3UWTA

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 2.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
197
Chain Sequence
GAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 49
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA01
2YKAA 2MXYA 1CVJA 2DNKA 2BZ2A 3MDFA 1VQ9S 2AD9A 1VQKS 1U1KA 2DNZA 4ED5A 2LXUA 2XS5A 2LA6A 1UW4A 3US5A 4F02A 1SJ3P 4RU2A 2ERRA 1VQLS 2LQ5A 4F25A 1ZZFA 2K8GA 3U1LA 1Q81T 3BS9A 2J76E 2KXNB 5DDRC 1D8ZA 5CYJA 5JVHQ 5H1SV 2YWKA 3NS5A 4WFBQ 3UCUP 2Q79A 2DHSA 2N7CA 4LIRA 2CPHA 3VAFA 3NMRA 2DNHA 3NNHA 3BO2A 4YB1P 1AUDA 2DGWA 1NU4A 1SXLA 3B4MA 2EVZA 3D2WA 2MQNA 2MKKA 1YTYA 5GAEU 5IQQA 5FJ4A 1X4EA 2DGSA 3HHNB 1O0PA 2RS8A 1U1LA 1X4DA 1VC6A 3NS6A 2DIVA 2DNRA 3CCVS 1HD0A 3THPA 4ZKAA 1WI6A 2MYFA 5D78A 3UE2A 2CPDA 1JMTA 2KT5A 2DH7A 3VAIA 1D9AA 1VC0A 1X4CA 2XB2D 2F9JA 3CCUS 1A7GE 2FC8A 4TU8A 3S7RA 4C7QA 4CH0S 1FT8A 2FPHX 2MKSA 2OIHA 3G8TA 1YIJS 3UD3P 4Y0FA 4W92B 2LKZA 1WEXA 2MPUA 2CPFA 4C4WA 5GAHU 2F3JA 3UCGA 3G9CA 1YHQS 2HGMA 2MJNA 3RW6A 4BS2A 4WIIA 1FJ7A 3UWTA 2AYGA 4IUFA 2DHGA 2DITA 3MURP 1DRZA 2VOOA 4ERDA 1WWHA 2JVRA 2CQCA 3BEGB 2RUGA 1UAWA 2OJ3A 2MGZB 2G4BA 2CPEA 2E5GA 2X1FA 2D9OA 4IOAQ 3I56S 3NNAA 3NNCA 5DETA 5JVGQ 2MZSA 5GMKa 3V4MA 3VALA 1H6KX 5ITHA 1K9MT 4LMZA 2F9DA 3PIPQ 1N8RT 4QU7A 3VAMA 2MZQA 2CQBA 1ZZNA 2GO9A 2FHOB 4F26A 2MKCA 3G96A 5LSOA 1OO0B 4QQBA 2X1AA 2U2FA 2CQ0A 1F9FA 1PO6A 3K0JA 2BOPA 2UP1A 1SJ4P 3MI7X 1WEYA 5MLCV 1SJFA 2KXHA 2E5IA 2MQMA 3CCSS 2KU7A 2JRSA 3LPYA 3Q2SC 2GHPA 1Q86T 5D77A 1H2VZ 1VQ8S 4WFNQ 1X4FA 1FXLA 2MZJA 2XS7A 2DGUA 1VQMS 3THTA 4P6QA 2QFJA 2CPYA 2MSSA 2E5JA 5LXRA 5GADU 2LXIA 1WELA 2DNLA 2MGZA 1VQ7S 1OIAA 1WHYA 1YJWS 1HA1A 1YI2S 1X5SA 4TU9A 3VF0B 4CQ1A 5IM0B 5HL7Q 1WHVA 3IRWP 1UP1A 2VODA 4FXVA 2CQPA 2VOPA 2J0QD 1DZ5A 2E5HA 2J0SD 2KG1A 2KXFA 1DHMA 3P3DA 4Y00A 2MQOA 3Q2TC 2OSRA 2DNPA 3CMES 1M1KT 2KN4A 1VQ4S 2SXLA 2LEAA 2DISA 1KD1T 3CTRA 2CPIA 2KM8C 3EX7B 2ZJQQ 2I38A 4WKRA 3J7YU 2RQ4A 2M4MA 4EGLA 2MQPA 2YH1A 3HI9A 1NO8A 1R8PA 2DHXA 2MKJA 2RS2A 2FC9A 4QU6A 2CQDA 2KG0A 2DB1A 4M5DB 3R27A 1N52B 3ZZZA 2KM8B 1P1TA 4TLQA 1S72S 1WG1A 3UCZP 4C0OC 2JWNA 1M5PC 1Q7YT 3H2UB 2L08A 5IM0A 4A8XA 2DNGA 3CC7S 3FEYB 5DDOC 1WG4A 2MB0B 1FJEB 2DGVA 3EGNA 4QPTA 1L3KA 1KC8T 1SJQA 1U2FA 1S79A 2DNMA 2NZ4A 5CXTA 2RRBA 2D9PA 5GVQA 1U1RA 2WBRA 3G4SS 3CCRS 1KOHA 1VQPS 2RT3A 2X1GA 2ZJPQ 2AYEA 3S01A 3G8SA 2DNOA 2PEHA 2JVOA 3P6YC 2DGOA 3MUTP 5LXYA 2LYVA 5GAGU 1G2EA 4OZ0A 3SMZA 2A3JA 2KRRA 2EK1A 3MD3A 4PR6A 1X0FA 3CCQS 2PE8A 1K73T 5DDPC 2OTJS 3BO3A 2QEXS 1H2UX 5DDQC 4J5OA 3P49B 1WHXA 2DGXA 2HVZA 2O3DA 1VQ6S 1U1NA 2RNEA 1N88A 2J8AA 2LCWA 2XNQA 1WI8A 2RU3A 3TP2A 2M0GB 3S8SA 2B0GA 3UD4P 1P27B 2HGLA 1U1PA 3CCLS 2DHAA 1U1OA 1VBXA 2OTLS 1WEZA 1KOOA 2XSFA 3OW2R 1QVGR 1VQNS 2HGNA 2L9WA 2RVJA 5LSLA 2D3OR 1QM9A 4UQTA 2KI2A 2MQQA 1X5OA 2HZCA 3I55S 4IOCQ 2M9KA 1BY9A 3CF5Q 2MJUA 4Z2XA 2QA4S 5DM7Q 1VBYA 3CCMS 2CPXA 2FY1A 2LMIA 1VBZA 5HO4A 1N54B 3CC2S 3PIOQ 1M5KC 3P5TL 3LQVA 2KHCA 4U67Q 3MUMP 3CXCR 2DGQA 2DK2A 3G6ES 2ADBA 1NJIT 3CULA 3MUVP 1X4AA 3DLLQ 1SJRA 2DNYA 3U1MA 3JB9k 1URNA 2N3OA 1JJ2R 5BJRA 3SXLA 1X5TA 1U1QA 1YWXA 3H2VE 3S6EA 2MQLA 1M5OC 2DO4A 5CA5A 3FEXB 2M70A 2MZ1A 2ZJRQ 2KFYA 4WCEQ 1VC5A 1Q82T 2M8DB 5DM6Q 2ADCA 3DXBA 3TO8A 1X5PA 2U1AA 5EN1A 3ZZYA 1PGZA 1DBDA 3J7ZT 2KVIA 2DH9A 2G1DA 1X4HA 1U6BA 3ULHA 1JJHA 2AYBA 1X4BA 1FJCA 3CCES 1IQTA 2XS2A 1OPIA 2M2BA 4WF9Q 2AYMA 2JX2A 2MY7A 1JJ4A 4PRFA 2DIUA 2V94A 1W2BR 2EK6A 4YOEA 1M90T 1U1MA 4V19X 1OWXA 2DNNA 1M5VC 4IO9Q 2CQ4A 2VONA 2MMYA 4WFAQ 1YITS 3MXHP 1A9NB 2E44A 4PKDB 2M8HA 2DH8A 2LEBA 2DNQA 3SDEB 4YUDA 2YH0A 1FO1A 3N9UC 1K8AT 4CH1A 1RK8A 1WG5A 3CPWR 2CQHA 2CPZA 2CQ3A 2KYXA 4CIOA 1QVFR 1VQ5S 3VAKA 1B7FA 2M7SA 1YJ9S 2MZRA 2CQ2A 1KQSR 2N3LA 2KRBA 2M52A 4UY8T 3IWNC 3MD1A 1FHTA 4TU7A 2MKHA 2CQ1A 2NLWA 2CPJA 2LECA 1WF0A 2I2YA 1ZH5A 1RKJA 2K3KA 1FNXH 1X4GA 4LJMA 3CCJS 2HYIB 5LJ5Y 1WF2A 1YJNS 3L3CA 2XNRA 3R1HA 3CD6S 3CC4S 3VAJA 1HL6A 2MY8A 3B4DA 2L41A 1XN9A 2RRAA 3VAHA 1UFWA 2YTCA 2KH9A 2DGTA 2MSTA 4OZ1A 3SDEA 2MKIA 1VQOS 3RW7A 1WF1A 4FXWA 1WHWA 3BO4A 4W90B 3CUNA 1HD1A 1R8HA 3EGZA 2CJKA 2MHNA 2G0CA 2OSQA 3MOJB 1WTBA 3R1LA 2DO0A 5IFMA 1H2TZ 2X1BA 3TYTA 3CMAS 2CQGA 3G71S 1U6FA 2N82B 2M88A 2LA4A 5LJ3Y 3VAGA 2RQCA 2MZTA 2CQIA
chains in the Genus database with same CATH superfamily
1VQ9S 3LALA 2ZZMA 2OEKA 4K2XA 3HCXA 2GVDA 4C0HA 2VUGA 1HWKA 2XWYA 1RTIB 1HI1A 1RAGB 1C1BA 4PXBA 1T3NA 2DEIA 2ZC4A 4EZ6A 4HI2A 1MSWD 4RW7B 3NGKA 1NU4A 4G65A 2P5VA 2AU0A 4DV7J 2DNRA 4ZVHA 2AWZA 4DPUA 3ONQA 5H9FK 3HK2A 1VC0A 1T9XA 2KT2A 1A7GE 1NPRA 3F44A 3AD8C 1TL1A 1YIJS 3W5XA 2MPUA 1GTEA 4IOBA 4R8UA 4PG6A 2QG9B 2DCLA 1RLDA 4YR0A 4NLYA 3GYNA 4KKOB 2ZBIA 5C7PA 2KO1A 3QGGA 3NNCA 2MZSA 3VALA 2Z2YB 4EBEA 2MZQA 1D9FA 3MMCB 2VG7B 1OSDA 1U0SA 3O8WA 3TUJC 3DLHA 4G3IA 2I5JA 2JL9A 3AJDA 2KXHA 2E5IA 2KU7A 3KJVA 3D0HE 1IQZA 4QR1A 5KG2A 4RUCA 1IBKJ 3BQ2A 2HNZB 3RB3A 1C4AA 1M5HA 2ZKTA 3FSXA 4NZ7A 2ZBRA 1VDHA 4F3MA 3KLHB 3TUIC 1FERA 3CMES 1MROB 1MG7A 9RUBA 3T19A 2WW4A 2VDIA 2UVVA 1Z2ZA 3EVWA 2CJAA 2G2YA 1Y0HA 3RRHA 1ZTTA 3BH6B 1VRUA 1BGXT 3FCVA 3MMJA 2WB4A 3RB4A 1CULB 3K58A 2IC3A 1P8GA 4K4ZA 3W9IA 3E01A 4JUZA 3OXLA 1M1GA 3O1LA 1F6TA 3DRSA 3M4XA 2DNGA 4ZPBA 2WSCC 5DDOC 2BDPA 1QJHA 1EKSA 3OVSA 4RLEA 3AQOA 3C15A 3P6YC 3IWLA 1S1XA 1X9MA 5GAGU 3BN4A 2HHUA 2A3JA 2GW8A 1BUXA 1IBMF 1TFYA 5D8HB 2QEXS 5L1IA 3M2RA 5DDQC 4J5OA 1U1NA 2WHOA 4J9PA 2RU3A 1YKWA 2WRMA 5J2NB 2YPZA 5THWA 1HHSA 1V3ZA 2ZH2A 1F5AA 5EWGA 4DUZF 2EKNA 4UT4A 5KFKA 1P27B 2AGPA 2HMIB 1GMUA 3LW5C 4G1QA 1XNQJ 2FHKA 3CCLS 1NJYA 1IKYB 2B56A 4AE5A 4DCOB 4Z2XA 5EX3A 4ZJQA 4X66J 3BGRB 4NLDA 1JX4A 1PJ5A 2UVUA 4DS5A 3KLEA 2KJWA 4ZVUB 3MUMP 2BMBA 4K59A 5IS2A 3PKYA 5B0AA 1RT4B 3M30A 3TAMB 2VF3A 3A8KA 3LP0A 2ZJRQ 4LVOP 4QR2A 3WZ0A 3BQ1A 2M8DB 2GS8A 3KHRA 3ZZYA 1Q53A 1PGZA 4LR9A 1DQAA 3J7ZT 1S0OA 4EO8A 2OI2A 2MEWA 3MPDA 1FKPA 4WF9Q 1OY6A 2R7WA 2HHQA 1JJ4A 1JXEA 4ED1A 1F9EB 2IY5B 2DY1A 1SC1B 3BV8A 2XMKA 1U1MA 5KT6A 2P6SA 4ANEA 4KPCA 3IRXB 2MMYA 2W7PA 1D0EA 4CH1A 3MCSA 1TKZA 2CPZA 3K5MA 1ZYQA 4JI8J 3W8PA 1YJ9S 3RRKA 1V5VA 2CQ2A 1YBUA 4P9SA 4IH5A 4ZLPA 3OTEA 4OZNA 2LECA 3OVBA 3POTB 2CJXB 4DPOA 2RB7A 1GXLA 4F4WA 1F5CA 2FVCA 5J1EB 3CJ3A 3GFHA 2H51B 3B4DA 2W2NP 2Y1IA 3VAHA 3MEDA 2DGTA 1TVRA 2CAJA 4B3SJ 5E3RA 4ZJLA 1SC6A 1HBNB 1WOOA 4PYDA 1HR0J 4DV4J 3Q89A 3WBZA 3T3FA 1S6PB 5IZHA 1IJEB 5HBMA 2B4VA 2LA4A 4OJGA 1RBAA 4H4KC 2DXFA 1IXKA 4M63A 1RQ0A 1U1KA 4BLGA 2R7RA 1ULRA 4RO0A 4YDXA 3HP6A 4QYRA 3H25A 4QZVB 4XK8C 1RT7B 4DPTA 4UZCA 2CPHA 4XIUA 3RR7A 3CCWA 3G8QA 3L95X 3D28A 4NLUA 2DGSA 2DXDA 4I68A 3F73A 2QRRA 2QJ3A 4OHXA 1NJXA 4NRUA 2A6OA 2CWKA 1HNZJ 5CYMA 1HBOA 2XM3A 2FC8A 1Y7PA 2R7VA 4M5KA 3K2YA 4Y0FA 1Z4UA 3AT1B 2PN6A 1KVIA 1ZA1B 4M95A 1S4FA 4BS2A 2ZWPA 3LGHA 3W2VA 4B17A 3GJRB 2F8EX 5K9FA 5GMKa 2WOMA 4QWBA 5D15A 1WUUA 3HVWA 1SIZA 3WC2A 4Y2AA 3HHEA 1K1QA 4QW9A 2GNKA 2U2FA 2IDLA 1F9FA 2CNNB 2XMWA 1SJFA 1XWLA 4E0DA 3ETMA 3KMQA 2EBEA 1Q16B 2XMJA 2F4FA 4EBCA 2OPRB 2W9CB 1LK7A 1WHYA 3LUYA 4F7VA 4KBIA 3VF0B 4GKKJ 3C16B 2V8DA 4QCLA 1KEKA 4Y2CA 5LSRA 3M32A 5HVHA 1RBOB 3A4TA 1M1KT 3UDEA 3MPWA 4ZK7M 2DISA 5HMYA 3EX7B 5F8NA 3AODA 2MQPA 5J2MA 3CDEA 2RS2A 3T1HF 2RJZA 3HZGA 5EWFA 3O6QA 1MMNA 2JJ4D 5B09A 4RW4A 1TMMA 3E2EA 4CLPA 2KJVA 3T5JA 3C8YA 3NBPA 2DR6A 1FJGF 2RRBA 3JAMU 5GVQA 4DZ6A 3HT3A 1UWAA 4USIA 3RRGA 2EXUA 2ZD1A 3R2DJ 2AYEA 4C9DA 1H72C 2JVOA 2KVQE 4NEYA 5T14A 5C42A 2KRRA 1RAEB 4DL4A 2A2DA 4PPDA 4BC9A 2E7XA 3R5CA 3GWCA 4RPFA 3FEZA 2B9EA 1I94F 2XLKA 1NSKL 2GVDB 2DHAA 3H4DA 2C3UA 1RAIB 5KFLA 3PO5A 1C1BB 1T9UA 3M7VA 1MLAA 4LF8J 3WIUA 2F65A 4I0WA 3CF5Q 1VBYA 5D0HA 5AXNA 3R6LB 2EWHA 2ZUAA 1LEOA 4NEZA 4WYWA 5J1NA 2AZ1A 4OZLA 2ZH8A 4N47A 5C25A 1HHQA 3GQCA 2I0XA 3R5DA 4FF1A 4CRJA 5K8NA 3OFHA 4DSIA 1O5JA 1RZMA 3S6EA 1M5OC 3FMBA 5IC4B 2P9EA 2V34A 1Q82T 4LT6A 3TO8A 2W4CA 3OBIA 5DG9A 1NK0A 1TL1B 5F0WA 1FRIA 1IUJA 2J9DE 4MKYA 3BZQA 1IQTA 3OD2A 4AL6A 2RIJA 5I3PA 4ECUA 1CC8A 2UV8G 2O5DA 4ZMMA 1LKZA 2LP4A 2ZBQA 4WE1B 1RWNB 4PKDB 2NS1B 3PJ9A 4KH1B 1JLQA 5A8WB 5DS7A 1Y5LB 2HNYA 3H59A 3E8OA 2YKQA 4UY8T 2Y0SD 3IWNC 3NCRA 2NXEA 4X2BA 3N6MA 2I5JB 1WF0A 4ENOA 2C3YA 2XCAA 3KJVB 5T41A 3I31A 4ZLNA 4JI7F 3MMAA 2EW9A 1HL6A 2XSJA 1XN9A 1MN9A 2J0XA 2GC8A 1CJKA 4QIEA 4OLPA 2KL8A 3CB4A 1WHWA 2OMOA 4K5SA 2OPQA 2G0CA 2PA8D 3MOJB 3OL8A 4O4RA 1FFSB 1LV5A 2G0JA 3TYTA 3G71S 4NXMJ 2R2SA 2K1RA 4DU7A 2G2ZA 2CQIA 3DNCA 1VRUB 3PHEA 1R27B 2IC3B 5KFRA 2AJ0A 3ELHA 3QFHA 3EJMA 1UW4A 2HFNA 1UKUA 1VQLS 4HHJA 2EKYA 1FNMA 2CG4A 2HQGA 1FRJA 2P9CA 2IAJA 1LFPA 4MMOA 2N7CA 1Q5VA 1YZ6A 4HL9A 2HFSA 3C15B 4O0NA 1S1XB 1KWMA 2MQNA 2BABA 2RRNA 4USTA 5FJ4A 4LBHA 1RWWB 4PZVA 1OQ3A 3TX0A 4UUWA 1J5OA 1NKEA 3M2RB 1VJQA 1AFJA 2FHMA 4U96A 4O0IA 2JZ5A 1N5VA 1JMTA 4OZ3A 5IT4A 2ZH7A 2W8LA 2EG2A 3P8BB 2BM0A 3S7RA 1FKOA 4G1QB 2V8GA 4J9KA 4B9TA 5KT2A 4DLGA 2HBZB 4ED7A 3O5TB 4LSNA 4C6AA 1YHQS 3RW6A 4ER8A 3MURP 2CQCA 3OL9A 2ZDOA 4I64A 4P75A 3BDEA 3C19A 3KLEB 3JSBA 4QWAA 3HZEA 5JXSA 1RWPB 1IBMJ 1YRTA 3M30B 3KKFA 4QU7A 1K47A 2F5GA 3LP0B 1TP7A 2UU9F 1B70B 3CIMA 1TUWA 1GAOA 4KHPF 4Q2LA 4X65F 4DUZJ 3ENWA 3K5PA 3FUYA 3Q2SC 3OUYA 3OJUA 1FKPB 1WTFA 2R7TA 4DR4F 3R3TA 2MGZA 1S6UA 2FTRA 2ZWOA 3K89A 4OX9F 2ZFHA 4P74A 4XPEA 3V5RA 1SV5A 4URQU 3P3DA 1TKZB 4ED8A 2P9GA 2Y1JA 4Y2KA 1JNZB 3LH2S 3A3OB 2LDYA 4QOTA 2RHQB 3KHHA 1NO8A 3OR1A 4M5DB 1RADB 1J2VA 1H7WA 1WD6A 1NDPA 2V8VA 3O2IA 2AF6A 3TA1A 1EQ0A 2XHWA 1WG4A 1NSAA 1TVRB 2GCFA 4JV5F 5B0DA 3S01A 5DJBA 3H8YA 1N5QA 2DJWA 1SH2A 4B3RF 1N5SA 3OTOF 4NI2A 4F36A 3GLJA 5HBMB 4M5GA 2R2UA 2B7CB 4NE9C 2DGXA 3SQOP 3AA9A 2Q6BA 1KTVA 1GTHA 3M8QA 4TXSA 5I42A 3SZ2A 1RJJA 4RBTA 2PIIA 4IQMA 3KHLA 1REGX 1HBMA 3JSRA 2YQ1A 3PG9A 2HKEA 2A2CA 2H4YB 2QLWA 1BY9A 3GJQB 1BD6A 3EPIA 4YQWA 3HHLD 2VB6A 4O3QA 2R7SA 4F4AA 5D4OA 1UVMA 3G6ES 3MUVP 4A8YA 1UW9A 1RTJA 1X31C 2M70A 5CYMB 2DHHA 5F8MA 1HBOB 1H38A 3UN5A 2KFNA 5EN1A 2PT0A 4V1Ak 1YBTA 2C2KB 3GR1A 1H98A 2D41A 1I51B 3D67A 4E8UA 2JX2A 1I5OB 3Q86A 2HRUA 1KR4A 3I9ZA 3LOUA 1RDRA 3W2VB 2NYIA 2DT9A 2FJAB 4WFAQ 4CLWA 4QIWD 2WOMB 3QATA 4K0KF 1KSPA 2BE9B 5G0RB 3QRQA 1HI8A 2AKWB 3H7HB 4UOCA 1KDNA 4MK8A 5BR8F 5L1JA 2OD6A 2CPJA 1JLCA 1LNQA 3GP9A 3I32A 1F2HA 4IG0B 3ETOA 3L3CA 3R1HA 1AA1B 1FWPA 3T5HA 2QZ8A 2EFVA 4ZP8A 4ZVOB 1ZAVA 4PYAA 4K4TA 1YDLA 3SQGB 2MKIA 4DUYF 3GFZA 3M32B 3OXFA 2IBOA 1F2GA 4OZ2A 4DR3F 2WSEC 1CS4B 2K7JA 2N82B 3M8PA 4O3PA 3VTIA 2MXYA 1T05A 3W7BA 4JI3J 2VDHA 2PGCA 1XIQA 4RW4B 2LA6A 1N36J 4X4OA 1RT1A 2VQFF 1ZZFA 3MEEA 2OPPA 3NBPB 3DI6A 4N5SA 5JVHQ 3W5YA 3ITHA 3UCUP 2HQ3A 3G6YA 2RUSA 4I2PA 2ZD1B 2ASJA 4ZVQB 2R8IA 2V5HG 5C42B 2DRBA 5GAEU 3WX8A 4RKUC 1XQIA 4W4MA 2F7VA 2Y9HA 3TEGA 1N5YA 3H5UA 4WBFA 3OLAA 1ZPVA 4ZJOA 4DV3F 3T1HJ 2KT5A 2DH7A 1C0TB 1U6ZA 4UF4A 2QC3A 2DRAA 4H4OA 1TL3B 3AJ2A 3OVAA 4TU8A 4PEOA 4FDFA 3JQMA 3OT9A 3ET6A 4JYAF 4MFBA 1MW7A 1K44A 4M5NA 3UCGA 4JI0F 3EICA 5L39A 4K4VA 3GR0A 1FJGJ 1QE1B 3FMWA 2EFPA 3EZ5A 4ERDA 2ASDA 1KHWA 3GMGA 2PMWA 1NK5A 2X1FA 4ZVGA 2XY7A 1UJ5A 3I56S 2HHWA 5D0GA 2HS4A 5C25B 2B4UA 3HDSA 4LMZA 3PIPQ 1S49A 1VR6A 2H3EB 4M5LA 8ATCB 1FXRA 2H65B 3G96A 2ZOGA 3NWRA 2W7OA 2R7XA 5KTQA 1HNWF 4C2MA 1FI4A 1FRHA 2YKMA 2WW8A 2MZJA 2CXEA 2VPZB 2V4RA 4ZVEA 4YEAA 4DCPB 1KVKA 1FDNA 5A8RB 1YI2S 4M94A 1X5SA 2FLLA 4JOUA 2VODA 3EE3A 4ZLLA 2CQPA 2DR7A 1NK4A 3D5MA 4DX8H 2E5HA 4IYQA 1U48A 2IJRA 3BN7A 1DLOA 1JLQB 1G6BA 3GSIA 2FJXA 2HNYB 1PJ7A 1RGVA 2VZ9A 2CVIA 1NKBA 4RU9A 2VPYB 3FRZA 2LQBA 1OJ4A 1R3NA 3G86A 4QBUA 2GIQA 5GAGI 1U7LA 2QL7B 3DLBA 3JSMA 3MMAB 3DOLA 2QLBB 1MWQA 2XSJB 3H2UB 3FEYB 3QZ8A 1CJKB 1NRKA 3PRBA 3L4BC 2EEYA 3HT0A 1PYSB 1U1RA 4AL7A 2Z8QA 2OPQB 2X1GA 3HHLA 2HRTA 2PEHA 2Z2ZA 1G2EA 4OZ0A 4HT5A 4DQIA 3DDKA 4PR6A 2VIHA 4MT1A 1S9EA 2MLYA 1XJWB 5F8IA 2HVZA 2B5JA 2AHOB 5DZ6A 2PMZD 1NK6A 1T02A 1NSPA 2HNDA 4JI7J 2HGLA 5HAOA 3OJSA 3L9ZA 3W63A 2V67A 3HULA 3I5CA 3BB5A 2BE2A 1TK8A 4MKBA 1JXVA 2YNIA 3TANA 1W26A 1HW8A 1J5OB 1S0NA 3U27A 3IBWA 3U1MA 3GTYX 1UWBA 2F40A 2NCKL 1Q78A 4FZVA 1B0PA 3B82A 3OSPA 5DM6Q 2DD8S 1SC4B 2ZKUA 1FKOB 1SL0A 3J7A1 3W62A 4RW9A 3QZ7A 1O6XA 1R43A 3M8WA 2Z4PA 3T41A 1KFSA 1KBRA 4USMA 1NMEB 5JUMA 3FGVA 1WG5A 1IM4A 3QWPA 1LWFA 1OYDA 1RWVB 3VAKA 1IKXA 1U26A 4P73A 2UXDF 5M2PA 3KTQA 1RACB 4RW8A 1JKHB 5A2QY 2MQ8A 2N7YA 1S59A 1X4GA 3WQPA 2BKPA 1T95A 1RT3B 1HWIA 2CRLA 2E1MC 5A2QU 2B51A 3MAQA 2YNHA 3I6PA 4WWSA 3BJYA 3H5XA 4ID5B 1U09A 1SV5B 5IC6B 3FBEA 1HD1A 2RDDA 2O1PA 2ASLA 3SCIE 2YX1A 4HHHA 4LF9F 2UU9J 3TZWA 3H5YA 2DEJA 4KHPJ 3OR1B 2BZ2A 3MDFA 4X65J 4X62F 4FBTA 2FJBB 2V9KA 2QYGA 4WK1A 4HEA9 1NUEA 1XEZA 4DR4J 5D0EA 3Q8VA 2C1EB 5BYQA 3E3XA 2JOQA 1VHIA 4OX9J 2HK3A 3CVKA 3LAKA 2VPWB 2IRYA 3V6DB 4YB1P 6AT1B 3IGVA 2JLFA 1UETA 5LM7E 4NPOA 3IXQA 2V4QA 4FPIA 5F41A 4NI2B 2DIVA 2R9LA 4J9MA 2MYFA 5L9NA 4Y2IA 4CWBA 3M8QB 4J9OA 4J9QA 2F9JA 4KO0A 5EWEA 1X60A 1HBMB 4JI4F 2OIHA 3M1VA 4KGXB 4W92B 3CCTA 1CPZA 2MJNA 2RQMA 1F9HA 1H7XA 1RTHA 4IUFA 2DITA 3GJTB 4JV5J 3I0RA 3X3UA 2BXJA 2CPEA 1TL4A 3R5JB 4DV2F 5CCLA 3NNAA 4F8RA 4B3RJ 3OTOJ 4DXLA 3C6UA 1RTJB 3KMSA 5F0UA 4JI2F 1HBUA 1TAUA 1RCXB 3K0JA 1AYEA 3R6GB 5HJXA 3DRYA 2ZOFA 2MQMA 3IM9A 3AOBA 1BE4A 3QSIA 5LMUJ 3MM5B 3VZIA 3HFZB 4B3MF 2BRLA 1YJWS 3KDNA 2NR0A 4JB8B 4KRWA 3GYGA 2F4VF 1PCAA 2BANA 2AP6A 2W24A 3DXSX 5HJYA 1CJTA 4MIAA 3QIDA 2KM8C 4X4RA 1DURA 2ZJQQ 3IWXA 1NLKL 2IHR1 2M4MA 1JLCB 1B64A 2RF2A 3R27A 3AD7C 3DC2A 1BMQB 2JWNA 4H54A 3BREA 1NKCA 4F2SA 2DGVA 3EGNA 2DPJA 4OYMA 3VGTA 3IP0A 4U7UD 3CDAA 1X0PA 1QDUB 1Y9OA 4ZS6A 3HSJA 2YWEA 3D3BJ 2VBXA 3SV3A 2L48A 3D1OA 4ECTA 3M8PB 4DX7A 3KYLA 5BR8J 1T05B 1G1XA 3TP2A 1FX4A 4KFBA 2ZHAA 5J2QA 3H40A 3MEEB 2OPPB 3ITHB 2GMHA 4QWEA 4CLSA 4PG7A 2MDAA 4DUYJ 3AAWB 4I2PB 1RT6B 5HO4A 5IT9Y 4OZ5A 4IQXA 4PCQA 3FBCA 3CMQA 3JB9k 1WJ9A 4DV6F 2NPIA 5IT9U 1VLOA 2IVMA 2AJ2A 1REVA 1D8YA 3FCHA 3ZTSA 2DRDA 5KFMA 4MFBB 3GU0A 1SQGA 2VQFJ 2C3PA 1GX6A 2XS2A 3SCJE 4F0MA 2EFQA 1T9WA 2AYMA 4OLOA 4MIWA 1RHJB 5KFPA 2V8HA 2HFOA 4V19X 2Y8YA 3JYTA 2GHWA 2CQ4A 4C8LA 4B9LA 4ZIVA 3J7Z5 1HIYA 1Q95G 4F4KA 3NOGA 4K4XA 2DBBA 3C3LA 1KP6A 1RAHB 4OYZA 4OI6A 1YQHA 2E1PA 2NLWA 5DZ7A 4LFAF 3DOMA 1ZH5A 4MYUA 1FNXH 2YKMB 4JYAJ 3CCJS 3MTJA 1N33J 4KV8A 3C6TB 3CD6S 3LF0A 2C22A 2L41A 4WYLA 2KH9A 2MSTA 3LP1A 5M2UA 4FN5A 3QSYB 3RW7A 4Q0BA 1QSYA 3EGZA 1DLOB 5AJ3F 2XYPB 4DG1A 2DO0A 4BWMA 2X7IA 3ZZUA 1S0MA 2C2MB 2MZTA 2CJYB 2BRKA 3PY8A 3GILA 4C8OA 2DNZA 3D6HB 1Q4RA 5J1PA 2VJVA 3DOLB 5K14A 1SJ3P 3KK1B 3FZ2A 4ZVTB 3QAUA 4CO1A 2DR9A 3QNWB 2D74B 3CJ5A 3FVYA 4KHRA 2ZE2B 2QMWA 4TYBA 5KOXA 2POKA 4DCJB 3MF5A 4CO0A 3IGNA 4ZPTR 3PKMA 5L9XA 2MKKA 3RZAA 4ZVRB 2G0IA 3LAMA 1X7VA 3THPA 4ZKAA 5D78A 1ITPA 3A8IA 3SSRA 2CPDA 3N28A 4LR7A 3DFEA 3CE8A 4DV1F 3PW2A 3WX4A 1D9AA 4N76A 2YWFA 2WONA 3EVMA 3MPYA 4I69A 1Q8KA 2ZH6A 2XCPA 1BQMA 3GG1A 3G8TA 2C3MA 3K5LA 2J8SA 4ILMA 4B02A 1FVQA 2DHGA 2DR5A 2VC1A 2YNIB 2XG8A 2D9OA 4KYZA 3U7JA 1UWBB 2R3VA 2F9DA 3GZ7A 1B0VA 1LXNA 4QQBA 1C2PA 4NXNF 2XWXA 4NLSA 1U2RA 4KE5A 4NYPA 1IR2A 2AX0A 1F0XA 3VGUA 3LPYA 4RW9B 3OFEA 3HO1A 4J90A 3WC0A 1Q0NA 5KG4A 1LWCB 1BQNB 1RU2A 4OYOA 5KFDA 2LXIA 1N32F 3RU0A 3TUPA 1JIHA 3D7SB 4LSLB 5IM0B 3NRBA 1S4EA 1IR0A 4J9SA 3ZC4A 3IBCB 5ETRA 3AFGA 2IRUA 4R5PA 2CIMA 2VV5A 3MMCA 3T5KA 2YBVA 1LWFB 2ZM6F 3CDUA 4L76A 1TL7A 3HVRA 2XYGB 2QE5A 3HI9A 4JI1F 4RW8B 2KG0A 4DL7A 2YNGA 3DU5A 1P1TA 1H0HB 1KHVA 2HNZA 1M5PC 3CWJA 4CI0B 1I3OB 2HBYB 2YNHB 1PJ6A 1HQUA 5EUHA 1SJQA 3SBMA 4I6YA 2HZVA 3IM8A 4TKTA 2R7OA 1EHWA 3M6VA 3WDOA 4IFVB 3SMZA 3RBEA 5T7LA 3LA0A 1UPPA 3M6UA 4ILLA 1CULA 1R8CA 5KT5A 1R0AA 2J8AA 3PO4A 4NLQA 3FBBA 3S8SA 4WZQA 1TKDA 4KTQA 4ITSA 1Y3JA 2OMLA 1IBLJ 4WU3A 3M2VA 2MQQA 5HI7A 3ZZRA 2PC6A 4J9NA 3ZTPA 4Q2MA 3UDLA 4EBDA 1YG0A 2VD3A 3P5TL 2H9ZA 5E33A 4MKAA 2R2RA 4CLKA 4LF9J 2BEFA 1SJRA 2DVIA 4PABA 2N3OA 2F63A 2B9YA 3FEXB 2HBRB 2KFYA 4X62J 1VC5A 2ZBCA 4KO0B 2HFZA 5L8RC 4Z7YA 3M1VB 4HLBA 1JLAA 3NAHA 1R7IA 1RTHB 2MY7A 3CDBA 2V94A 2IM3A 1JLEB 3I0RB 2IM2A 3HXMA 2ROGA 4UTGA 2BA9A 4G1IA 2EC0A 5FIIA 2DH8A 2LEBA 1D9DA 3RAQA 3C6UB 2ZOMA 4MYTA 1AW0A 1CC7A 3K17A 3EZUA 1HBUB 3GPAA 1KQSR 4PAAA 1FRLA 2BUNA 4NCBA 2C2RA 3TZZA 2K3KA 5BXIA 3CIZA 4LJMA 3IG1A 4A8FA 1R0CB 4X4QA 4ECWA 4DFMA 3FNNA 4ED4A 4ED2A 1C1CA 1WC0A 2ROEA 4LF7F 3TZYA 2BANB 2PSZA 2IFXA 4KB7A 3TRGA 3OFGA 4YB7A 1CJTB 4ECRA 4M5HA 4DU8A 4NWBA 4JI2J 1T3OA 1QLNA 1N0VC 2XHCA 1HQEB 2M88A 4B3OB 2RAQA 2RF2B 1VIXA 3P4UB 4GKJJ 3D6FB 3W64A 5LMNJ 2MLXA 5KFIA 5EGYA 2B6AA 1UVLA 3IS9B 2J76E 1D8ZA 1UZDA 2Q3PA 3MAHA 2F4VJ 3RJMB 2BV3A 1UFLA 3M2UB 3EZOA 3OLBA 2EC2A 2EVZA 2WVDA 1O0PA 2FYXA 4JI6F 1ZS6A 4Q8FA 3DGPA 2E7VA 3H2LA 3J80Y 3UN2A 3FFIB 4KFBB 1YJVA 4OX8A 2E7WA 4ZCKA 5A0YB 5J2QB 5KG7A 3J80U 2LU2A 1JLGA 2AW0A 5JMNA 5IWAF 1AUSL 1PAEX 2VOOA 2KDOA 4WTYA 4RNHA 1UAWA 4A8MP 1EQMA 3RGIA 2PFDA 2RMLA 3BH7B 3DRPA 2J9DA 2WSFC 1H3DA 2HQDA 4XTTA 4YY3F 4ZHRA 2GO9A 2FHOB 4F26A 2BYCA 3CCZA 1NHUA 4ANCA 1B0TA 2R7UA 3VWSA 2IMOA 4DV0F 4NA1A 1Q86T 3PDNA 4PWWA 1FXLA 4P6QA 2WBMA 1BC6A 2CUYA 3ENAA 1WC6A 4WFZA 2F8MA 1NJWA 3EWGA 4BC7A 2WVCA 3HHLC 3JYTB 1VRQC 1FEHA 4DUTA 2BBEA 1DHMA 3Q2TC 4Y00A 4X64F 2DNPA 3V6JA 1LXJA 1VQ4S 3BPDA 4PXDA 4PG4A 2ASYA 8RUCA 2I38A 1R8PA 5CABA 3DOMB 4A8KA 4F4ZA 1N5TA 3MGJA 3T1YJ 3BQ0A 3UCZP 4KV8B 2D3ZA 3H20A 5KFQA 4ZPCA 2XTJP 1KLNA 3AXKA 1FJEB 1P1LA 1L3KA 3KUHA 4ZOSA 1U45A 1BWEA 4Q0BB 3W66A 4ECVA 1HHTP 3GIJA 3G8SA 2DGOA 4M5IA 1FK9B 4DG1B 3N6NA 3CCQS 1K73T 1RHKB 2NXNA 1H2UX 3OL7A 3NS7B 4KPYA 4LFAJ 2CJQA 3RAXA 1S12A 3VV2B 3T1AA 5K14B 1U1PA 1CLFA 5F8HA 4FYDA 2IA0A 4EFAC 4IOCQ 5SUHA 3A13A 2JC0A 3PIOQ 2AJ4A 1ZM9A 5SZTA 3IR5B 2W25A 5AJ3J 4NLPA 4KJIA 5DLGA 4Q45A 1T7PA 1X4AA 4CO5A 4BHQA 4QYZK 3LWMA 3AJ1A 5L1LA 1AFIA 1KKHA 3H2VE 3V81A 4QWDA 2V8PA 2WONB 3SEOA 1X5PA 1RE1B 1BQMB 3QT5A 3CJKA 2AYBA 1FJCA 2E29A 3D6MB 1FWKA 1NAQA 1S7HA 3UO0A 4OIXA 4F0HA 4PRFA 3K59A 4QYZJ 3MXHP 1GNKA 3QPIA 2UVRA 1FO1A 1K8AT 1K0VA 1SL2A 1CJUA 3W65A 2M7SA 3HD1A 3ZZ0A 4DV1J 4C97A 4IRDA 2ATCB 3I87A 1Y4ZB 3UR3C 4ZCIA 2CFXA 4HTIA 4DSEA 2Y1LB 2FHJD 3RBXA 5KG5A 2P8IA 3TW0A 4PG5A 4WE1A 4K2JA 4KT0C 3UNGC 4J9RA 4OZ1A 2DCUB 2ZNZA 5H9FJ 5KFZA 4R5PB 5A8WA 3D3CJ 4DI6A 1EJ7L 4AXIA 3V4IA 4DR6F 4ZIWA 4EO6A 4CYUA 4USJC 3KUEA 1TL7B 3DRRA 3HD2A 4NXNJ 1NXIA 5CA5A 4N56A 3OTCA 5DGBA 2YNGB 1S7IA 3ENQA 3I9V9 2NYHA 1OMSA 4LRFA 2LQ5A 1N32J 3BS9A 3A3PB 1HQUB 4DL3A 1WC4A 4ALZA 2B8PA 2VU5A 4LIRA 2ZNYA 5KFUA 2HHXA 4PWDA 1Q8BA 4P7VA 2ABYA 4MK7A 2QA4G 1X4EA 2GHVC 5E3CA 1VRTB 2RS8A 5D4PA 4LRBA 1JLBB 2AX1A 5T7LB 2ZM6J 2HVIA 4AD6A 2FJEB 4QIVA 5H9EK 4URGA 3C66A 1QUPA 1R0AB 2XLIA 4JI1J 2YKOA 1S10A 2W4DA 5E3AA 1AZSB 3CCUS 4DLEA 4NYZA 1WC3A 4Q5VA 2ALZA 4DBQA 4NASA 5KOWA 1URRA 1H74A 3PRDA 1MU2A 3M2VB 3T5LA 2HGMA 4ED6A 1WSRA 1S6QA 2JVRA 2EI5A 2ILZA 3CJQA 2N4CA 3FJ2A 4LF4F 1L3TA 4USKA 3T6BA 2HHHF 3ZXWA 2XMUA 2FGCA 1VI7A 1ICEB 1NH8A 3H4BA 1V6HA 3NGSA 1UEUA 3R5AA 4I2QA 3BSCA 2HAIA 3IFEA 1KVJA 3V6KA 1H2VZ 1VQ8S 3KJFB 1JLAB 5CYQA 1Y3KA 2HLUA 3M9NB 4AYBD 1IKWB 2HLTA 2VFTA 3B54A 4CQ1A 5HL7Q 4O4GA 4ID8A 2ZVIA 4OI2A 2BQUA 1WHVA 3IO1A 1VS3A 2FZCB 3SYZA 4I7FA 1U49A 3Q8PB 2OSRA 2GQCA 3FCWA 1GH8A 2LEAA 1KD1T 2ZZNA 1OS5A 3E51A 5D0RA 2RQ4A 1RAJA 4JV1A 3MEGA 3ENVA 2YX7A 1EETA 1C0UA 3IG1B 1WG1A 1RWOB 1ZM4A 5KFNA 5ETPA 2W4PA 3QFWA 1TZ0A 2L08A 4DPWA 4E2FB 1Q79A 1C1CB 4QPTA 1WORA 3DLGA 2GJIA 1Y5IB 3BBFA 1KOHA 3PRVA 2RT3A 2DNOA 5HMWA 3R7SB 1UVNA 1PAUB 2EK1A 3MD3A 3UVJB 3KK2A 4ZPWR 2HIQA 1ELOA 2RU9A 4M5DA 1JXLA 1VQ6S 1EIYB 4CP5A 4IDKA 4M5JA 3OXGA 1M1HA 1OY9A 3M9OB 2UXBF 4RWWA 2B6AB 1U1OA 1WEZA 2LEPA 3TJAA 4NLWA 1W25A 3I55S 2MTLA 1PKUA 2K06A 4DMZA 5DM7Q 3PZPA 1F3VA 1RHUB 1N54B 4GRSA 2KHCA 3CXCR 4ZDNA 2PMHA 1NJIT 4CO2A 4LFCF 3A8JA 3DGPB 1RLCL 2W2MP 5BJRA 2NREA 1WDTA 4EYHB 2V2QA 2MQLA 2DR8A 5LT5A 3EUNA 2QGFB 4WCEQ 1S99A 2FQQB 2U1AA 3VVTA 5AE1A 3QBCA 3GV7B 1JLGB 2FHJA 5FDLB 4Y3CA 3HSGA 3M6WA 3PYGA 3EMTA 1KFDA 2DPIA 1W2BR 4CNZA 1VYAA 2ZZTA 2JLEA 2YX4A 3DRPB 3J81Y 4DF8A 4MKVA 2QMUB 4JI6J 4CTAA 4ZHRB 3HFKA 3AB4B 1SJ1A 3VGSA 3D4JA 7FDRA 1TKXA 2OKQA 4OHYA 1SCJB 3MFIA 1U24A 2ALYB 3K7RA 1RB0A 1V5IB 1DQ9A 2XULA 1YBAA 3DLKA 1TTHB 1CBKA 5BYRA 4IR9A 3PYDA 3TNVA 1Z1ZA 1TUVA 3D0GE 3W8GA 4IKAA 5KFSA 3DLEB 2FVRA 3KLIA 3DHXA 5FLXY 4W90B 3HSDA 1BQXA 1QSLA 5G0RA 1R8HA 2A0FB 2MHNA 1E6VA 3GCWP 1TU0B 1CG2A 4I56A 4YY3J 2VBZA 5FLXU 2CQGA 2V2VA 5LJ3Y 5C2GA 1CJVB 4IG0A 2OEMA 4XDDA 2HPUA 7FD1A 4DV0J 2XS5A 4KGMA 2VFUA 2LLZA 2UUWA 3D1HA 3SQGA 5DDRC 3NS5A 4PXEA 3VAFA 3IBFB 4IH6A 4CLUA 1OYEA 4X64J 2DTJA 4CCHA 1CS4A 4F67A 1NSQA 2WAQD 3EXCX 4L6V3 2QYCA 2RE1A 4YS2A 1NK9A 2H5EA 3M8YA 2MKSA 1MN7A 1SKSA 4XPCA 1WEXA 2HWHA 2QA2A 3G9CA 1GXUA 3TVKA 2AEJA 1RKIA 3KG1A 2YWWA 4FS2A 1TMJA 3UN3A 3MTKA 2P2CB 3FRYA 2RUGA 2HFUA 3BGLA 4IOAQ 2XC9A 4P72A 4ZVFA 3GIKA 1RTDB 1N8RT 1C0TA 3V81B 1VHFA 4RUHA 4B9NA 3EM1A 1TL3A 1PO6A 4NYOA 2C2EA 1WEYA 2KFZA 2L3MA 2GA7A 3ZFVA 4WP3A 3CJKB 1B3TA 4XAKA 1VK3A 1X4FA 2QSWA 5CCMA 2DGUA 3ISZA 1QE1A 3THTA 2CPYA 1KN6A 4NZ0A 4TN2A 3TOQA 1T03A 2NQPA 1RUSA 3TA0A 1WKJA 1UVIA 4TU9A 3MM7B 2WCXA 2W2OP 2PEBA 2ZDPA 2FVPA 1RYRA 5AE3A 2J0QD 5KFFA 1FWLA 5DQHA 2Z2MA 1D3WA 4ZCLA 2MKYA 3RTVA 3QT8A 1CJUB 1FESA 3DOKA 2JEIA 2DHXA 4S0MA 2MKJA 3ZZOA 2CQDA 1NDKA 4IO1A 1JLFA 4P2XA 5A8RA 4PQAA 2VG5A 5B0FA 1FD2A 2GGPA 4D3GA 4KGVB 4DR2F 2NZ4A 2D9PA 2V2KA 2X3DA 1HLWA 3CJ8A 2KKHA 2W2QP 4HH0A 3V4IB 5LXYA 5GMDA 4WFXA 4CYUB 3PXGa 1ZAXA 2OTJS 1PSDA 3DRRB 1KNZA 3TWZA 2JSXA 4NL5A 1N88A 3VCDA 3PJXA 2VFRA 4OHZA 4LVNP 1KQFB 3QMQA 2EBGA 3UD4P 2AEMA 3KNAA 1CQMA 2HFVA 3OW2R 1ZOTA 3SIPB 2KI2A 3EGWB 1RBLA 3QLHA 4X4NA 1NDCA 2BX6A 4PWDB 1VBZA 4DR1F 3PVXA 1GT8A 2W8KA 1HNIB 2BQ3A 2VKRA 5F9NA 4DR6J 3Q8SB 2HAFA 4DSFA 9ATCB 3RUBL 4LF5F 3LTOA 1UJ6A 3DLLQ 3PJWA 4AXJA 2GZOA 1X5TA 1RP5A 3HKWA 2ADCA 3J7AN 1TKTB 3SCLE 3ILIA 3N01A 1IWGA 3HKZD 4HTJA 2JEJA 1MMLA 1JJHA 3UW1A 3CCES 3DM2B 3KLGA 4NX9A 1MU2B 4DSLA 1HNZF 1NHVA 2GV1A 4Y34A 4OJ1A 1S6QB 4L74A 3A3NB 2IMWP 4KY3A 2BJ7A 5E7OB 3V2UC 1HWUA 2LVWA 2VQEF 4HDGA 1N34F 5G4DA 1TELA 2BKOA 4CIOA 3M05A 4MH8A 1VQ5S 1B7FA 3W9JA 2N3LA 4DEZA 2E1RA 3QT6A 1CSJA 5ETSA 1GXTA 4NLRA 4C8NA 1PIEA 4I2QB 4DPXA 5EDWA 5CYQB 2L9DA 4P2FA 3OL6A 3VAJA 3PTWA 5B0GA 2FD2A 3QJPA 4NLVA 3MCMA 3TJ9A 4O4GB 3RG6A 4CM2A 5L1KA 4DSJA 1UA0A 4I7FB 1WKKA 5EHHA 1WF1A 3NKYA 2BJ8A 3AQPA 1XK8A 3D66A 1FF2A 4LF1A 3LGMA 1JKHA 3N6LA 2YKAA 3MEGB 4DHVA 5K8PA 2AD9A 5KT4A 1EETB 1RT3A 1C0UB 4LREA 4CLYA 3CEDA 2UUBF 4O3OA 3ISNC 4NZ6A 3U1LA 4DOZA 2KXNB 4NCGA 5ETKA 3JQJA 3DLGB 4ID5A 3R8YA 4WFBQ 2HVEA 2DHSA 4NCAA 3VGVA 2FY8A 1QY7A 3BO2A 1X9WA 1AUDA 2COLA 1S6OA 4DV5F 3BKFA 1JK9B 4RNOA 4XDCA 3KK2B 4EUVA 1QSSA 1X4DA 3NS6A 4L75A 2IRXA 1HD0A 1YSJA 2YKNA 4IDKB 5C2CA 5KFCA 2F8HA 1X8DA 4NRTA 2DKOB 4I6AA 3L09A 2Q43A 4BBYA 4C3LA 3EVOA 3UI3A 3N79A 1ZETA 1DTTA 3NGRA 2ZH5A 5KG1A 3MFHA 2K7KA 3V6DA 3NWGA 3CT9A 5IV3A 2FLOA 1IJFB 1LW0A 4CNYA 4PG8A 2XZWA 2J7KA 1H6KX 1YRXA 5HP1B 3DDNA 4PQUA 2BJ3A 2FGOA 2V68A 5CD4A 4R0JA 2MKCA 3FDSA 2YY3A 4F2RA 4ES3A 5F3ZA 2BR0A 1SIWB 1SL1A 2APOA 4KH0B 3Q22A 4MJKA 2UXBJ 4GC7A 2B9XA 4GO5X 1YJUA 1TAQA 3UR0A 4YP3A 3GIIA 1TR0A 3GFYA 4A48A 2J0WA 1K0TA 3IRWP 4RUAA 1RHRB 5ETQA 2CG8A 4NOHA 3CJ2A 4O44A 5ETMA 3ZNUA 3HVAA 4DL0C 1UZHA 2K3IA 2DY9A 4CTAB 4LFCJ 1Q1KA 2ZBPA 2KN4A 1TKXB 3CTRA 4RUBA 4HHUA 2NXJA 2HIYA 2HQFA 4EMDA 3LPEA 2E1CA 3MM5A 1M5SA 3DLKB 4NMLA 1VQYA 3NXZA 2XZTB 1U2CA 1FCAA 4A8XA 5KFVA 5KFWA 3T9ZA 4ATNA 2ZVSA 2MB0B 2IBKA 2Y3YA 1G4CA 3K5NA 3QIPA 1U0HA 2ZC3A 1LFWA 3KLIB 4EZ9A 4DX6A 2QT7A 3NLCA 1Q8LA 1FRMA 1E6VB 1FX2A 4BDPA 2C2NA 4U8VA 3R7NB 4C3KA 5DDPC 1RCOB 2BACA 3MR3A 1JB0C 1WHXA 1HNXF 2QTWA 2B0GA 4DL2A 3PACA 4CZCA 4NXMF 3IA0A 4J37A 2FIUA 1TK0A 1QVGR 5LSLA 3R7BB 2G9OA 4ECZA 1ZPWX 1X5OA 4NMXA 2P6TA 2CZ9A 4ZP9A 2FJVA 1QAXA 3V6HA 2OEJA 3L7OA 2IJNA 2YNFA 2HVDA 2KT3A 3VZHA 3GJSB 1URNA 2IDEA 1S76D 1T9VA 4GC6A 4OHWA 1SQFA 1YWXA 2NZCA 5KG3A 1A6LA 3DXBA 3PNIA 3MR2A 2XY6A 4ES1A 3G82B 2I9SA 4Q7AA 2EG1A 3CO9A 1X4HA 1U6BA 1RT2A 2H48B 1JQGA 4F50A 1YRUA 4LF2A 2MHEA 1RT6A 1K1SA 1S48A 2R42A 2DNNA 1NPKA 2VONA 3O44A 2HW3A 5ADZA 4Y6IA 4EYIB 1HWLA 3TAQA 3SDEB 2XMTA 3LGNA 3DU6A 3CPWR 4UOFA 3G6XA 4LBPA 1D1UA 1YK9A 2MZRA 1S1UA 3FQKA 1RWKB 1VJWA 4DQSA 1QTNB 2CQ1A 1Z2LA 3GIRA 1ZBTA 2Y0BB 2KYZA 3M9MB 2JFDA 2JLGA 5DG8A 1XMQF 1J27A 2BJ9A 5KAKA 3AY0A 1JWWA 1T03B 4D3HA 2YTCA 4DPYA 2R8JA 3K5OA 1I1GA 2YWGA 4OJ3A 5K8MA 3CUNA 1XNRF 2Z30B 3HJVA 1R0BG 1RWMB 2CZ4A 3C14A 3DOKB 1H2TZ 1I94J 4A4JA 2VJUA 3B8HA 4P7TA 4DQQA 1GK8A 2GQ2A 2QV6A 2HRYA 1CVJA 1RAOA 5D4NA 4UZBA 3C6TA 4IG3B 2CADA 1JLFB 3I96A 2VG5B 3GB0A 3TQEA 2GGPB 2CWXA 2NSCA 1WKLA 4YR2A 2XEXA 2QSFA 2DNHA 5A8KA 1SXLA 1DTQB 3S1TA 3B4MA 4O3SA 4OI1A 5IQQA 4DR5F 1GFWB 4LIWA 5JJBA 1DAXA 3ICLA 2R8GA 5DQIA 3MM8A 2XB2D 1SB6A 1MNEA 1RAAB 4FP9A 3KK1A 2KTQA 2ZE2A 4H4MB 1WSVA 2LKZA 5CD4H 2W2PP 3FC9A 3MAAB 4TQSA 4C4WA 3VR1A 3GYXB 4ICLA 3GIMA 3QLHB 2HHVA 4DR2J 1LW2B 3BEGB 1S1VA 4OYXA 2VA2A 2W9BB 1SUQA 3BDPA 2Q66A 1RXOB 4W98A 1XTZA 3OR2A 1TQLA 2G2OA 4AUKA 4WJBA 1YJ7A 1NEEA 2XZDB 2JC1A 1SC3B 2CDRB 2V69A 5CAAA 3MPUB 3CJRA 4OMFG 4ED0A 4OZJA 2GHPA 3U1NA 3KLGB 1QTMA 3IAM9 3MM9A 2QFJA 2MSSA 3PCOB 1Y5NB 1LWEB 1HA1A 3A12A 3TVZA 2VHGA 1CEZA 3HVTA 4DR1J 1HYSA 2GMLA 3BGOP 1DZ5A 3ZTRA 2ACMA 1V3SA 1PILA 2E66A 4LF5J 2KXFA 3BSAA 3SSSA 1IN0A 3HJFA 2CYYA 4O23A 1Q5YA 5IOLA 1IR1A 5IT0A 1RSCA 2N4DA 1FDBA 4OV1A 3J7YU 4EGLA 2YH1A 4QJVA 2FC9A 1LWCA 1BQNA 2OD4A 4RNNA 3P5BP 2QO3A 5GMEA 4DSKA 3EYZA 2C42A 4LSLA 5IM0A 3RBDA 3SCKE 2KZMA 3UDCA 2VFSA 3QGHA 2UUCF 4WFYA 4Z7CA 3MMBA 2VQEJ 2LDIA 5I4MA 1N34J 2LYVA 5KT7A 5GADI 4B9SA 4FS1A 2O3DA 2YPYA 2C2OB 1O8BA 3BYPA 5ETVA 3MCOA 3NGDA 2QX0A 5C24A 3CD7A 4CH7A 4B9MA 4P71A 1ZA2B 1T11A 3F56A 4X4PA 3MR5A 3PEJA 1KOOA 2XSFA 3PX6A 1QAYA 4NCGB 4JI3F 3RB0A 4WP8A 2M9KA 3HPOA 3SFGA 2QA4S 1N36F 3JTNA 4IFVA 1NBEB 2VASA 2FY1A 2CPXA 2JDJA 3N5BA 4U67Q 2KZZA 1JNRB 2FZGB 3QO9B 1EKRA 4P10A 3W61A 3BGFA 3OTBA 1F60B 3H98A 2YKNB 5F8JA 2DO4A 3QAEA 1BHNA 4HVZA 3GFXA 2GMJA 2B4OA 1DBDA 2UUBJ 1DTTB 5E5NA 2IJFA 2W01A 3N5FA 2DIUA 2EK6A 4LSZB 3JAMY 1NJZA 1HKAA 1LW0B 3CO0P 2JNJA 4DV5J 1A9NB 4JI5F 3RBZA 4YHHF 4HH1A 1NPPA 4PQUB 3MCNA 1UVKA 5D4LA 1G3OA 2ZHBA 3TARA 4FVMA 2O01C 2OUGA 5E3QA 4KGZB 3HM9A 1F1BB 1Q7LB 3NOCA 2GVZA 4CO4A 2W1BA 2HHPA 4DL5A 1JLEA 4K8RA 2HS3A 2M3DA 4RWXA 3QGIA 2JEFA 2NXUA 2B8QA 2CZVC 1S5ZA 1IBCB 5AXLA 3TUZC 3QJJA 4I67A 1YZ7A 2VFVA 1FA0A 5F3TA 4FVCA 5HATA 4HACA 1RA6A 4X84A 4O44B 3BF4A 2EFOA 4WKYA 2OSQA 4TY9A 4N41A 3R1LA 3G6VA 4CLLA 3R97A 2OO4A 3CMAS 5A6WA 1U6FA 2VG6A 3KHGA 2CKWA 1AXQA 1VQKS 5J2PA 5DQGA 3HHDA 2C3OA 2XQCA 4RU2A 2ERRA 3HFVA 3Q24A 4CO3A 4F25A 3AD9C 4CLFA 4KQZA 4B3TF 5CYJA 5H1SV 1SVDA 2FVQA 1R89A 4IRCA 3QIPB 1U0HB 2BW7A 2XMMA 4R8UB 4ZN3A 4QIFA 5K5MA 5D3GA 1SI9A 4K4UA 1UEVA 1HQEA 1W2IA 4B3OA 2OPSA 3NGUA 4DL6A 1EP4A 1MWZA 1B99A 3PW0A 4CDIA 2FVSA 4RNFA 3JXOA 2IIHA 3IC1A 3IS9A 2R2TA 4FNHA 3JTOA 4MK9A 2VBYA 3KG0A 4ILRA 3KFWX 3W1YC 3M2UA 4K0KJ 1DRZA 5A6PA 2OJ3A 2YNFB 2G4BA 3ZTOA 4F4YA 3ZZTA 2HG4A 2NPFA 2YVSA 1RHQB 4X4TA 3UPFA 1K9MT 3VAMA 3FFIA 2D69A 1HNXJ 3I4HX 2QFIA 1NB7A 3HF5A 3NEKA 3PV8A 5LSOA 4FKYA 2BW2A 5E3PA 5A0YA 1NZ8A 3ZNJ1 4LBIA 3CCSS 2AV5A 2JRSA 3CJ0A 5D77A 1RT2B 3VVUA 2XS7A 1WOPA 1FFWB 4EK2A 3PFOA 1PYTA 3TVYA 3E01B 1KRPA 4ANDA 4DR3J 3N4WA 3DRSB 1AT1B 2WTFA 2H1YA 4FXVA 1MWYA 4MIBA 4CT8A 3SFUA 7AT1B 3GG0A 3H5SA 1XR5A 3CDWA 1U8WA 3U02A 4DX5A 3OHBA 2V4JA 1S1UB 5GAHI 1WC5A 4WKRA 4OX7A 3B78A 5HROA 2GJFA 4NLTA 2A1BA 1FEEA 1NHKL 2J9EA 3DRXA 4DS4A 3KOAA 2HURA 1RT5A 3CW2C 1QD1A 1Y11A 3DGVA 1HFEL 4Y2MA 4OL8A 5B0CA 2ACYA 3DYAA 1U2FA 2DNMA 1HPZA 5HMZA 2GIFA 2WBRA 1VQPS 2ZJPQ 3W5ZA 1FTRA 4DV3J 3C14B 3QJLA 1X0FA 2PE8A 3BO3A 2PFFB 5BYSA 1VMBA 1HW9A 3NP5A 4EWTA 4JI0J 4V19J 1XMQJ 1KS2A 4OI0A 1VBXA 2OTLS 1RABB 3JTPA 4FYYB 3NCPA 4IH7A 1JJCB 2RH3A 5KFYA 3IMQJ 2HZCA 2I8EA 1TUGB 3T6JA 5HANA 2J6SA 3H0PA 1FK9A 5A8KB 5B0BA 4LFBF 1XNRJ 3TA2A 2OLWA 2XBPA 2YQ0A 2ADBA 1DFDA 4F3OA 1FVSA 1HNWJ 3I0SA 3MR6A 4USWA 4AQYF 1UA1A 5K8OA 3MM8B 2D3O1 2BKNA 4DQRA 4OV6A 2GFFA 3UNYA 1OPIA 4ICLB 1A0OB 4M5MA 1VOMA 2GAHC 1S1VB 5AXKA 1OWXA 1SUQB 2CJBA 4DWIA 1YITS 3MEDB 4FYXB 3RR8A 1S1WA 2DNQA 4DR5J 2K2PA 1RK8A 3OR2B 2ZUGA 5MAOA 3BR8A 2E9ZA 4KSEB 3WHIA 2RHSB 5DGAA 4ECYA 4ELVA 1ZM3A 3ADAC 2HYIB 3MM9B 1YJNS 2LFVA 2MY8A 3FSYA 2AJQA 5CZVA 2HS0A 2QN6B 2QLFB 8AT1B 1AB8A 4PWUA 3HVTB 1HYSB 4JBCA 4RX6A 5LMUF 1VQOS 3AHPA 2HK2A 4J9LA 3K8WA 2UUAF 5HK4A 1VISA 2OHDA 2X51A 1UFKA 4TYAA 5HVFA 1RU1A 1XBWA 1U02A 3KDOA 3VAGA 2RQCA 1RWXB 3Q8RB 6FD1A 4UW2A 1OSCA 1TV6A 2NUHA 1N48A 4F02A 5IV4A 4FF4A 3KUGA 1NNDA 3KXDA 4FBUA 1V3RA 4UQGA 2YWKA 1FE0A 2Q79A 1HQ2A 5IXUA 4OYWA 4A8WA 3BR9A 4JV2A 3MMBB 2ZH1A 3PYEA 3D2WA 1YTYA 3HHNB 4ETZA 4RW6A 1U1LA 2LQ9A 3L7PA 2VH7A 4I6WA 2C28A 3UE2A 5C24B 5KFJA 1P9YA 1LK5A 2C2DA 2AGOA 4N77A 1FT8A 1E6YA 1SQEA 4JV0A 5KG0A 2VBWA 4LQ9A 2CPFA 4AT1B 4P2SA 4O3RA 4DR7F 5B7WA 2AYGA 2BQRA 2E9TA 5CHCB 1WWHA 4Q44A 2UUCJ 2OP5A 4A46A 2JFKA 1FXDA 1VRTA 3CD0A 1JLBA 4X4UA 1LQ9A 2UXDJ 3DKDA 5DETA 1L3VA 4DZDA 1UCNA 1NK7A 3VHQA 1AZSA 3W2WA 4ED3A 5KFEA 2X1AA 5DLFA 2BOPA 2NSBA 2UP1A 2XO6A 2V63A 3BGUA 1IWAA 5MLCV 5E41A 4CT9A 4IFYA 5J2MB 4B9UA 3EDQB 2QLXA 3A8EA 4HKQA 1VQMS 3C46A 1I6JA 1FRXA 2E5JA 4G1PA 4X4VA 4ZP6A 1UP1A 2VOPA 4F4XA 4OFZA 4HDHA 4OQJA 4NLOA 2RQKA 4WK3A 2CPIA 3CGIA 1B4SA 1SBRA 3HHKA 2KM8B 1IKWA 2GVZB 1M0SA 2UVWA 4TLQA 1ACMB 1S57A 2CVEA 4DDFA 1RAFB 3CJTA 2C2ZB 4ECXA 3CC7S 2X3GA 2GAGC 4J7CA 4M1KA 4OI3A 2V6AA 3DLJA 2H5IB 5EX0A 4HACB 1N33F 3DHWC 3G4SS 4FF3A 4JI5J 2RSQA 3DN9A 1TK5A 4YHHJ 1BXNA 4YMEA 1FDDA 3MPVA 3R9LA 3Q8QB 3VQTA 1F3FA 2VG6B 4N8OA 4JI4J 4ELUA 2UXCF 4WZMA 1S9GA 2BVZA 2GIRA 3Q8UA 5J2PB 4DN9A 1R8BA 3PEHA 1NM2A 1U47A 4NA3A 2HGNA 3KLVA 4TQRA 5CH7B 4DV2J 5HMXA 2ZH9A 2FB0A 3CCMS 2LMIA 5D3GB 3M6XA 4UUXA 3UVJA 5U47A 1UPMB 3LQVA 2IPOB 5B08A 2OPSB 2DK2A 1L5UA 5KFXA 1EP4B 4J9UE 3R5BA 3HSZA 4FYWB 4OYBA 1IKVA 3MECA 4OI4A 2AQ4A 4B3MJ 4OHVA 4HYKA 1U8SA 2JH3A 4PUOA 3ULHA 2J7UA 4B3TJ 2M2BA 1YJTA 4N8NA 4RZRA 1W7WA 2WZ1A 4ZLJA 3OV7A 4IO9Q 5DRKA 1N6QA 3GE9A 1SPBP 4C48A 2D1CA 2CQ3A 1YVFA 4ZCMA 4A8QA 2QLJB 2DYAA 2KRBA 3I5AA 1WNEA 2MKHA 2V50A 3D6TB 5FDLA 1S97A 2K1RB 1XC9A 4A47A 2HZAA 5KFAA 2Y1RI 4PPZA 3TJ8A 2XNRA 3FQLA 3KK3A 4CM0A 1DJ0A 5FD1A 1FRKA 2RRAA 4C8ZA 2AT1B 4FYVB 2IAJB 4R25A 3L7UA 3MOZA 3AOCA 1KQGB 2HHTA 2IYGA 4IR1A 2IM1A 2LU1A 4OJHA 2FUG9 4MAKA 1H73A 2Z57B 2V4JB 4TY8A 4ES2A 1F5BA 1EZZB 3J81j 5HROB 2YKPA 3T9NA 3FKBA 4ED5A 2LXUA 1RT5B 4Q43A 1GMWD 3US5A 1NCLA 5E0OA 1APSA 5C5JA 2K8GA 1J5EF 4OYIA 1Q81T 1FFGB 3DLEA 1T8EA 3DYAB 1HPZB 4K4SA 3NMRA 4LSNB 4DV6J 4FF2A 1DARA 1VIOA 1S1TA 1FTCA 5KFGA 3CCVS 1WI6A 1CJVA 4R0EA 2BJ1A 1UVJA 4TNOA 2HWIA 4KIAA 3DCAA 1X4CA 3Q83A 1UL3A 4K50A 1NH7A 3QGPA 5HQLA 3A1YG 3CJSA 2O67A 2VICA 4RBVA 1WOSA 3LP2A 2EFNA 4ZVPB 3OUYB 4WIIA 4DFKA 2ZH4A 3PW7A 1PG5B 4LRDA 4U6PA 2W9AA 2WB1D 4KAIA 2R8KA 3BYRA 1GEHA 2MGZB 2Z2LA 1IBLF 3FZBA 5JVGQ 2A18A 4GO7X 3I0SB 5F8GA 2HVHA 1OO0B 4ZPVR 2CQ0A 4U9RA 1HNVA 2CNLB 3UFCX 3MEKA 5HQ8A 1ZM2A 3FBFA 3F0NA 4FXDA 3J7YI 5LXRA 1VCTA 4P52A 1WELA 2DNLA 1VQ7S 2JHEA 2MLZA 2VL1A 2I1RA 4LFBJ 3NL0A 4DQPA 4YB6A 1S1WB 1RTDA 1WC1A 4WTOB 3IR7B 1KLMA 4AQYJ 4GVBA 1HWJA 3OPKA 4QU6A 4OX6A 5I42B 3MM7A 4KR0B 3EGVA 1RI7A 1S79A 1XR6A 5CXTA 2BJDA 3UDVA 3AOAA 2KB2A 4DFJA 4LRAA 1QAJA 4N7TA 2HSEB 1XMBA 2H4WB 3PR4A 2LCWA 3W9HA 2XNQA 1WI8A 1TV6B 1UJ4A 1U25A 4RNMA 2V2ZA 3QT7A 3PFEA 2L9WA 2RVJA 5HLFA 4GKJF 4BWJA 2FDNA 4UOGA 3KNGA 4KHMA 5LMNF 2FLNA 4OYPA 4PXCA 3AA8A 4WPAA 3BM7A 4ZP7A 2YXLA 4KGKA 2UUAJ 1B7YB 4U95A 1ZTWA 3C2PA 4RW6B 1KTQA 3B6BA 3CULA 2FZKB 2ZHOA 1YX2A 4YFUA 3QWUA 1U1QA 2PO4A 3KWMA 4USVA 2YQ3A 4LQ3A 3EDRB 4ZVSB 4QPXA 3QRPA 5D6GA 3DMJA 1E6YB 3G2XA 1KQKA 3JS9A 5AT1B 2IYIA 1HNIA 2R4FA 2M5YA 3KJQB 1M90T 5ETOA 2EPIA 2Z58B 3NGTA 1LOUA 2E44A 3QQCD 1GMVA 3MM6A 5KFTA 3LWLA 2E5LF 2KYXA 1HMVA 4Y28C 3W2WB 1TKTA 1R8AA 5KFOA 1L3UA 3RAMA 1TL5A 2M52A 1R6VA 2B3TB 3MD1A 2XYHB 2I2YA 3DM2A 4IFYB 1WACA 2XMAA 1GMWA 3LO3A 4U8YA 4XO0A 4Z37A 4DR7J 2Q6CA 2HWTA 2XO7A 1UFWA 1RT1B 5H9EJ 1FKAF 1NZAA 2VA3A 4OYAA 4K4YA 3QRRA 3DI6B 2XY5A 5ETLA 4A8OA 3BKTA 3PW5A 2X1BA 5LOQA 2QL9B 3ILJA 2J6UA 2DNKA 1D09B 1N5YB 2VPXB 1R31A 3D9BA 1R6YA 2Z56B 2OAUA 3K8VA 4C11A 4H4OB 2RDJA 3ET6B 2HEKA 3T1YF 1XMOF 2AJ1A 4Y65A 2AIRB 1N56A 2VKZG 4ELTA 4RR5A 2DGWA 2WVFA 2Y8WA 1RYSA 1C4CA 3UD5A 3W3SA 1FDAA 1PYOB 1S9GB 4YB5A 2O66A 3VAIA 4C8MA 5ETNA 4X4SA 4H4KA 4C7QA 4CH0S 2RKIA 2FPHX 3TR5A 2E1AA 3UD3P 5HSPA 1EB0A 2YWHA 3UWTA 2ROPA 4UOHA 2RD5C 1PBUA 1S77D 4QR0A 2E5GA 3R5GA 2OH2A 3V4MA 5ITHA 4LF6F 1RISA 4USHA 2AEFA 4ZN1A 5I3UA 2CQBA 2UXCJ 3D54A 3K57A 1IKVB 1KONA 3MECB 2B9WA 3PHTA 2L9NA 4EU0A 2D7SA 4L3NA 4WXOA 3MI7X 1SJ4P 1Y00A 2GQQA 4PUOB 1EAYC 3N0VA 3TZXA 4LF7J 3GONA 1U4BA 2Z0GA 5GADU 4CLTA 3JSMB 1OY8A 4K5RA 4YR3A 1EX8A 1OIAA 2XGPA 1SH0A 2PD1A 4LRCA 1Q8IA 2A6MA 2XGQA 1N6QB 5HP1A 3PM9A 3KLFA 2KG1A 2MQOA 2FLPA 1VGYA 3KG4A 4DN0A 4DV7F 3HHLB 2G13A 3F41A 3AXMA 2AZ3A 3D1QA 1S9EB 3BKUA 2ZH3A 4ECQA 1S9FA 2B5JB 1S72S 2NUUG 3KK3B 2HNDB 3NCQA 3OFFA 3PX4A 1UTAA 1RTIA 3W60A 5KFBA 1KC8T 4GMKA 4A8SA 3GV5B 4RW7A 2BE2B 3M8ZA 3MUTP 3CJ4A 2CDQA 3J81U 3TQ1A 3MWBA 4TY8B 4ZPAA 1VQSA 3D0IE 2WVBA 3P49B 5RUBA 3HX9A 2PI4A 2M0GB 1OQ6A 1YLXA 2QA1A 5B0EA 5HQMA 1SKUB 3PR5B 5IWAJ 4L73A 2H5JB 3JQKA 2J7WA 5KG6A 2UV8A 1VQNS 2B4PA 1IBKF 2LQJA 1Y10A 2OFHX 2HQCA 3D68A 2HBQB 4E98A 4ECSA 4C0BA 3GV8B 3ISND 4F04B 3LANA 1M5KC 4YDDB 4KKOA 1S1TB 2DGQA 2R8HA 5L38A 4QW8A 2DNYA 4G6VB 1L3SA 2GX8A 2VC0A 4HI1A 4FKXA 5KFHA 1QAIA 4IRKA 2ZITA 3UQSA 4DJBA 2VG7A 4HR2A 1VBKA 2IVFB 1WDDA 2OFGX 1IKXB 3EXYA 1FE4A 2ZEJA 1DQ8A 4LUBA 1SH3A 2DH9A 4BCAA 1J5EJ 3O3LA 3LP2B 4B9VA 2BJEA 2BM1A 3P96A 2BE7D 1BWVA 3M8SA 1M5VC 2E9RX 5DG7A 2KHDA 2F1FA 2M8HA 2A10A 2YH0A 3N9UC 3KLHA 2PDAA 1OPZA 2CQHA 1V9OA 1MROA 2QMXA 1PC4A 3I4PA 1QVFR 1N4LA 3G82A 1HNVB 1FHTA 4TU7A 3ZO7A 3NY0A 2LQ8A 1O51A 4RL1A 1FNOA 3FK4A 4FNIA 1WF2A 1VLYA 1X9SA 1XNQF 3I5BA 1ROFA 3SDEA 3M8RA 2R7QA 5E2QA 4L72B 4X66F 5L46A 2V9WA 1IM6A 1NK8A 3H42A 1LWXA 2BOAA 1IVZA 4DFPA 5IFMA 1KLMB 4GVBB 1HI0P 2UUTA 2J9CA 2AJFE 2HHSA 1T94A 5J2NA 4F0KA 2CNKB 2HMIA 2ATLA 1IKYA 4NLGA 4FPRA 3I82A 5I3QA 2I6WA 1G7CB 1BLUA 5LL6d 3RB6A 3NNHA 3BGRA 2B43A 2XMVA 1UEKA 1GQEA 4ZPDA 1AROP 4ETXA 1VC6A 1YJRA 4WIQA 1RT4A 4HT7A 3TAMA 4JI8F 3IN5A 4IG3A 3GSDA 4RBUA 2AMCB 1SKWA 3Q8YA 4C3MA 1TFWA 3EPGA 4YN3B 1NB2A 3ILOA 2IA6A 3BSOA 1T9TA 5HLFB 5GAHU 2F3JA 2GO8A 2PI5A 4MTPA 4C8KA 1FJ7A 3Q0AA 1DTQA 2WVEA 1YGYA 3NAIA 4I4BA 1PC5A 4B3SF 3IRXA 1RTZA 2RILA 1HR0F 4UY85 2G1HA 4DV4F 4URSA 3OQ2A 3TAPA 1T0TV 1ZZNA 4CLZA 3QYYA 2PA3A 4B08A 4H4MA 3IR6B 3DMJB 3POTA 3MAAA 4GVLA 4WFNQ 2RDIA 3H90A 5GAEI 1LW2A 2ILYA 4Q8EA 5J1EA 2W9BA 4M8LA 3PYFA 1P6TA 3SI8A 4C8YA 4NA2A 1ZAWA 4WXWA 1P9QC 2J0SD 1HBNA 5K20B 3MM6B 3OSNA 2NXCA 5AXMA 1HMVB 2SXLA 1S6PA 3OTDA 3NMAA 4J91A 2WK4A 1FD8A 4KC5A 5CZXA 4U7UK 2DB1A 2GJ2A 1N52B 3ZZZA 3R2CJ 2LXFA 2CA9A 4C0OC 1XERA 5DO2A 1LWEA 1Q7YT 3CSKA 1PBAA 3ILLA 4JP8A 4C98A 1RT7A 3OHAA 1HARA 2FJDB 3CCRS 2XI3A 2V0NA 3JSYA 2XLJA 1NDLA 4J9VA 2W7AA 2E5LJ 3DDIA 5KT3A 3TI0A 4P2MA 2DXEA 4WP9A 4ZITA 1T9YA 3ZTQA 3X1LB 2RNEA 4QIGA 2Q1LA 1DY3A 3AB2B 3ZZPA 2H54B 1N0UA 2OELA 2XI2A 2UZAA 4NLXA 4C11B 1REVB 3BPSP 1VK8A 2J5AA 4U7CA 3MZIA 2D3OR 1VFJA 4QWCA 1QM9A 4UQTA 2AGQA 2D3UA 3HLUA 6FDRA 4L3KA 1SKRA 1RHMB 4LF4J 4WU2A 2MJUA 1QUVA 3PX0A 5F8LA 3Q23A 5F9LA 2HHHJ 4TLRA 3P45B 4GKKF 4AFFA 3CC2S 1MMDA 2HQIA 4O3NA 2CNOB 3TX8A 5HVGA 3PW4A 3CD5A 3AH6A 3NG8A 2B7BB 3KJNB 1JJ2R 4USUA 3SXLA 2MZ1A 3CNQP 4TVAB 1RWUA 4DF4A 1EARA 3MR7A 2RKIB 5ETTA 2KVIA 1XR7A 2G1DA 5IQ6A 1X4BA 5CQGA 3TEHB 2OPRA 2W9CA 4EEYA 1XMOJ 2IVYA 4ZA1A 2J6TA 3IAS9 4K7QA 4YOEA 4AL5A 5AE2A 2EFGA 4F3QA 2IM0A 3QO9A 3C16A 4I1TA 3SV4A 5M2RA 1S0VA 3SSQA 2FJWA 3LP1B 3VQSA 4YUDA 3RYLA 5I3UB 4K4WA 3BBCA 3THVA 5A76A 3G87A 1RKJA 3BSNA 5LJ5Y 1GX5A 2QIFA 4EI2A 3FSIA 3WIVA 1RA7A 2OGUA 3CC4S 3HMJG 4LR8A 3MHYA 4LF8F 3GCXP 4RJVA 5HN0A 4FXWA 3BO4A 3KLFB 2JEGA 2CJ9A 1CQNA 2CJKA 4LF6J 1WTBA 1UMJA 2QL5B 3BBBA
chains in the Genus database with same CATH topology
3Q8RB 3OR1B 6FD1A 2BZ2A 3MDFA 4UW2A 3LALA 4IG0A 1VQ9S 2ZZMA 4XDDA 1OSCA 2HPUA 7FD1A 4X62F 4FBTA 1TV6A 2FJBB 2V9KA 4K2XA 2XS5A 2NUHA 4KGMA 1N48A 4F02A 4WK1A 4HEA9 1XEZA 2VFUA 2LLZA 4FF4A 2UUWA 1VBZA 4C0HA 2VUGA 1NNDA 1HWKA 2XWYA 1RTIB 3D1HA 4FBUA 1HI1A 3SQGA 5BYQA 3E3XA 2JOQA 5DDRC 1V3RA 1C1BA 4PXBA 4UQGA 2YWKA 1FE0A 3NS5A 1T3NA 2Q79A 2ZC4A 3CVKA 3LAKA 4EZ6A 4PXEA 2VPWB 4HI2A 3VAFA 1MSWD 4RW7B 5IXUA 3NGKA 2IRYA 4A8WA 3V6DB 3BR9A 4YB1P 4JV2A 3MMBB 4IH6A 3IGVA 1NU4A 2JLFA 2ZH1A 1UETA 3D2WA 1YTYA 2P5VA 2AU0A 4NPOA 2DTJA 3HHNB 4CCHA 3IXQA 4ETZA 2V4QA 5F41A 4RW6A 4F67A 1U1LA 2LQ9A 2DIVA 3L7PA 2R9LA 2DNRA 2WAQD 2VH7A 4J9MA 2MYFA 4I6WA 3EXCX 4ZVHA 5L9NA 4L6V3 2QYCA 2AWZA 2C28A 3UE2A 4Y2IA 3ONQA 2RE1A 3HK2A 5C24B 3M8QB 4J9OA 4J9QA 5KFJA 1VC0A 2KT2A 1NK9A 2F9JA 1LK5A 1A7GE 2C2DA 4KO0A 2AGOA 5EWEA 2H5EA 4N77A 3F44A 1FT8A 1HBMB 1E6YA 1TL1A 4JI4F 2MKSA 2OIHA 3M1VA 1YIJS 1SQEA 4JV0A 1SKSA 5KG0A 4W92B 4XPCA 1WEXA 2VBWA 3CCTA 4LQ9A 2MPUA 1GTEA 1CPZA 2CPFA 2HWHA 2QA2A 4IOBA 3G9CA 4R8UA 4P2SA 4O3RA 1GXUA 3TVKA 4DR7F 2MJNA 1RKIA 4PG6A 3KG1A 2RQMA 5B7WA 1H7XA 1RTHA 4FS2A 2DCLA 2BQRA 2AYGA 4IUFA 2DITA 5CHCB 2E9TA 1WWHA 4Q44A 2OP5A 3MTKA 4A46A 3FRYA 4YR0A 3I0RA 2RUGA 4NLYA 2JFKA 3X3UA 2BXJA 1FXDA 1VRTA 2CPEA 3CD0A 3GYNA 3BGLA 4KKOB 1TL4A 1JLBA 4DV2F 4IOAQ 4X4UA 2ZBIA 5CCLA 1LQ9A 3NNAA 2KO1A 3QGGA 3NNCA 5DETA 2MZSA 2XC9A 4F8RA 1L3VA 3VALA 4ZVFA 3GIKA 1NK7A 1RTDB 3C6UA 1RTJB 4EBEA 1N8RT 3KMSA 1C0TA 5F0UA 3V81B 2MZQA 4JI2F 1VHFA 4RUHA 3W2WA 1HBUA 4ED3A 1D9FA 4B9NA 3MMCB 5KFEA 1TL3A 2VG7B 2X1AA 1TAUA 1OSDA 5DLFA 1PO6A 3O8WA 3TUJC 3K0JA 4NYOA 3DLHA 2BOPA 2NSBA 2C2EA 2UP1A 4G3IA 2I5JA 1WEYA 2JL9A 3DRYA 2KFZA 2L3MA 2GA7A 3BGUA 5MLCV 2KXHA 2ZOFA 2E5IA 2MQMA 5E41A 2KU7A 3KJVA 4CT9A 4IFYA 3D0HE 3ZFVA 5J2MB 1IQZA 4QR1A 3CJKB 4B9UA 2QLXA 4XAKA 1VK3A 1X4FA 3A8EA 2QSWA 5CCMA 3MM5B 5KG2A 2DGUA 3ISZA 1QE1A 3VZIA 3THTA 4RUCA 1VQMS 2CPYA 4HKQA 3C46A 1I6JA 1KN6A 1FRXA 2E5JA 4NZ0A 4B3MF 4TN2A 3TOQA 4G1PA 2BRLA 3BQ2A 1T03A 2NQPA 2HNZB 3TA0A 3RB3A 1YJWS 1UVIA 1C4AA 4TU9A 3MM7B 4X4VA 2WCXA 2NR0A 1M5HA 4KRWA 4ZP6A 1UP1A 2VOPA 2ZKTA 2ZDPA 3FSXA 4NZ7A 4F4XA 1RYRA 5AE3A 4OFZA 2FVPA 2J0QD 5KFFA 2F4VF 4HDHA 2BANA 2FLPA 2AP6A 4F3MA 5DQHA 3KLHB 2Z2MA 1D3WA 4ZCLA 2W24A 3TUIC 1FERA 3DXSX 3CMES 3RTVA 1MROB 4OQJA 4MIAA 1FESA 4NLOA 3DOKA 3QIDA 2RQKA 4WK3A 2CPIA 3T19A 2KM8C 4X4RA 1DURA 2ZJQQ 2JEIA 2UVVA 3CGIA 3IWXA 1Z2ZA 2CJAA 2IHR1 2M4MA 1Y0HA 2DHXA 3RRHA 2MKJA 1ZTTA 3ZZOA 1VRUA 1BGXT 2CQDA 1SBRA 1JLCB 1B64A 2RF2A 3HHKA 3MMJA 2WB4A 3RB4A 3R27A 3K58A 2KM8B 1IKWA 2IC3A 1P8GA 1M0SA 4K4ZA 2UVWA 3DC2A 4TLQA 4IO1A 3E01A 4JUZA 1JLFA 2JWNA 2CVEA 3OXLA 4H54A 3BREA 5A8RA 4PQAA 4DDFA 3O1LA 2VG5A 1NKCA 4ECXA 5B0FA 3DRSA 3CC7S 2X3GA 2DNGA 3M4XA 4M1KA 4ZPBA 4F2SA 2WSCC 1FD2A 2GGPA 5DDOC 4D3GA 2DGVA 2BDPA 3EGNA 2DPJA 1QJHA 4OI3A 3DLJA 4DR2F 2NZ4A 5EX0A 3OVSA 2D9PA 1N33F 2V2KA 3DHWC 3CDAA 4RLEA 3G4SS 4FF3A 2RSQA 1X0PA 3AQOA 3DN9A 3PIOQ 1Y9OA 4ZS6A 1TK5A 2KKHA 3P6YC 3IWLA 1S1XA 4HH0A 1X9MA 3V4IB 5LXYA 5GAGU 4YMEA 1FDDA 2YWEA 2A3JA 3BN4A 2GW8A 3MPVA 2HHUA 4WFXA 1IBMF 3Q8QB 3PXGa 1TFYA 1ZAXA 2VBXA 2OTJS 1PSDA 3DRRB 3VQTA 3SV3A 5L1IA 2QEXS 1KNZA 3M2RA 2L48A 5DDQC 2VG6B 3D1OA 4N8OA 4J5OA 3M8PB 2JSXA 4ECTA 3KYLA 4ELUA 2UXCF 4NL5A 1U1NA 4WZMA 1N88A 1S9GA 2WHOA 1T05B 3VCDA 3PJXA 4J9PA 1G1XA 2BVZA 2GIRA 2RU3A 3TP2A 2VFRA 4OHZA 2WRMA 4LVNP 5J2NB 4KFBA 5J2PB 5THWA 1KQFB 3QMQA 1HHSA 1V3ZA 2ZH2A 2EBGA 4DN9A 1F5AA 5EWGA 4DUZF 5KFKA 3UD4P 2AGPA 1P27B 2ZHAA 2HMIB 5J2QA 3KNAA 3LW5C 3H40A 1R8BA 4G1QA 2FHKA 1CQMA 3PEHA 3CCLS 1U47A 3MEEB 3OW2R 4NA3A 1NJYA 2HGNA 3KLVA 1ZOTA 4TQRA 2OPPB 5CH7B 1IKYB 3ITHB 2B56A 4AE5A 2KI2A 5HMXA 2GMHA 3EGWB 4QWEA 3QLHA 4PG7A 2MDAA 4Z2XA 5EX3A 4X4NA 2ZH9A 3AAWB 4I2PB 1RT6B 3BGRB 2FB0A 3CCMS 4PWDB 2LMIA 5D3GB 4DR1F 3M6XA 5HO4A 3PVXA 1GT8A 4NLDA 2W8KA 4UUXA 1HNIB 4OZ5A 2BQ3A 1JX4A 4IQXA 5IT9Y 2UVUA 5U47A 4DS5A 3KLEA 2KJWA 2VKRA 3LQVA 5F9NA 3Q8SB 3MUMP 4DSFA 4LF5F 4K59A 4PCQA 5B08A 1UJ6A 2OPSB 2DK2A 5IS2A 3PKYA 3DLLQ 3PJWA 5B0AA 4AXJA 1L5UA 5KFXA 3JB9k 1EP4B 4DV6F 2NPIA 1RT4B 3R5BA 3M30A 3TAMB 1X5TA 3LP0A 2IVMA 1RP5A 2ZJRQ 4LVOP 4QR2A 1IKVA 3MECA 3WZ0A 3BQ1A 4OI4A 2AQ4A 2M8DB 3HKWA 2ADCA 1TKTB 1REVA 3KHRA 1D8YA 3FCHA 3SCLE 4OHVA 4HYKA 3ZZYA 1Q53A 1U8SA 2JH3A 3N01A 1PGZA 1DQAA 3J7ZT 1S0OA 3HKZD 4HTJA 5KFMA 4MFBB 2JEJA 1MMLA 4PUOA 4EO8A 3ULHA 2J7UA 1JJHA 2C3PA 3UW1A 3CCES 3DM2B 3KLGA 4NX9A 1MU2B 4DSLA 1GX6A 1HNZF 2XS2A 1NHVA 3SCJE 2GV1A 1FKPA 2EFQA 1YJTA 2M2BA 4Y34A 4WF9Q 4N8NA 2AYMA 4OJ1A 4OLOA 2R7WA 2HHQA 4RZRA 1S6QB 4MIWA 1JJ4A 1JXEA 4ED1A 2IMWP 5KFPA 2XMKA 2V8HA 2HFOA 3OV7A 1U1MA 5E7OB 5KT6A 4V19X 3V2UC 3JYTA 4IO9Q 2P6SA