3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
2FGKA 4PQRA 2FF7A 4OHVA 2O8EA 1CF4A 3OEHD 2P6RA 2QAGA 1H8HA 4O2LA 3SYKA 1NRJB 3R9WA 1HYQA 1IN5A 4JLPA 1COWD 4MUBA 4Q4HB 1PJRA 1JB1A 3L0OA 4W5WA 1Z6YA 2XAUA 2ZYTX 4G0NA 4PQFA 3PUVA 5JI3E 4EFNA 3D6TB 3EARA 4Z1MA 2PZGA 3K09A 3RRNA 2NO7A 5KYKA 3SQWA 4DEXA 2H5EA 1TMKA 5FL3A 4F93B 2V6JA 1TUIA 3QE0A 3CWZA 4A2QA 3DMDA 2OG2A 1M1YE 2JATA 2Q0HA 4TYNA 1MT0A 2FU5C 3MUFA 4LV5B 2ORIA 4WZBE 1E0SA 4FMCB 4RZ2A 1IY1A 1UBGA 1MV5A 4EPYA 1NVXQ 1N6PA 2WHXA 5BYJA 4G5QA 4CVNA 3AUXA 3U61B 1W7AA 3LV8A 2YNMA 3THYA 5HKKD 2OT3B 4M22A 1ZCBA 3MJHA 4B3CA 2DFLA 4Q4AA 3M6AA 4QJ5A 1N6NA 1SHZA 3HU3A 4L4UA 1GP2A 1T5IA 3BH7A 3Q8XB 1VYVA 3TBKA 3Q72A 721PA 3BIFA 4G5SA 1EGAA 2EFGA 3TUIC 1R5NA 2YC2C 2P5TB 3PCRB 5HZHA 1LNZA 1G41A 4M9ZA 4GPTA 4AK9A 2IX3A 3U6BA 3KJHA 5EXXA 1Z6GA 2YWFA 1NN0A 1EXMA 4YQFA 3B13B 4ZI2A 3NC0C 1NMXA 1W46A 4XH9B 2KWIA 2QBYA 4LGMA 5FOVA 3MGCA 1KNQA 2ZRBA 3QPUA 4RSGA 2JASA 1XEFA 1E0KA 2QTFA 4LWZA 1E1QA 5L3QA 4FW9A 4LK2A 1E2LA 1MO5A 3D7MA 4KBGA 1W4CA 1FOEB 4M21A 1G3RA 1NKSA 2O8BA 2RGXA 2QBYB 4C0KA 4G1UC 5BN4A 3BJIC 2GBLC 5AJYA 4EQ6A 1Z0JA 2BIFA 4IEIA 4GL2A 3G82C 5E7JA 2P67A 3AV0B 3TE6A 1RRCA 2O8CA 2OLJA 4V0KA 1JXMA 3B5JA 4DIDA 2O8BB 3ADDA 4EFLA 1FMJA 2G0TA 4UQOA 2CNWD 4C30A 2BJWA 2YZ2A 3KDSE 2HLDD 2A7QA 4JL8A 2OV2A 3TAHA 4EPXA 2HV8A 2XZLA 4QGGA 4NU0A 3UKDA 1DPFA 2VQSA 2FFQA 4D0NA 3BORA 1ZD8A 2GXUA 3E5HA 3AVPA 3IUYA 4A6XA 5JEDA 2GDJA 3Q3JB 1G18A 1E1RD 1AJEA 4AKIA 1SXJA 2NO0A 3OZXA 4H9GA 1TU4A 3U60B 3U3MA 3I61A 2HXSA 3RRMA 2FZLA 4LJ9A 3BGWA 5FPKA 3ZLJA 2HCBA 2AWNA 2R2AA 4Z8YA 1Z6XA 1AKYA 4PPFA 5FOUA 4B48A 4B2LA 4Z51A 3CONA 1YZUA 1KI4A 2YWGA 4BFUA 2JLSA 2WVJA 2FV8A 1T0HB 1G5RA 1X8KA 5FOXA 2ZR7A 3WMEA 1KIMA 2R6GA 3UMRA 2ZJ5A 2YVUA 4FMDB 5JECA 1YZQA 3AVYA 1ANKA 3KQUA 3QXSA 3ZGXA 1QG4A 1KY3A 2FX3A 1FQJA 2G3YA 1F2TA 4C0LA 4IVPA 3ADCA 3LNCA 2ZUDA 1JJVA 3LFUA 3A58B 3PENA 1X86B 2JIZD 3VAAA 3QKTA 4C2TA 1LFDB 2IXGA 4W7SA 2G88A 1Q44A 2ZI5A 1VPLA 1YZLA 4GMDA 4PAOA 2ECKA 4PO1A 1XXHE 1U0JA 3LVQE 4TL6A 1N3BA 2QAGC 5A4JA 4DLSA 2QQ0A 5UKDA 2E87A 3B2EA 3W34A 4R2IA 4HAZA 5EXPA 4RFSA 4ASUA 1CS4C 4HLCA 1IBRA 1YZTA 4B33A 2QROA 1E2JA 2GETA 3I92A 4JLKA 4KFTA 4ESHA 1RYHA 4UNQA 1XZQA 1UJ2A 2JEOA 2IYYA 2ZRMA 1DVRA 4JZKA 4LOAA 4YONB 2ZJBA 5E4FA 2HT6A 1W0KD 3GQBA 1GNQA 2VA8A 1P72A 3QF4A 4BFXA 4P33A 3D31A 5KU1A 5TMPA 1MOZA 3RS2A 2BM0A 4NDZA 4A8JC 1ZC3A 5G40A 1WB9A 2ODNA 1P2UA 3BWDD 4NCNA 1YE8A 5HTKA 1CLUA 1KDOA 1G8YA 3KL4A 4Q9IA 1G3MA 1NY6A 1HE1C 5TB5A 1J8YF 1GKUB 1SVKA 5JJIA 3P1JA 4DDWA 3CR7A 4JLVA 3AVQA 3VKHA 4G5GA 4QBIA 2CL0X 1FPMA 1XXHA 2R9VA 4B47A 1R0WA 3A6PC 1GRNA 3SNHA 2IS1A 1L4UA 1SHKA 2G83A 1X6VA 3QXJA 4JBYA 3FB4A 2QT1A 4Q9JA 1KYIA 1XJCA 4C4PA 2IHYA 5SZHB 2QMOA 4DC9A 4QBGB 2J7KA 1N25A 3P4XA 4HEJA 4RZ3A 1JAIA 1IJFA 4LCBA 3I5YA 2BMJA 4R2HA 5EE3A 2QPAA 1ZD9A 4JL5A 2ZS9A 4OL0A 1UPTA 3EWSA 4KBFA 4YMTA 4CEHB 1IN6A 4AURA 1XNJA 1RZ3A 2OFWA 3MMPA 5JWHA 5SZIA 4PZYA 4IDNA 3CW2A 2QRNA 4JVNA 1GL7A 4K81B 3PJRA 4BZQA 1Z06A 2V9PA 4I4LA 2W83A 1KDRA 1MH1A 2GAAA 2OE2A 3LW8A 4WZ6A 3WBKA 1KY2A 3RYTC 3CX7A 2OM2A 1ONBA 1FMLA 5JHGB 1PLLA 2ZJ8A 4A9AA 4HB4A 1O3YA 4PC6A 5KOYA 1UBEA 1G3UA 3GPLA 2VBCA 1KJZA 3T5DA 3CNLA 2GJKA 4RKEA 2ODWA 3ZVRA 3B85A 2HJVA 2YINC 1P9NA 3B9PA 1G5TA 1GIAA 1F3OA 1TF5A 4WAUA 3SC3A 2OCBA 1Q21A 2JJ1A 4NP6A 2B7CA 2W6JD 3LD9A 3W8NA 1OFTA 2GCNA 1KO7A 5KNCA 4AKEA 1E99A 3K0FA 1N6OA 1NG9A 3B8HA 3T1VA 4D0LB 3LQQA 1AZTA 1CP2A 2G6BA 4Q1EA 5CK4A 3SJBA 3BXZA 3MFYA 2PT7A 1J7KA 5EJEA 3HU1A 3QJYA 4ZO4A 4DSTA 5JRZA 2ZETA 5CB8A 4B3GA 4YMWA 2CL7X 4YLGA 3FHTA 2ZJYA 4M0LA 1NY5A 1ZP6A 1AGRA 3AM1A 2QMEA 3IHLA 1NL3A 4B3BA 5D3MB 4C0JA 1P4SA 4GDFA 1HUQA 1T8UA 1TQDA 2VHCA 2XNDA 1VG0B 4IOLA 2QE7D 3ZIAD 5AK0A 4OI4A 4W5HA 4D4LA 4B32A 4UNSA 3C5HA 4DLZA 4LDJA 1FNNA 4EPWA 5LBIA 5EP1A 2GWHA 2OAQ1 2QI9C 3UXMA 1CEEA 1IM2A 2LWIA 2JCSA 4HLUC 5CLQA 1G291 5FOWA 1EK0A 1RVDA 3QG5A 3QKSB 1UDWA 1ZM3A 2BBTA 1VYTA 4TTRA 2GXAA 3PUXA 3TW4A 4R98A 5A0FA 5BW8A 3I4LA 3U3OA 4E07A 1UDXA 2CCKA 2C5LA 3EIQA 2YOHA 3OFND 1TAGA 4TT3D 2YWEA 4LV8B 1D8TA 4MGYR 4OJKA 2B92A 3QXCA 3X1ZA 2HXYA 2FFAA 1QVRA 1VKJA 1N6LA 5TV2A 4C2UA 3AVTA 1XZPA 3TQFA 1NLYA 1P9WA 1CJKC 2D7CA 3RS3A 5JJKA 1CJUC 3TSOA 2ZS7A 1A2BA 3ADKA 1T6NA 2J3EA 3CF6R 3FHCB 4QHSA 1N2CE 2WJGA 5FBQB 1I4LD 5FUXA 2WJIA 1QHGA 5KSOA 3OESA 1KAGA 2ERXA 3O8DA 4I1OA 4ZPXA 4IHQA 1R6BX 1TEVA 4EJSC 3U2QA 5CJ2A 4TL7A 2D2EA 4OBEA 5IF9A 5FPHA 3B1YA 4LHYA 4US2R 3RSOA 1RRGA 3P32A 1YR8A 3BB4A 3VQTA 2PCJA 4PSKA 2VH5R 1OXSC 1VIAA 1KMHB 4MYUA 4A6PA 1HT2E 4FMBB 2QPOA 3DZ8A 1S4QA 1U94A 1DAGA 2F1HA 3CRQA 1HE8B 4B3XA 1TEXA 3L82B 3QKRB 1KDPA 1SGWA 3TSZA 4EPRA 3GLGB 1KKLA 2O8DA 2F43B 4NYIR 1NVVR 3EG5A 2ANCA 4QRHA 1ESMA 1XCMA 2CBZA 3AGPA 1AS2A 4L9SA 1NBME 3H2YA 3M0EA 4B35A 5H70A 4FWTA 5KDDA 2WSSA 2GHIA 2O8DB 2BMFA 3UMSA 1YR6A 3U3RA 2IBMA 4PO8A 3EIEA 3VTKA 4F92B 3C5CA 1MO3A 1MR3F 4Q4JA 3KB2A 4L9WA 1R5OA 2F9LA 3FKQA 5FUWA 2DB3A 2BBWA 2ORVA 4DUGA 3QI2A 4P3YA 2WWGA 3LX5A 5E95A 3IGFA 1MABB 4TYPA 3CX6A 3KQHA 1G3IA 4QC2A 1G5PA 3UWKA 2ZROA 4LPSA 2OLKA 4OYHA 3AF3A 4Q4JB 3EX7C 5DYIA 3TMKA 1ZJ6A 1F2UA 3RWOA 4D26A 1Z5ZA 3P4YA 1NIPA 3IQXA 3LW7A 4C0QC 4A82A 6Q21A 1OW3B 4KAXA 4IXMA 2ZAOA 5EP2A 4ERNA 4HI0E 3RS4A 3RRZA 5IRCD 4IRUB 1F6BA 3TSWA 3NBXX 2ZE6A 3OIWA 1CR0A 4N3NA 2OEPA 3IPXA 1YR9A 4DKXA 1XJ0A 2JDID 4RD2A 1W2GA 1Q1EA 2EFHB 2I3BA 4JJKA 1RJ9B 5A5GA 4GRAA 4AD8A 1OIVA 2ZRHA 1IOZA 3GEHA 5B58C 1A82A 2K5UA 2JGNA 5AWFC 3EZ2A 4FCVA 2ZSDA 2IYQA 2GJAA 4F7WA 4Q9LA 4CEIA 1NSFA 4O2RA 2VP4A 4BFZA 1KSJA 2P3SA 3CF0A 4MRPA 3VR3A 3U6KA 2CHGA 1NVUQ 1AGPA 1H8EA 3OIYA 3WNBA 4QJ4A 1KMQA 3UATA 5J5CA 1CKEA 4Q9HA 3V4RA 2ZJZA 1G17A 5K8UA 4BEJA 1ZUNB 1JR3A 3T34A 2FMXA 4DRZA 2J0SA 2XEXA 4ZKDA 1OKKD 3VNVA 4H1UA 5C4GB 2DR3A 3EC1A 5FL7A 3NHAA 3DM5A 2CK3D 2REBA 4OQLA 5IHPA 2W2XA 1XTSA 3PEUA 1UKZA 1M7BA 1DAMA 5EXSA 3A36A 3UPUA 1W36C 3BOSA 5FBWB 2B7BA 4GI7A 1OHHA 2FOLA 3AF2A 1BMFA 2Z4RA 1II8B 1WCV1 3KKNA 2AD5A 4WA7A 5K8IA 2H92A 2EFCB 2RGDA 4OHWA 1GTVA 4O0MA 2VP9A 3IHWA 2J0QA 2QSZA 1J2JA 3MSXA 1XMVA 2XNSA 4EAQA 1Z3IX 1SKYB 5DI3B 1WXQA 3QENA 1G16A 3SQXA 4MGKR 2W6IA 3AKEA 2A5GA 1VHLA 5GJWC 3LBHA 2DWQA 3KXKA 4ITRC 2YC4C 4KU4A 5KTYA 3BFKA 1QG2A 3LVRE 2BEKA 1RE0A 2JJ2A 1Q1BA 1E2QA 2CXXA 3A4LA 4URVR 2REOA 1JQLB 1ZRHA 2KE5A 5AUQA 4Z1MD 1YZGA 1PVOA 4LJ5A 4M1OA 4PHTA 3EPJA 1DAEA 1JECA 2WWFA 5FR1A 1LV7A 1SZPA 2MSCB 2FA9A 2ZS8A 3GJ0A 1H65A 1II9A 4RCYA 4AKGA 3WP0A 5KSPA 5B2ZA 2ATVA 3RVBA 4DHEA 1EX7A 5H1YA 3VR4A 3T1OA 1Y3AA 2QP3A 4GNKA 4PC1A 2GCPA 3RLFA 4MDEA 3CPEA 2GBLA 1VCIA 1F48A 4LHVA 4M4SA 2AR7A 3CZPA 2XTZA 1ZC4A 3OE7A 3K53A 1P61B 3SR0A 4NYMQ 1ZINA 4O25A 4A2WA 1CJTC 4URXR 2JLZA 4DXAA 2YJTD 1EFCA 1TU3A 1ZW6A 2GZDA 4LYJA 3T5GA 1CBUA 1OSNA 2Q9AA 1E98A 3GEIA 5J40A 2W0SA 2ZSBA 2OFXA 2OZEA 4QFMA 1EX6A 1UBFA 4HYYA 2XSZA 1Z29A 1OFIA 4OK5A 1HQCA 1S3GA 3EZFA 4U02A 3A8TA 3HP1A 2WJYA 2IS4A 3B1WA 1XU4A 1OPXA 2PEZA 2N46A 3CLVA 4JLNA 4ZDKA 3F8TA 821PA 1GITA 2CEAA 1DAHA 4PZZA 2J7PA 4S35A 4X8LA 3EASA 1CJMA 1B23P 2FPMA 4TMZA 2QMHA 1XEWY 1GZSA 4D80A 1XPOA 2REXB 1N5KA 1KI1A 3TW8B 3DPUA 1D5CA 1AKEA 2I4IA 2AFHE 3JVUA 4NCKA 2ZI3A 1U2RA 2CE7A 2RB4A 3A4MA 3BC1A 3QEOA 4Q1BA 3H84A 2XJ9A 4KLNA 4TQ9A 4W5JA 2J0UA 4Q1CA 2EWVA 4XTCS 4ZIRB 4M9SA 3KXIA 2OXRA 3IQWA 3DOEA 1KI3A 4D4MA 4B6EA 1G6OA 2ONJA 2IW3A 3OIVA 3I8XA 1WQ1R 1TX4B 2ZRDA 1OT3A 3N2EA 2AN9A 4DCTA 2F3RA 3A1SA 1GL9B 3T15A 3AKYA 2WIBA 4RD0A 4I99A 1ZMXA 2GVZC 3KKQA 3UWOA 3NVAA 4Q1DA 5GVRA 4D25A 1XTQA 1TQ2A 4LYHA 1M8PA 1SXJD 1UBCA 2EYUA 2NO6A 2RCNA 2JLVA 5HCIA 1Z47A 1R8SA 2ZI4A 3FMIA 2P5SA 4YMVA 1NNEA 1AN0A 4YXWD 2GF9A 2FN4A 3QBVA 2BWJA 1W4AA 3J81k 3V00A 2DFNA 3U7FB 2CLSA 3D3QA 1LY1A 1KI6B 5G41A 1KK3A 3V9PA 1OH6A 4N0EA 2XXAB 2DY1A 4Q01A 1GRRA 2IYZA 4YMSA 3WBJA 2A3RA 5J4KA 2HF9A 2HDNB 1YU9A 2ZE8A 3SS8A 2VHQA 1OIXA 2O8EB 4M2LA 2QAGB 2WIAA 2BV3A 1NN1A 4AIIA 3T12A 4BWYA 1U90A 2V3CC 2GXQA 5CB6A 2R6CA 3LDAA 3NEYA 4LY6A 2WTUA 1N5LA 2CCJA 4NE2A 4Q02A 2FE4A 3RSLA 4GMXA 4IVQA 2LKCA 1KSHA 4A8JA 1AM4D 1N5JA 2QA5A 4I81A 3IILA 2MSEB 3QEJA 3IIMA 1D6JA 4R9UC 5JEEA 3ASZA 3EPHA 1XMSA 5SZJA 4TL9A 5FTKA 3OF5A 2O5VA 2HT1A 4Q47A 3LO5A 1RKBA 1Q1QA 1ZM7A 4DLXA 3C14C 1SVOA 3GEEA 5B64A 2VTKA 3RHFA 5ELXA 1Q0UA 1VDZA 4HAYA 4D0GA 3THYB 1WA5A 1CU1A 3KB1A 3REGA 4ABYA 1YHNA 4G5OA 4C0AC 4Q4AB 4NCIA 2WKRA 1VCMA 3N2IA 4M1SA 1D2EA 1W47A 2ZJOA 3IO3A 4JKIA 2R65A 1BYIA 5HE9A 4ZDWA 3WNDA 3GJ6A 1KO5A 1XD9A 2RHDA 2GNOA 4HUTA 1EWRA 1EFUA 1XF9A 3QF7A 1SVLA 4QXAA 2BOVA 5E7IA 3QVVA 1Z6AA 4JBWA 4LYAA 3IIJA 3WHLA 4IOJA 3X1DA 5KPDA 4CT4B 5D3QA 4F91B 1KI2A 3W8RA 2Q3FA 2WICA 4BLOA 1FTSA 3CWQA 5G3ZA 1IQPA 1VG1A 2A5YB 5L3QB 3FDIA 1X1SA 2F6RA 4UJ5A 1BH2A 5EZ6B 4OK6A 3TVTA 4JL6A 3K9LA 3WMGA 1Z0KA 3DDCA 3MCAA 3UIEA 2WPDA 1WF3A 2GK7A 4EQ6B 3SBEA 1EFRA 5IK2A 1OXTA 5JLJA 2DFKB 1OH8A 3VKWA 3ZZ0A 1LVGA 1W0JA 2WBLC 2IUUA 1DAFA 2B8WA 4QG7A 4WBSA 2O8CB 5JI2E 4IFEA 2QENA 3TIFA 1Q22A 2ZYVX 3DKVA 4QGHA 1E9FA 2RGBA 3PUZA 4RZXA 5GJVC 1Z0FA 4UNRA 1UM8A 4JLMA 4AC9A 1JJ7A 2QY9A 2BVNA 3PQCA 1KKMA 4P4SA 4CZ2A 2WSMA 3TRFA 3GLIE 2JLQA 2A2ZA 1G6HA 4ILEA 4F4CA 4YC7A 3IDQA 4EDHA 4B71A 2XTNA 3CPHA 1QZXA 4MYCA 1SXJB 1KZGB 1K5GA 1ZYUA 5DN6A 2VO1A 1E2DA 4A0GA 2WWXA 4U7DA 3DKPA 2CHQA 4Q7MB 2V1XA 4LV6A 4JLBA 1NMYA 1NKTA 1Q1ZA 2G1KA 3ND9A 1LTQA 2O52A 1ZM9A 2V7QA 1HQYE 4AG6A 2Z5FA 2R6AA 3LLUA 4KYIB 4AYXA 1CXZA 2OBMA 4Q7JB 2R44A 2JLUA 1ZU4A 3L0IB 5JS7A 4GSYA 3KQKA 3RANA 5DE3A 4LJ6A 3WRXC 2VP2A 3C15C 4MRRA 2GEVA 4F38A 2VHUA 3A1VA 1ZNYA 1XB2A 4HLUA 1KO4A 3SBDA 3O47A 3MD0A 3P27A 2ZI9A 3X1YA 2MSDB 2GXSA 4XVRA 3KJEA 1Q3TA 5J4LA 3C8UA 4JLDA 3LLMA 3TUJC 4MGIR 1HTWA 2EFDB 3VFDA 3B9QA 1F2TB 4OQXA 1NG1A 2CVFA 3QOFA 2IK8A 3CRRA 4BEBA 3LWNA 1FL9A 1JPJA 1SVMA 2XTMA 1IN7A 1T4GA 3EC2A 4MA4A 1YVDA 3FOZA 3DMNA 4ON9A 5AR1A 2J45A 2ZU0C 3CPJB 1TNDA 2VHTA 3KTAA 3H86A 4URUR 1X8JA 5J4VA 1HY3A 3RS0A 1T91A 3E2IA 2YHSA 2PJRA 1S0UA 2CLDX 4DLVA 1YQTA 2X19A 2YV5A 4QNMA 2J87A 2XNDD 5FPSA 2GAOA 1W48A 2RHMA 3PR1A 5HKKA 2OHFA 4LJYA 3KTAB 4RFSB 5AJWA 5AJVB 5DYGA 4B34A 2DWPA 4HB0A 5FTJA 3SHWA 1FNMA 5KNDA 4EJSA 1MRSA 5EP3A 1R0XA 1YKSA 3BB1A 1ZM4A 3EA5A 3MWLA 4RD3A 3S1AA 4RVCA 1SVWA 4XD7D 5C18A 1XMIA 2ZYWX 3PV0A 3K8YA 5EQTA 1LB1B 4DCUA 3QF4B 2Y8EA 1Q20A 1QF9A 1U99A 2IF0A 1IY0A 2RGGA 2JJ8A 3EA0A 3T35A 3LY5A 1W44A 5DI9A 2C96A 3NH9A 3PEWA 4R7ZA 3R8CA 3S1AB 1LW7A 4DT1A 5BYKA 3B1VA 2BC9A 5JSZA 1VYUA 2EWWA 4OJQA 4PTLA 1XBTA 4Y0VA 3U7EB 2H8KA 2NIPA 2WKQA 1U81A 3IEUA 4PAMA 1XEWX 5FI0B 1OV4A 3GJ3A 4BGDA 2H57A 4NCHA 1XXHB 5JSZB 2AXNA 1DS6A 4TYYA 4NYJQ 2ZRCA 5F98A 3NKVA 4US1R 4UXIA 3ZVLA 4DLUA 2VYFA 5JBQA 3F0TA 1XEXA 2IC5A 2NQ2C 3PEYA 4DBLC 3K70B 2LCFA 521PA 3G5UA 2CNWA 4I1UA 3IEVA 2ANBA 4BRUA 1G7TA 2HEIA 2YYZA 3PITA 4Q7KA 3B6EA 4QJ3A 2A9KA 5C46F 3LBIA 1W4BA 2MMGA 4DLTA 1T5LA 2VP0A 1QHHA 1R5BA 4TN1A 1U0HC 4NH0A 5JCPA 1AS3A 2QTHA 2RGNA 2E9SA 1E79D 3NTUA 4JSYA 1E9DA 5HZKA 1E1RA 5CM9C 1AK2A 4LJ4A 2ZRLA 5KDLA 3N5CA 5EZ5A 2W0MA 1IHUA 2FFBA 4TLEA 3OEEA 4B2IA 4IDOA 5IT5A 4AWXA 3DVLA 1U8AA 2QT0A 4C0HA 1QHSA 3C7KA 3TLXA 1OYYA 1CIPA 3U44A 1KSGA 3QVUA 4BECA 1HT1E 3CNNA 3W6OA 4J0QA 1G7SA 1CULC 1G4AE 5TY0A 3UG7A 2WJJA 3MRSA 2R62A 4OI1A 2FFHA 1M7HA 5JJLA 2QTVB 3BRWD 4Q18A 3K0FB 3CIOA 2D06A 4PC7A 5LB4A 3FTQA 3MAAC 5AUNB 1VHTA 2PX0A 1CRPA 1ZIOA 4KV9A 2ONKA 2ZAMA 1QHYA 2JIZA 1NLZA 2R6DA 4OKSA 4BFYA 2PMDA 2ZRIA 5JRJA 3THWA 4KSBA 3NBYC 2H16A 4WVFA 4Z54A 1QHNA 2HF8A 3L0PA 1KGDA 4GBMA 5DHAA 4OHXA 4PC3A 2G9NA 3A1WA 3R7WA 3I62A 1T8TA 3C4JA 4U5XA 2C98A 3WXMA 1XPUA 4HAVA 2WOOA 4XJXA 5L8VA 1JI0A 1EESA 5FPTA 1NIJA 4GZMA 1IN8A 4JSTA 4RJLA 3K9GA 2FSHA 1CR2A 2W2TA 1C9KA 3OAAD 1W0KA 4HUQA 3DOFA 4NBSA 2RGAA 4B74A 1XRJA 1ZD1A 1UKEA 3HJNA 4LBVA 4CW7A 5JCZA 2IYRA 1H8ED 4CEJA 1E32A 1Q3HA 1VIYA 2PLRA 4TLDA 4UJ3A 4N0DA 1OFUX 2XOKD 3QXXA 1GRQA 2WJVA 1Z6TA 1WBBA 1JR3D 4JBXA 4BRWA 2W58A 4HUQB 1T3HA 2F9MA 3PVSA 2BHRA 4QL3A 5M04A 1Z0IA 1QBKC 5FL7D 5DHFA 1UADA 2QP9X 1ZU5A 1FX0A 2IEZA 4XOIA 3VR2A 3HYTA 4HB2A 3GLFE 4HLDA 3O8CA 4PPQA 2IUTA 1RRPA 2HCJB 3CX8A 1WRBA 3RRYA 4M9XA 2DBYA 3ZVMA 4LJ7A 1BMFD 4JVSB 1XDBA 4NZYA 1VG9B 3GJ5A 4ZCLA 3UK6A 1D2NA 4HDQB 5CLLA 1KOFA 2PCLA 4ZI3A 4V0OA 4V0ME 4PZLA 2W6ID 1R2QA 2KSQA 4ZCIA 3LQRA 2BBOA 2EFEB 2H17A 3R20A 4NL4H 3ETLA 2KB0A 1E9EA 1XD2A 3K0AA 3OIUA 4DCVA 4A15A 1BYUA 1RW4A 4NPHA 1GDDA 5CYPA 5DO9A 3IBYA 3TVDA 1G20E 1HURA 1BOFA 2ZE7A 3SU8A 4TTQA 4RD4A 2D62A 1R0ZA 2F7SA 3M4YA 1E3MA 1K6MA 1KJWA 1O87A 1S9DA 2NG1A 5CIWA 4UNPA 2A5FA 3MG9A 2J1LA 3CRMA 1OF1A 4PO9A 1U0LA 1E0JA 4GZLA 2HYDA 4DB4A 2WJHA 2Q21A 3AB3A 4CF7A 1RC8A 2Q3MA 5TXGA 3TKLA 4BFVA 2DYKA 1U9IA 3BS4A 1KK1A 1ZVQA 5HR5A 2XB4A 4FI3C 4OK3A 4RKFA 3L43A 1S3SA 1NLFA 2W6JA 1LF5A 3SJAA 1ODFA 4TSFA 2NOAA 2RGNC 4RY2A 3W90A 2OFOA 2AWOA 2ZU6A 2V8OA 2ZI6A 3OHMA 1IXRC 4P31A 2QZ4A 2ASEA 1E2KA 4KCGA 2IWRA 4V03A 1F2UB 4L16A 5L3VA 3FKSD 2Z6VA 2IUSA 1MRNA 5DIFA 2QQEA 1Z28A 1X3SA 2D3WA 2XSZD 4QOSA 1NBMA 2D74A 5H8WA 2SHKA 4JMPA 3N70A 1FQKA 2UZIR 5EUMA 4CDGA 1ZM2A 2ZEJA 2CLCX 3KXLA 4DCSA 1DEKA 4QM6A 4BFWA 3L8YA 5TARA 2X1VA 3ZIAA 4XSHA 3ZS8A 5AUPB 2KI5A 1MKYA 3U3KA 3VMFA 3LAWA 3LBNA 5LD2B 4L8GA 2ZRJA 4KHZA 4CEIB 2AD1A 1XTKA 2QL6A 2IYUA 1E4VA 2PMKA 2I1QA 2C95A 3SFVA 3U5ZB 2FEOA 4LBWA 5GJCA 4EKDA 3X1XA 1DTSA 4LC0A 5CDFE 3I32A 5FBRB 3CZQA 1QHXA 3EXAA 4DLYA 1Z07A 4URZR 1XTJA 1R7RA 5CJPA 4CT5A 3UMFA 2FWRA 3GLHE 4D4JA 2PX3A 3EAQA 1T9HA 2QSYA 4PANA 3DO6A 4L15A 4K8OA 5F9FA 4HZUA 3GJ7A 1N6IA 4WZAE 4G3XA 4WXPA 5HE8A 3K0EA 421PA 2UVQA 4PHFA 2OCAA 3WMFA 2GEDA 4LX0A 3T61A 5GVSA 1IY2A 4P0TA 2O0JA 1CR1A 1CJVC 3NXSA 4E03A 2FNAA 1DG3A 1ZIPA 1H8HD 4Q4LA 3B78A 3AP3A 3KX2A 1D9XA 4NKRA 3C41J 3SFZA 4DCNA 3BAFA 2V54A 5DNYB 3AKDA 1PLJA 4OQFA 2GA8A 2OILA 2FG5A 4GT1A 1I2DA 1XWIA 4F4IA 1ZCAA 2MMCA 2AXPA 4PQYA 4LHXA 1KNXA 4JIMA 4KJZA 2D2FA 5CDFA 3TNFA 3CH5A 1XJQA 3JZMA 1G8PA 1UKYA 5FR2A 1GUAA 4YDSA 1UEIA 3HYRA 3GLHA 3IPYA 2J0VA 2ZSFA 3NIBA 1KDTA 4AY2A 1T3SA 4A0FA 3ZD7A 2P2LA 4LZZA 4XVUA 4DEYA 1FTNA 1SKQA 3KKOA 4UKDA 4C3ZA 1GKIA 2BEJA 4ARZA 5LB2A 4Y0AA 5JHHB 1NP6A 1ZUIA 1I4TD 3ADBA 3NHBA 2JLYA 2QRZA 3G0HA 1X1RA 4AYWA 2V6IA 3FMOB 3TK1A 5FOTA 3P26A 4DSUA 2VSOA 4G01B 5KDOA 5AJZA 3QSYA 4MITA 1K8RA 4TMKA 1NI3A 3DZDA 2WAXA 4QM7A 3THOA 4KITB 3IO5A 2GCOA 1ZUHA 4C7OA 5KNBA 2O0KA 4Q19A 4UXJA 3DM9B 1JR6A 2VP5A 2C2HA 1ELOA 2IYTA 3K0SA 3MLEA 1G7CA 1Q12A 4JT2A 4KLZA 1N5IA 1U8ZA 2C03A 4TL8A 1XP8A 4MKIA 3A1UA 4NYMR 4IFBA 1E1QD 4MUAA 4M1YA 4MKHA 1KO8A 1J70A 3F5FA 4CEJB 1U9IC 2XX3A 1SQ5A 4OHYA 4QHTA 1DOAA 2FSFA 1XTRA 2ZRFA 1J8MF 3H4MA 3JZAA 1E9AA 1KHTA 3FMFA 4M1KA 1KSFX 1F5NA 3ZQJA 1TQ4A 4MDFA 4AG5A 4IDHA 1K5DA 1Z2AA 2WPDD 4X8OA 3KZ1E 1QVAA 1Q57A 1LS1A 4Q66C 3WRYC 2AHOA 1E4YA 4A92A 1LF0A 1US8A 2WOJA 5HCNA 2J0UB 2Z83A 1XCPA 2XZOA 1W0JD 3TGPA 4LJ8A 4QBFA 2HJGA 3B82A 2QM8A 2WZQA 3KUCA 1I4DD 1XTIA 1XMJA 4BLPA 2P65A 1OH5A 1OKKA 4KI0A 3ECCA 3EWAA 3SE0A 1L8QA 1WMSA 4YDHB 4D4KA 3NWJA 1Z8FA 221PA 5FTNA 3SDZA 2ZANA 3U7GA 3IBGA 1OB2A 2BCJQ 4EIWA 2ERYA 1N0WA 3LXXA 3QNUA 3W5JA 5FUYA 3NDPA 1S96A 1ZNWA 2H18A 4UNNA 2YOGA 4PC2A 2AKAB 3BE4A 2F3TA 3BH0A 4KXFB 3NBFA 3BFXA 4Q4HA 2GZAA 2J9RA 4V02A 3GP8A 1XCGB 3RNLA 4TYQA 2DHRA 3RAPR 5BXQC 1EG7A 2QM7A 5TVKA 2UZ3A 3SI7A 4ZCMA 1TF7A 1FP7A 4PHHA 2IYSA 4M1MA 4B2PA 4ZDIA 4ZDJA 1VECA 2IYVA 3B60A 5K8TA 3EW9A 3KFVA 4WW0A 2OESA 4Q03A 4Z8XA 2ATXA 4KO8A 5DISB 5EP4A 1M6NA 3DEFA 4P32A 5B57C 2EU8A 3LRPA 3FPAA 4GOKA 4FXPA 4RCZA 3SJCA 1ESNA 4A8JB 1JEEA 4PPGA 3VKGA 1GNPA 4Q9KA 2JLXA 2IS2A 1U8YA 1DO2A 1E2GA 2WM9B 4BLRA 4O3MA 4KYUA 4YMUA 4ASUD 3RS7A 4EFMA 3EZ9A 3ONWA 1A2KC 3RWMB 2JLWA 4PXAA 4M53A 4TMWA 3VX4A 1GAJA 1Z63A 4XWAA 4KFRA 4B6FA 2P6NA 4LHWA 4BLQA 3K0CC 4QKQA 4XTRA 3ZQ6A 3I72A 2ZM5A 1M7GA 4BFSA 1JBKA 2RH5A 1IJEA 3GFTA 5BN3A 2W00A 5BWMA 4JYBA 2AK2A 4P4UA 3VR5A 4NTZA 2RKOA 1SULA 4BLTA 2Q3HA 5AJXA 2CVHA 4ZKEA 4PR0A 1Z83A 4R71A 5L3SA 1G3QA 4XIGS 2A5DA 1OYWA 4M8NE 1FUKA 3NG1A 5KSZA 3K1JA 5FI1B 1KJYA 4B3DA 3ASYA 5CK5A 4BPBA 1JNYA 3CBQA 3QG1A 2GJ8A 3W9YA 2YWHA 2IL1A 2ZVQX 1SXJE 1J90A 1XD8A 1S1MA 1XFAA 1IN4A 2IEYA 2IXEA 1ZAKA 3CF2A 4IEEA 5FFMA 4A4DA 5L3SB 1E2PA 3CH4B 2V1UA 3QQ5A 2B8TA 4TQUS 4HSEA 3Q9LA 5JFGA 5LPNA 2PZFA 3MWKA 3R8FA 3K70D 1UAAA 1JXOA 3CM0A 4NONA 3AVXA 1HV8A 1OE0A 2VP6A 3QIAA 1VCOA 4A2PA 3FFAA 3A37A 4V0NA 4HATA 4CRWB 3AKCA 2PT5A 2C9YA 3QUSA 4MKGA 1IXZA 4FCWA 2GTPA 4X8MA 2ZSAA 1E2MA 1OXVA 4IOMA 3Q5EA 2FZ4A 1AQUA 3AH8A 4LI0A 1M34E 1EFTA 1UEJA 2NZJA 1R4AA 2PL3A 1UF9A 2BJVA 1E2IA 2GJSA 1PUIA 4WOPA 4XSGA 4G5RA 2AK3A 2C78A 4P4SB 3CUEF 1JQJC 2ZR0A 2BMDA 1Z22A 3KQNA 3AGQA 2GZHA 1E94E 4B75A 2EYQA 1N6HA 2H1LA 4NCJA 3HPRA 1IAQA 3PFIA 2J59A 1N6RA 1SVIA 3CO5A 2V4ZA 2ZE5A 1P3JA 4JLOA 4JLJA 5FUVA 1R0YA 4YXWA 2UKDA 3QPWA 3OEHA 1L2TA 4D81A 3OEED 2JJ1D 3L0SA 4DSOA 3SYLA 1COWA 1NN3A 2BMEA 3AUYA 3WP1B 4LSGA 4Q21A 4DSNA 2XB2A 1OH7A 1E9BA 1CTQA 2XGJA 3NH6A 2XZPA 3AEZA 2RGEA 5J47A 4HAUA 4LC1A 5CM8B 5G3YA 5E7MA 3GLIA 3F3YA 1DAKA 2QAJA 2VF7A 4D6PA 3NDBB 2ZJ2A 3VHXA 2VIIA 1HA3A 2NTYC 2ZPTX 2QPTA 2NPFA 3T1TA 2J46A 2JA1A 4HZIA 2CJWA 3TAUA 4PAQA 1DADA 1KO1A 4KFUA 1G19A 1TL7C 3GLIB 3PG5A 2ZVPX 3BFVA 3WYFA 3HR8A 2DWOA 3Q5DA 2OBNA 1AQYA 3ND8A 3I5XA 3NEJA 3ZYCA 5FTLA 3KJIA 2CJWB 1DARA 1YZKA 2V55B 1CRQA 2C77A 3CB4A 4HAXA 1L7VC 1W36D 2FPLA 2YKGA 4IDPA 2A5JA 4GOXA 4AYTA 1ZNZA 4ACBA 2TMKA 1GILA 3UG6A 5C4MA 3R9XA 1GOTA 4LJAA 5DLQC 1QRAA 3VR1A 1ZNXA 3K09C 1FW6A 3CR8A 4GP6A 4EJSB 2VEDA 2L0XA 5FTMA 5F3WB 2WWWA 4IXNA 1G64A 5JMTA 3EPKA 5EUQB 4JT4A 5H68A 3JVVA 4QGAA 1GM5A 4WXRA 1HH4A 3ZD6A 3DL0A 5FBLB 4LHZA 3MJRA 1CR4A 1PLKA 2VRWA 4LYFA 1X8LA 1YRAA 3L2OB 5DGXA 3AVVA 2ZITA 3RS5A 4FMCF 2QGZA 4DT1B 1P62B 4TMXA 2QEQA 4DDTA 5JWRA 3BERA 1OFHA 4EUNA 4II7A 1OJLA 1D9ZA 5TDHA 3SEAA 2IA5A 2VSFA 1KK2A 1TF2A 2IWHA 2F1RA 3KFXA 4A0RA 2HLDA 5G53C 4HLQB 4CEHA 1E2HA 2LKDA 3I73A 2PH1A 2FGJA 1XEXB 2I1VB 1EFHA 3KUDA 1AS0A 1TUEA 1OLOA 2OSBA 2IXFA 1T3LA 5KPJA 4NYJR 1QDEA 1P7CA 4QNRA 4B44A 3HWSA 1JAHA 3ZZUA 1C4OA 1E9SA 1R8QA 4WIAA 4DLWA 2WWIA 4S2EA 3AVWA 1QHHB 3LXRA 1J99A 2VSXA 3W3ZB 2YOFA 2D7DA 3HDTA 3GJ8A 3BK7A 1VG8A 4JKYA 2O8FA 4TMVA 1TPZA 1WDTA 2WSSD 1MO6A 3O8RA 2BCGY 1E9RA 1TADA 2PEYA 4TZ6A 3KKMA 4IVRA 4CYMA 2GESA 4URWR 1W1WA 4I1SA 4DUGD 3PUYA 1JALA 2O8FB 3NC1C 1P9RA 3U44B 3Q85A 1WBDA 4BE7B 3BD9A 3VR6A 2WWHA 4P4TA 1E2NA 3EZ7A 4L5BA 1NSTA 4TSFD 2BDTA 1E9CA 3MWJA 1HEIA 2ZRKA 4X8HA 3TH5A 1SXJC 2BBSA 1E69A 2CCGA 1GVNB 4URYR 4N1AA 2HYIC 5J4HA 5EE1A 2DPXA 3FHOA 2PLFA 2W2VA 5D3MA 1NVWQ 2J5XA 5EE0A 3WHKA 4DZZA 2CL6X 4KVGA 1NBMD 3THWB 4PHGA 2ZUBA 3FWYA 3GMTA 4DLRA 4MGZR 4B43A 121PA 4BQSA 4BZXA 2PBRA 5L3RA 3R7WB 5BN5A 4GP7A 1W36B 4TZ0A 4C0BA 1P73A 4BLSA 4PX9A 4A36A 4TMTA 2AX4A 3FFBA 1II0A 3K9NA 3QKSA 4FMDF 2OAP1 2R6FA 3GJ4A 4U00A 1YZNA 3SOPA 4Q1FA 2FEMA 3TJZA 621PA 3E1SA 2GF0A 1A5TA 1BIFA 4KSCA 4TWZA 4XD7A 3TQCA 1S9HA 1VCNA 1GG2A 2B6HA 2JAQA 2ZQ5A 3TR5A 3GLGE 1OB5A 4M9QA 1ZBDA 2ZRAA 1TQ6A 1RPZA 3P20A 2F1JA 2NGRA 4IDQA 4FIDA 2B21A 3GJXC 2KBFA 2OXCA 3FGNA 3M1IA 1DE0A 2C99A 2JLRA 2OCPA 3WYAA 1FFHA 2J41A 4W9MC 1N0VC 3SN6A 3T06B 4B3FX 1OHHD 3ZS9A 5KO2A 1Y63A 2G1JA 4ESVA 1FX0B 4DJTA 5J4YA 5E3HA 2A30A 2DFTA 3I3SR 4HDOB 4B73A 5KSYA 2NO9A 2ZR9A 1W5TA 1M74A 1OXXK 4A1FA 3THXA 4JLAA 2GK6A 3AP2A 5P21A 2BKEA 4NYIQ 1NVVQ 1KMHA 1VMAA 2WMOB 4AI6A 2HUPA 1E2FA 2JJ2D 4RZUA 1E6CA 3RDPA 3THXB 1V43A 3QKRA 1C1YA 4JS0A 4M1WA 4MKFA 3AP1A 2H7VA 2P6UA 3GLGA 2IYWA 2F43A 4TTPA 4CGZA 5HPYB 2IF2A 2FPKA 2OUKA 4OQNA 3ZVNA 1A1VA 1JEDA 1U98A 1XD2B 3K0AB 4EPVA 3RC8A 2CDNA 4OI2A 4ZV4A 2VF8A 4BASA 1E79A 5JZVA 3KJGA 4MRSA 3GLFA 1TTTA 2ZYUX 5JS8A 3IKJA 2D4HA 2QMUA 3AF4A 1G8GA 2FSIA 4H1VA 4IOKA 2GEUA 3E70C 2ZRNA 3R9IA 2ZREA 1SVSA 4V0LA 4TLBA 2FH5B 3K70C 4HAWA 5EE9A 1KTVA 5CIQA 3GLFB 1MABA 1FZQA 2XITA 4D2IA 2GVDC 4V0MA 3D8BA 1R10A 2WKPA 3OE7D 3WYGA 4Q00A 3X1WA 3QY0A 1KAOA 1KI7A 3B7GA 4E22A 2GRJA 1W49A 1GFIA 4NHOA 2OCYC 1IONA 4XWKA 4Q5IA 1JPNA 1OIWA 2OO7A 1D2MA 2EVWX 2Z0MA 3LX8A 3SHFA 1GL6A 1UKVY 2GILA 2QP4A 1P5ZB 1RYFA 4JJZA 1E96A 3W5IA 2VL7A 4CIDA 1JR3E 4RD6A 4DVGA 4OI0A 1AA9A 2F55A 3CRW1 2Q6TA 2J7PD 4FINA 4TLCA 5DH9A 3SYNA 1LS6A 4KVAA 3QBTA 1RJ9A 1QHIA 2QE7A 2X8AA 2Z4SA 3T1QA 4RD1A 2NMVA 1E0AA 2X2EA 1AIPA 5BQ5A 3UANA 2G77B 2ZRGA 4GOJA 1W5SA 1F60A 1NF3A 1SKYE 2EQBA 4DDUA 3WY9A 2C04A 3VU9A 4MRVA 2ZXUA 4LBZA 3ICEA 4AKHA 4HDCA 3FE2A 4JYCA 1GNRA 3EZ6A 5B30A 2PZEA 1IXSB 4GFDA 3A1TA 2ZRPA 1P6XA 5IDVA 3H1TA 2Q9CA 5KUTA 4E5UA 3B1XA 1PUJA 3OAAA 5EXTA 3VU9B 3ZDQA 3OFNA 4TT3A 2C9CA 1A4RA 4B76A 3CKLA 1BS1A 2ZIAA 4KODA 4LRWA 3NBZC 2ZJAA 1A7JA 3VNUA 2F1IA 1OXUA 1RIFA 3KKPA 4C9BA 3TR0A 1KI8A 1W2HA 2XOKA 3AF1A 4PFSA 3QKUA 4PSAA 1KZ7B 4FWIB 3WNCA 4Q7LA 1DELA 1MO4A 2N42A 3B1ZA 2IYXA 3PXGA 4IKEA 4C0SA 1II8A 2QG6A 2DCUA 2Z43A 8OHMA 4XVQA 3EPLA 2G0NA 1AZSC 1N6KA 4HZUB 3CNOA 1EWQA 1ETUA 1P2VA 5C2JB 2C9OA 4Q48A 1DAIA 2VPPA 5DI3A 3KQLA 3U4QA 3ZZTA 4DWJA 3GFOA 1BO6A 3EIHA 3FYHA 3W6NA 3GD7A 4I1VA 4IW3B 5EE5B 2IS6A 2N1BA 3SZRA 3U3JA 1S1CA 4RFVA 4M1TA 2WWYA 3HU2A 4IJMA 3L8ZA 3FVQA 3K0CA 3SJZA 3O8BA 1G21E 1Z0DA 1NMZA 3ICQB 3U4QB 1NJGA 3AVUA 4LPKA 2QNRA 4QGFA 1V5WA 4POAA 1YJ5A 5F2EA 1WE2A 3X2SA 4OQMA 1PZNA 4LUCA 4E09A 2E1RA 2QUZA 3K9HA 1XPRA 5GJBA 1P2TA 2Q9BA 2CE2X 2WV9A 4FD2A 5FH9A 2QORA 2IHBA 4FN5A 1DG1G 5ANRB 1RFLA 1BKDR 2BKUA 3I1FA 1P2SA 2ZI7A 4LBYA 3CRVA 5LDDC 3GLHB 1PV4A 3DHWC 2A78A 2NPIA 2FDCA 2RGCA 3AF0A 3BBPA 5K8LA 3LA6A 3A4NA 4US0R 2EW1A 2GKSA 4MH0R 3ZJYA 1YRBA 4ARZB 1DO0A 2PJZA 5FBVB 2ODEA 4BUJA 1S2MA 3MWYW 1G8HA 3W3AA 2WMNB 2X77A 5KHOC 2QGNA 1WP9A 4NMMA 4PPNA 4TYWA 3Q7QA 3H0KA 3QXHA 1GKYA 1RRFA 4D82A 2ODBA 3U7HB 3HR7A 1P75A 1T0JB 2QN6A 5GADl 1G4UR 4MYTA 4DIEA 1KI9A 3RC3A 4C7OB 2GCOB 4HB3A 3C16C 4DDVA 4TLAA 1Z08A 3BH6A 2ZTSA 2CHVA 1G8FA 1FP6A 1UFQA 4MQBA 3ZH9B 3FKSA 5F9HA 3IIKA 1B0UA 2JDIA 2BM1A 3LH5A 5DSZA 4OHZA 3BB3A 2KBEA 5FPYA 3Q7PA 4F4JA 1N0UA 3GCGA 2VLIA 4A0HA 4BFTA 3AQ4A 2XJ4A 3V4FA 3PIRA 3RABA 5FOSA 2ZSEA 3TUZC 4ACAA 4BZPA 3HPQA 4PSVA 5JWOA 1S8FA 4DB2A 5CITA 1EFRD 2IT1A 4K46A 4MYHA 4ZIRA 5IK2D 4XWOA 3PEVA 4FCTA 2QU8A 2NZ8A 2RMKA 1G1MA 4MRNA 2WAYA 4Q1AA 1G9XA 1GSIA 2CMKA 4EPTA 1P60A 1NJFA 3VHLB 1Z0AA 2GJ9A 4QBHA 2FSGA 2RAPA 1US8B 2X2FA 3W6PA 3AVOA 2AFIE 4JVLA 1YR7A 4QHYA 5SZKB 2C8VA 2CK3A 2OBLA 1Z2CA 4UXHA 5CYOA 5AUOB 1XX6A 3I8SA 3QPVA 1VTKA 1GWNA 2ORWA 2O0HA 1M2OB 1L4YA 3PUWA 2IYLD 5C1BA 2NO1A 3REFA 5DN6D 2KJQA 3GFPA 1G7RA 1I2MA 1E2EA 1NN5A 2FJUA 3VX3A 3FMPB 5LD2C 4TQAA 4KFSA 1KK0A 1KI6A 2R8RA 2XXAA 2V7QD 2ZUCA 1DBSA 2AKYA 2P0EA 1FUUA 1W4RA 4JVMA 2AL7A 2VHJA
chains in the Genus database with same CATH superfamily
1PSWA 2FGKA 2C57A 2B4AA 4CQMA 2C3UA 4ZHQB 1CF4A 2C8JA 1ESZA 1ECFA 2IUFA 1H8HA 4CQLB 1W36C 4LGCA 1IN5A 1EP2B 4M54A 3S27A 2ZYTX 3PBKA 2FI1A 4PQFA 1OZHA 4WACA 5CPFA 4A91A 4EFNA 5LWHA 4QRIA 3U48A 2G7ZA 2JLAA 1AKUA 2PZGA 2OGSA 3NOOA 4QUDA 2W2KA 2AVNA 2HFJA 1B76A 2RI0A 5KYKA 3SQWA 3MB5A 2AFIA 1TMKA 3H9JA 4FKMA 5FL3A 3RVMA 3K3PA 4KO4S 4KX3A 3WLIA 5HK8A 5JG7A 1BG6A 4GOND 1XEAA 2HBQA 2P35A 3ER9A 4GLBA 4UUMA 5ADVA 4IV5A 1M1YE 2JATA 4TYNA 4OBBA 4AO7A 4HYTA 2FU5C 1WXFA 4LV5B 3DCIA 2G08A 5JNTA 2O6HA 1T5OA 1E0SA 1TA9A 4WZBE 5F9MA 1JHAA 1UBGA 3O9MA 3ROXA 3IAEA 2QRVB 1K7EB 3IAHA 1N6PA 2O3QA 3AERA 3K30A 3OIFA 5BYJA 3ORHA 2I71A 4RETA 1LDMA 2VAWA 3U61B 4CTMA 4BX8A 1QV6A 4D8TA 3W8FA 3HRIA 2NSYA 1LBQA 3IAM1 3THYA 2HPZA 3FETA 1ZCBA 5H4HA 3MJHA 1A96A 1NRWA 3GGDA 3M6AA 1LI5A 5BOSB 5T41A 1AQLA 3BH7A 1Y9EA 2J3DA 3Q8XB 1CEQA 1HC7A 1YDFA 2O07A 1N2OA 2VVTA 4ZT7A 4G5SA 4BO8A 1Z37A 4N5LA 1EFKA 1D6SA 2V7GA 2XBMA 2ZUWA 5M5BA 4J49A 4TKLA 2HQ1A 3AYXB 2DOKA 3AFHA 1AKNA 5F1OA 3KUUA 3OJOA 4GPTA 3U6BA 2IX3A 1VSBA 4MQ4A 3TEFA 5EMNA 3NHLA 2RGYA 3AMVA 5AXDA 4BNWA 4Z7NB 1RE1A 3BXPA 3HS3A 3AEUA 3B13B 2LIVA 4ZI2A 1P45A 5I4BA 1NMXA 1W46A 3D54D 3QX8A 4IJWA 4NFSA 4O4HA 4LGMA 4WGFA 3BIXA 3MGCA 1GT91 1KNQA 4QGSA 3QPUA 4LOHA 3P9PA 2A1TS 1OZFA 2ODPA 2QDKA 3EAGA 4NCXA 1CPYA 1RHUA 4N3AA 4RDHA 4KR6A 3EVGA 4LWZA 3SBXA 1E1QA 1OAKA 3O3CA 1U0GA 5IT4A 1PWZA 4FW9A 3H04A 1Q17A 1MO5A 4L0CA 4GWGA 4M21A 1FOEB 4BO6A 1G3RA 1GKLA 2QTWB 4C0KA 4G1UC 4HQ0A 2GH1A 2AI3A 3FCAA 4W7IA 5BN4A 4EMBA 2P1ZA 3PHCA 5AJYA 1S7CA 2HIGA 5KNLA 3HL4A 4LXIA 1TIPA 5JZVA 4I6EA 3PGA1 1JHRA 1I0IA 5KWVA 3D1LA 1EVYA 3TE6A 2CDBA 2IKSA 2R6JA 4Q12A 3ZDZB 3UJDA 1FF9A 2A9PA 3PNYA 4V0KA 2IZ0A 1M2EA 2NU7B 3ADDA 4I4TB 4EFLA 2G0TA 2EAUA 1QQBA 4UQOA 3QFRA 2CNWD 3GRRA 4IVNA 2GN1A 1CV2A 1FDIA 5DULA 4E46A 2AZTA 1WU8A 3ZUPA 4X1KA 5K6RA 3TL3A 3JQFA 4HJXA 2XZLA 4QGGA 4NU0A 3O2SB 3KHTA 3UKDA 4EFKA 4XX1A 1XQ1A 2VQ3A 2VQSA 3A14A 3ZEIA 4MUIA 3CUTA 3AT1A 1ZD8A 5H81A 3JCZA 1E77A 3IUYA 4A6XA 2GDJA 2E49A 3DYBA 3P19A 4X93A 3KAQA 1JU3A 4EHHA 3JSXA 1KXZA 3AB7A 3CMMA 3OZAA 1DG9A 1K3UB 2JCBA 3UYKA 4AKIA 3S55A 5DK4A 2QUBA 3K32A 3CEJA 1JBQA 5BWNA 5C5EA 2GN4A 2XW6A 3RTDA 3WAGA 5ICMA 2M32A 2MT9A 2FZLA 2PU5A 5AI0A 2EGUA 1QE0A 4L2IB 4CI0B 5I45A 5FPKA 2W2MA 5TGDA 1PU2A 1RP1A 1WUTA 1PQUA 3C7TA 3BEOA 2AWNA 5ILGA 3TFQA 4AZ3A 3DXZA 4Z8YA 1Z6XA 2WG1A 5EVJA 3GLUA 4OP2A 5DNCA 2O3JA 2VT3A 4QUAA 4ENVA 3RVJA 1V6CA 3KLPX 3UV6A 2FV8A 3WMEA 1LLFA 4PZPA 2CHEA 1KIMA 1ATZA 1VP3A 4DG5A 2H9AA 1BVUA 3HXKA 1ANKA 3KQUA 4XKJA 1KZ6A 3WAKA 3TJMA 4QT4A 4HN9A 3VI3B 1QFJA 4NJMB 5E2IA 1QG4A 5EZYA 3GHYA 3ZGXA 1FDWA 1KY3A 3RM3A 1A7AA 2HU2A 1F2TA 4KR0A 1X15A 3FRJA 4JKOA 3WJAA 1JJVA 1SC9A 3L8EA 3L8CA 4NFLA 3AWDA 1I4WA 3A58B 3PENA 1K8QA 1QYXA 2QUAA 4LRUA 3HL0A 2FSVA 1D03A 2WE8A 1LFDB 2XDQB 4O3FA 4QPJC 4BQRA 4D3SA 5BSUA 4QBKA 4UTNA 4W5QA 3LYAA 1JJIA 4IIVA 3UMYA 3WOHA 4DILA 1SRRA 1WQ3A 2WHPA 4PAOA 1PT8A 3VVBA 4TL6A 3T3NA 1N3BA 1HM5A 3EMKA 4ZMSA 4B82A 3GUVA 3W8DA 3B2EA 3F5SA 4AY4A 1EJBA 2C5AA 1HYEA 4RFSA 2ZT7A 1RYEA 3C3KA 3CHYA 3THWA 2QROA 2GETA 1YQEA 2XQKA 1TVEA 2JEOA 1YDEA 3DUWA 3HXPA 4IYJA 4EVRA 3N53A 3ISTA 4Z6KA 1DVRA 5B53A 2FMTA 5EXDA 4YJFA 3B53X 4D7AA 1LV8A 1P77A 4DQXA 4P33A 1M0SA 3D31A 1S3FA 2H1FA 4N49A 4GLJA 4RPIA 4UD6A 3PLRA 4KN9S 3RS2A 1NVKA 2VDMB 2C29D 1TYCA 1P2UA 3KT6A 1PGJA 2VJDA 4NCNA 1DGQA 2JGRA 3LJKA 3T5MA 1YE8A 3FSEA 4JI7B 1L4EA 2I55A 2XUZA 3PDIB 4O1MA 3F73A 2A9QA 1WY5A 2HI0A 3QW2A 4HTFB 3HJUA 4EY6A 2ZUEA 1OGJA 1QJCA 1LTKA 1ISFA 2R7KA 5TB5A 3P1JA 2CLOB 3P97A 3IIEA 3TSYA 3FM9A 3WSTA 2QV7A 3V9AA 4DDWA 3VR2D 4G5GA 4E4TA 2IXTA 1XXHA 4KXXA 1NE7A 4KV7A 2R9VA 4IIBA 2W90A 5AKJA 5JD4A 1Y4ZA 3R74A 3S28A 1RLUA 1SHKA 1I3LA 1X6VA 3PFWO 3QXJA 4DV0B 1SQFA 1WMAA 4P6VF 5LYJB 1XJCA 3A0UA 1GCIA 3NGXA 3M89A 3DVQX 2BMAA 3OJWA 5SZHB 4C4PA 5AM3A 2PFGA 1V48A 1AC5A 1OAOC 3IOBA 3OLVA 3WDKA 3R3ZA 1EFLA 4P82A 2PSJA 2QNBA 4EOGA 1CQIB 2FLWA 2V5AA 1E6UA 2WIGA 3R6TA 2ZS9A 2VOJA 4KBFA 1V8BA 1YACA 1ZD3A 3ITKA 1IN6A 3L7OA 5DV9A 2Q6VA 1RZ3A 5EJMA 3MMPA 4NBKA 4OOEA 5SZIA 3NT4A 2NXJA 1GL7A 4L4ZA 3PJRA 4TN5A 1UJBA 1WJGA 2VPWA 2O4UX 4OKNA 4X45A 5REQB 2OE2A 1MH1A 2BZ0A 4G5YA 2JRCA 1NP7A 3EMVA 5EY5B 5FO1A 4D0RA 4C6SA 5AESA 2NSDA 2GX6A 4LVOA 1Q1GA 2OM2A 1L7BA 2MU1A 4ZGBA 2QVBA 3H2KA 4U2EA 1PV1A 3TM5A 4PC6A 5AXAA 1E66A 4B1FA 1JAZA 4MLDA 4M38A 5IEJA 4FOSA 4IUYA 1N7HA 2GJKA 4RKEA 1OX4B 2ODWA 3DE1X 3L7YA 2XXBA 4GBED 1EE2A 1HG1A 1Z74A 2CUKA 2FEXA 3B9PA 4PZ9A 2JIMA 2M1ZA 4G1VA 1B4DA 1IPHA 4UMDA 4QE3A 3D3WB 4KQGA 1G0OA 5F77A 4YPFA 3RTAA 4Z4IA 4FR2A 4RMIA 2P5UA 3ZJ4A 4AUNA 1J06A 4DR6B 3LD9A 4ZCPA 1XCLA 1KO7A 1MAWA 2GCNA 3GRVA 5KNCA 4FEYA 2JGKA 4AKEA 2Q5LA 1P9OA 3K0FA 1N6OA 3LKDA 5TQ0B 2P9ZA 3FX2A 5A7HA 5TE9A 3VPBA 5B3KA 1HE3A 1H9AA 1M8FA 3LQQA 5I8WA 3ERCA 4PYLA 2CYCA 1AZTA 4X62B 3UK7A 3IOCA 4Q1EA 4J76A 2AYYA 3ULKA 3BZUA 1S8NA 3BXZA 3VR6H 3ZKAA 4LRXA 1QMGA 2NAPA 5LZ4A 2PQ2A 3HU1A 1A2OA 4ZO4A 3MLAA 5J59A 2QZJA 5KNCH 4KACA 2POQX 1XC7A 3FPBA 5F35A 2VAVA 3SZUA 1ID8A 3KQSA 3LGAA 4JAVC 1NL3A 2QLMA 3ETCA 4G09A 1FXWA 4B3BA 4C0JA 2I9PA 4CM8A 1Z5WA 2XNDA 1VG0B 4AP9A 2WLTA 2EFYA 4Y67A 2BPOA 4QUJA 1XZNA 1YSCA 4W5HA 2LCQA 5ABPA 4B32A 4UNSA 5CNKA 3C5HA 4ZT3A 4DLZA 5K8VA 1FNNA 4PFJA 2XUFA 3CISA 3DMTA 2ACVA 5BN5B 5KKAA 1I2BA 4GIBA 4I8IA 1IM2A 3NDRA 3OZEA 3RJTA 2YUIA 1W73A 1FY2A 2JCSA 3V3KA 1G291 4BLWA 1EUQA 2DPLA 1ZVVA 3ZCRA 2VBGA 2DETA 2F8SA 1LLCA 1WU7A 2PX5A 2QTBA 3H5IA 3I12A 3QKSB 3JQAA 5TX7A 2BBTA 1IH8A 2IUEA 4ALMA 5A0FA 3U3OA 1CEXA 3FR8A 2YFHA 3HJCA 4GXRA 1NFRA 3NUQA 1YBHA 2ZIWB 5FWYA 2C5LA 3ISJA 1QAMA 1X9IA 5IPFA 2YWEA 4YREA 4RC9A 2IZ1A 3QXCA 4IDGA 2O2SA 1QK5A 2QD5A 3OP1A 4MV1A 4BB6A 4N8SA 1N6LA 4DJFC 3AVTA 3TQFA 4RANA 1ISGA 1NLYA 3U7JA 1A9TA 2Y67A 4Y1RB 2QB5A 3SQOA 4RTLA 1CUBA 4RF4A 2B4TO 2XUHA 2VQ6A 3FHCB 3CF6R 1T6NA 1I3OA 5I8PA 4OIFA 1N2CE 5DCWA 4ML3A 2PGDA 2WJGA 2M9MA 2YYSA 1I7PA 3JWJA 5M3BA 4A73A 3GT7A 4D3DA 3HNPA 3WGLA 1D4OA 1VJTA 1KAGA 3HHPA 4X90A 4MMXB 3Q3VA 2ERXA 3IJPA 2I4LA 3T38A 2P6MA 1Q11A 1VRVA 4IMJB 1KY5A 1TEVA 3GAFA 4IJ5A 2E4WA 2C07A 5CJ2A 5DLDA 2D2EA 4WFQA 4B7CA 3X0DA 2DPYA 5FPHA 2GM3A 1QFZA 3DEKA 3S8MA 4FK8A 1YI0A 1EA5A 1YR8A 1QLJA 3COPA 3E5MA 3I04M 3P32A 4QX6A 5B1EA 1K27A 1NM5A 1M2VA 1RHQA 2PV0A 5F51A 1JVBA 4PSKA 3VQTA 5BRJA 4R69A 4YAJA 5LL6P 1VIAA 4J0DA 4YT8A 2V58A 1KR2A 1XMQB 4FMBB 4N76A 1R0CA 2QPOA 2IXBA 1Z4IA 1M6EX 1S4QA 1SUAA 1T4MA 2YRXA 3EXIB 1FTQA 1DAGA 2HAEA 3CRQA 2OV3A 2FPGB 5HHTA 1B1CA 4L74A 3L82B 1YCGA 2C4HA 2ZATA 1KDPA 1YASA 4NESA 5ENDA 3VTAA 4EPRA 3SYTA 2O8DA 4NYIR 1NVVR 1G38A 3M6UA 2PGXA 3PC3A 2ANCA 2J4DA 3AF5A 4QRHA 1ESMA 1E6MA 1BQEA 2MYTA 2VDUE 3ZK9A 4COOA 5CIYA 1XP5A 1T2CA 3PNSA 2WHQA 1N4AA 1FK8A 1W5BA 1MEJA 3TD6A 3A25A 1Z25A 1PT7A 1RMQA 2BMFA 5TR9A 5INTA 3BICA 3OWHA 4LI3X 1HFKA 3GNLA 3ESQA 3VTKA 4F92B 3C5CA 1MO3A 3G2QA 4IH4A 1Z2OX 3RG8A 4C76A 1V5EA 3MELA 4NS4A 4JC5A 3QLJA 2PYIA 4I66A 4OGLA 1WHSA 2DUUA 1QRUA 2Q3EA 4P3YA 3TQQA 3G6KA 2FQ1A 4TYPA 2PE5A 2NYVA 2XCOA 4KH0A 1G3IA 3ND7A 3W3AD 1UXKA 4O29A 2ZROA 1YTUA 2OLKA 4OYHA 4DS3A 3AF3A 3G8AA 4Q4JB 2J9FA 2Y76A 1ZJ6A 3VRHA 4J1TC 1UWVA 1NP3A 2OZLB 3TMYA 2UAGA 3IQXA 2CJFA 2HIMA 1F8FA 4IICA 3RRBA 3OX4A 4C0QC 4CG2A 4RF5A 2QN2A 4Y2QA 3TNLA 4DEVA 4D9BA 1XDZA 4U5QA 4IXMA 1SUSA 4O2AA 3UXHA 3LPLA 1QS0A 4HNVA 3B2QA 2Y0DA 3QLUC 4UBLA 3RS4A 3M4XA 2C3YA 1PG0A 4WJLA 3JR7A 4WCVA 3VZQA 1U2PA 3FLMA 2E6KA 1QE5A 3KPUA 3KRTA 4EYQA 4FB4A 5C35A 2OEPA 1VJRA 1L4LA 5DGIA 1RWOA 4LGVA 6YASA 5K6AA 2GBPA 4MP8A 2JDID 4RD2A 2RBKA 1IEXA 2YN4A 4ETWA 4WUVA 2I3BA 1N36B 2ROQA 3VYTB 13PKA 3FSGD 4KUHA 3OSZA 2OXFA 5DWQA 4JI5B 1A82A 4GS5A 5HKAA 1Y3HA 3EZ2A 3OM0A 4B7XA 2XQVA 2XQIA 3I01A 4H15A 4K3VA 4CEIA 3OCCA 1WVGA 2RHJA 2VP4A 1OBHA 4O2RA 4YRZA 2PS9A 2P3SA 3P71T 4UM5A 2DSNA 3B20A 3U6KA 1G0NA 1NVUQ 1IPEA 4IR7A 4ZOLB 5E6UA 2I8LA 1H3FA 2I34A 4LNHA 5BSMA 3U49A 5I7SA 4KUGA 2ZIVB 5AJHA 4Q9HA 3KPVA 3V4RA 4FIZA 4C5CA 4HR7A 3WGYA 5K8UA 5JY1A 1FDRA 4FFWA 4BEJA 1BTOA 1NW6A 1PZXA 4MGHA 3OA2A 3BREA 4DRZA 3G0OA 1UH5A 3JS5A 3KQTA 2J0SA 3UFXA 2LP4Y 3VNVA 1GZ5A 2DR3A 3EC1A 3UT5B 4ME6A 1QKIA 3C3JA 1J33A 1QXSA 3D3KA 3NHAA 4HGPA 4OQLA 4FDMA 3TNYA 5IHPA 2FW1A 2RBGA 5DFAA 3OCVA 5EXSA 2VYVD 3PNOA 4WESA 1C7EA 4E2ZA 1QFSA 2L2QA 5FBWB 2B7BA 4GI7A 3VPCA 3W5UA 5CT5A 5K3DA 4F1KA 1BMFA 3KKNA 4FGJA 4MR9A 4AS2A 1QSGA 5K8IA 4KNVA 1P0PA 2ZAGA 1GTVA 4N65A 2J0QA 2QSZA 3U7QB 5A62A 2NUTB 4BP3A 5HF9A 1G59A 2H0RA 2G63A 1SKYB 3VBEA 1GU7A 3A6GA 4DJTA 1JPVA 3ID6C 1UFRA 2FAXA 1P4AA 2DJIA 2OCIA 3L49A 4ITRC 4RV9A 4LF5B 2X7XA 1QG2A 3TFOA 3ETEA 4PVDA 1KR5A 1RE0A 3G88A 1A4XA 4DJJA 4GO1A 4JNKA 3OTOB 3GU3A 3DYIA 1P33A 4EM6A 1EH5A 4CE6A 2KE5A 5EGSA 3KBBA 1I9CA 1D5WA 4H0FA 4GX2A 4GYJA 3IT1A 4PHTA 5AVSA 1DAEA 3ZJUA 1JECA 3QIVA 3GEDA 3HHEA 1SZPA 4BXOA 1XAHA 1UXGA 2MSCB 5HILA 3A9VA 3U81A 1KDYA 3OLQA 3F90A 4MW9A 5CA1F 3KVOA 2R8BA 4IJ6A 3SHVA 3KEOA 2MSNA 5C7LO 1KEZA 1SOUA 4CGYA 5F23A 3GOQA 4H6WA 3EOZA 3V1UA 1NR7A 4RY9A 4ZT5A 3ASUA 4GNKA 4X7MA 2NZUG 4S1OA 1T2UA 1HFEL 4S24A 3W9SA 4Y9UA 4MDEA 1RMTA 1JG6A 5HJ5A 2GBLA 3L6UA 1F48A 4LHVA 3ZGLA 1AQNA 4JX9A 4RYDA 1VSVA 3D2CA 4EB3A 3ROTA 5E1DA 2R1VB 1EEHA 4A2WA 4EKIA 1CJTC 4R0MA 4RULA 4S1NA 2LGJA 2YJTD 1EFCA 1TU3A 1ZW6A 1NZJA 4ZEOA 3VR5D 4YR7A 1QKJA 3O3OB 3O94A 3OTIA 1TKRA 3O8OB 1RXIA 4YRCA 1GGVA 1NOIA 4NDAA 4O4IA 2P9QA 2VI5A 5J40A 3TEJA 2D1TA 2DHQA 2ZSBA 3UCEA 5MGNA 3VH4A 1Y3FE 2OFXA 2OZEA 3KT8A 1G21B 4H1HA 3ROMA 2BR4A 4J9UE 5BYAA 3FYCA 2EHDA 4ZI7F 2WILA 4U02A 1UWKA 4OK5A 4AJ4A 1ILWA 3EZFA 4YASA 3V42A 2IS4A 3P7MA 1HDEA 3B1WA 5IXSA 821PA 4QDKA 3CLVA 4P3NA 5KX5A 1PR0A 2WFZA 2YICA 1GITA 2QRHA 4PZZA 5DBEX 4ZDKA 3GCZA 1CUXA 4KJXA 4CLRB 1ULBA 4PX2A 2J7PA 4S35A 1TDJA 3PXEA 1BWPA 4NBNA 3RVOA 2FPMA 3RT7A 2YV4A 2QMHA 4TMZA 1YS1X 1SRQA 1BDJA 4D80A 1XPOA 5EYPA 3HZRA 1G6Q1 1XYGA 3VTFA 2C7VA 2FR8C 2IP2A 1QIFA 3LOQA 1NXSA 2FSPA 3LUHA 4PNHA 3NTLA 1YGPA 1AKQA 1D5CA 4V2UA 2AJTA 3TZEA 4D5GA 5B6IA 1AJEA 2ZI3A 4WNYA 4W5JA 1JFLA 3A4MA 3L5OA 4OF4A 3H84A 4X65B 3AEYA 4KLNA 1EUCB 1ORHA 2LDXA 4PRYA 4M9SA 1EGHA 1BQ4A 4J7UA 5JDCA 3O4GA 1T26A 3ML1A 4CKEA 3OIVA 2Q1UA 1CS0B 3AR8A 1LW6E 4H7DA 1CUYA 3F4KA 4YP7A 3KELA 2RHWA 1IZ8A 4BMDA 1IWPB 2WP0A 2ZIEA 3A1NA 3TO5A 4GRDA 1U02A 4R8KA 3T15A 1C9MA 3SMQA 3A6JA 2WIBA 2C4TA 1KZ1A 3VOAA 4I99A 1D04A 3H2ZA 4P2GA 5G0TA 4OB7A 4YRAA 3TGWA 2GVZC 3LM8A 3UWOA 3HP4A 2UZAA 2YHAA 1XTQA 4FZJA 3ZGVA 1HLPA 1SUPA 1BXRB 1SXJD 1UBCA 2EYUA 2PKXA 1GG9A 2JFZA 4LYHA 2FUG6 4OXXA 4G0WA 2CFRA 1EM6A 2I87A 3C6YA 2PUFA 3D6UA 2F3QA 3ZY3A 4FOPA 4KR3A 3J81k 1QO9A 2DFNA 2CLSA 2Z1NA 1E59A 4F72A 1KI6B 4JT8A 4H2DA 2PL9A 4N0EA 2E7ZA 2VDVE 3VO2A 4Q01A 3WMXA 2K87A 2AFHA 3B2NA 3WBJA 2A3RA 3ZE7A 4Q7QA 4ZVRA 2JFNA 4UCFA 2VZLA 4CQMB 3FNFA 4F8EA 3BE5A 1DWOA 5AHXA 4YLYA 1YFLA 2Y3IA 1P5JA 1NN1A 2OD9A 5KOJA 3NHMA 5C5DA 1HL7A 4UTZA 3W4IA 1U90A 4BNIA 2I2FA 4EEZA 4UVDA 1E20A 4C3VA 5CB6A 2WTUA 1J24A 5K4AA 4BQPA 1B42A 1D2HA 4A8JA 5IZCC 2W2KB 2Q3JA 3GYGA 2GCGA 1CDOA 4YRRA 1SHTX 2X8WA 3UKOA 4CKWB 5KQSA 3HSYA 3W2HA 3P2IA 2AFIB 2QA5A 3NWEA 4FDLA 1J5XA 1MD9A 2MSEB 1A5BB 4MLCA 1QCZA 4R9UC 5JEEA 3U39A 1MENA 1XMSA 2O5VA 4GMHA 3LO5A 2QIPA 1RKBA 1R5JA 3EPRA 5IBPA 3QY9A 3NS7A 1SVOA 1FDOA 4MSUA 5B64A 3AERB 4ENPA 3GCXA 4XPIA 2YCLA 3AU8A 1LC3A 3GFSA 3ZLBA 4HAYA 1FUEA 1G8KA 3THYB 1ES9A 3TKAA 4D46A 3PU6A 1ZH4A 3C7DB 4II3A 3EN0A 1DIRA 1TT5A 2QS9A 1GTMA 1YHNA 2R1TA 1PKXA 2IOQA 4G5OA 3REGA 1SUWA 3BX1A 2D4AA 3NOXA 5GPBA 2NWQA 1OA0A 3EPPA 1ADCA 5JXWA 1VCMA 5KWSA 1T9GR 1D2EA 4GMGA 2PRSA 4HQLA 4JKIA 1QK4A 5TS3A 2W42A 1SPXA 2NW6A 2GNOA 4C7OA 3W1EA 1E3DA 1EWRA 1XF9A 1YNSA 4FQ5A 1F12A 4N3BA 4LYAA 2YJ3A 3WHLA 3QEBZ 4IOJA 1XA0A 4DV3B 2QUHA 3AEUB 4OXKA 2GCEA 3A6KA 3ORSA 4B6PA 4D6XA 1JEQA 2P40A 4O4HB 4KNYA 4N18A 5COAA 4F91B 1JDUA 1I3NA 3HO8A 4KOAA 3W8RA 5HXAA 2E2WA 2HU8A 2V65A 3IB6A 4KDRA 4Z9FA 5G3ZA 1RWKA 3NCHA 3O9ZA 5K99A 5A4DA 3FTCA 1OWMA 2F6RA 2QL7A 3OZTA 3BCUA 3EFHA 2X8JA 1MQSA 4OK6A 5EZ6B 1NYTA 1M2KA 1I7SB 2O54A 2NXWA 1WZEA 3JALA 3JASA 3UQYS 5B1DA 5BN4B 3ZR4B 4AICA 2HDOA 3TQSA 4AVYA 2Q6KA 4XWWA 1SXGA 5IK2A 3LUGA 4WLOA 2Q5IA 2VUHB 4TS3A 1OH8A 5GIOE 3ZZ0A 1LVGA 2WBLC 3MQ4A 1ZJ5A 5ECYA 2BMVA 2X2OA 3VPSA 3CXUA 3WFJA 1HWYA 3TIFA 4BY9E 2RJ3A 1ILEA 4BDTA 2J3JA 1NXOA 1DIAA 1FXUA 1E9FA 2HMAA 2X5OA 3PUZA 3PR3A 5FCDA 1JTEA 1Z0FA 2PUHA 1AZLA 1VKOA 2PG3A 3JQDA 4NJOA 3JQPA 4JLMA 4JJ8A 4KVZA 4X1KB 1OMOA 3KYCB 2RAFA 1SMKA 1X1TA 1LBSA 3IJEB 3IP7A 1PJZA 2A2ZA 2J3LA 3WI7A 4F4CA 2Q1WA 1YRQA 3IBTA 5IASA 5ALKA 1DZ3A 5L40A 1DAOA 1WMFA 3OQJA 4B71A 2JCVA 3GGCA 3HLTA 4C3OB 5KAMA 1OGIA 4OJNA 3D6VA 5HIMA 3ZY4A 4MYCA 4F5DA 4O4JF 2NVWA 1KZGB 2DTXA 4CTNA 3VA7A 4A0GA 5HJEA 3FGZA 2GBIA 3V2IA 3VYVA 1VL2A 3JVIA 3DNFA 4MIKA 4RJJA 3VUFA 1ABFA 1NKTA 1NQXA 2G1KA 3PXAA 2VKTA 4BL5A 1TIBA 2O52A 2VUSA 2XMGA 2R1ZA 4RWZA 5D5QA 5F5LA 3MJCA 3KYDA 4AZ3B 4J2OA 2Z5FA 4R51A 3WGIA 4W9NA 5AI8A 3BSFA 3BA1A 3ECSA 3EODA 3EGWA 5KWJA 2JLUA 4LVUA 3JQ9A 5DGTA 4HAIA 4GSYA 5CFQA 5JS7A 4QATA 3PNVA 3RANA 4L4RA 5BORA 4LJ6A 3VH2A 5FWNA 3AUKA 4MRRA 2N3ZA 2GEVA 4IIGA 5LZ8A 5SY6A 1YH3A 3EIOA 5JPIA 4DZTA 1RAEA 3STYA 1KO4A 2WVGA 3O47A 4WJKB 3MD0A 3P27A 4FFNA 2ZI9A 3X1YA 2MSDB 2W2OA 4MV9A 4A5OA 4YAKA 4JELA 1HTTA 3KJEA 1Q3TA 1QQ6A 2NSLA 2BSQA 3DAYA 4JLDA 3GOHA 1HTWA 1Y5LA 3IT2A 2CXRA 1QF7A 3VFDA 4AT1A 1SVUA 5IKMA 1F2TB 3QOFA 3AEXA 3SR3A 4DBZA 1AUXA 1NVAA 3ZU4A 3EC2A 5ALHA 2JBHA 3QUCA 5J2UF 4ON9A 1VL0A 2Y0CA 5AR1A 4MW4A 1KDZA 2EWMA 2HHAA 4H35A 2VJCA 2VDPB 3KTAA 4NZPA 4JBNA 4UU7A 5KU7A 2VF5X 5IDWA 3E2IA 1UMKA 2WHPB 3CLTD 1M5TA 4FSHA 1DI0A 1XVUA 2NUBA 3E9QA 3GLSA 1T2DA 4DLVA 4ZVPA 5DYNA 3U3DA 4TKZA 1CRWG 1K7FB 5EUBA 2CMFA 5E4YA 1U8FO 1JIKA 1W48A 2RHMA 5F4ZA 5FPSA 2OHFA 4OB8A 4RFSB 3AJRA 1XIVA 3UJ3X 4ALJA 2QTLA 4B34A 4HB0A 4BWFB 4KH1A 3H65A 2ID8A 2A4KA 2P4HX 4ZJPA 2Z3ZA 1YKSA 5EP3A 3TD9A 3BB1A 1DL5A 3ZX5A 1ZM4A 2FZCA 4AJNA 4RD3A 3G13A 2AH5A 4RTPA 3CGGA 3PTZA 1CZRA 4XD7D 4UPEA 3ZCSA 2VK1A 3PV0A 4JP2A 4MZDA 2AG1A 4R2XA 4YJFB 5AYVA 3SSMA 4B9AA 2PWZA 2Y8EA 3H1PA 2E3JA 4MCHA 2IDJA 5FUBA 1L6IA 3GPIA 2RGGA 1B3BA 3WJ1A 2JJ8A 1HLFA 1VHWA 2JHGA 3EA0A 3LY5A 4TPKA 5BNTA 1PFKA 1ZWKA 3BXEA 4DLKA 5IX8A 5KTKA 1LW7A 1KYZA 1JDBB 3NPMA 2PS1A 3OMLA 4OJQA 3QKWA 4Q9DA 1KQ3A 4KXYA 4Y0VA 3U7EB 2BFPA 2GRUA 3KE8A 2Y0EA 4K03A 1C9DB 2NIPA 2O6LA 3CN9A 4KXMA 4C08A 4CF4A 4F8JA 1IVYA 1VL1A 2AZ4A 2G7MC 3K15A 3UAYA 4BVFA 4BGDA 1CY1A 2I6GA 4CFZA 1BE1A 1GAEO 4GW3A 5K0FA 4O33A 1M1UA 4C4OA 1H4QA 1XXHB 1JG1A 5JSZB 5JBNA 2AXNA 4TYYA 1UANA 1MGPA 1U6IA 1XROA 2BMWA 3F2VA 3HKBA 4DLUA 2VYFA 4DA4A 5FAKA 4LQLA 2Q5QA 2VXOA 2CDCA 4OX9B 4R1OA 1OLUA 2NQ2C 1YZFA 4NEQA 4PCAA 3PEYA 4CM4A 2G07A 3W5VA 4WASA 2LCFA 2CVPA 3G5UA 1XOIA 4I1UA 4PYJA 1UAGA 2IYOA 4XYGA 3SIRA 1IN1A 3T9CA 3H3JA 3GUZA 4EATA 1L5LA 5CG1A 2MIIA 2ONCA 2HBRA 3LBIA 4JP1A 1W4BA 1ORDA 2A9OA 4ITVA 1N3LA 1AZWA 3Q8MA 5JD6A 1R5BA 2QTNA 1U0HC 1Z4NA 3GV0A 1BJRE 5I48A 5BW6B 2FMUA 2QTHA 1CUGA 1Y9ZA 2V7WA 3LWZA 1E79D 3RCBA 4JSYA 4A03A 2Z04A 4J2TA 2JD1A 2EP7A 1OBOA 2J33A 3ILSA 1YMQA 1GUFA 1Q5PA 2I4MA 5EKXA 4LJ4A 2AOVA 3TINA 2NTJA 1AQJA 2H2FA 3OZ7A 3N5CA 2IITA 3EFOA 2VRCD 3F6EX 4JIGA 3W8EA 4A26A 3SIXA 3G8DA 1AQIA 2EBFX 4TLEA 3IR7A 3ED1A 5T4HA 3ESBA 4KYTA 4CUKA 2WTAA 3C1OA 1VKHA 2EV9A 2XLCA 1DTEA 1KSGA 2QX8A 3QVUA 3I9LA 4PINA 1ST3A 3AEKA 1HT1E 1XWWA 3ABZA 4LG1A 5AKIA 5FQOA 3W6OA 3LUFA 5F76A 1L4KA 2EKPA 1G4AE 1LDYA 1UMBA 2ZULA 5TY0A 1YI1A 3LLSA 3UG7A 4HJRA 1YIDA 4FOTA 3H2JA 3IURA 4ND7A 5L7WA 1DBVO 2IEAA 3HUEA 4MW6A 2HY7A 5TF4A 3DBIA 2JIQA 4BWVA 2IEIA 1RWMA 3K0FB 1TM5E 1IY9A 1SC3A 4X44A 3UWMA 1ZICA 2PBZA 3EGDA 1ZIOA 3I9OA 4ZT6A 5L3ZA 4BC1A 4KV9A 1TMYA 2QXTA 3AJEA 2L17A 2R6DA 3E9CA 2DT8A 4OKSA 2C7OA 5AO9A 3K71B 5JRJA 4CXMA 4NAUA 1V2GA 4U6NA 4EYSA 3QPAA 5C3UA 3UTDA 1QHNA 4D4HA 4NE9A 2GSDA 3ZC3A 2H59A 1EPUA 1TW3A 4Y1FA 4EUFA 2HQSA 2OYCA 3V6LA 3A1WA 1T8TA 4ZYWA 4HAOA 2XODA 2WOOA 1PN3A 1SAYA 2NUAA 4RPJA 4CCWA 4CMEA 2COUA 1AGXA 1YC2A 4I9NA 3R24A 1VL5A 2X7HA 5KYWA 1QOQB 3BCHA 3P0HA 2R5FA 3S68A 5HUQA 2C58A 2FSHA 2N47A 1PO7A 2X9LA 2W2TA 4CM3A 1C9JA 2PWBA 1U0EA 2QUJA 1X87A 2LR0A 3HVIA 2RGAA 2QI9F 4B74A 1JJFA 3NIDB 5JCZA 2A1TR 1H8ED 2IYRA 3AHHA 1M75A 1D4FA 1BKYA 1M1NA 3B6JA 3G5MA 3HI4A 3JQAB 3MF4A 4FKZA 1YBAA 3QXXA 4TLDA 4D41A 4YRGA 2Q41A 1E1NA 2WJVA 3D2BA 1WCXA 1EUDB 5FWYB 1KFKB 1MMFB 2J3KA 1ZXBA 4JBXA 2W58A 4PG5A 5F21A 1DBPA 4BEVA 2F9MA 2WUGA 4BRWA 3PVSA 3ZJVA 3WLTA 2JAXA 3AJ8A 3LUJA 2Q4EA 1ZMOA 2YZ7A 2V7EA 5DHFA 2P2CA 1JZTA 3BHJA 3SEZA 3RYCA 1I2CA 2WVHA 2NVOA 3HYTA 4HB2A 3GLFE 3ZHRA 4MIEA 2F62A 4QDTA 1SOWA 2Q8PA 5ALYA 2V0GA 4G9GA 3QOYA 2WTNA 4WXEA 4M9XA 3DT6A 1KEVA 3BIOA 3RROA 4JVSB 4RVOA 5ITVA 1VG9B 3GJ5A 3USCS 2Y92A 1JQ3A 2HEGA 4TVKA 1W581 1S2DA 5K3EA 4HDQB 1SKBA 2YXLA 5KYVA 4UMEA 1KOFA 3EF1A 4WLVA 5ALXA 4ZI3A 5IABA 4V0OA 4ER0A 1FMFA 3UMVA 3B36A 4YRDA 4D0SA 4P7FA 1P5RA 3GDGA 2IOFA 5BR1A 2W6ID 5TF0A 4HNAA 4JI6B 3L0BA 2HH9A 1NQVA 1F1BA 4I1IA 1Z5UA 3ETLA 4W8HA 5D87A 4D9NA 1LWOA 2KB0A 3OIUA 1MZVA 1SCDA 2W71A 3BMNA 4Y1EA 1RW4A 5CYPA 4NPHA 1GDDA 4RWEA 4TYMA 2F3PA 1LLUA 5ALEA 5EXEA 3TVDA 4BB0A 4DSAA 1ESDA 2DQYA 4ZCTA 4EARA 2P8JA 4QO7A 4TTQA 4RD4A 2UUPA 2F7SA 2OGUA 4LOLA 1K6MA 1T0PA 3PF9A 1TYAE 1NUUA 2J1LA 3CRMA 3HBFA 3LOPA 1HNZB 4PO9A 4D1YA 1YVEI 3CZ9A 4H4EA 2VCYA 2FF5A 3R3HA 5G02A 3DA8A 1JKMA 4XZ3A 1KQOA 1TCCA 2WJHA 3T6KA 3B1FA 1GCAA 1U65A 2I03A 2Q3MA 4JLUA 2DYKA 1T1GA 3DWGA 2AFVA 3FRIA 6PFKA 4ZVTA 1YNOA 3FDXA 2XB4A 3PHIA 1J0DA 2NACA 1WTCA 5TQJA 2BTOA 4XR4A 1J5EB 3RYIA 5IJAA 3DEZA 3QOWA 4RGVA 4XI9A 4TSFA 2NOAA 3SJAA 3ZNPA 3W90A 2SICE 2QBYA 2FFJA 1SQ6A 3KS9A 3QLTA 1VGRA 1OUMA 2F2TA 4QJBA 1NVFA 4R1PA 4G0VA 3NEAA 3OLWA 1DCMA 2HTEA 1CJCA 4Y7CA 1IBSA 1F0YA 2J9FB 2PUVA 2W22A 5LP6B 1RWPA 1ZJ4A 4D9IA 4ZRNA 2XUGA 3ZWOA 2QQEA 2EL7A 3EJ6A 1LJLA 4UFNA 2UV8A 2CF6A 3E0QA 4CDRA 3OVMA 5JSUA 2SHKA 2BGLA 4JMPA 4LWPA 4WH0A 2G28A 3BXFA 3NWBA 3GHHA 1EM8A 2ZEJA