZA 4L8FA 2RJOA 1KMQA 2HHLA 4G09A 1IN8A 4LVUA 2JEZA 2G4VA 1OYVA 3OSZA 1C30A 1TZCA 1WKCA 2QE6A 2IP1A 3E8SA 4YQYA 3VU0A 1GG5A 1E60A 1ZD3A 4EZBA 5LNK1 1U7PA 2O07A 1ZS9A 2D0DA 1XQVA 3H1TA 3DOOA 3RQIA 1UWVA 2GK4A 3MMSA 1L5HB 2PPV