3UWTA

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 2.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
197
Chain Sequence
GAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
rcsb
source organism Homo sapiens
total genus 49
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA01
2DGXA 2CQ4A 2CPFA 2FPHX 4Y00A 2XSFA 2SXLA 2U1AA 1YTYA 1WF1A 1WEZA 1X4GA 2DNYA 1HD1A 2DIVA 1N54B 2MZSA 4TU8A 2MKIA 1WELA 2DHSA 2DNRA 2LEAA 2RVJA 2MJUA 2CPJA 2LXUA 4IOAQ 3UCZP 2ADCA 3MD3A 1DZ5A 2CPXA 3CCQS 2MKJA 2LECA 2RU3A 1M5KC 2JVOA 5GAGU 2MZ1A 1U1QA 5CA5A 1QVFR 3HI9A 3TO8A 1SJFA 1H2VZ 3G4SS 4TU9A 2RS2A 3SXLA 2KH9A 1RK8A 2O3DA 1CVJA 2DGTA 1WF0A 2D9PA 3CUNA 1VQ5S 2XS7A 3CC7S 5DDQC 4QPTA 5D77A 1N8RT 2MY7A 2DNPA 4F02A 1N52B 5DM7Q 1X4AA 2KG0A 3G8SA 4IOCQ 5JVGQ 1SXLA 2KRRA 3FEYB 2LKZA 3J7ZT 2HYIB 1SJRA 3FEXB 1WHYA 2N3OA 3I56S 1WG4A 2OSQA 4Y0FA 1R8HA 2MY8A 1UAWA 5LSLA 2DITA 2KXFA 4QU6A 2ERRA 1HD0A 3SDEA 2RS8A 2I38A 2XNQA 3P3DA 4PRFA 4TU7A 3LPYA 3ZZYA 3MUVP 3ZZZA 2CPHA 3THTA 2DGVA 1WG5A 3MDFA 1VC5A 1G2EA 2DGOA 2CQGA 1B7FA 5DDRC 5IQQA 3R1LA 1VBYA 1FHTA 5HO4A 2MZJA 2CPZA 2M8DB 1X4DA 3B4DA 2DNZA 1VQ6S 4WCEQ 5H1SV 3RW7A 4OZ1A 2HVZA 2XB2D 3N9UC 4CH0S 3G96A 3G8TA 1ZZNA 1XN9A 3CCJS 1NJIT 2EK6A 2MSTA 2U2FA 2FY1A 3S7RA 2OJ3A 2Q79A 2M88A 5DM6Q 1X4CA 2MQLA 2WBRA 3CCSS 1JJHA 1YIJS 4LIRA 1FJEB 2XS2A 3DXBA 2KFYA 2KT5A 2AYEA 1JJ4A 2B0GA 2KXNB 2MJNA 4A8XA 1U2FA 2M2BA 2X1AA 1KOOA 2X1BA 1OIAA 2LMIA 3VAHA 2MHNA 1U1KA 3NS6A 3VALA 1K8AT 3S8SA 2GO9A 3SDEB 2M8HA 1VC6A 3CCUS 1S72S 3NMRA 2XNRA 5GVQA 5DETA 2AYGA 1WHVA 3UCGA 3BEGB 2VOOA 1O0PA 1UP1A 2KN4A 2MQMA 5HL7Q 2CQ1A 2AYMA 5CXTA 2DO0A 2I2YA 2MZRA 2AYBA 3B4MA 4U67Q 1F9FA 2DH8A 3TYTA 5LXRA 1VQKS 3H2UB 2MGZA 1WHWA 2DH9A 2CQ0A 1H2TZ 3K0JA 3H2VE 3MOJB 1FJ7A 2HGNA 2CQ2A 2V94A 3CC4S 2J76E 3BO2A 1VC0A 2J0QD 3CULA 2MZTA 1P27B 2MMYA 2MKKA 5LJ5Y 4LMZA 1VQMS 3UCUP 5MLCV 5DDPC 2LEBA 1VQ7S 1U1RA 2VOPA 2CQPA 1RKJA 5D78A 1U1OA 1PO6A 2EK1A 2LQ5A 2G4BA 4ED5A 4W92B 4M5DB 2QFJA 2DGWA 3CMAS 3VAJA 2MPUA 5GAEU 1Q82T 1OPIA 4Z2XA 2FC9A 4UY8T 2LA4A 2KRBA 2X1GA 3EGNA 1DBDA 4P6QA 2M52A 1UFWA 5IM0A 1K73T 1VQ9S 2MB0B 3R1HA 2KHCA 2L9WA 3CCLS 4WFNQ 1KD1T 3MUMP 1X0FA 5GAHU 2KG1A 3NNHA 2MZQA 1M90T 2DNHA 1DRZA 5LSOA 2DGQA 3CCVS 2CPDA 3HHNB 1U1PA 2F3JA 4ZKAA 3IRWP 2L41A 1OWXA 3I55S 2KU7A 2E5HA 3L3CA 2MGZB 1W2BR 1X4HA 4UQTA 1DHMA 1WEYA 2M9KA 2KM8C 2OTLS 2VONA 3OW2R 1Q86T 2OTJS 4RU2A 4C0OC 1SJQA 1U1MA 2JX2A 2K8GA 1QM9A 2DK2A 3PIOQ 2RRBA 4IUFA 4QU7A 2A3JA 1AUDA 3CXCR 3EGZA 3CD6S 2MKSA 2GHPA 3ULHA 2ADBA 1WHXA 2PEHA 2MSSA 4WFAQ 1JMTA 2G0CA 2K3KA 5IM0B 3UE2A 2JVRA 4V19X 1SJ3P 3P6YC 2RQCA 2JRSA 1FT8A 3VAIA 5JVHQ 1QVGR 5ITHA 3G9CA 1X5PA 1M5PC 2D9OA 1K9MT 1S79A 1YHQS 2M70A 2KXHA 3RW6A 2KM8B 2YH0A 4TLQA 4WKRA 3CC2S 2RQ4A 1NO8A 3D2WA 3NNAA 4LJMA 4PR6A 3PIPQ 1VBZA 2J0SD 2JWNA 2XS5A 1HL6A 2F9JA 4WF9Q 1A7GE 2MYFA 2DB1A 2OIHA 1Q7YT 2CQBA 2M0GB 3Q2TC 2DNMA 4BS2A 5EN1A 1BY9A 2QA4S 1VQPS 2YH1A 2G1DA 2ZJQQ 4C7QA 2L08A 4CQ1A 3MI7X 1YWXA 2M4MA 2LA6A 3THPA 1VQOS 1M1KT 1WI8A 1D8ZA 2DNOA 1YJWS 2DNQA 1P1TA 1YITS 2J8AA 2MQNA 4YOEA 3S6EA 3U1MA 2CQDA 2MQQA 2LCWA 4J5OA 1ZZFA 2DNGA 3J7YU 3VAGA 2BOPA 3UD4P 1X4FA 3MXHP 1Q81T 3NNCA 4FXWA 3CPWR 1M5OC 4CH1A 3SMZA 1N88A 3BS9A 1FXLA 2HGLA 2OSRA 3G71S 2QEXS 3MD1A 2N3LA 2EVZA 2RT3A 3U1LA 2HZCA 3MUTP 2KI2A 2MKHA 2CQ3A 1URNA 1U1LA 1X5TA 3V4MA 4YUDA 1WG1A 2CQCA 3P5TL 3MURP 3DLLQ 3CCMS 2NZ4A 4F26A 1X5OA 3G6ES 3NS5A 2CQHA 1HA1A 3JB9k 1YJ9S 2YKAA 2HGMA 2DHAA 2X1FA 4WIIA 2N7CA 2YTCA 2LYVA 2CQIA 3BO3A 1SJ4P 2FHOB 4YB1P 3VAKA 1VQ4S 2DISA 3CTRA 1X5SA 3R27A 2MQPA 2DNKA 2RRAA 2DIUA 1NU4A 2AD9A 1FO1A 2DHGA 5LJ3Y 5FJ4A 5GMKa 2DGUA 3VAMA 4IO9Q 2DNNA 1KOHA 3CMES 2VODA 2PE8A 1FNXH 4C4WA 3UD3P 2CPEA 1WTBA 2ZJPQ 2E5IA 2KVIA 4EGLA 5DDOC 3TP2A 2MXYA 4CIOA 1JJ2R 1KQSR 1WEXA 5IFMA 1YI2S 2MQOA 5GADU 1WF2A 4F25A 1U6BA 3CCES 4WFBQ 2DGSA 3CCRS 3CF5Q 1R8PA 2D3OR 1FJCA 1VQ8S 2NLWA 1M5VC 1ZH5A 2E44A 2KYXA 4QQBA 2RUGA 1U1NA 1UW4A 2FC8A 2MKCA 3EX7B 3US5A 2DHXA 5CYJA 2YWKA 1IQTA 1KC8T 1X4BA 1U6FA 4FXVA 4W90B 1H2UX 2CPYA 2E5JA 3BO4A 2UP1A 4OZ0A 4PKDB 3S01A 2F9DA 2ZJRQ 2BZ2A 5BJRA 2LXIA 2N82B 3IWNC 2E5GA 3VF0B 5LXYA 1D9AA 2CJKA 1VQLS 1PGZA 1WWHA 2DH7A 1YJNS 2DNLA 3UWTA 2CPIA 1L3KA 3LQVA 3Q2SC 1VBXA 4ERDA 3VAFA 1H6KX 2DO4A 1A9NB 2M7SA 1OO0B 2RNEA 1WI6A 1VQNS 3P49B 1X4EA
chains in the Genus database with same CATH superfamily
5FD1A 2ATLA 2AP6A 2CPFA 9RUBA 5CCLA 3FZ2A 4O44B 1RBAA 2U1AA 3NP5A 1LOUA 1WEZA 2Q6CA 4EO8A 3ZTOA 2D3O1 3J80Y 4ZMMA 1N33F 4QIVA 2BE9B 3CGIA 2R7TA 4Q8EA 4OHWA 3UCZP 1EQ0A 4RR5A 2CPXA 3O8WA 1RHMB 4DSKA 2HSEB 2MZ1A 2BDPA 1CBKA 2FLOA 1Y7PA 4TKTA 3E01B 3GFXA 3C6TA 3GYNA 1RAGB 1JLCA 2RSQA 1TL3A 2HBQB 3OT9A 4FPIA 2UUAF 2C2RA 4HKQA 1N52B 3TWZA 3DOMB 1VGYA 2RE1A 1SQFA 2KXFA 4K4VA 3MEDA 4WP8A 2XY7A 2QA2A 3OUYB 3SDEA 2K1RA 4L74A 4WK1A 2DGOA 2BE7D 1YJ7A 2HVZA 3Q8RB 2G2YA 4NZ6A 4NOHA 1K47A 3LP1B 1QTNB 3KUGA 4LF2A 2GVDA 3GCWP 2R2SA 2A10A 4FPRA 3UPFA 2BOAA 2C2NA 3DM2B 3E01A 2YKQA 4MYUA 4ELTA 1S49A 3BN4A 3UI3A 1WC3A 1PJ5A 2HURA 5G4DA 3LF0A 1U1KA 2XTJP 3LOUA 1X7VA 2B4VA 3ADAC 2W2MP 2ZOGA 2MQMA 4NZ0A 4ED3A 1SI9A 1NK7A 4XTTA 5KFMA 4GKJF 1L5UA 4F0KA 2CQ2A 3BO2A 2MMYA 1C4AA 2H48B 4I2PA 5KFVA 1LV5A 3W60A 4C9DA 2OPQA 3HFKA 1S59A 1ZM2A 2WAQD 5KFHA 4UY8T 3EGNA 1SKSA 2BJDA 5IM0A 2E5LJ 1DY3A 2BE2A 4ECRA 3CCVS 5FDLA 4EFAC 3I55S 4KO0A 4KBIA 3I0SB 2FGCA 3KJNB 4PG6A 3OR2B 2OTLS 1HQUB 4RU2A 4CLLA 3M30B 3KMSA 2I9SA 3AB2B 1M1HA 5KG3A 5KG2A 4YB6A 3CJ2A 1VRUA 3ZFVA 3EGVA 5KFEA 4P9SA 1JKHA 1FT8A 1X5PA 3CEDA 2D9OA 3I87A 4RW4B 2KXHA 3IA0A 3Q23A 2RQ4A 3JSYA 1YRUA 1S9GB 4PR6A 1UVKA 4DR4J 4LRBA 1A7GE 1S10A 2GAHC 1NPRA 2YKMA 3CJTA 1XQIA 5F8NA 3J7AN 2QFIA 3IAS9 3BBFA 5CCMA 3P96A 1YJWS 2BV3A 3DXSX 3NRBA 3OR2A 3U1MA 4J91A 3MAAA 2DNGA 5CZXA 1YRXA 1WTFA 1NDLA 4RNFA 4OI4A 4J9SA 1DURA 1Q7LB 1NK8A 3N0VA 3PX0A 4ZJQA 4C0HA 4I64A 4QWBA 2Q43A 2NR0A 1HA1A 1DLOA 4LQ9A 3TRGA 3MMCB 4DV6J 4X4PA 2F8HA 1LW2B 4ZK7M 4FXDA 4DUYF 5J1PA 3KHHA 5J2QA 4HTIA 4EGLA 4FVMA 3MHYA 2ACMA 3M1VA 5ETQA 4CO2A 3N6NA 4PYAA 3PW5A 1TUWA 3T1YJ 1U6BA 2FZKB 3WC0A 3FMBA 4B9TA 3AAWB 3KK2B 4LBPA 4OHVA 3HVWA 1RTIA 3WC2A 4MKVA 4TNOA 2CJ9A 4X64F 3H90A 1M5HA 3GZ7A 2LP4A 4WBFA 5BYSA 4RW6B 3S01A 1ZS6A 2LXIA 2QLXA 5DLFA 3CO0P 2AJ0A 2OH2A 2VG5B 1APSA 3PX6A 3VAFA 2LVWA 1WI6A 4RBUA 1KS2A 4GC7A 2Z30B 1HNXF 3M6XA 4W98A 2AWZA 3HK2A 1VQYA 2MZSA 4MFBA 3D67A 3IRXA 2VQFJ 1RU2A 4NPOA 2OLWA 3DRRB 5A76A 2HQ3A 1IR0A 4E98A 5GAGU 4LFBF 3TAPA 5G0RA 3ONQA 2HPUA 3SQGB 4URQU 1NSAA 4TU9A 3V6KA 3U02A 2UUCF 2WZ1A 3BYRA 3RG6A 1IKXB 4DF8A 1HMVA 1WF0A 2ZBRA 1XMOF 5I4MA 2IBKA 5DDQC 5IT0A 1N8RT 3BJYA 4X2BA 5KT4A 2DNPA 4NEZA 1XJWB 2V0NA 3K8WA 4RUAA 3DYAB 2HYIB 9ATCB 2J8SA 2GQCA 2NQPA 2KYZA 3GSDA 3RBEA 2D3ZA 3NGRA 1AFIA 2WSCC 3PO4A 5SZTA 3BGOP 1FDDA 2BACA 1YGYA 4QIEA 3DRRA 1I94F 2CZ9A 1Q4RA 3BDPA 1X4CA 4QYZJ 4XPEA 4LREA 1FA0A 1JX4A 1IWGA 1OIAA 2DHHA 3W5XA 4C3KA 3FBBA 1K8AT 4J9PA 3WX4A 3SFUA 2YX1A 3PJWA 2CQ1A 4QW8A 4O3QA 4LF4F 1F5CA 1UWBA 2DR6A 2PIIA 1GTHA 5E0OA 3U27A 1H2TZ 5HROB 4G1PA 3EVWA 2MKKA 3ZZ0A 1BQNA 1RWMB 4I56A 3W61A 5ETMA 1S97A 3DLEB 2W8LA 3PHTA 4DPTA 4JI1J 5EWGA 2ZH3A 4DS4A 4DSLA 1XIQA 4P75A 1NPPA 1W25A 2WOMA 2MB0B 2RHSB 3CCLS 2VZ9A 3FUYA 4ZPAA 1JIHA 4NA2A 1LNQA 2OUGA 3HHNB 4DV2J 2V2ZA 3FJ2A 3EYZA 3HZGA 1DHMA 4OYBA 4KGXB 2M9KA 3H0PA 2BQUA 1WC0A 2LQJA 2CJYB 2Q66A 2Y1IA 1SJQA 2NPIA 4UOCA 4HR2A 1XTZA 5LSRA 3PIOQ 4N41A 1RT4A 2DTJA 1JWWA 1NK0A 1NDPA 4MKAA 5DQHA 3QAEA 1VLYA 4XK8C 4ILLA 1Q5YA 5L38A 5J1EB 2HHXA 2X3DA 2RQMA 1WJ9A 1T9YA 2P9EA 4KJIA 3DRPB 2ZKTA 3EZOA 3PIPQ 2DR7A 2JWNA 2B7CB 4G6VB 2DNMA 4ZVSB 3JQMA 2AT1B 4HH1A 3KYLA 1XNRF 1RTHA 2JDJA 2ZJQQ 3TQ1A 4ZP8A 1YWXA 3THPA 1M1KT 3FQKA 4NLGA 2C2KB 4NLTA 2MQNA 1Q16B 4I2QA 1ZZFA 3VAGA 1I3OB 2JL9A 4A8WA 1B70B 5ETNA 1YDLA 4K4ZA 3UNYA 1H7XA 3ET6B 3U1LA 3G82A 1RTJB 4NASA 3UDCA 2KVQE 2DVIA 3MMBA 2JOQA 2AX1A 2CJXB 4DX7A 4NEYA 3MURP 3OQ2A 4JYAF 2W8KA 2OPPA 1T03B 3FRYA 2GFFA 1PC5A 1ZAWA 2GCFA 3AY0A 3NL0A 5I3PA 4P2SA 4BBYA 3CTRA 2YBVA 3L7OA 2YKNB 4NLYA 3UD5A 2G0JA 4K4UA 3JTNA 5LMNJ 3OSNA 1VISA 3R6GB 2F8MA 5E5NA 3RBZA 4K5SA 3UDVA 2RKIA 4ZVEA 1YSJA 3CCRS 1H0HB 2XYPB 4ZHRB 2FHMA 3D4JA 3VQSA 3PRBA 2ACYA 1CQMA 2FD2A 3MTJA 3NS7B 1PC4A 4OZ0A 4DR7F 3DLKB 4ES1A 1FRIA 1L3SA 4OI1A 2B9EA 3H20A 1SC3B 4EWTA 4G3IA 1T03A 4DQPA 2V6AA 3MMJA 2RNEA 1U48A 4ZIVA 2VPYB 1S0VA 5F8MA 2ZVIA 2V34A 4PAAA 2QLJB 3OLAA 1S1VB 4Q7AA 1TQLA 4EYIB 2DNRA 4CT9A 3N5BA 1T94A 3GIIA 1LWFA 2ZH9A 1Y11A 2R8HA 2HNZB 3QT8A 3CDBA 4U95A 3HI9A 4J9LA 2HHPA 3ZTQA 1H2VZ 3A4TA 4NLQA 1RK8A 1ZTWA 2O67A 5HBMB 2EBGA 4IG0B 2I5JA 5KG4A 4LVOP 4QPTA 5D77A 3G6VA 3DLKA 1CQNA 3J7YI 2NREA 3UDEA 3AJ1A 1WOSA 3OFFA 3AQOA 3HD1A 2M5YA 2OHDA 2PGCA 3BGRB 1JNZB 3OTDA 3GFZA 4NMLA 4UUWA 5KFRA 1NMEB 3CJKA 3OVAA 4DFJA 3PACA 4OZ1A 1MU2A 5JJBA 4ES3A 1S1TB 2PFDA 4IH7A 3HVRA 3S7RA 4LFAJ 1IBLF 2LQ9A 4L3KA 3AHPA 3CJ8A 2AYEA 1JJ4A 1RT3B 2NCKL 3DI6A 1IQZA 2LLZA 2MHNA 3HLUA 5HBMA 2GO9A 3CJ0A 2B9XA 3M8QB 4CLKA 4AXJA 1JLAA 1KQGB 1RWNB 4CTAA 2O66A 3KK3B 2VOOA 3UVJB 1WDTA 3R5JB 3ELHA 1MMDA 3HFVA 2QE5A 2R2UA 1IBKF 2ZH2A 1TUVA 2EFOA 1ZTTA 4YP3A 4IQMA 2V8GA 5U47A 3MPYA 5MLCV 2LEBA 4DR1F 2H4YB 3R3TA 1PO6A 3MAHA 1HQEB 2QFJA 4ID8A 2V5HG 3T5LA 3AXMA 2X1GA 4ZPTR 4LSZB 1HWJA 1FWLA 3CDUA 2KHCA 4WFNQ 3ZTPA 4LSLA 5LSOA 2B8QA 3GIKA 1U2RA 1OYEA 3MCNA 5K8MA 2RH3A 1RLCL 4C8NA 2FVSA 4OYWA 3JS9A 4K4YA 5IOLA 3BH6B 2D3UA 3D6HB 1RHKB 3D3CJ 3OR1A 4USJC 4GMKA 1KKHA 3IBWA 1QM9A 3TEGA 4IUFA 5B08A 2QMUB 3R5DA 4DCPB 2ZM6F 5C25A 2R7UA 2MSSA 1RT2A 3T1HJ 2K3KA 4WJBA 2E9TA 3PYGA 2ILYA 2PEBA 1RQ0A 3VAIA 1VIOA 2OPRB 3P45B 4KR0B 1UVMA 2J7WA 3MAQA 3ZC4A 3RW6A 4WXWA 4ED4A 1RACB 1R0AB 2KDOA 2NSBA 1U6ZA 2CQBA 4NLUA 2ZZNA 2ZE2B 3K89A 4IFYA 4R5PB 2YH1A 3EZ5A 3QGGA 4NCAA 5DZ7A 1HI8A 2FIUA 2AJ4A 2LA6A 4AYBD 2EPIA 3TZZA 4PCQA 3T9ZA 1EJ7L 1FWPA 4B17A 5KG7A 3GJSB 5EWFA 4IO1A 1G1XA 2QLBB 4NCGA 3Q24A 2UUTA 4FXWA 2CZVC 5CH7B 3CCTA 4NLDA 2HGLA 2W9AA 2F1FA 5A8RA 1T0TV 2PMZD 2XO6A 2C3OA 2BA9A 4Q45A 1URNA 2Q3PA 3JSMB 4J9NA 1FRHA 4H4OA 3DLLQ 2ZDOA 5E3CA 1MN9A 1Z2LA 3G6ES 2CNNB 1BMQB 3RB0A 4OX8A 4LR8A 1GMWA 3LO3A 3HHDA 2XYGB 5T14A 4PXBA 4XAKA 1NK5A 3LANA 3PVXA 3MEGA 2HLTA 1WTBA 5I42B 2NS1B 4RNHA 2F4VJ 5GAEI 4GC6A 1T9XA 3Q8SB 1JQGA 2RB7A 1UJ5A 2Y1RI 3QRQA 3SQOP 1ZH5A 1JLEB 2KFZA 2BKPA 1SQEA 4USTA 4S0MA 1D1UA 2YWFA 5D4NA 3C15B 4K8RA 1CPZA 1HNZF 3EUNA 2EBEA 2HHVA 2CJKA 2AJ2A 1LQ9A 1M1GA 1V5VA 1JLFB 3BM7A 1H6KX 4JI3F 1WKLA 3IP0A 3KOAA 2M7SA 1TK8A 1NH8A 2P9CA 4JI7J 2XG8A 2XWXA 3W3SA 2RDJA 3MM9A 3MR2A 4TU8A 1F5AA 2W9CB 5KFUA 2K3IA 2CPJA 2FDNA 4PXCA 1YBTA 1OY9A 3PNIA 4I7FB 4USWA 1CJUA 2JVOA 5GMDA 2H3EB 4ILRA 3KG1A 4YY3J 3TO8A 5DGBA 5D3GB 5IV4A 1UVNA 4DR3F 2YQ1A 1RUSA 5AJ3J 3EDRB 1AZSB 2XHCA 1NPKA 1U09A 3KUHA 4KGVB 1RA6A 4RPFA 4F04B 3H5XA 2N3OA 1WG4A 2MY8A 1JLFA 3MMAA 2D41A 4ZCMA 3KXDA 1NJXA 4DPWA 1KVIA 3TZWA 4CLUA 4Y3CA 1T7PA 2IC3B 1U0HA 4CYUA 4B3OA 2IA0A 4WZQA 1VBYA 3AA9A 2HK3A 3KLFA 5ADZA 2CUYA 3DLJA 3OTOJ 2GAGC 1V3RA 3CCJS 4CLPA 4DR6J 4ZVTB 3DDIA 3R7NB 3X3UA 2YWHA 1FJGJ 1TVRA 1R27B 1ZAXA 4EBDA 1X9WA 3R2DJ 4LT6A 4ECWA 4FDFA 3H42A 5KFGA 1MROB 3MPWA 2AYGA 1HNIA 2KN4A 3B4MA 4FBUA 2ASJA 3H2VE 1VLOA 2IC3A 2C2DA 7FD1A 4DQRA 4O4GA 5F8LA 5A2QU 1U1RA 2Q1LA 1HI0P 2GIFA 1U24A 4M5JA 2Z2MA 1GTEA 4FYWB 4IKAA 1R8BA 2QZ8A 1IBMJ 4KE5A 3F41A 1ZPWX 1E6YB 3FK4A 4J9UE 1HBOA 4AE5A 3ZO7A 1S1WA 4NXMJ 2W7PA 3QQCD 3I31A 4QPXA 4QOTA 4LUBA 4CNZA 3TX0A 4FF3A 3HJFA 2GIRA 1TZ0A 1Q86T 4OHZA 2OTJS 4ZPWR 4X4RA 1TL1A 3ISND 1FFSB 2BBEA 1E6VB 2ZH5A 2ZHBA 2DK2A 3M2VB 2JEGA 1AUDA 3EGZA 2GHPA 5HJXA 2UU9F 4WFAQ 2BKNA 2R42A 2B6AB 1NB2A 5DZ6A 5JVHQ 4KYZA 3JXOA 1K9MT 3KUEA 2M70A 1F3VA 3B6BA 2HQCA 4F2SA 1T8EA 4CO0A 4Y2MA 1XC9A 2WVEA 4KKOB 2DB1A 3DGPB 1Q8KA 4X4TA 1PYOB 4Y28C 2HQDA 4JI0J 1KNZA 1TP7A 3IM8A 3R5BA 1KRPA 5HSPA 4X4QA 3EWGA 1RU1A 1WI8A 3EZUA 3HD2A 1B0VA 4A46A 1CEZA 2W2OP 2ILZA 3IGNA 2YNGA 2JSXA 2BOPA 3JQKA 2KZZA 1BUXA 1HNVB 3CPWR 1DQ8A 4DR2J 3PG9A 1N88A 5ETRA 1FXLA 3IG1B 3OVBA 1UMJA 2XEXA 5IT9U 2V4RA 1TKZA 3N6MA 3PYDA 4ZN1A 2YKAA 2X1FA 2HGMA 3NGSA 2J9DA 3CD7A 1C1CA 1KTQA 3LTOA 2UZAA 1FK9B 1V5IB 3K5OA 1UZHA 1FO1A 2C28A 3P5BP 3JAMY 1KLMB 2CYYA 2J0XA 5IWAJ 2PMHA 2ZJPQ 2J6SA 2E5IA 2W7AA 4CIOA 2QA4G 1RYRA 4WFBQ 4WWSA 1HPZB 1VQ8S 5HI7A 1TL7B 5GAHI 1NK6A 3M8RA 2R7XA 1G4CA 3EX7B 4J9KA 1X4BA 4B3MF 2DY1A 4W90B 2OMLA 1B64A 2AEJA 2IMOA 3IWNC 5BYRA 2E5GA 4ED8A 4PEOA 2QL7B 3CJSA 4PUOA 4LSNB 4DFPA 4C11B 2CJBA 3ISZA 3TVYA 1WD6A 4JI6J 1UEVA 1X4EA 2HS0A 4X4VA 2XCPA 3P4UB 3O5TB 5A0YB 1S0MA 1WELA 1GXTA 3QT6A 1XBWA 1FWKA 2VFUA 2Z2ZA 3VWSA 1WOOA 2R7WA 2QIFA 1NB7A 3I0RA 5K14A 3OBIA 3KJFB 2ZUAA 2DRAA 1Y5IB 3O2IA 2NXUA 3KJVB 2WSFC 4OZLA 1VHFA 2O3DA 2HBYB 2V8DA 3NAIA 3CC7S 1BWEA 1YZ7A 4ZPCA 1CJVA 3BV8A 5JUMA 3TJAA 4C8ZA 1AROP 3BSCA 2B4UA 5I3UB 1WHYA 1RHUB 3H4DA 3JSRA 2AW0A 1SC4B 5A8KB 4N56A 3N79A 5L1KA 5DQGA 4IFVB 3LPYA 2CPHA 3MDFA 3AJDA 4A8FA 2HBZB 3T19A 3TAMB 3CNQP 5B0AA 3RW7A 1N6QA 1Y9OA 1V3ZA 1VS3A 2BR0A 4C6AA 3GJQB 1XN9A 3G87A 1RB0A 1RTDA 1VYAA 1EZZB 4Y2KA 4BC9A 5IV3A 1Y10A 3QYYA 5DM6Q 2DEJA 4ZP9A 1LWCA 3DXBA 4JV1A 1U2FA 1KOOA 3CJ5A 4M5DA 1GMUA 3ENWA 3W2VB 1S72S 1KBRA 3BEGB 4OYMA 1UP1A 1IKVA 2UVVA 1VIXA 4RW9B 2LFVA 2EWHA 2EG1A 2I2YA 2HAFA 3W2WA 1HBNA 4IQXA 2ZKUA 5HVGA 4ZCIA 4DN9A 2YXLA 4DWIA 3A8KA 1SV5A 1HWLA 2ZM6J 2MZTA 3T3FA 3RR8A 1XK8A 4HL9A 3GILA 4ZP7A 4NXNF 2WONA 2AV5A 1HNWJ 4LBHA 1T3OA 3VHQA 2CRLA 2KRBA 4LR9A 1FERA 4P6QA 4O3NA 1K73T 3WIVA 2JLEA 4TY8A 4NLSA 2KG1A 2OO4A 3DHXA 3CDEA 3VQTA 1DRZA 2KO1A 3MTKA 4F4ZA 1P1LA 2E1PA 4DBQA 1W2BR 2FHKA 4H4KA 4DLEA 3QRRA 3D1QA 4DUZJ 1GX5A 2R8KA 2VONA 3M2RB 4RUCA 5IXUA 3CJRA 1J5OA 1KLNA 4O3RA 4QU7A 3CXCR 2HZAA 3IM9A 3TVZA 1SKWA 4M1KA 1H74A 5L1IA 3IGVA 3JTPA 2JVRA 2IY5B 1SJ3P 3QGIA 3NBPB 1ELOA 2W4PA 4OJ3A 2KKHA 4DSEA 2VG7A 5J2PB 4I67A 5LOQA 5ETVA 2YWEA 1VBKA 3D2WA 2FLPA 3NNAA 1RWXB 3FCWA 4DXLA 1LK7A 2HNYB 2VKZG 3DOKB 2M0GB 5KOXA 3CW2C 3OHBA 1FKAF 2GS8A 3KHLA 3Q2TC 1MMNA 3ETOA 2ZFHA 3M8WA 1IJEB 3RRHA 1FESA 3MM8A 5C2CA 1T3NA 2UXCJ 1N5TA 3AXKA 3VZIA 3DU5A 3MM5A 4O0IA 5KT6A 1FEEA 2ZHAA 2B56A 2VJVA 1UVIA 5AXKA 3KLHA 2NUUG 4RO0A 2RT3A 3HVTB 3MM6B 2AGOA 2HFOA 2VQEJ 2VICA 4Q2LA 3CCMS 4PWDB 4GVLA 1QSSA 3D0HE 2GQQA 1HHSA 3FFIA 4HDGA 2IDLA 1N0UA 2Y8WA 1UEKA 3VAKA 2GVZA 1IBCB 4ATNA 3HT3A 3LP0B 1RT6A 4DV7F 2C1EB 1BQXA 3M8ZA 1S9EA 3C14A 4PPZA 5L46A 2DXFA 1RWKB 1OPZA 3TP2A 4YHHJ 4DL7A 1RI7A 2C2MB 2LDIA 4CLWA 1WF2A 3KHRA 3CCES 2NXNA 3GYGA 1R8PA 4HT7A 4ZVOB 2RUGA 2J9CA 4OZNA 3MPUB 2FC8A 4YFUA 3D68A 5F0WA 3OJUA 2YWKA 4DR5J 2H51B 2CPYA 3POTB 2BZ2A 1HR0J 1IKYB 1YQHA 1CSJA 2FQQB 1O51A 4RZRA 2DH7A 2DNLA 3LQVA 5F8GA 3DU6A 1KSPA 2HAIA 5B09A 4RUBA 3E8OA 2ZC3A 4G1IA 4ECXA 1VQNS 2IHR1 3SV3A 2IRUA 5KFSA 3NOCA 4CH7A 2V9WA 1RSCA 2EW9A 2VDHA 4Z7CA 2XMUA 4UQGA 5IC4B 4LFCJ 4RNOA 2JEFA 1VCTA 1MW7A 2LDYA 3KTQA 1KP6A 2OEKA 3QBCA 1K1SA 2N4DA 2HKEA 5A8WB 1CS4A 5BR8J 3ZNUA 1JLBA 4G65A 4BLGA 2EG2A 1LXNA 2W01A 5KAKA 4QWCA 3R2CJ 3PRVA 3J7ZT 2J0WA 4Q5VA 1UFKA 1EKRA 4U7UD 1TMMA 2LQ8A 2HQIA 1NEEA 2ZBCA 4ZJLA 3KNGA 4FP9A 2XZDB 2DPJA 2IVFB 3QO9B 2F65A 2MZJA 2AJFE 1VQ6S 4PPDA 5T7LB 4A8MP 3IBCB 4DFMA 1PCAA 3KLIA 2JC1A 4DMZA 3Q83A 4MIBA 1I51B 2BJ3A 1BC6A 1TUGB 1W7WA 4Q0BB 5L9XA 5FLXY 5EX0A 2WBRA 3H5YA 1EX8A 2KT5A 1QTMA 5AXMA 2XQCA 2EKYA 4RU9A 2YNFB 3NS6A 4FYDA 4ZPVR 5GADI 1KEKA 2E5LF 2XNRA 5DETA 1FRXA 3UCGA 4C0BA 4ED2A 4DX6A 1HWUA 2BUNA 4FKYA 1JLQB 3N01A 2ZBQA 1MWQA 3QJLA 1TL4A 2B51A 1K1QA 3HULA 5HMYA 1TKTA 3DCAA 1FVSA 2VFSA 3LAKA 2QC3A 5AXNA 1X60A 4A8KA 1P27B 4FNIA 4ANCA 4WTYA 2XY5A 2CQPA 1ZM4A 5D78A 2BJ7A 4K4TA 4W92B 4LR7A 1U4BA 3D6TB 2J9EA 1UFWA 2G2ZA 2MLZA 3M8PB 3MUMP 1S0NA 3BSAA 3TR5A 3GIJA 4DR4F 3IRWP 2E5HA 2MGZB 1O8BA 4LF9J 3LA0A 1DQ9A 3OW2R 1EETA 2EKNA 1UZDA 2K8GA 1REVA 3OVSA 3CDWA 3HXMA 3KK1A 2V2QA 3GR0A 1LFPA 4CNYA 2O01C 4N76A 3A3PB 2JEJA 4GO7X 2RQCA 4B3SJ 5CD4A 2ZHOA 4Y2IA 1O6XA 4DV4J 1N32J 1OYDA 2Y9HA 4TLQA 4U7CA 3K5MA 5HN0A 1UPMB 4X4NA 3DLHA 2XMJA 2W7OA 3ZZRA 2FVPA 1HL6A 3ITHB 2C3MA 2F9JA 2Y0SD 5LMUJ 1OQ3A 4XIUA 3LP2B 3EVMA 5RUBA 1OMSA 3CD5A 4DV6F 3KLEB 1BY9A 2YKOA 3PRDA 2VG6B 3VCDA 1WC6A 5C42A 4FYXB 4M63A 3S6EA 3G86A 2YX4A 3M6UA 4K4XA 2AU0A 2AF6A 3T1YF 1Q8IA 4DPUA 3L9ZA 1H38A 3MD1A 4IDKA 4R8UB 2CADA 1IM4A 4NRUA 2HHWA 4NRTA 2CJQA 2NZ4A 4QW9A 1WDDA 2YNHA 3V6DB 2HMIB 3HHKA 2B5JB 4K7QA 1TKXA 1EB0A 5L39A 2HNDB 2ROEA 3EDQB 4LF7J 3CMQA 8RUCA 1NH7A 2IBOA 3SYZA 1LWEB 3ITHA 1RAHB 2YX7A 2XLJA 4V19J 2HHTA 2VBYA 1RWUA 3M7VA 2R7VA 5F41A 4DJBA 3MM7A 1YI2S 2VG6A 3M2UB 1TV6B 4N8OA 2DGSA 1DQAA 3PCOB 2VQFF 3N5FA 4QQBA 1SKRA 3OFGA 2M3DA 5LL6d 1NJYA 2KHDA 3US5A 4FXVA 1EAYC 1FKOB 1FDAA 2YVSA 3LUYA 4C8OA 3VF0B 3ZNJ1 5DO2A 4KHPJ 3QLHB 2RF2B 2CNLB 2W9BA 4ERDA 1T05A 4DPXA 2XLKA 3QT5A 3W8GA 1PILA 3T41A 4OYOA 2FPHX 1Y5NB 4Q2MA 4GKKJ 4YR2A 4HVZA 2WVBA 2BJ9A 4TYBA 1F1BB 5HAOA 2LXUA 4MK9A 4ZPDA 1CULB 3H5SA 3CWJA 1KR4A 2E7VA 2RU3A 3QWUA 4X62J 2OD4A 4ICLA 3DRSA 1N5YB 1FEHA 4O4RA 1VDHA 2PI4A 1NDKA 5C24A 2XC9A 3UQSA 1OSDA 2FJBB 5HP1B 1HBUB 3IS9A 4YDDB 1FRMA 1UA0A 1BQMA 3C6UA 4DL5A 3SEOA 2QT7A 3PJ9A 4ZVQB 4URSA 4AQYJ 4M5LA 3BREA 5LM7E 4ZLLA 2Y8YA 2WRMA 1BWVA 1HD0A 4ZLPA 1FE4A 2W1BA 2XMAA 5DS7A 4ANEA 3HHEA 1WC5A 3GV8B 2ROPA 3HSJA 3THTA 4QYZK 1U8WA 3D54A 2DNZA 3C66A 1SH3A 4KH0B 1DTQB 2AGQA 2ZOFA 3Q0AA 1YK9A 4KSEB 2EK6A 3SSRA 4J37A 4J9VA 4RW7B 3AJ2A 4JI1F 1F6TA 2OPSB 2CDRB 3GIMA 5CYMB 1YX2A 2KXNB 2E1AA 2IM0A 2F8EX 1RT7B 2K7KA 1NNDA 1BGXT 4OYIA 3OTCA 1X0PA 1PJ7A 4RNNA 3GE9A 4DV2F 3OLBA 1R6YA 4H4MA 4R0EA 3AB4B 3DDKA 4U67Q 2R8JA 1NSQA 3IBFB 4HDHA 1F9FA 3H2UB 3V6JA 2DRDA 3RU0A 3QGPA 5J2MA 1RWOB 5HQMA 3KLGA 5KFWA 2ZH6A 1S1UA 2AHOB 2K06A 2G4BA 2OP5A 2V9KA 4EBEA 1JLGB 4V1Ak 3OFHA 4ED0A 1KHVA 2NXJA 2HFVA 3FGVA 2OPSA 4HT5A 2DGQA 2R7SA 1RLDA 4P7VA 4OV1A 1HARA 2NUHA 1HW9A 2BXJA 5KTQA 3VTIA 2NZCA 4HHUA 3ISNC 2IAJA 3D6FB 2XHWA 4A47A 2PEHA 2JLFA 1UJ6A 4E2FB 4RL1A 3FCVA 3FBCA 2XMWA 4I0WA 3CVKA 3V4IA 2V4JB 2DKOB 1M5PC 1KQKA 5CD4H 1RAOA 1NLKL 1JK9B 2Z4PA 2I0XA 4KPYA 2XZTB 3BYPA 3PW2A 4M5NA 2MEWA 4L73A 1S1XA 2JFKA 4DV0J 4DPOA 1IUJA 2GZOA 4NI2B 4ID5A 4C7QA 4TLRA 4I6YA 4RW8B 5LMNF 2AJ1A 2O1PA 2LCWA 3BGLA 3FKBA 3BN7A 1M5OC 2K7JA 1MNEA 2OSRA 3G71S 2QEXS 4CLTA 3HHLA 4J9OA 3O3LA 3V2UC 1MN7A 2CQ3A 2J5AA 5IC6B 4RKUC 1UJ4A 2JNJA 3QIPA 3W62A 4NYOA 5BYQA 2CQHA 2IFXA 3K5PA 2N7CA 2YTCA 1H3DA 1BLUA 4OYXA 1N4LA 3FBEA 3DLGA 3DRXA 1FFGB 3BQ0A 3CMES 2PE8A 1HBMB 4F8RA 1HHTP 4LF1A 2OMOA 2HQFA 1SIZA 4B3RJ 4NWBA 5DDOC 3EPGA 3FSYA 4C98A 4YR0A 1QUVA 2PN6A 4O44A 2D3OR 2KT2A 3GLJA 2B8PA 4XDCA 2JC0A 5CYJA 3W63A 2Z58B 3DKDA 3TI0A 2ZH4A 4PQUB 3QATA 2JH3A 4ZVFA 2DO4A 4ZN3A 3J81U 2BM1A 3QFHA 1T11A 3NGDA 2CA9A 2R3VA 2DJWA 3L09A 1WF1A 2BRLA 4QWDA 2LEAA 3BH7B 3DOMA 3TEHB 1CJKB 1G3OA 2MKJA 4USKA 3KG0A 1FKPB 2P8IA 3OUYA 2CDQA 3AOAA 2RILA 3LGNA 1D9FA 3ZZUA 2GHVC 2N4CA 3PFEA 1FNOA 3QGHA 3VGUA 2CIMA 3UO0A 4LFAF 3QPIA 3WZ0A 3LGMA 1VQ5S 5KFAA 4C8YA 3PY8A 5F3TA 1S48A 3LP1A 4U7UK 2LQBA 3J7Z5 2QMXA 1T9TA 3MR7A 3DM2A 3NGTA 1VRTB 2FLLA 5LSLA 1RT5B 4Q43A 3MR5A 3GB0A 1NK4A 5EDWA 3ZZOA 4EYHB 2DY9A 1DTTB 5F9LA 2Y0BB 3K5LA 3HKWA 1B7FA 5HO4A 1Q78A 5H1SV 1YVFA 4ES2A 3VGTA 3OXGA 3TOQA 2IVMA 3LWLA 2Q79A 3S1TA 3CCSS 1YLXA 3DGVA 2M2BA 2LMIA 4YQWA 3VAHA 4ECTA 3OL9A 1XWLA 2GJFA 3N6LA 1VC6A 2M8HA 3CCUS 4RBVA 4RUHA 5LT5A 2AYMA 1ZAVA 2MZRA 2IA6A 2C2OB 3A12A 3I0SA 1H72C 3BKUA 4MIWA 5KT3A 1OY8A 1HQUA 5DDPC 4TVAB 2FUG9 4USIA 1RKJA 3M30A 5H9EJ 5EGYA 1WC1A 1FX4A 3T1HF 2OEMA 4ED5A 3OD2A 5A2QY 2FB0A 2ZH7A 1UL3A 2RRNA 1BD6A 1DBDA 1UWAA 7FDRA 1P9QC 3QJPA 3T9NA 3MECB 3M8SA 4ZPBA 3SSQA 2QMWA 4ZKAA 4RW4A 3OTBA 3L3CA 4IG3B 1UVLA 1WOPA 2XSJB 1LEOA 5GAGI 1S9GA 2HZVA 2MLXA 2RIJA 3A8JA 1FD8A 4DS5A 1W2IA 3BKTA 1A6LA 5J2NB 4A8SA 1TMJA 3TARA 1LW0B 1TK5A 4GVBB 1QSYA 4MK7A 4X65J 1YRTA 3MFIA 1L3VA 2J7UA 1YHQS 3NG8A 3FDSA 4LF5J 4WKRA 3CC2S 1X8DA 4DN0A 3R5CA 3K8VA 2E1MC 1NAQA 4M95A 1EP4B 4ED1A 5HLFB 2XMKA 3PDNA 4RLEA 1VQPS 3H2LA 5D4OA 4ZVPB 1N48A 2HHSA 3MEKA 3QT7A 3MMCA 1YITS 3QMQA 1U26A 4KHRA 1LW2A 3HJVA 4E8UA 2F63A 2F4VF 3NGUA 3HT0A 4OX9J 2F7VA 4F67A 2B7BB 1QD1A 5DRKA 4DDFA 3HHLD 3M9NB 1QY7A 2WB1D 4YUDA 3P5TL 3T5JA 1ICEB 5IT9Y 3RR7A 3K2YA 3KK2A 1FFWB 1N56A 3SFGA 1ZA2B 1NM2A 4DF4A 2DHAA 1B4SA 3BGUA 4WIIA 2LEPA 4RW6A 4WE1B 3RYLA 2HVIA 1AXQA 1RHJB 2RRAA 3H40A 4USMA 3HSDA 3KFWX 2VG5A 4FF2A 4YDXA 1EIYB 4JI7F 3BBCA 2MXYA 5J1NA 3SZ2A 2GHWA 2ZH1A 1QLNA 2CZ4A 1D9DA 4JI8J 2IIHA 2WBMA 1I1GA 4QR0A 3LWMA 4K0KJ 4PWWA 4KV8B 4YY3F 5CYQB 4JI2J 2E5JA 4DV3J 5FLXU 4ECYA 3ILOA 2VASA 4JV2A 1D9AA 5AJ3F 1PKUA 3SQGA 5KFOA 2B4PA 2VPZB 1WKJA 4CRJA 1VHIA 2DD8S 1IKXA 1Q95G 4UT4A 4Y00A 3T5HA 1NDCA 3HCXA 2J6UA 2DIVA 1N54B 1S57A 3DYAA 2A18A 4EI2A 2YNIB 1K0TA 2OEJA 3HZEA 3CCQS 3G8QA 3PM9A 4EUVA 2FJEB 4F0MA 1WORA 3OPKA 2NXCA 2OI2A 3KDOA 3G4SS 1XR5A 3MEEB 2UV8G 3SXLA 3WDOA 3OTOF 4HHHA 5KG1A 4DR6F 2ROGA 2AZ1A 2R7RA 4I6AA 3CUNA 1KN6A 2EFNA 1FJGF 3A13A 1GK8A 1VR6A 5DM7Q 3HSGA 5JVGQ 2VPWB 2Z57B 1OY6A 4X66J 1V3SA 1YJUA 4ZA1A 2V67A 3WX8A 1C0TB 5KFJA 2CWXA 2E1CA 4TU7A 5C2GA 3ZZZA 3M4XA 3I4HX 4KGMA 1XMQJ 1G2EA 4W4MA 5KFNA 4WCEQ 2JEIA 4C48A 1CJTB 4G1QB 4CH0S 1QE1B 4NZ7A 3OSPA 4M94A 4IR9A 1F3FA 5HROA 2OJ3A 2HFUA 1I5OB 1JJHA 3O1LA 3DLEA 2X1AA 1IBMF 2P9GA 4KB7A 1WKKA 1VFJA 3R9LA 4ZIWA 3FCHA 2I6WA 2VC0A 4NXMF 2G9OA 3SBMA 4L6V3 4CM0A 1TKDA 3KNAA 3HMJG 2V8VA 4AL6A 1PAEX 3TYTA 2AIRB 2UUBJ 2BQ3A 1IVZA 2B43A 1M0SA 3BPSP 1UKUA 4Q8FA 4WXOA 4K4WA 5F8JA 3ETMA 1GXLA 3VAJA 1Q82T 1CJTA 2QSFA 5DG7A 1JXLA 5F0UA 5B0CA 4FYYB 2M52A 5E41A 1VQ9S 3M32B 4NLWA 2YWGA 1KD1T 1OS5A 3PJXA 4WFZA 5J1EA 1NKBA 3VVTA 2OELA 2RDDA 2CPDA 4AD6A 3DRPA 4EU0A 1OWXA 2EFQA 5MAOA 4JI0F 4MH8A 4H4KC 4ZVGA 1QSLA 2H54B 2JX2A 5EUHA 2CG8A 4PQAA 3CD6S 2A6MA 4B3TJ 3JSBA 2HRTA 2G0CA 4CLYA 3T1AA 3AH6A 4FZVA 5KFFA 4DR2F 1QVGR 4UTGA 1RWVB 1YZ6A 1X9MA 5JXSA 2V68A 2C2ZB 5ETLA 3V81B 3ET6A 1RTJA 4P73A 2Y1JA 2JFDA 2RUSA 2G1DA 2UXDJ 3OXLA 1K0VA 1RT1B 2UXBJ 2J8AA 5IWAF 1ZYQA 2YKNA 3SCKE 3CD0A 3G2XA 1YJTA 5DG8A 3MCOA 4CH1A 5M2UA 2F5GA 2BW2A 4HACB 3C16B 4P2MA 2P2CB 1Y0HA 4ZHRA 5D0RA 4F26A 4O3SA 4Q44A 3BO3A 1SC6A 4OLPA 3VZHA 2DNKA 2GA7A 5SUHA 2DGUA 4DPYA 4JI6F 4IO9Q 1KOHA 4HI2A 3H8YA 3UD3P 3PX4A 1WEXA 1SC1B 4ZS6A 1IM6A 3QAUA 1SB6A 1SH0A 2HVEA 2ZBPA 5B0GA 2HWTA 1S1VA 1N34J 3WQPA 4RNMA 3FZBA 3LPEA 1IQTA 2CXEA 1H2UX 2ZD1B 3BO4A 2HNZA 5KFDA 3TUZC 4DL3A 5BJRA 1DJ0A 4LBIA 2GMHA 3K7RA 2ZC4A 2E29A 4A48A 1RABB 1S6QB 4KFBB 2LXFA 4IG0A 1Y5LB 4DU7A 3H5UA 5HMXA 3NWGA 1SUQB 1HQ2A 3VR1A 2AEFA 1FXRA 4HTJA 2H9ZA 4DV5J 2UVUA 1HHQA 2OAUA 2RVJA 3PW4A 4CLSA 4EEYA 3AFGA 1RWWB 2COLA 5A6WA 3R7BB 3RBXA 1RISA 2LECA 1C0UB 3ILIA 1IKWB 4IRCA 3BGRA 5CA5A 4IH5A 3CCWA 4YEAA 1PAUB 3FRZA 5HJYA 2CJAA 4AT1B 4UY85 4P2FA 1S1TA 5E33A 3PEHA 2BMBA 4F50A 3H25A 4CLZA 5JMNA 4R25A 3G8SA 4IOCQ 1SXLA 4QR2A 4F4YA 1RT3A 1UAWA 4KFBA 4QU6A 3C2PA 5HVFA 2YQ0A 3F0NA 2HIYA 3MFHA 2HFNA 1K44A 2FTRA 3M8QA 2MTLA 3KK3A 4WU3A 3MUVP 3UVJA 4X4UA 4I69A 3UN2A 4AFFA 3C6TB 3GJTB 5IQQA 2HEKA 4F4KA 4HEA9 1JLCB 1TL3B 3N9UC 3LALA 4L72B 2MSTA 2Y1LB 3AOCA 3WBZA 3PTWA 1N36J 1GAOA 1QAXA 1HNWF 1HLWA 5ETPA 2KFYA 3GU0A 1HQEA 1MG7A 3MEDB 1RAAB 3VALA 3SDEB 1LWXA 3R7SB 5KG5A 2K1RB 5GVQA 3AOBA 1WHVA 4DUTA 2W24A 1IXKA 2FZCB 5C5JA 3RB3A 3KHGA 3E2EA 1UETA 1TU0B 2J6TA 4JI4J 2DH8A 4DUZF 2HRUA 3ZTSA 3W65A 2VPXB 5C7PA 1R89A 1FJ7A 1FTCA 3VVUA 2J76E 3CC4S 2GVDB 4LMZA 2FJAB 3I82A 1RE1B 1U1OA 2EK1A 1UPPA 3CJQA 1OPIA 4Z2XA 3NCPA 5E3AA 1U45A 5D6GA 3B82A 1M90T 2OPRA 4P52A 2BM0A 4O23A 3SCIE 1X4HA 4UQTA 1R0AA 4RWXA 4BHQA 1RTZA 4I2PB 4B9VA 2OPQB 4J9QA 2ZE2A 3GTYX 2UXCF 4FF1A 4R5PA 1QJHA 1TAQA 4CO1A 1JMTA 4NA3A 1KHWA 5IM0B 4FS1A 2HWHA 4V19X 3PZPA 4CM2A 4WK3A 3PKMA 2DXDA 4OYZA 3G9CA 2BE2B 3TUJC 2MQ8A 1S79A 3R97A 4NLVA 5FDLB 3U7JA 4KO0B 2FJVA 1NO8A 2HRYA 2VQEF 1S77D 4B9UA 4O0NA 3JSMA 1S76D 3CSKA 1GT8A 1FCAA 3GONA 2FVCA 4PABA 2YPYA 2QA4S 3G6YA 1U25A 2L08A 1F2GA 4OX7A 1VRUB 2M4MA 5DGAA 1Q1KA 1D8ZA 1L3TA 1JKHB 2FVRA 5CQGA 3RTVA 2HFSA 4DFKA 2RQKA 4YHHF 4CO4A 2H65B 1SL1A 5ETOA 3BS9A 5I42A 4L3NA 2PA8D 1VK8A 1U47A 2WVDA 2AJQA 1R0CB 4EBCA 3L95X 2XWYA 2PDAA 4DR5F 4HH0A 1JLEA 2YKMB 1HR0F 4KC5A 2IDEA 5L9NA 3IC1A 5B0BA 1YJVA 3C15A 1SH2A 1X5SA 2IRYA 3MAAB 5KFLA 2ZZTA 4MJKA 4H54A 3NEKA 4GO5X 4LIWA 1FNXH 3W64A 4QJVA 1VQSA 2KVIA 1KQSR 4QR1A 3NCRA 3DHWC 2VFVA 3LGHA 4UOHA 2WTFA 4ANDA 1DFDA 1FJCA 5KT2A 2E7WA 2XCAA 4ENOA 1Q53A 2W9CA 2UV8A 4LFCF 5KFBA 5F8IA 3BPDA 1DLOB 4J90A 2L9NA 4I7FA 4FBTA 3Q86A 1SJ1A 3PV8A 2QLWA 2E66A 4YMEA 1VQLS 1YJNS 4N47A 1VBXA 5D3GA 5BR8F 4DL0C 3RB6A 3FEZA 3HPOA 2VJUA 4K50A 2EEYA 1WC4A 5J2QB 3TQEA 1R43A 3R8YA 2D69A 2VFRA 3M1VB 1AZSA 2CNKB 3PYEA 1HYSB 1NSKL 2YPZA 4UF4A 3RB4A 1RTIB 1PG5B 2R2TA 4KAIA 3HX9A 1CG2A 2BVZA 7AT1B 2DXEA 2PC6A 4RWWA 4FS2A 4LRDA 5KOWA 2DGTA 3OHAA 4PG8A 3D7SB 2D9PA 2HHHJ 1FDNA 3QZ7A 3GSIA 1PBUA 2MY7A 4F0HA 1X4AA 3GG0A 4MFBB 3OJSA 3QSIA 3IRXB 5DLGA 2OSQA 2I8EA 4Y2AA 2WB4A 4DI6A 2IM1A 4CT8A 5G0RB 1U49A 1MROA 2OD6A 1HYSA 2I38A 5HANA 1VK3A 1NXIA 4DLGA 4A4JA 5AT1B 4MTPA 2HHQA 2V63A 1HMVB 1BXNA 2ASYA 1WACA 1NBEB 2OFHX 1NJIT 1FVQA 2XI2A 2FY1A 3I4PA 4OZJA 2QSWA 4PG4A 4XO0A 4MAKA 4P7TA 2NXEA 1S5ZA 3Q8PB 4WYWA 2VHGA 3S8SA 2X7IA 1B3TA 4DL4A 1RKIA 5F8HA 2ATCB 2EFGA 4C8MA 1E6YA 5CXTA 2DO0A 3Q8UA 4LF9F 1OQ6A 4KPCA 1TAUA 2AX0A 4URGA 1P9YA 3KJQB 2HGNA 2V94A 1B0TA 5AE3A 4Y34A 2IJFA 5KFYA 3NWRA 4LF8J 4DV1J 1VJWA 1E6VA 2XGQA 3GFHA 3M2VA 3BSOA 2GNKA 3Q22A 4B3SF 4Z37A 4NYPA 1LKZA 1N32F 4DV4F 2B6AA 2VKRA 3EGWB 1UWBB 3CIZA 2MZQA 2FGOA 2Z2YB 4LVNP 4QIFA 3BBBA 4HI1A 5LMUF 4JBCA 2KM8C 4KKOA 1BQNB 1RBLA 4C0OC 3DGPA 2E9ZA 1FDBA 3HSZA 3HKZD 4LF6J 3F56A 3D1HA 1FRKA 1NJWA 4IYQA 4M5MA 1RHRB 1SKUB 2WOMB 1HWIA 1ZM3A 4L75A 4C2MA 3UE2A 3P8BB 1J5EF 5KFXA 3TJ8A 1Y3JA 5AXLA 2D74B 1ZPVA 2HWIA 1HNVA 4OI6A 3PXGa 3IG1A 2AQ4A 4FN5A 4IR1A 2E1RA 3MGJA 4JI5J 2V50A 5ETTA 1J27A 1Q7YT 4KY3A 4TYAA 3PHEA 2IM2A 1RT4B 3GMGA 3M8YA 2C22A 2CFXA 3IFEA 4LF7F 4F2RA 2AEMA 4LQ3A 3D5MA 2DNQA 3QZ8A 4ILMA 1FK9A 2QGFB 2PT0A 1U02A 1KLMA 2WVCA 2K2PA 4K2JA 3DC2A 3UN3A 3N4WA 2JLGA 4B08A 1TTHB 4CCHA 1HIYA 2KI2A 3GG1A 1HPZA 3HHLC 3MPVA 3KDNA 4J9RA 1TL7A 4B9SA 3IN5A 3ZXWA 1RTHB 3R5GA 1Q0NA 2LYVA 4KHPF 4F36A 4YB1P 4ECZA 2DISA 2MQPA 1KFDA 4I2QB 3CJ4A 2GW8A 2DHGA 5LJ3Y 5FJ4A 3TW0A 4LSNA 5F9NA 4C11A 4WYLA 2G0IA 4GKKF 2J9DE 5K8PA 2R4FA 3G82B 1X31C 5A0YA 3MMBB 2GMLA 2POKA 2OPPB 1YG0A 4X62F 4DSIA 1PYSB 3OXFA 2B9YA 2DCLA 2JHEA 1S6UA 4DSFA 3DNCA 1QAIA 1CLFA 3ENQA 4MKYA 4F4XA 3KJVA 3L4BC 3HFZB 4OL8A 2RKIB 3P49B 5BXIA 3QSYB 3J81Y 2P5VA 3C19A 4AQYF 2XSFA 2SXLA 3PKYA 3PYFA 1PSDA 1X4GA 2DNYA 4DEZA 2UVRA 4ECSA 2GMJA 2MKIA 1MWYA 5I3UA 2ADCA 3IXQA 3TA2A 3G6XA 3Q8QB 1XNQJ 2XY6A 3GFYA 3JYTB 3MOZA 1M5KC 5A8KA 1U1QA 4IFVA 2BW7A 3M6WA 3TAMA 3RUBL 2E9RX 1RCOB 1R0BG 4U8VA 2EXUA 4C8KA 3D3BJ 3F73A 4NMXA 4NA1A 4CO5A 2ZNZA 2KRRA 2LKZA 2ABYA 1S7HA 5AE1A 2DITA 1LWFB 1N33J 3W2VA 4PRFA 2AKWB 3SCLE 3AA8A 1GEHA 2CAJA 4RW9A 2CPZA 1X4DA 1S12A 4IRKA 2I5JB 2MKYA 1GXUA 3JYTA 2CVEA 2M88A 3NXZA 1NSPA 2UUAJ 2J7KA 3M05A 3C46A 3C8YA 1R8AA 2Q6BA 3X1LB 3NMRA 4O3PA 3TUIC 4WPAA 1O0PA 3U1NA 1ACMB 1EQMA 4FNHA 4ZCLA 1Q5VA 3CJKB 3GJRB 1MU2B 4P74A 3V6HA 3IR7B 1S7IA 2HVDA 2DR9A 1VQKS 2FY8A 2DH9A 2CQ0A 2V8HA 4M5GA 2J0QD 4UW2A 2VA3A 3M2RA 2BRKA 2FJXA 5GMEA 2LQ5A 5EWEA 1GQEA 3DI6B 4YB7A 3H4BA 4NX9A 2LA4A 1JLAB 4CTAB 3KKFA 4A8QA 1I6JA 2RAQA 4OMFG 3NBPA 2Y3YA 4A8OA 1J2VA 2JZ5A 1U1PA 2F3JA 2D7SA 2L41A 3UW1A 4PG7A 4DV0F 5J2PA 4GRSA 4GKJJ 3DFEA 4KGKA 1P8GA 2HNYA 3DOKA 5L1LA 2YQ3A 2MKSA 2W25A 1NJZA 1UFLA 3FSXA 2FZGB 2XI3A 3BR8A 3I5CA 4LSLB 4U6PA 2RDIA 2ALZA 2UUWA 3IMQJ 2QYCA 1WUUA 1KWMA 3HVTA 3MM6A 5AE2A 3CT9A 3OR1B 4ECUA 5EX3A 1WNEA 4PWDA 4DCOB 3NAHA 2FYXA 5L1JA 4KT0C 5C25B 1RT2B 4UZCA 3SCJE 4F3MA 1P1TA 3LP0A 4B3RF 4B9NA 1HW8A 3J7YU 1XR7A 1X4FA 1P6TA 1RAJA 1TK0A 4DQQA 1FNMA 3SMZA 4ECVA 3CJ3A 4WU2A 4DQSA 3AODA 2EVZA 3BGFA 5CABA 2PMWA 3EM1A 3RRGA 1X5TA 4PZVA 1YJRA 2OKQA 4PYDA 4IFYB 8ATCB 3FSIA 2KJWA 3JB9k 2XGPA 2YKPA 2VIHA 5M2PA 2FHOB 1VQ4S 3POTA 1IKYA 4YB5A 4ETZA 3R27A 4CLFA 4DL6A 2C2EA 1S0OA 3PO5A 3VAMA 4NCGB 1FD2A 1NKEA 1WSRA 1RA7A 3IAM9 2HW3A 2PO4A 5A8RB 3L7UA 1RYSA 2NLWA 4H4OB 5KG6A 1RGVA 4UOFA 3EJMA 2AGPA 2C3YA 1AUSL 4ZCKA 4DQIA 2CWKA 1UEUA 4PKDB 5B0FA 4DU8A 1PGZA 2IJNA 4CO3A 2CPIA 3Q2SC 3O44A 3MEGB 5A8WA 5E3PA 4DUYJ 3TX8A 2RJZA 1OSCA 3J80U 2DGXA 2CQ4A 2BQRA 4WP9A 4DOZA 3SI8A 4B9LA 1S6OA 3MWBA 1KVJA 3MD3A 3DN9A 1EARA 3HF5A 2H5EA 4X64J 1QVFR 4DSJA 2A0FB 1HKAA 2IRXA 1SJFA 3QO9A 4FYVB 5T7LA 5M2RA 4MT1A 2HS3A 2CNOB 1TL5A 2XS7A 1LXJA 2R9LA 3MM9B 2ZH8A 4Q0BA 1SQGA 5KG0A 1HNXJ 2ZZMA 3Q8YA 1SJRA 3FEXB 1UW9A 3GCXP 1HFEL 3I32A 2YNFA 1CJUB 2UVWA 1FF2A 3IO1A 3VV2B 2DGVA 1BHNA 1VC5A 1JLQA 4LFBJ 1SCJB 2M8DB 4LRFA 3G96A 4EMDA 2UUCJ 2XYHB 1XMOJ 2MQLA 2IPOB 2GJ2A 2B0GA 2MJNA 2L3MA 4QIWD 3MMAB 3IR6B 3LH2S 5ETSA 4Y65A 1YBAA 1U0HB 4CYUB 1AB8A 4B3OB 4OQJA 3M8PA 1U0SA 4AL7A 2XMTA 5H9EK 1IN0A 3KLFB 4BWMA 2ZITA 1JJCB 5LXRA 2MGZA 1FRLA 3IWXA 1ZM9A 1S6PB 1NK9A 1I94J 1VQMS 1ZA1B 3EXCX 1TVRB 2VOPA 3A3OB 1J5EJ 2VUGA 3D28A 1NRKA 4QZVB 1T02A 2HBRB 3KMQA 4OZ3A 5GAEU 4X65F 1HNIB 2C3PA 2FHJA 4LF5F 4Z7YA 3VGVA 2B9WA 5B7WA 5KFQA 1QAYA 2PI5A 4LF4J 1BE4A 2ZBIA 4QIGA 1N5VA 1RAIB 4R0JA 3AD8C 2ZEJA 3D0GE 4O4GB 4CI0B 3LP2A 1REGX 1T95A 5K9FA 4QYRA 3KLEA 1PBAA 1Y3KA 3JQJA 4M5KA 1WHXA 3T5KA 1KFSA 1B7YB 2A2CA 1S6PA 3P6YC 4OX9F 2JRSA 2YWWA 1HBOB 1S1WB 4ZDNA 4KIAA 3PR4A 4ED6A 2V8PA 4R8UA 1GH8A 2J0SD 3MCMA 4JV0A 4F3OA 2GO8A 1TL1B 5K8OA 2DT9A 5D0GA 4BS2A 2HFZA 3C3LA 3V6DA 2HMIA 2W2QP 2B5JA 3MI7X 2ZVSA 2HNDA 1ZOTA 2VH7A 1LWEA 6FDRA 3GV5B 1URRA 3UD4P 2ZNYA 3MXHP 2XZWA 2RHQB 2WW8A 3M6VA 5HATA 3K17A 4JI8F 3PFOA 1FE0A 1R8CA 3M2UA 1TV6A 3FVYA 4YS2A 2VA2A 3GQCA 3TVKA 4ZJOA 4F7VA 4K0KF 2QX0A 4JI2F 4DV3F 2W4CA 4K5RA 1PYTA 2ZUGA 3NS5A 1KONA 1SJ4P 1FKOA 2QN6B 4FKXA 1XNRJ 2F40A 2DYAA 4JB8B 2H4WB 4D3HA 2DIUA 2YNGB 3QLHA 2RF2A 2DPIA 1F0XA 5IQ6A 4I1TA 2CPEA 2IVYA 3THVA 1Y00A 3TJ9A 2MQOA 4NLOA 1TKZB 3VGSA 2KYXA 3W5YA 1ZBTA 1U8SA 4CWBA 1U7LA 1D8YA 5CHCB 2HLUA 4JYAJ 4WZMA 3NLCA 2UP1A 1CULA 2F9DA 2ZJRQ 1C1CB 2OFGX 2ASLA 4TXSA 1N5YA 2GX8A 4ZVRB 3I96A 1L3KA 1N5QA 3D0IE 2CVIA 5KT5A 5HP1A 1OO0B 1HBUA 2DR8A 2C3UA 5IZHA 4X66F 1IJFB 2DHSA 2FLNA 2BANB 3ZTRA 3RAXA 2EFPA 1DZ5A 1S9FA 3BKFA 5FIIA 3AQPA 3R6LB 1XMQF 3RAMA 2AZ3A 3FQLA 4EO6A 1O5JA 1NHKL 1CC8A 4P2XA 1QDUB 4PUOB 1F9HA 4DR7J 4ZLJA 1SL2A 2R8GA 1YBUA 4MK8A 4PG5A 1DTQA 5KFIA 3W1YC 3M9MB 4BCAA 4RW7A 4F02A 1GMWD 5A6PA 4Y6IA 3EPIA 5CYMA 3TANA 4FVCA 3DMJB 3OL6A 3J7A1 1RT7A 3I0RB 4K4SA 5K14B 2RS8A 3F44A 4O3OA 3ZZYA 5D8HB 4UZBA 4C8LA 3E3XA 2BANA 2UUBF 3B4DA 4P10A 1RDRA 4PXEA 2R7OA 3G8TA 1IWAA 4U96A 1CJVB 1RJJA 1FRJA 2VD3A 2N7YA 3MZIA 4LIRA 1FJEB 2DRBA 5CAAA 2A6OA 2EFVA 4A8XA 2D1CA 2X1BA 5ETKA 2VC1A 2VBXA 3RGIA 3CO9A 4ELUA 1RP5A 3MCSA 1JLGA 3NKYA 3NY0A 1NHVA 3I5AA 4ZVUB 1WSVA 4KGZB 2KL8A 4Y2CA 2A1BA 1V6HA 2KB2A 2AYBA 1N6QB 4OFZA 3DMJA 3SIPB 2JJ4D 1RTDB 3MOJB 3K0JA 5E3RA 1VC0A 4OYAA 4EZ9A 1LWCB 4K2XA 3ZZTA 4OJ1A 5HVHA 1IBLJ 4B3TF 2BYCA 3I6PA 4M5DB 1MWZA 2DGWA 3PW7A 4DG1B 2HG4A 3OFEA 2GGPB 4ELVA 2NYHA 2L48A 3TNVA 1IKVB 3K59A 3R1HA 5GAHU 1UVJA 2FHJD 2V4JA 4OI0A 4C3LA 3W2WB 1HBNB 4ECQA 2KZMA 3V5RA 4OX6A 1RZMA 2VB6A 1SV5B 3QWPA 6FD1A 5E2QA 1IBKJ 3ILJA 1RWPB 2UXDF 1U1MA 3NOGA 1JXEA 4NI2A 2RRBA 2UXBF 2WONB 2NPFA 4DR1J 3ULHA 1XERA 1S4EA 1F5BA 4D3GA 4RW8A 4ED7A 2KFNA 4TY8B 3W66A 3I9V9 4USUA 3HM9A 4NE9C 1Z1ZA 2B3TB 3BF4A 4NLRA 2YH0A 3W9JA 3QRPA 2XULA 4DG1A 1VJQA 3JTOA 5E7OB 2GGPA 4LJMA 8AT1B 4M5IA 1VBZA 1QAJA 1RHQB 2XS5A 3TAQA 4WF9Q 2ZDPA 3ICLA 3T6BA 2MYFA 3GWCA 2OIHA 2WHOA 1J5OB 2RD5C 5DG9A 4K59A 3CE8A 5EN1A 3RRKA 3A8IA 4CQ1A 4MIAA 2R7QA 1FTRA 4PXDA 4BC7A 2GV1A 2MDAA 2L9DA 1NZAA 3NNCA 3LW5C 1HBMA 2VG7B 2QTWA 2G13A 1RAEB 1N34F 3UR0A 4HLBA 1H7WA 1XR6A 2MKHA 4ITSA 1U1LA 1C2PA 1WG1A 2CQCA 5H9FK 3ENAA 2DEIA 5DJBA 1X5OA 2RMLA 4ALZA 3MM8B 2CQIA 4A8YA 1M5SA 1GFWB 2ZWOA 3GP9A 3AD9C 3EVOA 3MM5B 4PQUA 2WVFA 2NYIA 2VODA 4JV5F 3DOLB 1RAFB 4X4OA 3KLHB 1JJ2R 5IFMA 4DV5F 2I1RA 4F25A 4KRWA 2ASDA 5IS2A 2IM3A 2MKCA 3FFIB 2VV5A 1CJKA 3MF5A 4B02A 2GVZB 1FKPA 1RT6B 2QV6A 3A1YG 1NKCA 1S9EB 3C14B 3UWTA 1VI7A 5KFKA 1XEZA 4NL5A 1A9NB 1R7IA 1B99A 1JB0C 1YTYA 1MSWD 1HD1A 2QJ3A 3BQ1A 1EKSA 1PIEA 2MJUA 5HMZA 5HMWA 4IOAQ 3B54A 3DOLA 4XPCA 1VRTA 1RT5A 1Q79A 2QLFB 4UOGA 1UA1A 4OI3A 4CP5A 4JUZA 1X9SA 3HP6A 3MR3A 1DTTA 4LRCA 4M8LA 4TQRA 3W7BA 1HNZJ 1MMLA 2RS2A 5B0DA 4DCJB 2KH9A 2Z56B 1CVJA 3KWMA 5HQLA 1N36F 3LAMA 1S4FA 2RU9A 1G7CB 4JI3J 2HQGA 4OI2A 1ROFA 5KT7A 4N5SA 4X84A 2KT3A 4RBTA 3FEYB 4IOBA 1T9WA 4Y0FA 2XM3A 3RJMB 2E7XA 2ERRA 3RBDA 3OV7A 1VOMA 2PSZA 4E0DA 2XO7A 1YKWA 1LFWA 3K58A 5B0EA 4NLPA 1GX6A 3P3DA 2PA3A 1WG5A 4JI4F 2CQGA 3WHIA 1H98A 1IR1A 1FHTA 2HVHA 3OL7A 1CS4B 4ER8A 1JLBB 2O5DA 4DR3J 3AD7C 3HO1A 3UNGC 2U2FA 2P6TA 3M9OB 3D6MB 2V2VA 4DZ6A 4QWAA 3GYXB 4QWEA 1LK5A 2G2OA 3BDEA 2VBWA 1FXDA 5HL7Q 4ZITA 4NLXA 3MECA 4DX8H 2IYIA 4U9RA 4I6WA 4WKYA 2R8IA 3KLIB 4IG3A 1R31A 2XSJA 3W9IA 2FJWA 1D0EA 1VRQC 3Q89A 1GMVA 3NMAA 5LJ5Y 4ZOSA 2QYGA 3EMTA 1VQ7S 2VU5A 1A0OB 4USVA 4XDDA 3PEJA 2MPUA 5J2NA 3B78A 2W2NP 2WK4A 3DDNA 1LW0A 4GVBA 3FBFA 4OHXA 3NNHA 3A8EA 5KFCA 4OZ2A 3GIRA 3I9ZA 2KU7A 4P72A 1TKTB 2Z2LA 5THWA 1SIWB 4J7CA 2VBZA 3W9HA 2XMMA 1EP4A 5D4PA 5HLFA 4M5HA 1JNRB 4QBUA 4IH6A 2A3JA 2Z0GA 3QIDA 4RJVA 4WFXA 3K57A 1ULRA 4JOUA 3MPDA 3Q8VA 3K5NA 1KDNA 1UTAA 1PJ6A 3I5BA 3W8PA 2G1HA 4L76A 1EETB 3TUPA 2HK2A 3W5ZA 4OHYA 1D3WA 1REVB 3NCQA 4DL2A 3KK1B 1D09B 2QL5B 4WE1A 3BSNA 5E3QA 2CQDA 2MQQA 2UU9J 4J5OA 3TA0A 1Q8BA 4ETXA 4WTOB 5HK4A 1SBRA 2B4OA 2H5JB 3TZXA 1NHUA 2N3LA 2GC8A 3MR6A 2HZCA 4NYZA 2KJVA 4HHJA 1G6BA 1TFWA 4TN2A 3IR5B 2VL1A 4KH1B 4KV8A 5CYQA 5C42B 2C42A 3D9BA 4I4BA 3SSSA 3CCZA 4USHA 1NU4A 2AD9A 3QFWA 3UFCX 2XBPA 2BJ8A 3EXYA 2P6SA 1T9UA 4C4WA 4WIQA 2V2KA 4IDKB 4F3QA 5GADU 3PR5B 2FVQA 4RX6A 2YY3A 2BEFA 1M5VC 2BABA 4YN3B 2APOA 1U1NA 1UW4A 2YNHB 2DHXA 2YNIA 5IT4A 4WP3A 3FC9A 1TKXB 3AT1B 2DCUB 2W2PP 4FF4A 1AW0A 1WWHA 2QL9B 4TY9A 1FX2A 1F60B 4EK2A 5K8NA 2HHHF 3MEEA 1KQFB 3MM7B 4OJHA 3BZQA 3BQ2A 5D4LA 1Y4ZB 1Z4UA 3L7PA 1DARA 3J81j 1KTVA 4QCLA 4F4WA 5EHHA 4B3MJ 1C0TA 4ZVHA 1TR0A 2W9BB 1T05B 3RZAA 2GIQA 5D0EA 1T9VA 1F2HA 1EHWA 2IMWP 1RADB 1MLAA 1RCXB 2EC0A 4B9MA 3TA1A 1N0VC 4G1QA 1QE1A 3QJJA 1TELA 3TZYA 1RXOB 3RAQA 2GJIA 2KG0A 3WIUA 3ILLA 3R5AA 2KTQA 3I56S 3CDAA 4X4SA 4U8YA 1R8HA 2X3GA 4BDPA 5DQIA 1CC7A 2DR5A 3BR9A 3OTEA 2MHEA 4ZP6A 4ICLB 3DRSB 3UR3C 1OJ4A 2XNQA 3GR1A 1SPBP 5C24B 2ALYB 5DDRC 3R1LA 3D66A 3IS9B 2XMVA 3UN5A 2XB2D 4MMOA 1BQMB 4MYTA 4PWUA 3C6UB 1ZZNA 2XLIA 1R6VA 4DHVA 4LF8F 4DV1F 3A3NB 2ZWPA 4DZDA 1Z2ZA 1YIJS 2GQ2A 2XS2A 2HIQA 4OJGA 3EE3A 4AL5A 1NZ8A 4LRAA 2H1YA 2QRRA 2HS4A 3NGKA 3HVAA 3DLBA 2EC2A 2QG9B 3M32A 2BJ1A 4C97A 2PFFB 1NCLA 4KTQA 2QA1A 4MKBA 1TFYA 2WCXA 1L3UA 3SV4A 1WHWA 3KLVA 1ITPA 2BKOA 3CULA 4LF6F 4CDIA 4WFYA 3UCUP 2NSCA 4AUKA 2LU1A 5KFTA 1NUEA 3N28A 3CMAS 1HWKA 2FC9A 2WW4A 5K5MA 4BWJA 1AT1B 2VFTA 2L9WA 3IWLA 2V69A 1X0FA 4I68A 4H4MB 5D0HA 5I3QA 2DNHA 2OGUA 2Z8QA 1QUPA 3CB4A 3FNNA 5KFZA 4JI5F 2CG4A 1WEYA 3V81A 2H5IB 5J2MB 1GNKA 3KLGB 5H9FJ 2WSEC 3GPAA 4YR3A 1C1BB 2W4DA 1S1UB 2R2RA 4OYPA 2ADBA 1IR2A 1FI4A 2IYGA 1RT1A 3OL8A 4NXNJ 5ITHA 3ZZPA 2KM8B 4F4AA 4P71A 2PD1A 4OLOA 4OZ5A 4HACA 3C16A 5D15A 3KG4A 1W26A 2EI5A 4ZLNA 1HI1A 1SVDA 2IAJB 4OIXA 4UUXA 5F3ZA 1AYEA 1RBOB 4HYKA 3GV7B 2VF3A 4JV5J 3BB5A 3O6QA 1VQOS 2MLYA 2BX6A 2DNOA 4YOEA 3DRYA 2BJEA 2A2DA 2IJRA 3V4IB 3H7HB 6AT1B 1JXVA 1Q81T 1C1BA 3UDLA 2F4FA 4J9MA 3H59A 5T41A 4DX5A 2VDIA 2AMCB 4NCBA 2CKWA 1S1XB 3MUTP 4EZ6A 4OV6A 3V4MA 4AXIA 3CIMA 1AFJA 2V4QA 3E51A 4ID5B 1C4CA 3T6JA 5K20B 5HQ8A 1YJ9S 1KVKA 4KHMA 1H73A 2ZD1A 5KFPA 1UCNA 3JAMU 1ZETA 5CZVA 3FMWA 3H98A 3PW0A 1S99A 1R3NA 5GMKa 2DNNA 4TQSA 2LU2A 1S6QA 1Q8LA 2ZOMA 4KQZA 2DBBA 4N77A 3HHLB 3B8HA 3EICA 4N7TA 3ENVA 3CF5Q 1SUQA 3HDSA 3QIPB 2X51A 1DAXA 2E44A 1XNQF 1B0PA 1KC8T 4C3MA 1U6FA 3QNWB 1AA1B 2N82B 1C0UA 1IKWA 5LXYA 4IRDA 3D1OA 4CZCA 3DLGB 2FJDB 1U2CA 1XMBA 1F9EB 4JP8A 4N8NA 2HHUA 1V9OA 1VMBA 4DV7J 5L8RC 1SL0A 1N5SA 2QO3A
chains in the Genus database with same CATH topology
5FD1A 2ATLA 1OSCA 2AP6A 2DGXA 2HS0A 2XCPA 2CQ4A 2BQRA 2CPFA 4X4VA 4Y00A 3FZ2A 5CCLA 3O5TB 2U1AA 3NP5A 4O44B 1LOUA 5A0YB 3T5HA 1WEZA 2Q6CA 4EO8A 1S0MA 2J6UA 4DOZA 2DIVA 1N54B 3J80Y 1WELA 3DYAA 1GXTA 4ZMMA 3SI8A 1N33F 4QIVA 1S6OA 3CGIA 4B9LA 1XBWA 2R7TA 2VFUA 2A18A 4Q8EA 3MWBA 4OHWA 1KVJA 3UCZP 2YNIB 3MD3A 1K0TA 3DN9A 3VWSA 2CPXA 3HZEA 2R7WA 3O8WA 3HF5A 2QIFA 3CCQS 1NB7A 3G8QA 3PM9A 2H5EA 3I0RA 2FJEB 5K14A 4EUVA 4DSKA 2MZ1A 2BDPA 1QVFR 2FLOA 4DSJA 3OBIA 1Y7PA 4TKTA 2DRAA 1Y5IB 3O2IA 3OPKA 2IRXA 3E01B 2NXUA 1SJFA 3G4SS 1XR5A 3GFXA 3MEEB 3QO9A 3C6TA 3KJVB 2UV8G 3SXLA 3GYNA 3WDOA 2WSFC 4OZLA 3OTOF 5KG1A 4DR6F 1VHFA 2ROGA 5T7LA 2O3DA 5M2RA 1JLCA 2RSQA 1TL3A 2HS3A 2R7RA 4I6AA 3CUNA 2V8DA 1TL5A 2XS7A 1KN6A 3NAIA 3CC7S 1BWEA 2UUAF 2EFNA 4ZPCA 1FJGF 1LXJA 2C2RA 2R9LA 3MM9B 2ZH8A 1N52B 5DM7Q 5JUMA 4HKQA 4C8ZA 4Q0BA 5KG0A 5JVGQ 1AROP 2VPWB 2B4UA 3BSCA 2ZZMA 5I3UB 1VGYA 1SJRA 3FEXB 1WHYA 2RE1A 1V3SA 3H4DA 3JSRA 2KXFA 1YJUA 1HFEL 3I32A 4ZA1A 2AW0A 4K4VA 2YNFA 3MEDA 2XY7A 2QA2A 3OUYB 2UVWA 5A8KB 3SDEA 4N56A 3N79A 1FF2A 5L1KA 5DQGA 4IFVB 1C0TB 2K1RA 3IO1A 5KFJA 2E1CA 4TU7A 3LPYA 3ZZZA 2CPHA 3M4XA 2DGVA 3MDFA 1VC5A 3I4HX 4KGMA 2DGOA 4WK1A 4A8FA 1G2EA 1JLQA 3T19A 3TAMB 5KFNA 2M8DB 5B0AA 4WCEQ 2JEIA 3RW7A 1N6QA 1Y9OA 2HVZA 1V3ZA 1VS3A 3Q8RB 4G1QB 2BR0A 4CH0S 1QE1B 4NZ6A 3G96A 4NZ7A 4NOHA 1XN9A 3LP1B 1RTDA 4Y2KA 3OSPA 4M94A 4BC9A 4IR9A 5HROA 3QYYA 2R2SA 2OJ3A 5DM6Q 2A10A 4FPRA 3UPFA 2MQLA 1JJHA 4ZP9A 1LWCA 3DM2B 3E01A 3DXBA 3O1LA 4JV1A 2YKQA 2GJ2A 4MYUA 2B0GA 4ELTA 1S49A 2MJNA 3DLEA 1U2FA 2L3MA 2X1AA 1KOOA 4QIWD 3BN4A 3MMAB 3CJ5A 3UI3A 1IBMF 3IR6B 5G4DA 3LH2S 4M5DA 3LF0A 1U1KA 3ENWA 2P9GA 4KB7A 3LOUA 1VFJA 3W2VB 1S72S 1X7VA 2B4VA 4Y65A 1YBAA 3FCHA 2VC0A 3BEGB 4B3OB 2ZOGA 1UP1A 4OQJA 1IKVA 2MQMA 4NXMF 4NZ0A 4ED3A 3M8PA 2UVVA 1VIXA 1SI9A 2G9OA 4AL7A 4L6V3 4RW9B 2XMTA 1NK7A 2EWHA 2EG1A 2I2YA 1TKDA 1IN0A 3KLFB 3TX8A 3HMJG 3KNAA 4BWMA 5KFMA 3W2WA 1HBNA 2V8VA 4GKJF 4AL6A 4IQXA 2ZITA 2ZKUA 3TYTA 1L5UA 5LXRA 4ZCIA 4DN9A 2MGZA 1FRLA 2BQ3A 4DWIA 2B43A 3IWXA 1SV5A 2CQ2A 1ZM9A 1M0SA 3BO2A 1HWLA 1S6PB 2MZTA 3T3FA 2MMYA 3RR8A 1XK8A 1C4AA 1NK9A 4HL9A 1VQMS 4I2PA 3EXCX 5KFVA 1LV5A 1TVRB 4C9DA 3GILA 4ZP7A 2VOPA 2OPQA 1UKUA 3HFKA 4Q8FA 4WXOA 4K4WA 5F8JA 2VUGA 4NXNF 3D28A 1NRKA 4QZVB 1GXLA 1T02A 2WONA 3KMQA 2AV5A 1ZM2A 2WAQD 3VAJA 5GAEU 1Q82T 1T3OA 2QSFA 2CRLA 5DG7A 5KFHA 4X65F 1JXLA 5F0UA 4UY8T 2KRBA 3EGNA 1SKSA 1FERA 1HNIB 4P6QA 4O3NA 5B0CA 2M52A 5E41A 2BJDA 5IM0A 2C3PA 3M32B 1K73T 1VQ9S 2FHJA 2JLEA 4TY8A 4NLWA 4NLSA 2YWGA 1KD1T 4LF5F 2KG1A 1OS5A 2OO4A 3PJXA 3DHXA 2B9WA 4WFZA 3CDEA 5B7WA 5J1EA 5KFQA 3VQTA 1NKBA 1DRZA 2BE2A 2KO1A 4ECRA 3MTKA 4F4ZA 3CCVS 1QAYA 2CPDA 1P1LA 5FDLA 3DRPA 4EU0A 1OWXA 4EFAC 3I55S 2PI5A 4DBQA 4KO0A 4KBIA 2FHKA 2ZBIA 2EFQA 3I0SB 1W2BR 2FGCA 4QIGA 5MAOA 1N5VA 4H4KA 4PG6A 4DLEA 3D1QA 4R0JA 3OR2B 1GX5A 4JI0F 2R8KA 2OTLS 2VONA 3M2RB 1HQUB 4RUCA 4RU2A 3D0GE 4MH8A 4O4GB 4H4KC 4CI0B 3LP2A 5IXUA 4ZVGA 3M30B 1QSLA 2JX2A 1J5OA 5EUHA 1KLNA 3KMSA 4O3RA 1T95A 2I9SA 5K9FA 3AB2B 4PQAA 4QYRA 5KG3A 5KG2A 3KLEA 1Y3KA 4QU7A 3CXCR 3CD6S 4YB6A 3CJ2A 1WHXA 3TVZA 3T5KA 1SKWA 1KFSA 4M1KA 1VRUA 3JSBA 3ZFVA 5L1IA 2G0CA 5KFEA 3IGVA 3JTPA 3T1AA 2A2CA 2JVRA 1JKHA 3AH6A 3QGIA 1SJ3P 4FZVA 1S6PA 3NBPB 3P6YC 4OX9F 2JRSA 5KFFA 1FT8A 4DR2F 1ELOA 1HBOB 2W4PA 1QVGR 1X5PA 3CEDA 2D9OA 1S1WB 3I87A 4OJ3A 4RW4B 2KKHA 4ZDNA 2KXHA 4DSEA 1X9MA 5JXSA 3IA0A 3Q23A 2VG7A 5J2PB 4I67A 2RQ4A 3JSYA 4KIAA 3PR4A 1YRUA 2YWEA 4ED6A 3D2WA 2FLPA 1S9GB 4R8UA 3V81B 3NNAA 4PR6A 1UVKA 1GH8A 1RTJA 2J0SD 4JV0A 4F3OA 2GO8A 1A7GE 1LK7A 2HNYB 2VKZG 1S10A 1TL1B 5K8OA 2Y1JA 3DOKB 2M0GB 5KOXA 2DT9A 3OHBA 1FKAF 3Q2TC 3KHLA 2JFDA 4BS2A 2YKMA 1MMNA 2HFZA 3C3LA 3V6DA 3ETOA 2HMIA 2G1DA 2ZFHA 5F8NA 1IJEB 2B5JA 3OXLA 3RRHA 1FESA 1RT1B 3IAS9 3MM8A 3MI7X 1K0VA 5CCMA 3P96A 1T3NA 2ZVSA 1N5TA 1YJWS 2BV3A 2HNDA 2J8AA 5IWAF 3VZIA 3DXSX 3DU5A 1ZYQA 2YKNA 3MM5A 4O0IA 3NRBA 3OR2A 3U1MA 1ZOTA 2VH7A 3SCKE 1LWEA 3CD0A 6FDRA 2DNGA 1FEEA 1URRA 5KT6A 3GV5B 3UD4P 1YJTA 2ZHAA 5CZXA 2ZNYA 3MXHP 2B56A 2XZWA 1YRXA 1WTFA 5DG8A 1UVIA 4RNFA 2WW8A 4CH1A 3M6VA 4JI8F 5M2UA 3PFOA 4OI4A 5AXKA 3KLHA 1FE0A 4J9SA 1R8CA 2BW2A 2NUUG 1DURA 2RT3A 1Q7LB 3HVTB 3M2UA 1TV6A 3MM6B 3FVYA 1NK8A 2VA2A 3GQCA 3TVKA 3N0VA 3PX0A 4C0HA 4I64A 2AGOA 2HFOA 4QWBA 4K0KF 1Y0HA 4ZHRA 4JI2F 4DV3F 4Q2LA 2Q43A 3CCMS 4PWDB 2W4CA 4K5RA 3D0HE 2GQQA 4F26A 1QSSA 1HHSA 2ZUGA 3FFIA 4HDGA 3NS5A 2NR0A 4O3SA 1KONA 1HA1A 1N0UA 1DLOA 4Q44A 4LQ9A 3BO3A 1SJ4P 1FKOA 3TRGA 3MMCB 3VAKA 3HT3A 4ATNA 4X4PA 2F40A 3LP0B 1SC6A 4OLPA 3VZHA 4D3HA 2F8HA 1RT6A 4DV7F 2DNKA 1LW2B 1BQXA 4ZK7M 2DIUA 2YNGB 1S9EA 4FXDA 4PPZA 3QLHA 2RF2A