3UWOA

Structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
205
structure length
194
Chain Sequence
b'GLFVTLEGPEGAGKSTNRDYLAERLRERGIEVQLTREPGGTPLAERIRELLLAPSDEPMAADTELLLMFAARAQHLAGVIRPALARGAVVLCDRFTDATYAYQGGGRGLPEARIAALESFVQGDLRPDLTLVFDLPVRLDRFEQEDRRFFEAVRQTYLQRAAQAPERYQVLDAGLPLAEVQAGLDRLLPNLLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate kinase
publication title Structure guided development of novel thymidine mimetics targeting Pseudomonas aeruginosa thymidylate kinase: from hit to lead generation.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 194
sequence length 205
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3uwoA00
3FB4A 1ZBDA 2NO7A 4D6PA 3CNLA 3GJ3A 4RZXA 3FOZA 5JCPA 2EW1A 5AR1A 5KTYA 1ZMXA 1JEEA 1VYVA 2AKYA 1EX6A 3KKMA 4TLCA 2QBYA 3KDSE 2FDCA 2J45A 2WJVA 4IXNA 3GJ8A 3MJHA 2XOKA 1M7HA 3FKQA 1H8ED 2PMKA 2QQEA 4MRPA 4ABYA 3KQHA 1IJEA 1ZC4A 2G0TA 2ZS8A 3U3KA 5DE3A 2IS4A 4YMSA 5D3QA 4D81A 1U0HC 4QGAA 1IJFA 1DE0A 2B6HA 2ZAOA 3GCGA 4Q1EA 1A1VA 5BW8A 2WSMA 4B3GA 5CM9C 4CEHB 3PVSA 2WJHA 4B73A 2XSZD 4O2LA 1TF5A 4JLKA 5M04A 2O0JA 5DNYB 4EJSC 1DVRA 2QY9A 3TW4A 1NY6A 2QNRA 1CR4A 4P32A 5GJWC 3QENA 1YJ5A 4GRAA 2ZRMA 5EP4A 1MR3F 4A8JC 1H65A 1KMQA 4BLRA 3NBFA 3CM0A 1SVIA 2JEOA 4WA7A 2N46A 3A4MA 3ND8A 1ZD8A 1AGPA 1G3UA 4HLUA 4TTRA 2W00A 2RHMA 3W34A 2QI9C 4B44A 4LHVA 3QQ5A 4A0GA 1OHHA 2F1RA 4AY2A 1N3BA 2NOAA 1CJUC 1KY3A 4JJKA 4MQBA 2ORIA 3IO3A 3NBXX 3L0SA 4YDHB 1VG0B 1U81A 4R9UC 3SHWA 2HXYA 1CP2A 1B0UA 2FPMA 3R20A 3EZ2A 3TKLA 3LVQE 4MYTA 2ZRGA 3AF0A 1Z28A 3W6OA 4DDVA 5L8VA 2OBLA 4HB4A 4HAVA 4DUGA 4A36A 3VKWA 1JR3E 3F8TA 2ZJYA 2YZ2A 1IY0A 4HB0A 2ZRCA 1JXOA 4TLEA 3EPLA 2QE7A 2BIFA 1N2CE 1COWA 1DAMA 4M1MA 3TSZA 1B23P 1CIPA 3HWSA 4OHVA 2ZM5A 4DSTA 3GLGB 3QKSA 5JHHB 2A2ZA 4LC0A 1X1SA 3IGFA 4ACBA 2YINC 3U7GA 3EZFA 2YOGA 4LWZA 1N0WA 3CPHA 2MSCB 5CM8B 2ZRFA 4C2UA 2JJ8A 5EZ5A 2Q0HA 4NCHA 4D4KA 1IN4A 2Q6TA 1X8JA 4GT1A 5KSYA 2ZE7A 4O3MA 1W46A 3RC8A 1U8ZA 4DDTA 1XD9A 2YWFA 1MV5A 2PT7A 1L8QA 2JJ2A 2VF8A 4JBYA 3AVYA 4JLVA 1JQLB 2FZLA 2WAXA 4KSBA 3VMFA 2C04A 1FQKA 3NXSA 3BH7A 2GAAA 3P4XA 4YC7A 1AQUA 4JLDA 2E87A 2C78A 2WWIA 4XJXA 3WXMA 1FW6A 1OXUA 2VP9A 3P32A 1OXVA 1VCMA 5JSZA 2OCPA 5DYIA 1M7BA 3BGWA 4M1YA 5C46F 2CLDX 2RCNA 4M1TA 3ZQJA 5JJLA 2UKDA 4TMXA 4K81B 3OF5A 1IN6A 1SVLA 2DB3A 3LRPA 3AP1A 4E5UA 3NH9A 2CJWA 1U9IA 4BRWA 2IW3A 1KO8A 2DHRA 3MWLA 4NP6A 1FOEB 3LLMA 5DLQC 3SHFA 2B8WA 4OQMA 2VP0A 3B1WA 3M0EA 1OKKD 2XTMA 2BM1A 2I4IA 1M34E 4URUR 1XMVA 4XWKA 1G4AE 1Z2AA 4WZAE 5BQ5A 3GFOA 3ZVMA 1J2JA 2GJSA 1P3JA 3W3AA 4JLNA 1XMJA 4LCBA 1E0SA 4UXHA 1G1MA 2O8BA 4UNQA 4Q4AB 1ZM4A 2ZEJA 3BWDD 4QGGA 4TL7A 3B1ZA 8OHMA 3QE0A 4TMVA 1R6BX 3IKJA 2OXCA 3CIOA 4G1UC 5FPTA 3UANA 4C0LA 3W8NA 4GZMA 1KKMA 4S2EA 2ZI9A 5BYKA 1SVKA 3NTUA 1QF9A 3EXAA 3K0FA 3LWNA 1E2DA 4QRHA 1IOZA 4KXFB 4A0FA 1E9FA 5HZHA 2C99A 1XMSA 3GLHE 5A5GA 1KKLA 1Z22A 5AJWA 1XXHB 2O8EA 1EGAA 4EJSA 5FBVB 1Z8FA 4HDCA 1FX0B 5G3ZA 3QF4B 2OSBA 1N6IA 2CL6X 4A2WA 1AKYA 3H0KA 2WM9B 4A8JA 3T15A 1RRGA 1ZUNB 2QMOA 5DISB 2E1RA 2PBRA 2W6IA 4W9MC 4AI6A 4A2QA 3MG9A 4LX0A 3U6KA 4DB4A 2BMFA 2F43B 3V4RA 1IXSB 3HU3A 1L4YA 3PV0A 2HT6A 2J7PD 2WIBA 2DFLA 1T3LA 1QHYA 1VG9B 2PLRA 3FGNA 2EFGA 1E2PA 1JXMA 1VCOA 3QEOA 4HLQB 4Q01A 5FTNA 4URXR 2EWWA 3L8YA 1P75A 4JBXA 2A5DA 1ZM9A 2VP2A 3K0EA 1YE8A 4NCJA 1MABB 4PC2A 4DLRA 2ZI6A 4TZ0A 3I3SR 2ZREA 2R62A 3FDIA 3U7HB 2GXAA 2H16A 3C14C 5DGXA 2ZIAA 2FH5B 5FOVA 1ZJ6A 5DI3B 1UKEA 1Z0IA 3FKSA 2XB2A 4H9GA 1YU9A 4IDHA 4AC9A 2CEAA 4B33A 2XNDA 1XTKA 3U5ZB 1ZC3A 2BJVA 2EYQA 5LBIA 1QRAA 4NE2A 4B3DA 3QJYA 2NO6A 4CT4B 4I1UA 1WDTA 4LHYA 1ZM3A 2KE5A 1RFLA 4B71A 2C8VA 1P73A 3HR7A 2WJYA 4B35A 1D2MA 1Q57A 2W0MA 3RANA 4PPQA 1I4TD 1CRPA 3C4JA 1W44A 2H57A 4IOJA 1FQJA 4URYR 3K9NA 3LFUA 5LDDC 1PLJA 1RRFA 1T8UA 1RYFA 3PUWA 4KFTA 5JEEA 4DEYA 1EESA 1PLLA 3QPWA 1OJLA 4G3XA 5FPHA 2O0KA 3B6EA 4MKFA 4MA4A 5TVKA 4XD7D 1BYUA 2W0SA 3KTAA 1SQ5A 1G5RA 2NO0A 1HEIA 2OFXA 3B13B 4M1SA 1KI8A 4YDSA 3NG1A 4OHZA 1P61B 1JJ7A 3QUSA 4LJ7A 4PZYA 2KBEA 4RFVA 3U3OA 1Z5ZA 1PUJA 3NKVA 3PUXA 4B43A 2YC4C 1OFHA 3EIHA 3DO6A 1F5NA 3BFVA 4FN5A 3U4QB 1W7AA 2J1LA 3ZVNA 2ZS9A 4D2IA 1T5IA 2GXSA 4C0SA 3BB3A 3VR2A 4RVCA 5B58C 3BH6A 3WRYC 4RCYA 1SGWA 4IDPA 1KO4A 2IYTA 2WJJA 4PANA 5AUPB 1Z6GA 2RGDA 4PO9A 1KYIA 1GFIA 2PL3A 3CRQA 1DOAA 1XCMA 3ICEA 3W9YA 3WNDA 3CNOA 1CEEA 5CLQA 2WOJA 2PEYA 4BFZA 1KK3A 4B2IA 2ZRPA 2FSGA 2P65A 2WKQA 4DLSA 4DB2A 2BMEA 3T5DA 4CEIB 4PPNA 4TTQA 1QHHB 4ZCIA 3B8HA 2Z6VA 1GKUB 2ZSEA 1OIXA 2B92A 2FWRA 4V03A 4D4MA 3UMSA 4QHSA 1U90A 2OFOA 3SBEA 1GKYA 2FV8A 4Q4HB 1H8HD 1WB9A 4LV6A 3GPLA 2GF0A 2VSFA 4KLNA 3TVTA 4KV9A 5FPKA 5D3MA 5SZHB 4DJTA 3B85A 2YVUA 1MO5A 1MRSA 1A7JA 5KDOA 1JR6A 4JZKA 4D0NA 2G88A 2Q21A 3SYNA 3R8FA 1W48A 4DT1B 3VNVA 4ERNA 4DCUA 3NEYA 3U7FB 1G20E 4EUNA 4BFSA 3UWKA 2XOKD 4X8MA 3EW9A 5KOYA 3OE7A 2LKCA 2F9MA 4LHXA 1VCIA 3UMRA 4JLMA 3QBTA 5AJYA 2MSDB 1AS0A 2EVWX 1K5GA 4M53A 1TADA 2BM0A 1DO0A 4BLQA 3MRSA 1VIAA 4QKQA 5L3QA 5TY0A 1KDOA 4RZUA 4PAMA 1NVUQ 3V00A 2EFDB 1G8PA 1P2UA 3FE2A 2A5FA 2H92A 4LOAA 4QOSA 4A0RA 4B3BA 4POAA 1KMHA 1DAGA 1Q21A 4MITA 1KZGB 2ZU6A 2GEVA 2VHTA 2CMKA 3FHCB 2FOLA 5JLJA 5EE0A 1UBEA 4RZ2A 1W49A 2AWNA 4DLUA 5A4JA 1NBMA 1QDEA 4D0LB 2D7DA 4RFSA 1NMZA 1E1RD 3VHLB 4X8LA 3DOEA 2N1BA 2JASA 3BB4A 5KDDA 4FMDB 2Q9BA 2YV5A 4JLAA 3MMPA 1QG4A 4GDFA 4DVGA 2C5LA 3CF2A 2CCGA 4AKGA 3RS0A 3QKRB 4F91B 3THWB 2QGNA 1XJ0A 1NSFA 4NTZA 1OHHD 2ZANA 3B7GA 2R6AA 4LPSA 4M1OA 4Z8XA 3KFXA 1BYIA 3FHTA 1G8YA 1T0JB 4MKHA 3T35A 2QMHA 3UG7A 3EPKA 2ZYUX 2E9SA 4P33A 2WMOB 4C9BA 1G19A 1Z08A 1Z2CA 5DO9A 4L15A 3OIUA 1QBKC 2R44A 1W0JA 4Q21A 4M22A 3LW7A 4F92B 1E2GA 2XZPA 1D9ZA 4URZR 3SNHA 2FGKA 2IYYA 4HUQB 1AS2A 2C03A 1G3MA 3PG5A 2QE7D 1XTIA 3K0AB 3OEED 1G291 1XD2B 2EQBA 3SS8A 1QHXA 3TAUA 4DC9A 4B3FX 2CNWA 4MRRA 3UG6A 4QBGB 2IS6A 1W4BA 2J0UB 3KTAB 4B34A 2CCJA 3SZRA 3MWJA 4LV8B 4Y0VA 5EXPA 3JZAA 1WRBA 1KI9A 3EC2A 4LV5B 2GAOA 4TT3A 4EFNA 3AKYA 2VSOA 1Z29A 1G5TA 3AF2A 1Q1BA 4BFUA 3N2IA 5J5CA 1II0A 1FUKA 3V9PA 3B2EA 4A6XA 1F2TA 3GEIA 3C15C 3C8UA 3M4YA 3QVVA 5EXTA 1FTSA 4QFMA 3GD7A 2AL7A 3ZYCA 3HP1A 4ASUA 1CRQA 3KQLA 1C9KA 4QM6A 4CRWB 3VX3A 3RRZA 4C0AC 2OV2A 2AKAB 1CU1A 2GK7A 4AWXA 3P27A 1T4GA 3AM1A 1G7CA 1V5WA 1HURA 4R2HA 2FGJA 2X1VA 1D5CA 2VLIA 1G7RA 3QG1A 3E2IA 1DS6A 2WTUA 3BERA 3LO5A 3GP8A 3AVVA 3QXSA 4WXPA 2O8DB 2H7VA 4JIMA 3DL0A 2Z4RA 2D2EA 1NSTA 1KI6A 2GILA 1YZGA 1G8HA 3OEHA 3KKQA 1G6HA 2GJKA 1G18A 2OAP1 4E03A 1FUUA 3GLFB 3OHMA 2ODEA 4RD0A 1DO2A 1E99A 2IBMA 3BE4A 3UWOA 4DDWA 1J90A 1G7SA 1S3GA 1YR6A 1RVDA 3MCAA 1XCPA 4TQUS 3OFNA 2YC2C 4LUCA 1KI3A 2CVFA 2QQ0A 2V55B 3VHXA 3IEUA 1S96A 3TQCA 1SXJB 1E9AA 4EPYA 4EPWA 4YONB 1YRAA 2ZJOA 3I62A 2AXNA 4D82A 2PJZA 1BOFA 5JS8A 3DMNA 5FL7A 1HE8B 2XJ9A 2FFQA 2V3CC 4OQLA 4IW3B 4BLTA 1VDZA 4UJ3A 1JALA 1P5ZB 1F3OA 1P60A 1XEXB 2CLCX 3TK1A 2HLDD 3EZ9A 2ZI7A 2ZJ8A 2GJAA 3GJ5A 4WAUA 1GRNA 3P20A 4OI2A 3O47A 4Q18A 3UXMA 4D25A 4DKXA 4Q4JA 2W83A 2P5TB 1MT0A 2QAGC 3THYA 1D8TA 1ZCAA 3K9GA 1ZNXA 3QSYA 2SHKA 1ODFA 3QXCA 2IT1A 1GRQA 2XAUA 1DADA 3TAHA 2W6ID 4ESVA 3DOFA 3CO5A 1HT2E 2AFHE 1NN1A 1OV4A 1BH2A 1PV4A 1IBRA 4YMTA 1MKYA 1I4LD 1SKYB 4Q47A 3REGA 4XVUA 5KUTA 1KIMA 4PFSA 5J4VA 1XTQA 4KYUA 1KZ7B 2P0EA 3QEJA 3KKNA 4A9AA 5LPNA 3NVAA 5LB2A 3ND9A 2QZ4A 2IXGA 2JGNA 4PHFA 3LAWA 4RCZA 4Q7JB 1U8AA 1Y63A 4JL5A 2RGNA 3Q85A 4Q1CA 2J59A 4TYNA 5KSOA 1KSGA 2YWEA 2ZRNA 1VPLA 3O8DA 1UM8A 2UZ3A 3FKSD 4JVSB 2CVHA 3OESA 2XNDD 1OYYA 1M6NA 4NH0A 4AK9A 3A37A 1DAEA 2GWHA 1NBME 5CK5A 3I73A 3SQXA 2JLRA 3K8YA 3I8SA 3WY9A 1I2MA 5L3SB 1L7VC 2QA5A 1FL9A 4HAZA 1EWQA 1G8GA 1RYHA 1E94E 4QHYA 3QIAA 1LV7A 4GOKA 2D4HA 3CRRA 4DZZA 3MAAC 4O0MA 1PZNA 2FFHA 1E0KA 1WA5A 3VTKA 3QY0A 1R0ZA 5SZJA 3TLXA 2HJVA 2F9LA 1VG8A 2QRZA 4KLZA 2JIZD 5FFMA 2JLUA 3FWYA 5JCZA 5AJVB 2IX3A 2P3SA 4PX9A 5KPJA 1OW3B 3S1AA 4UQOA 2J0QA 1XB2A 3X1DA 1GL6A 3JZMA 3J81k 2YOHA 1E9DA 3LVRE 2YKGA 4KHZA 3MUFA 1XZQA 4D80A 2KWIA 3TUJC 2YWGA 4JLJA 1HH4A 1XD8A 2NZJA 3U44B 2VHUA 1ZM7A 5CB8A 2G0NA 4F4CA 1RPZA 2QT1A 1RC8A 3KJHA 1XP8A 3O8BA 4MYUA 4OYHA 4RKFA 2V6IA 5AJXA 4ZI3A 4TMTA 4FIDA 1E4YA 4HAYA 5H1YA 4QHTA 2AHOA 3K53A 1E9RA 3C5HA 4PTLA 4PAQA 3NBZC 2IUSA 5JECA 5FPYA 1V43A 1ZP6A 1CJKC 3AGPA 2I3BA 4E09A 3CZPA 2QPAA 1F48A 2PZFA 2J41A 4B2PA 3RS5A 2GTPA 1W0KA 2DR3A 2QTHA 2ZSFA 1N0UA 1XF9A 3OIVA 2OLKA 5FL3A 1RJ9A 3ZZTA 4BPBA 1UBCA 1NY5A 2R65A 4DHEA 1Q1QA 2GESA 1W4AA 2ORVA 2OILA 1UBGA 2XJ4A 4GBMA 3RVBA 2R8RA 3W5IA 2WPDD 3CBQA 3TR5A 1E2NA 5KNBA 4ON9A 2EU8A 4NHOA 3PEVA 4G5QA 2FJUA 4OI1A 4Q9JA 4FMBB 4Q48A 4EAQA 4DLXA 5CJ2A 3TNFA 1CR0A 4KFSA 5KDLA 4A15A 4JYCA 2ZR7A 1OXSC 2ZRDA 1BMFD 2FFAA 2GBLC 3L43A 4IOKA 5E4FA 3AKEA 3WP1B 4TL6A 4AYWA 4DLZA 1R0XA 3ADDA 1ZNWA 1L4UA 2BV3A 5EXSA 1XWIA 1JECA 2VIIA 4A4DA 4Q1BA 1X1RA 1FNNA 421PA 1G8FA 2IEZA 1SXJD 2DFNA 4EQ6B 3RS3A 1E2MA 1E69A 2GCPA 1E2LA 4G5RA 2QAGA 5JEDA 3AVPA 2G9NA 2GXUA 1UKVY 1IN7A 3OE7D 1GKIA 4JLPA 3SYLA 5B64A 3I61A 4BLOA 1Z07A 2ODBA 1F6BA 4IXMA 4M9ZA 4QC2A 3SE0A 4JKYA 2HUPA 1E3MA 3B9PA 1O3YA 3B9QA 4HLCA 2P5SA 4QBFA 2QGZA 4Q66C 2PZEA 3GLIA 221PA 4BWYA 1GITA 2IHBA 3AQ4A 1OIWA 3UIEA 3VU9B 1G21E 3VKGA 1PJRA 4GPTA 1RKBA 2X2FA 4RY2A 1WBBA 4YXWA 4US1R 2JLVA 4YMWA 2IWHA 2XXAA 3KB1A 3ASZA 4I4LA 5E7JA 1FFHA 1NVXQ 1EFUA 1CLUA 4KBGA 4P3YA 2A9KA 2WWHA 2RGCA 4WW0A 2BHRA 4Q02A 3LDAA 1AZSC 5IK2D 3G82C 4QGFA 1YZQA 1HA3A 1E9EA 2Q3HA 4TMKA 3AVQA 2GDJA 3TUIC 3PUZA 1MO4A 3K09A 4ACAA 1S8FA 3WHLA 4A92A 2FNAA 2X19A 2W6JA 4ESHA 1D2NA 4DLWA 1FZQA 4W5JA 3EZ6A 5FUWA 2WBLC 2ZE5A 1YRBA 1X8LA 1NL3A 3AUXA 4DCSA 1DAFA 1R8QA 1ZM2A 1VHTA 1W0JD 2OCYC 2CHGA 2Q3FA 1US8A 3ZIAA 1F2UB 4BFYA 4BEBA 1S9DA 3KJIA 4CEJA 4PC3A 2GK6A 5HTKA 2LWIA 1QZXA 3D6TB 3I92A 4WZ6A 4EIWA 1E0AA 1S9HA 3IEVA 3E1SA 6Q21A 3CWZA 3T06B 1SHKA 1SHZA 2IYVA 3CZQA 1KI2A 5UKDA 2ZTSA 3K70C 2IS2A 1VCNA 4Z1MD 1K8RA 3CH4B 4TT3D 2GHIA 3GLHB 4KU4A 3SJCA 5AUNB 2WV9A 2QP4A 3CWQA 1RW4A 2P6UA 3T61A 4H1UA 3V4FA 4XVQA 3P1JA 4XTRA 4IDQA 3Q5EA 1AN0A 1FTNA 4PC7A 4U5XA 1W1WA 2FF7A 3EPJA 1ZU5A 4UJ5A 3VR6A 1UPTA 1N25A 1K6MA 121PA 1XJQA 3QXHA 5FOXA 1Z6TA 3PEUA 2KB0A 4LBYA 3B78A 4OI0A 2Q9AA 2EWVA 4JJZA 4LJ8A 2OESA 4M1WA 1AKEA 1YZUA 2WWWA 4R2IA 1L2TA 4IFBA 2P6NA 2R6CA 2QBYB 4DEXA 2DYKA 5EP2A 1S1MA 2ODNA 4NYIQ 1C4OA 3N70A 1E9CA 3LXXA 1OFUX 3FHOA 4PC6A 1OB5A 2F7SA 1D6JA 2GETA 5AK0A 2IYUA 3AV0B 2BOVA 3THXA 2C77A 3NHBA 4Q7MB 2DCUA 3BRWD 2WJGA 4HZUA 1RIFA 2I1QA 3WP0A 3KQKA 5KPDA 4PPFA 3WMFA 3OEHD 3B5JA 1ZIPA 2NTYC 5DN6A 1MRNA 4FCVA 3RRMA 2PEZA 2JLXA 1HY3A 5KNDA 3HPQA 1W36C 2Z83A 4QXAA 4H1VA 5A0FA 4IOMA 1NI3A 2IS1A 2XZOA 2GBLA 1QHGA 1N6LA 4LK2A 3M1IA 5K8LA 4DDUA 2F1IA 3OFND 4MH0R 2IWRA 2ZETA 2XGJA 2XTNA 2QM8A 1U99A 3H86A 3I32A 3IBYA 4B75A 2XZLA 5JRJA 4GL2A 2HDNB 5FR1A 4UKDA 3DM9B 1GZSA 1XEWY 3GEEA 1DG1G 1KI1A 1JR3D 1N5IA 2X77A 4KBFA 1Z83A 4JVMA 2NQ2C 5FL7D 1TNDA 3GFTA 1E2EA 2PCLA 4GMDA 5HPYB 2J87A 4FWIB 1XX6A 3RS2A 3AVTA 1ANKA 2X2EA 4TN1A 3KQNA 2V1UA 2AWOA 5JRZA 3HYTA 2VP4A 5ANRB 1EFRA 2ZRLA 3MSXA 4PHGA 4QG7A 3I4LA 3AP3A 4M8NE 1LS1A 4M1KA 2UVQA 1XTRA 2VTKA 4Y0AA 1EK0A 2O8FA 2Z4SA 1GVNB 2ATXA 1DAHA 4FMCB 3U2QA 4W5WA 1OFTA 2NZ8A 4N0DA 2GZDA 4WVFA 1T8TA 2GZHA 2HF8A 3W3ZB 5FTMA 3FPAA 1E9BA 4NYIR 1AK2A 3X1XA 2VRWA 3AP2A 3QKSB 2ZVPX 1XU4A 2C96A 3CONA 4BZPA 1KI7A 3TJZA 1XXHE 4O25A 1IONA 1W2HA 4IVPA 2K5UA 2QTVB 5FR2A 1DAIA 2JJ1A 1KO5A 4CYMA 4R98A 1QVRA 1E2IA 5F9FA 1A5TA 3BORA 3SQWA 4JL6A 4HAWA 2MMGA 3OAAA 4G0NA 1KAGA 4PSAA 1JBKA 5E7IA 1XJCA 3TH5A 2QSZA 3FMFA 4MUAA 2IEYA 2F1JA 4NL4H 3NIBA 4GP7A 5FUXA 3D31A 4MRVA 3SEAA 2V7QA 1UADA 4PQFA 4RSGA 3KKPA 5CJPA 3ZQ6A 5JSZB 1TX4B 3BH0A 4TYWA 3NHAA 3DHWC 1BIFA 1E2KA 2CBZA 4IEIA 2IF2A 1GWNA 1UAAA 2REXB 5B2ZA 4TSFA 5HCNA 4Q9IA 3EZ7A 3LY5A 1WP9A 1CJTC 4BUJA 5FBWB 4EPXA 4N0EA 4QL3A 1WBDA 3ADBA 3BK7A 1VG1A 2CJWB 4NCNA 3KXKA 2OT3B 1E9SA 5LB4A 2FPKA 4JT4A 1KO7A 1XMIA 4B74A 1S2MA 4DCVA 1Q1EA 4B2LA 2VL7A 4JSTA 1SULA 2QN6A 4LYAA 4M9SA 5IF9A 4ZIRA 2QORA 4Q1FA 3A4NA 2XTZA 5KHOC 2A30A 2G77B 3Q5DA 1X3SA 5JZVA 4A2PA 3DM5A 2O8BB 5JWRA 2Q9CA 4C7OA 1ETUA 1T91A 5CDFA 4OQFA 4HEJA 2H18A 4BQSA 3ZZ0A 4FMCF 2OXRA 5CLLA 4TYPA 4KVGA 1TQ4A 1E79D 2F3TA 5B30A 1JJVA 1OH8A 2GA8A 3MLEA 3K0FB 3TE6A 4YMUA 3TRFA 1UF9A 4XIGS 5FTJA 3AKCA 2ZPTX 1JB1A 2RGAA 4CVNA 1DELA 2RGXA 4WXRA 2GJ9A 3IPXA 4EJSB 2O8EB 2D62A 2KBFA 1NN0A 4V0OA 1G4UR 1VYTA 5B57C 2XSZA 4QJ5A 1U0JA 1IN8A 3ETLA 4U02A 5JJKA 1YZTA 1ZAKA 4A8JB 1W0KD 2AK2A 4L5BA 1DG3A 5HE8A 1YHNA 1E96A 3C41J 1VTKA 5C1BA 4OQXA 2BJWA 4LJ9A 5HCIA 4LJAA 2YJTD 5G41A 2Z43A 4PAOA 1ONBA 1NG1A 2ZJ2A 4FW9A 5FOTA 3EPHA 2OBMA 1M7GA 2VBCA 3Q8XB 1N6PA 4FD2A 3IHWA 2J0SA 4P4SA 1II8A 2CL7X 1AZTA 4YMVA 4FI3C 5JJIA 1LTQA 2IYZA 2PX3A 5F98A 1M2OB 2C95A 2HEIA 4RD2A 2FSFA 3REFA 2HJGA 4Q9KA 2GCOA 4TMWA 3WMGA 2ZJAA 2BKUA 2KSQA 2PCJA 4KCGA 1CF4A 3JVUA 3K0CC 5GVRA 2ZJBA 3IQXA 5EP1A 4PQRA 521PA 4GMXA 4Q19A 5KSPA 4QGHA 5K8TA 3ADKA 3VR1A 2WVJA 1KJZA 3QXXA 3I5YA 2JLYA 1GUAA 1Z0JA 2IYQA 1GNQA 5DHFA 4CF7A 1F60A 2HXSA 4II7A 1P6XA 2IYLD 621PA 1E32A 3K9LA 2JDIA 4RD6A 3L0PA 1OLOA 4YXWD 3QI2A 1NKSA 4DUGD 3ECCA 2RGNC 2VSXA 4HZIA 1P9RA 2H8KA 4NBSA 4Q9LA 5FOSA 2IYRA 1KJYA 4EDHA 1MO6A 2FU5C 4PQYA 1COWD 3CW2A 4G01B 1N5KA 1AM4D 1VKJA 3ZVRA 2OG2A 4AIIA 2ZQ5A 2A3RA 5GVSA 1UDXA 1GSIA 1EXMA 2VYFA 2YNMA 1JPNA 4LPKA 5JWHA 5J4KA 4Q00A 1N6KA 2ODWA 4I99A 3SJAA 4KITB 2AR7A 2TMKA 4UNRA 3N5CA 2G6BA 1E0JA 3LH5A 5EUQB 3QKUA 3OZXA 3A1WA 2QM7A 5FOUA 3SN6A 2QAJA 3I8XA 2JJ2D 3TR0A 3TSWA 2IUTA 1R8SA 1JNYA 2IF0A 3FMPB 4JLBA 4MGZR 4C0HA 3R7WA 1DPFA 1P62B 1YZLA 2IHYA 3MWKA 4D26A 3Q7QA 1GP2A 3RS7A 3ZIAD 1NIPA 3HJNA 5JBQA 2JLQA 1XNJA 5EE3A 2Z0MA 2WAYA 2OLJA 1KK1A 3A1VA 3GMTA 2G1KA 5H8WA 1GOTA 1OKKA 1EFTA 4NCIA 2OFWA 4OK6A 2G1JA 3SR0A 4GOXA 2C9YA 3MGCA 1E2JA 2LCFA 3NH6A 2G3YA 3TIFA 5KNCA 2Q3MA 2AXPA 2DPXA 4ZI2A 4FMDF 4HDQB 4DLTA 2VO1A 3JVVA 4GI7A 5FTKA 4V0KA 3LX5A 3CRVA 4DIEA 5HKKA 1U0LA 3W90A 3CX8A 2C98A 3TW8B 4Q7LA 4HYYA 1Q3TA 4N1AA 1ESMA 2GRJA 2IUUA 5D3MB 1N6HA 4MGYR 2QMUA 4L8GA 3RWMB 4KYIB 4TQAA 1TUIA 3H2YA 1J70A 2ZUBA 5GJBA 1W36B 1E1QA 3RRYA 4LI0A 2WZQA 2QSYA 3LBNA 3E5HA 1GL9B 2HCJB 2DBYA 4LSGA 4YLGA 5GJCA 3B60A 1FMJA 3ZZUA 2RGGA 4MDFA 3EWAA 4MGKR 2D7CA 2VF7A 3CPJB 2ZSBA 3T34A 4W5HA 5GJVC 4DSUA 1IHUA 2FX3A 3ICQB 4Q9HA 1S0UA 3E70C 4RKEA 2AFIE 4C4PA 1ZW6A 3KJEA 5CDFE 5L3QB 4M2LA 3ADCA 1T3HA 4CEHA 1XPOA 4F93B 5G53C 1WCV1 2RKOA 1KMHB 4K46A 1IY2A 4MUBA 1Q20A 3W6PA 2BMDA 2J7PA 3Q72A 3ZD6A 3DMDA 3BXZA 4P0TA 3RRNA 4DXAA 1GG2A 4C0QC 4BFXA 2J3EA 4B76A 1X86B 1WXQA 2GKSA 4RFSB 2QP9X 3FTQA 2HT1A 3K0CA 5EXXA 4CGZA 1SVMA 1HQCA 2NIPA 3ZVLA 3GLFE 1DBSA 2A5JA 2OBNA 2XITA 4EKDA 1W5SA 5DIFA 3FVQA 3CNNA 3PUYA 1NIJA 4OK5A 3DPUA 2CL0X 1T0HB 4AG5A 4F7WA 2CDNA 1NP6A 1LW7A 2ZJ5A 2P67A 4MRSA 1IXRC 4ZKDA 5JWOA 1TQ6A 2X8AA 3QPVA 3LLUA 4V0ME 4AURA 1EFRD 2D74A 4OQNA 2FMXA 3PUVA 2Y8EA 3QXJA 4J0QA 5F9HA 1YZNA 4NKRA 4RZ3A 1SXJE 5CYOA 3FFAA 1OSNA 3RSLA 1G17A 4ZDKA 3BBPA 4WOPA 4LYHA 1GRRA 3SDZA 1R4AA 4FCWA 1QHNA 3K09C 3PIRA 5F2EA 2JLWA 3DZ8A 5JHGB 4XD7A 1NMXA 4AKEA 4LGMA 3GLGA 3KB2A 4CW7A 1KHTA 3NDPA 4A0HA 3A36A 1CS4C 1ZIOA 1G7TA 1UKYA 3BFKA 2ZJZA 1QVAA 1CTQA 1F2TB 2H17A 4TL8A 1NVVQ 3DEFA 3OAAD 4LJ4A 2J0VA 3CH5A 3GLIE 1E2HA 3CLVA 3RLFA 4C0JA 3L82B 5FBLB 2W2XA 1VECA 1YVDA 4ZDJA 4TSFD 4C2TA 2WHXA 1KY2A 1JI0A 4WZBE 4LY6A 2AN9A 5JS7A 2IXEA 2GVZC 3IILA 5G40A 3BJIC 3GFPA 3VX4A 5LD2C 1YR9A 5EP3A 4UNNA 3UPUA 2ZRJA 2JA1A 3PCRB 2H5EA 1KI6B 5CIQA 1OH7A 2KJQA 4XVRA 4I81A 1VHLA 3W6NA 2F55A 2RAPA 1TUEA 1R5BA 3H84A 4JVNA 1N5LA 2ZROA 3QKTA 1NVWQ 2C9CA 2KI5A 1TEVA 3TGPA 1H8HA 3PFIA 3U3MA 2ZI3A 3THOA 4BECA 3PEYA 3CB4A 1ZINA 2BCGY 2PMDA 5CYPA 4LJYA 5P21A 3KXIA 1PUIA 1A82A 2W2VA 3KUCA 1GILA 1ZVQA 1RZ3A 2HV8A 4Q4AA 3PITA 4KSCA 1Q44A 4PPGA 3L8ZA 3C7KA 2RGEA 2VHJA 1XPUA 2ANCA 1U8YA 5AUQA 1TU3A 1HTWA 2VP5A 3RC3A 2ZYVX 4QNMA 1GNRA 3R9WA 4C0BA 3FMIA 4ZO4A 2JLZA 2CXXA 1NLZA 3A4LA 2QUZA 3QBVA 5CB6A 3RABA 2OZEA 1G6OA 1KI4A 1KK0A 1R10A 1UKZA 5DHAA 4HDOB 3PEWA 1S4QA 2WKPA 4X8HA 5FI0B 1W36D 3MD0A 1HUQA 4B3XA 4LJ5A 1NVVR 2NPIA 4PZLA 4Q4JB 4D4LA 1XXHA 5BN3A 1NLFA 1LF0A 1SVSA 3W8RA 1FX0A 2AD5A 1HE1C 2WWGA 3QF4A 3THYB 3AVXA 2ONJA 3SOPA 1W5TA 1R0WA 3Q7PA 2NPFA 3SFVA 2NO9A 1Q22A 3C5CA 1N5JA 3AVUA 4XWAA 1KSFX 5KU1A 4LC1A 3RWOA 2DFTA 3AF4A 1E1RA 4Q7KA 2F43A 3EARA 3BB1A 3CR7A 4KVAA 4IDOA 2FE4A 4Q4LA 1XBTA 821PA 4I1OA 2W58A 1D2EA 2B7CA 3IIJA 2FG5A 3L0OA 1NBMD 5TXGA 1Q3HA 4IKEA 3OIYA 4MRNA 3AKDA 4UNSA 1MABA 2ZR9A 3FYHA 5CIWA 4IVRA 5DH9A 3IBGA 3K9HA 4CZ2A 2R2AA 4P4UA 4E07A 2A78A 1KNXA 1Z0DA 3AVOA 2R6DA 3CRMA 2VEDA 3OIWA 4IFEA 4ITRC 5DI3A 2CCKA 2GEDA 1OXTA 2ERYA 1W2GA 2OCBA 3TQFA 1QHSA 2BEKA 2FPLA 4AYTA 2YOFA 1A2BA 4PHTA 3OEEA 5ELXA 1KSHA 4Q1AA 4JLOA 2B7BA 1TF2A 4PO8A 1PLKA 1P4SA 4ZCLA 5EE9A 4BGDA 2FA9A 1BKDR 1KOFA 2JDID 5IHPA 2PX0A 3CRW1 2XX3A 3GJ7A 4JL8A 1UJ2A 5EE1A 4YQFA 1GL7A 2VPPA 2QENA 3SC3A 4B47A 3ZLJA 1SZPA 2ASEA 1FMLA 4G5SA 2VH5R 3KXLA 4A6PA 4IHQA 1UFQA 1IN5A 2CNWD 3EA0A 4Z51A 5C2JB 4OBEA 3BFXA 4V0LA 3EX7C 1TL7C 1UEJA 3KX2A 4DLVA 3HR8A 1Y3AA 4LBZA 1NMYA 1R2QA 3S1AB 4I1SA 1P2SA 4BLPA 1II9A 3BOSA 1AJEA 3AUYA 3U60B 3SU8A 2ECKA 4C3ZA 2WSSA 4TYQA 3VAAA 3LXRA 2V9PA 5IRCD 1OE0A 4LBWA 4NPHA 4IJMA 3U4QA 3Q3JB 3QF7A 4GNKA 2ZS7A 3WNBA 4ASUD 5BN5A 3A58B 3C16C 2ZRHA 3KL4A 2C2HA 3RHFA 4JSYA 5FBQB 5TDHA 2IXFA 3IQWA 3GLGE 5H70A 4DIDA 1TU4A 1TF7A 4HAUA 1WE2A 4LJ6A 1NLYA 4NMMA 2ZRAA 1XPRA 3RYTC 1GM5A 4BRUA 3X1WA 3PR1A 4MDEA 1LY1A 1GDDA 2F1HA 2QP3A 2DY1A 3RDPA 1JQJC 3WYGA 1EG7A 3SI7A 3LV8A 1SKQA 3AH8A 1WQ1R 2WICA 1RJ9B 3CKLA 4V02A 4R7ZA 3ZD7A 2V54A 1AQYA 4CEIA 5BXQC 1QHHA 4EFMA 4B6EA 5HKKD 1JAIA 1ZD1A 3GJ0A 4DSNA 2ZYWX 2RGBA 3X1ZA 1KO1A 2CHVA 4PSKA 3VR4A 4F38A 4LHZA 2NGRA 2YYZA 1TTTA 2ORWA 3PQCA 1M74A 2ZRKA 3A1SA 4Q4HA 2EFEB 1SVWA 2ZUCA 4BEJA 2O52A 1FP7A 3IIMA 4R71A 4QJ3A 3LQRA 4ZV4A 1Z0KA 2OO7A 3SFZA 3IIKA 4TLBA 4PO1A 4M4SA 1U94A 1E1QD 2IA5A 1VMAA 1Z0FA 3IO5A 2HLDA 1NF3A 4HLDA 3CX6A 2QAGB 4DT1A 2W2TA 4PR0A 2YHSA 1XRJA 2ZSAA 1AS3A 2NO1A 2FSIA 1SXJC 1DEKA 4P31A 3CR8A 4B6FA 1W4CA 4L16A 4RJLA 1KNQA 3LNCA 2H1LA 2CHQA 4RD1A 3AF1A 3GLIB 3DVLA 2J9RA 3GJ4A 2V1XA 3QVUA 1Z63A 4TZ6A 4TQ9A 3O8RA 1XFAA 3MFYA 3K0SA 2GCNA 2XNSA 4TMZA 4Q5IA 4D4JA 2XXAB 4L9WA 3B1YA 4WIAA 1S3SA 1OFIA 5E7MA 1LF5A 4JKIA 5FH9A 1VIYA 2ZVQX 1ZD9A 2GEUA 2G83A 4CIDA 2PH1A 1HV8A 1ZUIA 3GJ6A 3NDBB 3NEJA 4TLAA 2VHQA 5FI1B 1GNPA 4PHHA 5KSZA 3AEZA 4OI4A 3ZDQA 3RSOA 3WBKA 2ZSDA 3QKRA 4NU0A 3THWA 4RD4A 2PJRA 1R5NA 1RRCA 3CUEF 1A2KC 2QPOA 4O2RA 1YR8A 2C9OA 4Q03A 1CR2A 1U2RA 4V0NA 3LBIA 2BDTA 5H68A 1YZKA 4MGIR 3EAQA 4F4JA 1Q1ZA 1US8B 4AKHA 2QROA 3NWJA 3I5XA 2PLFA 4FWTA 3G0HA 1NN3A 4CEJB 4GZLA 2L0XA 2ZYTX 4HUQA 4QBHA 5GADl 3K0AA 1IY1A 1XD2A 5G3YA 2CK3A 1Q0UA 2FEMA 1EFHA 3IUYA 2MMCA 4OHYA 1RE0A 2J0UA 2J7KA 1QHIA 1ZNZA 2R6GA 1KSJA 1XCGB 4QBIA 1X8KA 4BLSA 2ANBA 2JIZA 3ASYA 2NG1A 2BWJA 4KODA 1TQ2A 4LDJA 5BN4A 3U7EB 5IT5A 2HYDA 4PC1A 4C0KA 3U6BA 2WWFA 4M9QA 3CF6R 2BKEA 4L4UA 5JFGA 5LD2B 1NG9A 2O8CA 2GXQA 3SYKA 2R9VA 1GIAA 1TMKA 2DWPA 4PSVA 3EIQA 1OT3A 2O5VA 3I72A 4KAXA 3EC1A 4M0LA 2OAQ1 3X1YA 5SZKB 2IK8A 1CULC 4PXAA 4HB2A 3VFDA 5AJZA 3R8CA 4EPVA 4BFVA 2Z5FA 5JMTA 4GFDA 4U00A 3KQUA 4IEEA 4AG6A 5C18A 3L2OB 1NJGA 3KFVA 4ZKEA 2V8OA 1PVOA 1NN5A 2HCBA 4Z8YA 4HUTA 1X6VA 1H8EA 3THXB 4HZUB 5TARA 4OL0A 3QPUA 4XSGA 5CK4A 2O8DA 5FTLA 3LA6A 4G5GA 5BYJA 1Q12A 2JLSA 3EA5A 4I1VA 2QRNA 4U7DA 5IDVA 4LHWA 1CJMA 5FUVA 3GLFA 3LBHA 2WPDA 1MH1A 1ZUHA 1G9XA 3HYRA 4B32A 1LVGA 1LFDB 4AKIA 2RHDA 2WKRA 1M1YE 4JT2A 2HF9A 1Z3IX 2OE2A 1JAHA 3HPRA 4FINA 2QEQA 2AD1A 4LZZA 4UXIA 4QM7A 721PA 2BEJA 4V0MA 5TB5A 1BMFA 3EIEA 2ZXUA 3VR5A 4DRZA 1G3IA 1DAKA 2OEPA 2OUKA 2PZGA 4PZZA 2IYSA 5J47A 1DTSA 5C4MA 1ZU4A 1BS1A 1IXZA 1SXJA 1ZCBA 3PXGA 1CBUA 3T5GA 1J7KA 1Z06A 3UKDA 3W5JA 5HR5A 2GZAA 4US0R 1TEXA 3GJXC 4M9XA 2V6JA 4GP6A 3BAFA 4ARZA 2VQSA 2P6RA 4NYJQ 2MSEB 2BBWA 2R6FA 1UDWA 1JEDA 1CXZA 2RB4A 2CLSA 4W7SA 1XEXA 1I4DD 2CE2X 3FMOB 3T1VA 4ZDWA 1HYQA 3VR3A 3A6PC 5TMPA 1DARA 4HI0E 5AUOB 2O8FB 1P7CA 1Z47A 3HDTA 4NCKA 1CJVC 2AX4A 3IPYA 5EE5B 1Z6AA 2NMVA 3TBKA 1J8MF 4P4TA 1KDPA 4JBWA 1E6CA 2DFKB 5FUYA 1OYWA 2A5YB 1Z6YA 2I1VB 3AGQA 4QNRA 2WWYA 4XSHA 3SJBA 2VP6A 3AVWA 1G16A 1G3RA 1WMSA 2BMJA 1AIPA 3EASA 4MYCA 5IK2A 2BCJQ 1LB1B 5EJEA 3U61B 4DBLC 3RNLA 5C4GB 3U3JA 3ZS9A 3NC1C 1UBFA 3WNCA 1XTSA 3UMFA 1CR1A 1OH6A 3D8BA 4RD3A 5HE9A 5SZIA 5KO2A 4ZDIA 2ZR0A 3F0TA 3VNUA 1LNZA 1XTJA 2ZI5A 1EFCA 4HATA 5FPSA 3I1FA 3SBDA 1GAJA 1T6NA 2VHCA 3B1VA 3D3QA 2GNOA 4GSYA 3WMEA 3DKPA 1N6RA 1VYUA 4LYFA 5AWFC 2W6JD 1TPZA 3AB3A 2GF9A 3O8CA 1O87A 1P9NA 3KZ1E 3K70B 2A5GA 1OIVA 3BC1A 3D7MA 3BS4A 3EWSA 3P4YA 3F5FA 4ZPXA 3EG5A 4WBSA 5L3SA 3WBJA 1MO3A 5J4HA 2B21A 3BIFA 1J8YF 1OPXA 4NYJR 4Z1MA 4KFRA 4XH9B 4G5OA 1NRJB 4M21A 5DYGA 3WYFA 2BBSA 4ZIRB 2RH5A 1YQTA 1FPMA 1QG2A 1A4RA 4LRWA 2O8CB 5JI3E 1NNEA 2ZITA 3SJZA 4NYMQ 3AF3A 1LS6A 1P2TA 4KJZA 1ESNA 2F6RA 1K5DA 4C7OB 2D06A 1AA9A 1G41A 3ZS8A 2FN4A 1W47A 2WSSD 3T1OA 1I2DA 4F4IA 3QNUA 1S1CA 2QU8A 4ZCMA 3DDCA 2QG6A 1P2VA 4GOJA 1AGRA 1R5OA 2P2LA 3ONWA 3A8TA 5DI9A 4EPTA 4OK3A 1WF3A 3U44A 4HSEA 4JS0A 5E95A 1TAGA 5CITA 4US2R 1T5LA 4Z54A 4TL9A 1G3QA 1UEIA 3CF0A 3H1TA 4DLYA 1C1YA 4BZXA 1N0VC 1P72A 3F3YA 3GQBA 3NBYC 3DKVA 1P9WA 3R9IA 2WOOA 4HAXA 4KI0A 2N42A 1T3SA 3VKHA 2FFBA 1NKTA 4NONA 3VQTA 2ONKA 3P26A 2ATVA 4BASA 2FZ4A 2WIAA 1NJFA 3LQQA 2PT5A 2JCSA 3Q9LA 2OCAA 4KFUA 4TWZA 3ZGXA 2ZU0C 1IQPA 2F3RA 4OKSA 4DSOA 4XWOA 1XEWX 5DN6D 3IDQA 4N3NA 4XTCS 1FP6A 4DWJA 1T9HA 1JPJA 2OHFA 4OHXA 4UNPA 3MJRA 4E22A 4A82A 4TTPA 4L9SA 1JR3A 2REBA 4P4SB 3B1XA 1II8B 1EX7A 4HB3A 4ILEA 5J40A 4ARZB 3TVDA 4CDGA 3NC0C 4C30A 1SVOA 5EQTA 2DWQA 1Z6XA 5J4YA 3M6AA 4MYHA 2QMEA 4OHWA 4X8OA 1ZYUA 4IVQA 2WWXA 2ZRBA 4NDZA 2GCOB 4NYMR 1OB2A 1E98A 5K8UA 4EQ6A 5DSZA 1BO6A 3TSOA 3WYAA 3LD9A 3QG5A 1U98A 2ERXA 3H4MA 4URVR 4HLUC 4BZQA 1HQYE 4JVLA 2BBTA 4JYBA 4CT5A 3LW8A 4OJKA 5L3VA 4QJ4A 1Z0AA 1M8PA 3TUZC 2ZAMA 2UZIR 5E3HA 3L0IB 1KAOA 2B8TA 2BC9A 1E2FA 2IL1A 1KDRA 3T1QA 2ZE8A 2WMNB 4K8OA 1N6OA 1ZRHA 2GJ8A 3GEHA 3VU9A 1D9XA 4IRUB 5JI2E 1YR7A 1G64A 2AK3A 1TQDA 1KK2A 1XDBA 2J5XA 2QTFA 2RMKA 3X2SA 1E4VA 2DWOA 3B82A 4TYYA 2ZI4A 5FOWA 5HZKA 1IAQA 3WHKA 2EYUA 2QPTA 3U3RA 5EUMA 4JMPA 2HYIC 1R7RA 2JATA 2JAQA 1OF1A 1N6NA 2XEXA 3K1JA 5K8IA 2D3WA 2OM2A 3ZJYA 3FFBA 2ZE6A 4IOLA 2IYXA 2VA8A 4MKGA 1CKEA 5EZ6B 2JJ1D 1RRPA 1E2QA 1KTVA 3TMKA 4A1FA 3R9XA 1XEFA 1KGDA 2IC5A 3CPEA 3KKOA 4MKIA 4BFTA 2IYWA 2O0HA 3A1UA 1OXXK 3T1TA 3CX7A 4DCNA 1J99A 3R7WB 1W4RA 2YWHA 3RAPR 4LBVA 1IM2A 3IHLA 4S35A 5F3WB 2V7QD 5FBRB 1YKSA 5J4LA 4DCTA 1ELOA 2XB4A 3DZDA 1KDTA 2REOA 3MWYW 1SKYE 2CE7A 5TV2A 4Q1DA 1F2UA 2QT0A 5L3RA 1XZPA 2BBOA 4TLDA 4UXJA 3UK6A 1HT1E 2V4ZA 3UATA 1GTVA 3BD9A 3K70D 3WRXC 4OJQA 2CK3D 1MOZA 2A7QA 3N2EA 4B48A 5BWMA 3HU2A 4XOIA 1KJWA 4URWR 3ZH9B 4FCTA 4B3CA 2LKDA 2FEOA 3PJRA 1R0YA 2BVNA 2QL6A 2FSHA 2GVDC 2J46A 3A1TA 4IDNA 3T12A 4D0GA 4AD8A 2ZRIA 2EFHB 3GLHA 1OH5A 1G5PA 2D2FA 1U9IC 2ZUDA 4LYJA 3RS4A 4EFLA 3PENA 4KO8A 4FXPA 3QOFA 4EPRA 3G5UA 4BE7B 3LX8A 3HU1A 5KYKA 1FNMA 2EFCB 3KUDA 1ZNYA 4NZYA 4BFWA 2WJIA 1E79A 4AYXA 3KJGA 1EWRA
chains in the Genus database with same CATH superfamily
4FR5A 4ZA2A 3M82A 1ZBDA 2NO7A 3G9QA 1PZGA 4D6PA 4RZXA 4FLMA 4G5YA 3EVGA 1Q0ZA 5AR1A 1ADJA 1OPRA 4P7FA 3JYHA 1NW3A 2AKYA 3KETA 4OKIA 4CKWB 2QIPA 1WSWA 3MJHA 3H9BA 3ZHSA 2PU5A 2XOKA 3BDAA 5FB3A 3HNOA 1M7HA 3FKQA 1H8ED 4QYIA 4I08A 3E22B 3B89A 5DP2A 1RP1A 2Y71A 4LNUB 1NP3A 3U3KA 4B4KA 4HG2A 4R40A 4R69A 4ZOLF 2NACA 2NU7B 2V7VA 4QGAA 4Z4EA 4C04A 4L5CA 1UWLA 2XD4A 3FVRA 3IT2A 3IIEA 1R8XA 3LSYA 4OHBA 4UUQA 4UZEA 2BZGA 5KTMA 4ZEVA 5BV2P 3R7AA 1CR6A 1K3FA 1XKTA 2XSZD 4GECA 7REQA 1Q19A 2HD4A 2ZYHA 4JLKA 4MQ6A 4NBWA 1L3BA 5DNYB 2PA3A 1M8FA 3ENKA 3O0DA 1V3QE 4YJ2B 1NY6A 3ZK7A 5AKHA 4ALLA 3LUBA 3L06A 1NYLA 3RUPA 5MN5A 3Q2KA 3EF0A 5EJ7A 1H65A 1KMQA 4MHSA 1PUXA 1SVIA 1PFYA 5EIAA 4LVNA 4JGIA 4HLUA 3HHPA 4UUBA 4GWLA 3TW0A 1OBHA 3VH4A 5C8XA 4Z2YA 1P5JA 4ZAWA 1ZD5A 4CUKA 3N87A 1B0ZA 4A0GA 3BUSA 1XWFA 3OT1A 2WJ4A 1JMYA 4X93A 2JAOA 4CR7A 1Q5PA 1ZA1A 2ZB2A 1GUDA 1ZK1A 2J5QA 2OCDA 4IF6A 2Q1WA 3P0JA 4WKBA 4KR9A 4FFVA 2NOAA 1P44A 4L74A 1B4DA 3LLCA 3LBYA 1X1QA 3KQPA 1CP2A 1OZHA 4IDFA 4MQLA 3FOWA 3PHJA 3AJAA 4OCZA 2FPMA 1RQLA 5TRTA 3TNDA 4EHBA 1LJ8A 4V24A 5IMSA 3UAVA 1AKVA 5ELLA 2IZ5A 3ZXIA 4CDNA 5BXYA 1P2DA 3AF0A 4OG2A 4YJGA 3O83A 4BKOA 1Z28A 4MQMA 4CLOA 4GQAA 2XTAA 1GZ7A 1SG9A 2WYHA 1JR3E 3GRVA 4MJLA 4QPCA 3VKWA 1R3UA 4MIOA 3DMYA 5ALEA 4TLEA 2J9XB 2AOUA 1WHTB 3ISJA 1N2CE 1XR3A 2Y77A 3G8AA 3OEWA 4BAZA 3FCCA 4X24A 1DAMA 1YQ9A 5IW8A 2NP7A 1CIPA 3HWSA 4DSTA 4NBTA 4UHBA 1QO9A 5J63A 2P9JA 2K6GA 1CYDA 4LC0A 1DRUA 1UCFA 4R6XA 4YFYA 3DLHA 1Z39A 2YINC 3U7GA 1MPXA 2NSLA 5JAPA 1N0WA 1IIBA 4RBNA 3CPHA 1NQTA 1JE0A 4M8IA 4HFRA 5CM8B 4Q3EA 4AZSA 5K0NA 4BO0A 4K9RA 2JJ8A 5DNUA 1SZJG 3V97A 1E0DA 2Q0HA 1IJBA 1BMDA 2Q6TA 4GT1A 1X8JA 1ACLA 1O94A 5KSYA 1UK7A 1W46A 5T6MA 5F1YA 2CN1A 2HC9A 2YWFA 1MV5A 3G7NA 3HDJA 4F5EA 2VF8A 5LIRA 3JQBC 3TB4A 4L8LA 4JLVA 4IFTA 3ZZMA 2FZLA 2WAXA 1WOYA 4UM9B 2C04A 2ISQA 2VKTA 4H60A 4ZRDA 2GAAA 2W6PA 3P4XA 4YC7A 1AQUA 1P4HA 4ZOAA 2B37A 2E87A 3IUPA 4JLDA 4RORA 4XJXA 3VGJA 2VP9A 1VCMA 1X80A 1M7BA 2P4SA 4CF5A 3FVVA 5E6RA 2RCNA 3OF2A 4Z99A 4ZVVA 5TS2A 3WLNA 1RAEA 1WZCA 2B1QA 4WFKA 2UKDA 3PRYA 1ONNA 2YVKA 3D0RA 2Z8XA 3OF5A 4XA8A 5HIIA 2D00A 2IH2A 3OZAA 3G9TA 4PRKA 1XNGA 1YHZA 5ITVA 2P2YA 1HLPA 2B36A 2QRPA 2V7UA 3M5DA 3TM5A 1FOEB 1PT8A 2COEA 3LLMA 4OQPA 1JP7A 4CTOA 1PJCA 4ZEWA 5IH7A 5EMJA 4EOGA 4AICA 2XTMA 5A6SA 5AI0A 5KNDH 1SMKA 2I4IA 2AZMA 3QA3E 3RHSA 3I1JA 5LOVB 3T9DA 5INTA 4W1QA 1XMVA 4XWKA 4ER6A 1Z2AA 1N1GA 4GX2A 5BQ5A 2IP4A 1GKKA 5C53B 1V16B 4IHJB 1HQKA 3ISTA 3PK0A 1P3JA 3W3AA 4JLNA 3LL7A 3Q3IA 1JXAA 2G5CA 2O8BA 1G1MA 1Q7RA 3ELYA 3PUJA 3MJ4A 3FM9A 1RDFA 1GQRA 4Q4AB 5EYPB 4D74A 5I7VA 3H05A 4YCAA 1JDBB 1QOZA 4GC5A 4GGPA 4TL7A 8OHMA 3IC5A 3TG8A 2PKQP 3NTQA 3QE0A 2YWDA 1ISMA 4P98A 2GEKA 1HDZA 3W8NA 5ERXA 4I1YA 4F12A 2GHQA 2JI4A 2ZI9A 4BGUA 4C1BA 4J76A 5BYKA 1AV7A 1NUSA 3GGOA 1SVKA 3NTUA 3GG2A 1CY1A 4D8VA 1NPDA 4C6TA 3CVJA 2DWUA 2JFXA 1F20A 2YZNA 3R6GA 3RAJA 3LZCA 1XF1A 4A0FA 3GWGA 5HZHA 2C99A 1XMSA 3B48A 4MVJG 1XXHB 2HO5A 1EGAA 1G5IA 2OMKA 9LDBA 3O6VA 3QWBA 4QFDA 1N57A 3REQA 5LIPA 2I3ZA 2Q4RA 4G1VA 1QIEA 3OUZA 1O9HA 4RELA 2XYVA 2HQBA 2H6EA 3SPXA 5BWOA 4UW9A 3H8SA 1RKQA 3VO9A 2H9IA 3T15A 3C7TA 2B99A 2E21A 3QLJA 4P5DA 1OAKA 3K5PA 2FMIA 1MV8A 5J2UA 5FLEX 1BD3A 2PBRA 4N3CA 4PINA 2PT6A 1OX6A 4DEVA 3M1LA 2BMFA 4GU5A 4ARIA 1L4YA 2P0AA 1M0SA 1U7WA 2I67A 3HC7A 3U0VA 4K9PA 4KMSA 4OIFA 2DFLA 2FEXA 1IZ8A 1QHYA 5FTNA 1VCOA 4URXR 4A10A 3MJVA 3L0YA 3HCWA 4JBXA 4AXBA 5FT9A 4FFRA 1AV6A 1LX6A 4H35A 3K0EA 4EEKA 3JYNA 4CQMB 1RPJA 5FA6A 4C6HA 4DLRA 2P77A 4Q12A 5KQPA 3DXFA 1DQZA 1DKOA 3FDIA 4D0SA 5DGXA 2RK4A 1VC2A 4EUEA 5BNWA 4IIGA 1YAHA 4WFIA 5EMLA 5FOVA 3GLTA 1EHCA 3UPDA 3WMWA 1E60A 2Q4BA 3PSHA 4U7PB 1W6RA 2H59A 2CEAA 2CYBA 4BMPB 2VUTA 3KG2A 2H2FA 2I55A 3I9V1 3QMPA 4U7HA 5J2TF 1ZC3A 4YRMA 3N05A 4IQ8A 4HDSB 1ZIXA 4V1CI 5K6TA 4DJAA 1RHRA 3I2IA 3BTSA 1FVFA 5D1NA 4H1WA 5GMOA 2KE5A 4QECA 3MD9A 3WYEA 2PUDA 1NJ5A 2IKSA 3NDJA 1P73A 2BMAA 2Y1OA 3ZBQA 4AJ1A 1L4HA 2B5WA 2QRKA 4TUYF 4W9NA 4NMHA 4DLPA 1RHMA 1YA6A 3C4JA 1UC5B 1W44A 5ALVA 2ALJA 2V58A 1FQJA 1C30B 1VLJA 1MORA 2WM8A 3NALA 4IOJA 3K9NA 4XJTA 4OP1A 4AQDA 4BL5A 1PLJA 1RRFA 4W5OA 1T1EA 3GRPA 1RYFA 3U16A 4YCNA 3LDGA 1R4MB 3OIDA 1PLLA 4V0SA 3UT5B 3WIDA 5FPHA 2PX5A 3B6EA 4U63A 5BRJA 2XR1A 2GD2A 3BEOA 1EP2B 1HI9A 5CDUA 1BYUA 3LS2A 3ZZ1A 1O8BA 1W5AA 3P8ZA 5D01A 3NG1A 4FD3A 3D59A 4FM9A 4KXLA 1JJ7A 3QUSA 3U0BA 3X44A 4AKTA 2YWCA 4DMCA 3C48A 3KT8A 5JZBA 1CRZA 4RFVA 1Y3CE 1Z5ZA 5AJUA 4TVSA 3OCJA 4EA7A 3ECAA 3NKVA 1E20A 3DC7A 2YC4C 1WV0A 5K2MA 4E4TA 4ETNA 4FN5A 1SHTX 2EC5A 2A57A 4EHKA 2J1LA 4E13A 5JD5A 2ILVA 3U4QB 3ZVNA 4C0SA 3HWRA 1X19A 2QRHA 4J90A 1HEYA 4C4OA 2I9KA 1M1YB 1XLVA 4MWTA 1PNOA 3VAYA 4J2OA 3RU9A 1YDWA 2BUAA 3KB8A 4IDPA 1ZPDA 3L02A 4PANA 1T4CA 2QG4A 5AUPB 1Z6GA 2BTQB 3SLRA 1KYIA 1PW7A 2O0LA 3KKLA 4HADA 4IQ0A 2ZZKA 5DTMA 1I5EA 5DCYA 1BRTA 1EWTA 1XCMA 1F38A 3JWGA 5IUNC 1IFXA 4OXXA 5A7FA 2JFNA 4AZ0B 5KWVA 4M0DA 1CEEA 1TMOA 5JC8A 4HPJB 5CLQA 3NUZA 1DKPA 3O92A 3PDWA 4H17A 4BWVA 4QDOA 2H1WA 2J4FA 4B2IA 1SURA 2P65A 4LE2A 3OIGA 1WDWB 3OM8A 3T5DA 1BXRB 2JCVA 4TTQA 1ISRA 1L5YA 2XT6A 3NETA 4WPGA 1F8YA 1T0PA 4ZCIA 1VB3A 2Z6VA 1GKUB 4PLFA 3LBFA 2B92A 5DBEX 4RMJA 1IG3A 3T7DA 4CMBA 2R4TA 3JAKA 5A06A 3LY7A 4DUPA 3EYAA 2EDCA 3RODA 1ISJA 3W4KA 3TW8A 1P1KA 1JG3A 2C3MA 5HBRA 5IBCA 1RWOA 2GF0A 1X7GA 2GPNA 4KV9A 4WLVA 5D3MA 5AW3A 1SXIA 5EWLA 3A3OA 2C5SA 5KDOA 5LUAA 4YB8A 1LSJA 16PKA 4D0NA 4AN1A 2Q21A 1J5EB 1L5ZA 3SYNA 1ULHA 3DUWA 1PJ8A 4RV5A 3B52X 2GHTA 3SMVA 3UMGA 1G20E 4BFSA 1IY9A 2XOKD 1K1EA 4BX0A 3QU5A 4S0XA 4ZQIA 3LQKA 4I6JA 1SG0A 3EW9A 4X8MA 3SQDA 2QX9A 4LHXA 3UFXB 5BWCA 2JF0A 1E3WB 1I80A 5AJYA 1FDTA 1K5GA 2OCKA 1NYRA 3LUCA 2PGJA 1DO0A 4X7PA 1T8WA 5TY0A 4PS0A 2IFTA 3FPFA 5L53A 3V00A 4N54A 1U3GA 2QN2A 4DMRA 3FE2A 1CY2A 1KEUA 4LOAA 4A0RA 4QPDA 4KMOA 1KMHA 1NR5A 1UM9B 4LQCA 5H83A 4BTEA 4K40A 4QZVA 2AC4A 4I8IA 3T1NA 3FHCB 1NC3A 3AR7A 5AK4A 1UBEA 2AWNA 2ECQA 1RQ7A 3H5WA 1J97A 1DV1A 1CNFA 1QDEA 3FCOA 3L84A 5CURA 1AN9A 1QF7A 3FX2A 4D4IA 2QSUA 3DE1X 2H5IA 3PNSA 4RFSA 5B4VA 1IN1A 4ZHSA 2JASA 2WHQA 3NV9A 5C8YF 3BB4A 5AVQA 1GO2A 2YV5A 1E3JA 1I3NA 2C9DA 3CF2A 1YQWA 1FMTA 1N8SA 3SSNA 1MTOA 1Y4ZA 4GR9A 5A0TA 3THWB 2QGNA 4AUNA 4HNUA 4YPFA 1NSFA 3DFUA 2IX9A 2ZANA 1GUBA 3AZOA 3B7GA 4GUAA 3ZWQA 1ID1A 4TV8A 1XRQA 1T0JB 4EVSA 3WAKA 2N9UA 1BG6A 1QGZA 3JPYA 2HIMA 4RHFA 2Y1XA 1EB8A 1DIBA 2EKQA 4E5KA 2XQKA 4OBXA 1KTIA 3Q6MA 1Z2CA 4KC0A 4Q21A 4F92B 4MINA 2VP3A 3PC7A 5EKDA 4WVLA 3UO8B 4EB0A 1ABEA 4YQEA 3TZEA 3Q5GA 1J0EA 4URZR 3S2YA 4JSRA 2FGKA 2JFZA 3L7NA 4UZSA 4G8JA 3V8BA 3PG5A 4QLAA 2E85A 1R0RE 3OEED 1G291 2JRLA 1XD2B 4WLFA 4B3FX 1KMMA 1JHXA 5FWXB 2E18A 2WHRA 1S3IA 3ROKA 1W4BA 3H0EA 2UZ4A 5T7BA 1WMBA 2IS6A 2FZGA 3SZRA 2JD1A 1HF3A 4FJ2A 2CNKA 5KNCH 1WRBA 2R25B 2HK8A 5HJ7A 1UJ6A 1XA0A 2R6HA 2VJPA 3SVZA 4CTMA 1NU6A 1W96A 2HCFA 3OZWA 4GRDA 3AKYA 4KJXA 1YQGA 2DRIA 1QUEA 2QN8A 4RJJA 3NFRA 5CDHA 1DMSA 4HS4A 1IPEA 1ISGA 1I94B 1II0A 4G84A 3K9QO 3G0DA 1JILA 4PONA 4A6XA 5IWCA 4DN6A 3GEIA 5KINB 4UHHA 1Z2DA 2G4LA 3FPCA 3NT4A 3M4YA 1ZLXA 3ZYCA 3W5CA 10MHA 3HP1A 3P9QA 1CRQA 2QX6A 1VSUA 3KQLA 4AU1A 3MRVA 4CKYA 1C9KA 4D9HA 1J8VA 4FNMA 4QM6A 4CRWB 5JPIA 1CY6A 1I0LA 1M2FA 4HXFB 4LQ4A 4C4ZA 1DWPA 1SUEA 3C6YA 3WGNA 2ZJ3A 5CA0B 4XYGA 3G5AA 4EKIA 3M49A 2FGJA 2FK7A 3QG1A 4KWTA 4ENPA 3KYJB 3B3QA 2WTUA 2AJLI 1Y81A 1U0OC 1M2GA 3E4CA 4BKQA 1WTAA 2Q4OA 4MWEA 1A2QA 3O1HB 3ZU6A 2ID4A 2JC3A 4MUNA 3QXSA 2NVUA 2O8DB 1JAXA 2X8JB 4JIMA 3DL0A 3BILA 3IV6A 3X0DA 2D2EA 1OA0A 4KMMA 4PHCA 3U7QB 1KI6A 1VLLA 4P7KA 1U5BB 5JNSA 4X3OA 1G8HA 5CD1A 1OBVA 1R9NA 4R81A 3KKQA 1G6HA 2GJKA 4G1BA 3ZEAA 1JIJA 1H2BA 3IJ5A 4P0QB 2ODEA 5JNRA 2BP7B 1YOVB 3N0VA 4ND8B 1AJEA 1E99A 3KR0A 3Q88A 1J90A 1YR6A 1R16A 3R2JA 4X6LA 1WETA 3CUVA 4PF1A 2JH3A 1N2GA 3MCAA 1XCPA 1RBZA 2PSDA 1OYOA 4OAPA 2WIJA 2B2XA 4FFNA 5M34A 3VHXA 1L9KA 1J0AA 3BGDA 4Y30A 1G21A 2PGAA 3UGKA 4WFQA 2JHCA 4O4JF 1U7PA 1UODA 3IP7A 4D57A 2VOEA 3DO5A 3QJGA 2ZJOA 3GFRA 4P6VF 4D82A 1XDDA 4A91A 2VCYA 3F46A 5DSXA 3PP8A 1HE8B 5HILA 2FFQA 2AJCA 2Q5HA 3T1HB 4MLDA 1VDZA 5IJWA 3GAZA 4UJ3A 1XEXB 1KQ3A 1LPPA 4KQHA 1LBHA 2HLDD 4IH9A 4FFDA 3P0HA 1MG5A 5F7XA 1RYZA 1QX3A 3P20A 4JUBA 5J23A 5KYGA 5L4LA 4WLUA 2H08A 4XARA 4BMCA 5CT9A 2HXGA 4ZJUA 3IDZA 1YDEA 3VV2A 3FXAA 3THYA 1D8TA 1ZCAA 2VJKA 1Q7GA 2QY6A 2X1LA 4K2HA 4P4LA 4B7UA 3QSYA 3QXCA 3R1IA 4FILA 2VEOA 4HNQA 2XAUA 5IXYA 4IICA 3VOAA 1QP0A 2TMGA 3JASA 3L6CA 4W6QA 1HE2A 3PXDA 4XZ3A 5C7YA 4ESVA 3ZY5A 3W1EA 3ZI7A 1Z7BA 4X92A 3MRXA 1OV4A 4A23A 3GLUA 1BH2A 4EB6B 4EH1A 1QCDA 2HJHA 5EQFA 3EEIA 1E3LA 2XE7A 3O84A 4Q47A 1P0CA 5DHSA 3REGA 4C4XA 2IW1A 4PFSA 2V0CA 4E1VA 1XTQA 4B9EA 4KYUA 4ND7A 5COAA 5T5QA 4QASA 2VTBA 2P7HA 5AW0A 3K35A 3LQFA 4LGVA 3NHFA 3MA0A 2IZ0A 3ND9A 2Q0SA 1L4FA 2W7TA 4IQGA 3KOMA 1KQNA 5ALTA 2GO7A 2G4CA 1IUNA 2J59A 4L3WA 3ZDYB 1P1JA 1CVRA 4TYNA 1VHWA 2WYWA 5HSGA 4R0NA 2UZ3A 4JB8A 1GEEA 5KX5A 2Q3LA 1M6NA 2A9RA 3MUEA 3O1JC 2CNOA 2DF8A 4LDNA 5EIWA 4CKBA 1M6EX 1PJZA 2QLNA 4EENA 4QT4A 5CVVA 3B3GA 5FQNA 2GWHA 2C82A 1K75A 1V7QA 2RK3A 3FLAA 3I8SA 4PYLA 3O3NB 2JGFA 2ENUA 1L7VC 1Y7IA 4FYMA 4Z53A 1U80A 1ZN9A 1CQJA 1T5DX 4HAZA 4MUHA 4RVNA 4BEVA 1DRJA 1G8GA 1RYHA 3JZFA 1C9YA 2QL7A 1UOPA 4RHUA 4UU7A 4YJ3B 4KREA 1OYVA 1P0FA 4GOKA 1COZA 3U4CA 4DZZA 4DCOA 1PZNA 2Q1TA 3VTKA 2PRIA 3NIDB 3MYRA 4GI2A 1WB5A 1KBOA 3M5WA 3QY0A 4HS9A 4LZAA 4ENSA 4YMGA 1R0ZA 5SZJA 2HJVA 2AMYA 1LPOA 1VG8A 3EPRA 1DG9A 2YXNA 2JIZD 4KLZA 3D6FA 3FWYA 1W9MA 5AJVB 1LDGA 5TQ2B 3PLAE 1OW3B 2YUIA 3S1AA 4D9NA 1Z26A 2LDBA 4EKGA 2J0QA 3X1DA 4O8CA 5C8DA 5AXBA 1J23A 5LC1A 2R86A 1O54A 2HJSA 5LN1A 2J0EA 4LWPA 1QGED 2IIQA 3G13A 2YKGA 4Z0TA 2CSUA 3NTVA 3MQ2A 4D80A 1XZQA 2BI4A 3DZJA 1VPDA 3GNLA 3TUJC 2YWGA 5B3JA 2NZJA 4URHA 2LNDA 1ZM7A 3W0LB 1QCYA 2IE0A 3OQVA 2QT1A 4NXNB 3RH0A 4D44A 1EAMA 1X94A 4RKFA 1SOMA 4RAQA 4ZI3A 4TMTA 1MNQA 3QYJA 4TTSA 2QX4A 1E4YA 1Z33A 2YDXA 2X1MA 3PICA 1YQQA 4R9VA 3TS1A 3LUAA 2QTZA 1AXRA 1CQIA 2Q27A 2IUSA 4RV9A 1X7YA 5FPYA 1V43A 1AOXA 1AMNA 2NXNA 2PUTA 4W4TA 3CZPA 5JD6A 3Q11A 1HFWA 4BJ5A 2OG1A 1WKCA 2PZFA 2J41A 1VJ0A 3TIGA 2GTPA 2DR3A 2QTHA 4ZCSA 1RJ9A 2ZBDA 5GZ1A 2C5GA 1VPEA 3ODPA 3KYDB 3PTLA 4N12A 3L8CA 4D2IA 4KG7A 2AEFA 2XJ4A 2CUKA 3ZBTA 3DBHB 4GBMA 4BMXA 3W5IA 3CLRD 4AL4A 1MOQA 4F21A 3HABA 1RRMA 4QBTA 4AS1A 2EU8A 2HSDA 1HEUA 3PEVA 1U2DA 1RPTA 3NAQA 4FFLA 4MI1A 1Z18A 3H5RA 4KWHA 4U7TB 4WDQA 4OI1A 4I3FA 4DLXA 3WLRA 4EAQA 2RD2A 2J30A 1E8MA 1KZYC 1ORDA 4KFSA 5EA2A 5KDLA 3RTCA 3Q40A 2ZRDA 3WP1B 1BMFD 4UUAA 5E4FA 3HKEB 1YVRA 4DLZA 3D3NA 3VR5D 1KJNA 1NXXA 1ZNWA 2ZTMA 1HDIA 1GCOA 1XWIA 3ET5A 1JECA 1I5OA 4GKVA 1FNNA 3PDCA 4B8WA 4FOOA 3CUSA 5C8VA 1P18A 3WLQA 4JQSA 3H7IA 3UM9A 2EZUA 1GR1A 5I7SA 2P3OA 4J0CA 1F0PA 3F73A 3TDNA 4EGQA 5DKFA 1GKIA 5ALIA 5B64A 2VWPA 4RA6B 1VL8A 4QC2A 3SE0A 3ROMA 1ZNQO 3HKDB 2D1RA 3VSAA 1E3MA 4YY3B 1PL8A 2QGZA 1X7DA 1RWBA 1VJDA 4XPZA 1GCUA 1GSHA 1IMJA 1TZJA 2M98A 3FBTA 4O29A 2YHAA 4P4GA 2VF4X 4BWYA 1OIWA 1QIKA 5KJFA 4GVLA 3VKGA 2DETA 1PJRA 5LDHA 5C0OE 3OWXA 3USZA 3F9RA 1WBBA 1SOAA 3A32A 1FVOA 4D8WA 3WLTA 1B73A 2P4EA 1J6UA 3EG9A 2R8PA 2Q6OA 3DD5A 3AESB 3KB1A 4GBJA 4DIBA 4ODIA 3OZEA 1JPUA 2XNCA 4KBGA 4YP7A 1CLUA 3ZE1B 3WKEA 1FDRA 2RGCA 3PUHA 4ZV9A 1SCBA 3ETJA 1RPNA 2FPSA 2X14A 4Q02A 4UCXA 2BZ0A 4G56A 3LDAA 3ZU3A 2QVYX 1XELA 2OOKA 2PYZA 2HWKA 2XGGA 3CKYA 3G82C 1U7ZA 1YZQA 4KWIA 4MVJH 4RU1A 1N2IA 2Z98A 3V7FA 1EUQA 2R00A 3QPCA 2FEPA 3AVQA 3BEDA 3TUIC 4HQOA 3I9JA 5REQA 1PJBA 1Y89A 1L5NA 1FNBA 2GDZA 4BNXA 3PNPA 3WZ2A 2I8CA 1LLQA 1N2BA 1BKYA 4YJFA 4DZTA 1H1DA 1ENPA 4ESHA 5LZ4A 2DKFA 5DB4A 4B17A 5EESA 3QVJA 3LDUA 2WBLC 1O96A 2QD3A 1X8LA 3AUXA 1GZVA 1NUAA 4I36A 1DAFA 5AI8A 3DL2A 2HCTA 4X3CA 2YRXA 3T9EA 3JZIA 1NRWA 2H4FA 1US8A 4QVIA 1HYBA 5A04A 1JIKA 3HEBA 1KYWA 3WO1A 1XQ1A 3IE2A 5HKLA 1S9DA 1H0SA 4AIRA 1JLHA 4ZI7F 1XZEA 4QYSA 3FYDA 4PYIA 3K16A 2H65A 2QF7A 5HTKA 4UCFA 2RIRA 2ZDGA 4MMYB 3L8MA 4Q7EA 4IZ6A 5CVTA 3T06B 4F8JA 2IYVA 2A92A 2NUBA 5UKDA 3KM0A 5JLAA 1Y1PA 3EGDA 3NGMA 4UDYX 5L51A 4PSDA 3ER8A 1SUWA 1LDMA 3L7JA 1R88A 1W75A 4MW5A 4UEOA 2D2IA 2GHIA 3VTFA 3PTZA 1JEJA 3PNLA 3NHKA 2WV9A 1KS2A 2V9CA 3EEOA 1RW4A 5SV2A 3VR4H 1G20A 1MC5A 1FTWA 4ZVOA 1HX7A 4ZMBA 4XTRA 3TOVA 1Z6PA 2OVFA 3KKKA 4RPIA 1VJ5A 3Q5EA 9MHTA 1MMFB 2DFVA 4M98A 4ME6A 4RMHA 4GPEA 4HWSA 3UV6A 3EPJA 4PXSA 1N3LA 4UJ5A 1RXWA 2ET6A 3MUNA 1K6MA 121PA 2EBWA 2JKVA 2IHNA 1N8KA 1Z6TA 2OBBA 3DHEA 1RYEA 3P2EA 4OI0A 3RNOA 4DJJA 2Q9AA 1SHUX 3MMSA 4LJ8A 4UU1A 4R2IA 2BFEA 5L6MB 3KALA 1V9CA 3DV9A 4BN4A 1GPKA 2AJDA 2CBXA 4HGPA 2DYKA 2Q6LA 4DEXA 4HX9A 1S1MA 3UJ6A 5B3LA 3W9UA 1SHJA 2FPGA 4RMNA 1C4OA 2PUVA 4RVGA 4UCQA 1E9CA 2AOTB 3H5OA 4QYIB 1YCDA 3FHOA 1C0EA 1KERA 5AK0A 3MJEA 2HPHA 2VATA 3H2GA 3ZWNA 1WZEA 2BOVA 1C9EA 6ABPA 4JB3A 4OU5A 3TXAA 5HZMA 2I1QA 1E18A 4M60A 3KQKA 1W4ZA 1D7AA 3CUWA 4PX5A 4PPFA 4D3XA 4MXDA 2WB2A 2CXTA 3B5JA 4BVFA 4KFCA 3R5FA 1YBVA 1MRNA 4FCVA 7REQB 1QV9A 5EIEA 1BAPA 3IAS6 1HY3A 1C7ZA 1Y8RA 3ZTTA 3RU2A 4OXQA 1JJIA 1L5VA 2P9EA 4CMGA 1AD2A 1O1YA 2QLTA 3JQ6A 3LKVA 2XW6A 2IS1A 2XZOA 1BE1A 1DI0A 3IJEB 4IG9A 4GX1A 4YRNA 5K8LA 3G2KA 1RBYA 4I5GA 1WW3A 4JI4B 2XYPA 2HRZA 1NMQA 2XUKA 3L46A 4FKZA 4PYKA 1DRWA 2W6ZA 1JMKC 1U99A 4GDMA 1HGXA 3DW3X 1EAYA 5AXAA 2XZLA 1K86A 1WSAA 5FR1A 5JAOA 4MV4A 3TZ6A 3DM9B 4C4RA 5IU6A 2KQUA 4YP0A 1C41A 2VXYA 1SXQA 4Y2QA 3O3CA 4JGGA 1XJWA 4RQAA 1MX3A 3F5MA 3TCNA 1G60A 1JR3D 3QV1A 3QEAZ 1ZR4A 1QORA 2VNHA 1PS0A 3OT1B 2EKBA 4JVMA 2NQ2C 4RANA 4X1IA 1Y6QA 1NVGA 3IRUA 4FEGA 4X3PA 3PC8A 1XFDA 3GFTA 1C5KA 1JIUA 1WZNA 3UAOA 3W6ZA 4YRKA 3MWEA 5HPYB 2PS1A 2DLNA 5L3ZA 2J87A 3ZWDA 3JR3A 1DB3A 1ANKA 2X2EA 3IPRA 2GR9A 4TN1A 4G36A 2AWOA 2V1UA 2FE1A 3KXDA 2XOXA 1IJKA 3HYTA 5C7IO 4BN5A 3JY6A 1EUYA 4WDRA 2DZDA 2Q07A 1K8ZB 2ZRLA 3LG2A 1EQ2A 2O20A 3MSXA 4MWZA 3I4LA 1I6LA 1KFKB 1PU2A 1GZ5A 4YJGB 4CLOB 1TA4A 1C0LA 2GLXA 3T5AA 4Y0AA 1MJGM 4L6CA 4ZTBA 5A3JA 4D9MA 2Q50A 3SZUA 2O8FA 1VL5A 1AC5A 2WYIA 1AVTA 3FZQA 1GVNB 3IA7A 2FR1A 4FMCB 1OASA 4Z7NB 2AOUB 1LTKA 4MR8A 3KEGA 1UKBA 5JDIC 4WVFA 1JA0A 1Z5UA 5DTJA 1M6VA 3DDUA 3FPAA 4FKBA 4NYIR 1KBQA 5E0OA 4PLZA 3X1XA 2VT2A 4WLOA 1XCOA 1MW9X 2ZVPX 3OU6A 2Q5EA 5J5AA 2C96A 4XWYA 2OQRA 5DM60 3K4PA 1DEAA 5AO9A 1MAAA 4OAOA 3IPAA 3NM6B 4N03A 1VJTA 3GFGA 4J16C 1PQUA 1P9LA 5I4BA 1LBEA 4IVPA 1ZISA 2K5UA 1QH9A 4CYMA 3Q15C 5DM1A 5F9FA 3E7XA 3BICA 4UHDA 1TKCA 2JFUA 1FXUA 4F8YA 1EE1A 3W2TA 5F7ZA 2C4HA 3DP7A 2AX3A 4G0NA 4R54A 5T4EA 5E7IA 3P9PA 3FTPA 1JYFA 4BGVA 1VHJA 2YH2A 1GPBA 4IGAA 1XRSB 1UAAA 4IEIA 5E6RB 2BI8A 2WTBA 1GWNA 2JGMA 3RBVA 2XCUA 4TSFA 3ZHUA 4Q9IA 3VC1A 2A84A 2VBFA 4CL3A 3KLOA 2HGZA 2B94A 5IARA 3H83A 4NK4A 2P9FA 2OFFA 4OQEA 3QVKA 3WOVA 2W2KA 2P5YA 1WBDA 3GJQA 2WTAA 2CL5A 1ZDMA 4Q24A 3OCYA 2Y0CA 4NH4A 2OT3B 1E9SA 3KJNA 3IDFA 4B74A 3KC2A 4DCVA 3DE3X 2ZWIA 3FWKA 1PSZA 1Q1EA 2YV4A 2VL7A 3HHEA 1XCJA 5A6SB 3T9BA 1R0LA 4M9SA 3S1LA 3EUWA 4E3WA 2A0FA 4L4RA 4FBLA 3QHPA 4Q1FA 4CQLA 5I8ZA 1TKRA 3HL0A 3VYRB 2ZB8A 2XVXA 1V4NA 2QM0A 4QEZA 1I1OA 4Y2VA 3LGSA 3KR2A 1X87A 4A2PA 1R6AA 3BJRA 5E38A 3V5NA 1KJ9A 2PZ8A 2VXCA 1C3EA 3IVCA 5L95A 1N5RA 2GRAA 1JDNA 2EEPA 2QPLA 2O8BB 5FNVA 4TGLA 3ZZNA 1QM5A 1JSCA 3GPDG 1ETUA 2YCBA 1BFDA 3DFMA 4OQFA 4TWBA 4G0OA 2H18A 2XE6A 3L0BA 4NFLA 3R77A 1QYDA 1R66A 5K0LA 4DSZA 3BSFA 3T0IA 3H4TA 4ENQA 1TJ5A 5CLLA 4KVGA 2VJAA 4FYWA 2DH5A 3DB2A 4B9AA 1K4MA 5B30A 1YR1A 9GPBA 4K5QA 4PZPA 1KZ6A 2EJWA 2XE8A 1L3CA 3MLEA 1FBTA 5EGNA 2J67A 2PVCA 4I0WB 4BV9A 3TRFA 1SZCA 4MWSA 1UF9A 2AMFA 5ED4A 2RGAA 3QVOA 2IPMA 4F9TA 1ZW1A 5T57A 1XVVA 4DIMA 2GJ9A 1MEEA 2D62A 1MEOA 3PGVA 1DQPA 2OD2A 3CCBA 4EY6A 3REQB 4ZQGA 1VYTA 3WLOA 3UWMA 3EQ6A 1U0JA 1IN8A 3ETLA 2PKQO 4ZYVA 3ICPA 1DLIA 2IZOA 1YZTA 5C1DA 2Q8NA 3I05A 4L5BA 5HE8A 5HFNA 3Q6IA 1E96A 3FOAA 4FOPA 5J2UB 1Q2XA 4X44A 2HW8A 7MHTA 1F5SA 4TKMA 4LJAA 2O05A 3VNBA 4MYSA 4LY3A 3W1VA 4E32A 3G0GA 4DA4A 2R11A 3AERB 1ONBA 1NG1A 2ZJ2A 4FW9A 4RULA 1CETA 2FI1A 2EKPA 3Q8XB 3PIDA 4GRIA 4OA8A 4EW1A 1N6PA 3KAJA 2XWBF 4R1MA 4M54A 1FRZA 2A0UA 4P4SA 4F85A 1E59A 2CL7X 1AZTA 1J22A 1DBQA 1E5LA 3EISA 4FI3C 4X60A 4NNPA 5ALMA 2NPOA 3NBQA 1LTQA 1E5VA 1MA3A 5JXWA 2DH6A 1AUXA 1VE1A 4RD2A 5FA5A 2XBMA 4G5HA 5B6IA 5DW3A 1NR7A 1P8JA 2RAUA 5KZMB 3FYTA 1YKGA 5C3UA 2H3HA 2PCJA 4BVAA 4KQGA 1BU8A 2XMCA 1TT5A 3WKAA 2QTMA 4IJQA 4QDZA 4KACA 4AQYB 521PA 3L1HA 5LMUB 5KSPA 3VYWA 2X5KO 1C7QA 3EY4A 4QGHA 4G9BA 2IRWA 2AA3A 2HFKA 4CKZA 1CUCA 3MTDA 1GUAA 1Z4QA 1GNQA 1F60A 1ND6A 621PA 1H0HA 2IYLD 5FDFA 4I4CA 4LOKA 1XMXA 3ELDA 3FZGA 4D98A 1AQIA 4G97A 3QI2A 4FQ5A 5IT0A 2RGNC 2MYUA 3M6LA 4HZIA 3UXEA 4Q9LA 5K0GA 4JELA 1DQNA 5AK5A 3A31A 3HA5A 1VE9A 4E2XA 3LCVB 3UF0A 2PZAA 1IOLA 2ZQ5A 3K7EA 3ZWBA 3HDGA 4U8HA 3L4JA 1GSIA 3OJ0A 2IPOA 4M99A 1GPAA 3MS2A 4JASB 2VYFA 4CPDA 2PS0A 5FAKA 1ZHOA 1ZD3A 4Q00A 3KHTA 4ZO6A 1N6KA 3RUHA 4P7BA 4W1SA 1EEHA 3GBPA 2Z4TA 3KEQA 3RUEA 4E15A 1IBKB 2P2DA 1ES9A 4X20A 3RTGA 4L8YA 4UNRA 1OC2A 2LV8A 1PAUA 4RY8A 3N5CA 1CNEA 1OD6A 1E0JA 1ZGJA 4Y18A 4BU0A 2QTNA 4EX7A 3A1WA 4U9UA 5JXJA 1FBNA 2HHJA 2BJHA 4N0QA 3TSWA 3OIFA 5B1EA 3ENNA 1B6TA 1ESCA 4NRDA 4QUHA 1PZHA 1XG5A 3RVJA 2QI9F 1T4CB 3Q7QA 1GP2A 5G1PA 3HBLA 3RS7A 2R85A 4NC9A 4FNOA 2TMDA 3HJNA 1Z25A 1OR8A 2JLQA 1ADFA 1ODSA 2O0MA 4J1TA 3V8VA 4U7JA 3ZCUA 1LQTA 4KPFC 3CJRA 1XGKA 1EK1A 2VDJA 2G1KA 2QTAA 5TMBA 1OKKA 3KQTA 5HWSA 3KTDA 3TZQA 3MQ4A 1GGVA 1HM5A 2MSKA 1ZK0A 2OFWA 1UOOA 2L42A 4J0GA 1T2DA 3LC0A 1FK8A 3DDSA 2OXTA 5LQCA 2G1JA 3OJCA 3AETA 3SR0A 1EA5A 1BVUA 2OUIA 5CCDA 4MKXA 1UPUA 3F78A 2DTXA 1T2VA 4UAGA 4X6UA 4FMDF 4DLTA 2VO1A 4OSEA 4ILKA 5FTKA 2H63A 3T3EA 1BA3A 2OB2A 3MIZA 4V0KA 3CRVA 3JAKB 4Y1RA 5F12A 1U0LA 2QZ9A 3W90A 5T6BA 1Y34E 1HRKA 3TW8B 4D56A 4Q7LA 4HYYA 4C6SA 1XROA 2P9QA 1Q3TA 4JUCA 3Q8WA 1L1RA 1L5KA 3TSCA 3NO4A 3OU2A 5D3MB 2X0FA 2EP5A 3NEAA 4MGYR 5EWLB 2EJBA 3UHFA 5C5DA