3UWTA

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 2.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
197
Chain Sequence
GAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Poly(U)-binding-splicing factor PUF60
total genus 49
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA01
3RW7A 2DNZA 3TP2A 2QA4S 3H2VE 1X4CA 3CMAS 3THTA 2HVZA 1B7FA 1WF2A 4RU2A 1VC6A 2KI2A 4UY8T 5LXRA 1RK8A 2CPXA 2DGSA 3CCMS 2MKKA 1U1PA 2MZRA 1N8RT 1R8HA 1X5PA 4PKDB 2M7SA 1N52B 2DH9A 3UCZP 3CCJS 1FT8A 1YJNS 2DNRA 2DB1A 1FHTA 2E44A 1K9MT 3CC7S 2AYGA 2MKSA 3J7ZT 5D77A 1HD0A 4IOCQ 2E5GA 1H2TZ 2KT5A 2CQIA 3VAHA 2LECA 3U1MA 2CQGA 4OZ0A 1DHMA 5GAHU 4F02A 1N88A 3CCSS 2CQ3A 1YWXA 2LYVA 1U1OA 1U6BA 4CH1A 4IOAQ 1DBDA 1ZZFA 3VAKA 2RUGA 1ZZNA 2L9WA 2OSRA 2RS2A 5GMKa 4C7QA 1VBZA 3NMRA 2D3OR 1KQSR 1FJCA 2ZJQQ 2CPFA 5BJRA 4F25A 5DDRC 1Q82T 1KC8T 2YH0A 4ED5A 1FO1A 4WFAQ 3BO3A 3R1LA 2MZTA 3EX7B 2XS2A 3MI7X 2DNGA 5LJ5Y 1L3KA 4WF9Q 2MQPA 5DM7Q 3MD1A 3MUTP 3CULA 2LXUA 2MQQA 1FNXH 2J8AA 2KYXA 1A7GE 3SDEB 2RRAA 2G4BA 2M9KA 3BEGB 2OTLS 3US5A 2CQ4A 4CQ1A 1WELA 1P27B 2KM8C 1JJHA 2LA4A 5LSLA 3JB9k 2LMIA 3FEXB 2JVOA 4PRFA 3TYTA 2MQMA 3R1HA 2G0CA 2CQ1A 4IUFA 2ZJRQ 4W90B 2CPYA 1U6FA 1Q81T 1VQMS 3S01A 4Z2XA 2PEHA 1SJ4P 1HL6A 1OO0B 2MPUA 1F9FA 1M90T 1N54B 3ZZZA 2RS8A 2KG1A 5DDQC 2CPHA 2MQLA 2FY1A 2PE8A 1WG1A 4Y00A 2WBRA 3UCGA 1NU4A 5D78A 4Y0FA 1FJ7A 2HGMA 5DDPC 2MKIA 3CD6S 2M52A 3NNCA 2QFJA 1FXLA 2SXLA 2YKAA 1M5KC 4IO9Q 2OTJS 1X0FA 3G8SA 1M5VC 2X1FA 5JVHQ 1U1LA 2Q79A 3NNHA 2K3KA 1VBXA 2AYBA 1WHYA 2J0SD 2DNNA 3BS9A 5EN1A 1X4HA 2LQ5A 1WEXA 3CC2S 4PR6A 2HZCA 3UCUP 2DH8A 4C0OC 1WEZA 1QVFR 4WFBQ 2HYIB 3ZZYA 3LPYA 2DNYA 2MKHA 2RRBA 2N7CA 2N3OA 1AUDA 2KHCA 3K0JA 2VOPA 3MUMP 3VAMA 1M5OC 2KXFA 4QQBA 3Q2SC 3NS6A 2DHAA 2DGOA 4BS2A 5FJ4A 2KRBA 4QPTA 1UFWA 5IM0B 2KXNB 1HA1A 2LKZA 4YUDA 2UP1A 5IM0A 2MY7A 2RT3A 3CPWR 1NO8A 1D9AA 1K73T 2RQ4A 2LA6A 3CUNA 2VOOA 2FHOB 3Q2TC 3CCUS 1X5SA 5JVGQ 2XNRA 1U1NA 5GADU 3CCVS 3OW2R 2VONA 5DDOC 2MGZB 1WHXA 2RQCA 4UQTA 3VALA 3EGZA 1M1KT 1SXLA 2DIVA 1R8PA 2N82B 1QVGR 2DHGA 1XN9A 5LXYA 2MZJA 2KVIA 3MOJB 3UE2A 1OPIA 1OWXA 3R27A 3J7YU 3DXBA 1X5TA 5GAEU 1VQ6S 1M5PC 1UP1A 2D9OA 2M70A 3THPA 1VQKS 3P3DA 2CQ0A 2MZSA 2GO9A 1VQ4S 1U1KA 4QU7A 2MGZA 5DM6Q 1SJQA 1VC5A 3G96A 1X4BA 2I2YA 2M4MA 3G6ES 2FPHX 2JVRA 3CCLS 1JMTA 2DNKA 1H6KX 3S6EA 3ULHA 2K8GA 3CTRA 3UD3P 2E5IA 1YI2S 3I56S 2AD9A 2FC8A 3VAIA 1JJ2R 4LMZA 2ZJPQ 4OZ1A 2MQNA 1OIAA 3HI9A 1W2BR 4TLQA 2M88A 2MJUA 1VBYA 2U2FA 2F9DA 2MXYA 1FJEB 2KG0A 3BO4A 1WEYA 4ERDA 4YB1P 1YTYA 1YHQS 2I38A 2L41A 5HO4A 4P6QA 3SXLA 5LSOA 2DK2A 2OIHA 2VODA 3MXHP 4WFNQ 1YJ9S 3N9UC 4WIIA 3B4MA 3IWNC 2L08A 1WF0A 1VQ9S 1HD1A 2MSTA 3SDEA 2AYEA 1U1MA 1ZH5A 3NS5A 3UWTA 1RKJA 2DHSA 2E5HA 1VQPS 1IQTA 1U1QA 3FEYB 3U1LA 2BZ2A 2EK6A 1VQ7S 2U1AA 3EGNA 2EVZA 3D2WA 2ADCA 2CQBA 3MDFA 3G71S 2MMYA 2EK1A 2KXHA 2HGLA 2MB0B 3VF0B 2M2BA 1SJRA 1PO6A 1WHWA 3L3CA 1JJ4A 2M8HA 2CQDA 2HGNA 2JX2A 1H2UX 2G1DA 1UAWA 2F9JA 2MHNA 2DHXA 4V19X 2KFYA 2KH9A 1WG5A 5GVQA 2BOPA 3CC4S 2OSQA 4WCEQ 1WG4A 2DGWA 5CYJA 1Q7YT 5IFMA 1X4FA 3SMZA 4FXWA 3VAGA 4YOEA 2QEXS 2CQHA 3P49B 2XS5A 1O0PA 2ADBA 4M5DB 2NZ4A 2DGQA 5LJ3Y 1KD1T 1X4GA 2CPEA 2DGUA 3MUVP 1YIJS 4ZKAA 1VQNS 2DNHA 3MURP 2XS7A 1YJWS 1H2VZ 2LCWA 1U2FA 1VQOS 2KRRA 2KM8B 1BY9A 2CQ2A 1VC0A 1DZ5A 1A9NB 2A3JA 3CXCR 2D9PA 2DO0A 2KU7A 2DIUA 5CA5A 2DH7A 2RU3A 1SJFA 2M8DB 1X4DA 2AYMA 1UW4A 4C4WA 2DNOA 2B0GA 2MKJA 2GHPA 3CCQS 2CPJA 1KOHA 5ITHA 2F3JA 2LXIA 1NJIT 3IRWP 1WWHA 4CIOA 2RVJA 1X4EA 5CXTA 1URNA 3CF5Q 2MJNA 2V94A 3PIOQ 3RW6A 2LEBA 2CPDA 3VAFA 4A8XA 4J5OA 1KOOA 4FXVA 3B4DA 3UD4P 5H1SV 2MYFA 2DGTA 5DETA 2MZ1A 2CPIA 3P6YC 3VAJA 2M0GB 2JWNA 2CJKA 4LIRA 1SJ3P 2DNPA 2MZQA 2YTCA 1WTBA 1WF1A 2YWKA 4TU9A 1X4AA 1K8AT 1U1RA 2MSSA 1QM9A 1DRZA 2DGXA 3I55S 5GAGU 2MQOA 2MKCA 2DO4A 2CPZA 3H2UB 2MY8A 3BO2A 3CCES 3V4MA 3CCRS 3CMES 3HHNB 1G2EA 2CQCA 5IQQA 1S79A 1P1TA 3P5TL 1CVJA 2RNEA 1VQLS 1VQ5S 2J76E 2DNLA 2KN4A 4W92B 2CQPA 2DISA 2NLWA 2X1AA 2X1GA 2OJ3A 1S72S 4U67Q 4CH0S 1PGZA 3TO8A 2DNMA 2YH1A 3NNAA 1D8ZA 5HL7Q 1WI8A 2DNQA 1Q86T 2X1BA 4TU7A 4EGLA 4TU8A 3G9CA 1VQ8S 2J0QD 3DLLQ 3G4SS 1YITS 2N3LA 2O3DA 1X5OA 3G8TA 2FC9A 2LEAA 3S7RA 2XNQA 2ERRA 4QU6A 3MD3A 1WHVA 2XSFA 1WI6A 3S8SA 5MLCV 3PIPQ 2DITA 2XB2D 2E5JA 3LQVA 2DGVA 4LJMA 2JRSA 4WKRA 4F26A
chains in the Genus database with same CATH superfamily
1FNOA 3ICLA 3MMAB 4OZ5A 3BN7A 2HFUA 3W61A 2ROPA 1RISA 3EGWB 5AE2A 1M5HA 3I0SA 3CMAS 2I8EA 3NL0A 3THTA 2HVZA 2VPYB 1CS4A 4HVZA 7AT1B 1B7FA 5KFIA 4R8UA 1T03B 1XBWA 1R89A 5KG3A 3V2UC 4IH6A 1VC6A 4RU2A 2J9EA 1XNRJ 5H9EK 3GMGA 2FZGB 3RAMA 5J2MB 1E6YB 4J7CA 4IH7A 5B0GA 4ED0A 1XNRF 4LBHA 2QYCA 1QAJA 4X4TA 5KFMA 1X60A 2MZRA 2QLBB 3V6DB 3MM5B 1X5PA 3RB6A 8RUCA 1N52B 2DH9A 1VS3A 1FT8A 1KKHA 2JSXA 5KOXA 2IYGA 1ZPVA 1IBMJ 2AYGA 3AT1B 2MKSA 3ILJA 5D77A 4OYXA 4EUVA 3NWGA 4IOCQ 1YZ7A 1YKWA 2R7SA 2ABYA 2F63A 2Y3YA 2K06A 2KT5A 1T02A 1PG5B 1RWUA 3AB2B 4B02A 1TP7A 3PX6A 3VAHA 3PVXA 2BKOA 2IM2A 1IBCB 2OPPA 3C15B 2FVRA 3BGRB 2CQGA 1KNZA 3MR6A 1Z2LA 1LXJA 1VQYA 4LREA 4NLTA 1RBOB 4ZK7M 3CCSS 4ECVA 1TL5A 2W2MP 2OPPB 3RTVA 3MEDA 3HFZB 3FRYA 4JI5F 4ICLB 4NPOA 2FZKB 2C2EA 2OPSA 3DLEA 3JSBA 5CCLA 2RUGA 3KJNB 5FLXY 4KGZB 2OSRA 1RTJA 4PWUA 4CTAA 3B78A 5HN0A 1WNEA 4MIWA 1KS2A 1RAEB 1JLEB 3NOGA 4TY8B 1HI8A 3DRRA 3SSRA 5GMKa 5DGBA 4ED3A 3H8YA 1TKDA 2VV5A 4GKKF 1VBZA 3NMRA 1RXOB 4MH8A 1SUQA 1KQSR 1FJCA 1DAXA 3POTA 4LIWA 1OYDA 3I5AA 2QG9B 5AE3A 1SKWA 4OFZA 4MMOA 1KC8T 1WC3A 2XZTB 3R8YA 3HD1A 1JX4A 3BKTA 4B3RF 3GQCA 3Q8VA 2HNDA 3EX7B 1NPKA 3EWGA 2Z57B 2YKOA 2VG7A 3OUYA 2R7XA 1LK5A 1JLBB 1TKTB 3OSPA 3IFEA 4ZVOB 3K8VA 4K7QA 2OTLS 4LF6J 4WF9Q 5IV3A 3OXGA 3CWJA 2MQPA 4BWJA 4YR3A 1H72C 2J6SA 1UZHA 1NDKA 4ECZA 2Y1JA 2EBGA 4OMFG 1IKXA 1TV6B 4KPCA 2MTLA 3I32A 4D3GA 1HR0J 2KYXA 2QX0A 1GTEA 1CULB 2ZD1B 1A7GE 3Q8YA 3IWXA 4NXMF 2ZH7A 1SPBP 2GMLA 1FFGB 4B3OB 3PRDA 2DXDA 2CUYA 1FXRA 5CZVA 4CQ1A 1NB2A 4HI2A 1JJHA 3TJ8A 4QWEA 2ROEA 2ZNYA 1MWQA 1WUUA 2BE2B 1HWKA 3AOCA 3EXYA 4RW4B 2ZWOA 5DRKA 3U02A 4E0DA 1K0TA 3GB0A 2MQMA 5LMUJ 2G0CA 4RO0A 5MAOA 1HHQA 2XULA 2YXLA 3CEDA 5AT1B 5A2QY 3H90A 1Y5NB 2ZJRQ 4GC7A 1U48A 5HVFA 1B3TA 2AMCB 2VBZA 3BJYA 4EBCA 4GVBB 3BR8A 1IVZA 2IY5B 1WC1A 1VQMS 1UPMB 4FNHA 3MEGA 4LUBA 1OO0B 4JI3J 1EP4B 2MPUA 2QA1A 2JLGA 3RB3A 1S10A 4NMXA 4QR0A 4ZJQA 2E9TA 2IFXA 4KBIA 1HBNA 3VGTA 1V6HA 2V8VA 4RW7B 2FJEB 5IXUA 1RT7B 1DQAA 2BM1A 3RZAA 2YKPA 5I3QA 3MCSA 2AJFE 4DV0J 3TI0A 3HPOA 2FTRA 2V67A 1D9DA 4NI2B 4L76A 3TUPA 3O5TB 4K0KJ 2RDDA 3UCGA 1NU4A 5HMWA 4YDXA 3T5LA 1EQ0A 4DL2A 4K4VA 2PMWA 3W5XA 2Y0BB 4P72A 1NBEB 3LTOA 3KK2B 4FDFA 3WIUA 2QFJA 1T9UA 5D3GB 4B3SF 2W01A 2YKAA 5C2CA 4DJBA 3OXFA 1X0FA 2B9WA 2IJFA 2G2YA 2KL8A 2PA8D 4L72B 3DI6A 3U27A 3G8SA 1U1LA 4F0KA 1M5VC 2I0XA 3M1VA 1LQ9A 3D0IE 4ZJOA 4JI8F 2QA2A 4BCAA 2AYBA 4DR6F 4QR2A 3ILOA 3P45B 3J81U 1RAJA 2A6OA 3GE9A 1U2CA 2V5HG 4OIXA 2FJWA 5F3ZA 1EZZB 1F5BA 1RI7A 1RCXB 2E1RA 2D41A 1D09B 4RUBA 5EX3A 1MW7A 4ZHRB 5EHHA 1NK5A 4ATNA 5EN1A 1X4HA 4O4RA 3TW0A 1WEXA 1WOSA 5DQIA 2QIFA 3ZZ0A 1YSJA 1S77D 3J7AN 4B9UA 1FDAA 4KV8A 1APSA 3UCUP 3T41A 2V0NA 1IM6A 1BWVA 1T05B 4B3RJ 3SCKE 2HYIB 2KJVA 2DNYA 2MKHA 3SV4A 4DS4A 1HNVB 2EPIA 1UVLA 5L46A 1TUVA 2N7CA 2N3OA 1AUDA 3PHEA 1PAUB 4NWBA 1ITPA 2R3VA 2CWXA 3LANA 2EG1A 3FUYA 1PILA 1OJ4A 3MEEB 3OR2A 5T41A 4BC9A 4A8SA 3K0JA 2VOPA 1M5OC 4W4MA 2W4DA 2P5VA 1NKBA 4QQBA 4R25A 1RT2B 2BJ9A 3D3BJ 3I96A 2DHAA 1NJYA 2JL9A 2B6AB 2V4QA 2HHVA 3J7Z5 3MMBB 5FJ4A 1RADB 3V4IA 4C3LA 3RB0A 2KXNB 2DTJA 2Z30B 2OEKA 3MMAA 4DR6J 4WYLA 1ZAWA 4O23A 4LRDA 2ALZA 4LSLB 1RT4B 1UVJA 1U47A 1ZPWX 2MY7A 4KSEB 3MMCB 3RB4A 2VIHA 3TEHB 4FYDA 2RQ4A 3DOLB 3CUNA 2IBKA 2RSQA 4UTGA 5H9FK 2VDHA 2UUCF 1REGX 3HP6A 4Y6IA 1Q8IA 1V9OA 5A6WA 1U1NA 3DLGA 2VONA 4WZMA 4DV1J 4JI0F 2MGZB 4X4NA 2UXCJ 3IRXB 1RWKB 1WHXA 1UJ4A 3BQ0A 1N33J 1IBKF 2FJAB 2QGFB 2BXJA 1HBMB 4DMZA 3J80U 5D0EA 1DQ9A 1NXIA 1TELA 2DD8S 3CNQP 3K5LA 4NLOA 1SXLA 3PFEA 4PZVA 2DIVA 3DGVA 4UOCA 2VPWB 3R7SB 1QVGR 1N4LA 1P1LA 1S1WB 1NZ8A 2DRDA 4FPIA 3E8OA 4USWA 5ETMA 4F36A 1XN9A 1T3NA 3KNAA 4PG8A 5LXYA 3G2XA 4PUOA 1MMDA 1N5SA 3HDSA 2DR8A 2YWGA 1J5OB 3BSOA 3MCNA 2XWXA 5HBMA 2OPQB 3GJSB 1HR0F 3H7HB 4O44A 3QBCA 3A4TA 3PJWA 3MAAB 5JJBA 4KYZA 1NSQA 2CXEA 4F4XA 2JDJA 2Z56B 3THPA 4EMDA 4YDDB 5M2PA 3EPGA 3IG1B 1FE0A 2CKWA 1AUSL 1REVA 3BSCA 5G0RA 2B9XA 3D6TB 1F9HA 1CQMA 2ZUAA 1Q4RA 1Z4UA 4KGMA 3IBFB 4IOBA 5HMXA 1P9QC 2QA4S 3M32B 2V9WA 2G0JA 1X4BA 3OFHA 1Q78A 3M6WA 1T11A 1IJEB 2M4MA 3HHLA 4Q44A 1LWCA 2EFNA 3BM7A 3G6ES 4DN0A 1N6QA 1PCAA 4DX5A 1SJ1A 3C6TB 4R0EA 4CNYA 3RBDA 3MM6A 2ZBIA 4USKA 3S6EA 4LF9F 3KK1A 2K8GA 4Y3CA 2Y9HA 3UD3P 4K2XA 1CS4B 4PCQA 2IVFB 2OH2A 1ZYQA 2CJXB 1HHTP 3IXQA 4NYPA 4KHPJ 1XR6A 4TKTA 4A8WA 3MPYA 1IKWB 1OIAA 1RZMA 3HI9A 4TLQA 1KFDA 1UTAA 4LF8J 1SC6A 2U2FA 4KHMA 1C1CA 2MXYA 2KG0A 2M5YA 3H5YA 3PKYA 4DL7A 3D28A 4KIAA 3OBIA 1YTYA 1FK9A 3AH6A 4NYOA 2HMIB 1K0VA 4N5SA 4ED2A 4DR5F 2VPZB 2XM3A 3F44A 3DLJA 1UA1A 3TA0A 2FVCA 3HVRA 1O8BA 5B08A 2RDJA 4Y2AA 2VODA 3MXHP 4ED8A 2R2UA 4WFNQ 5IC4B 2RAQA 2UVRA 1Y10A 4ZJLA 3GG0A 4LF9J 2IJRA 1DURA 1KLMB 3IWNC 1EHWA 3EE3A 2VQEF 2AX0A 2IAJA 1VQ9S 3M8WA 3OJSA 2E1CA 2H65B 3QFWA 2C2NA 2PIIA 4ZDNA 2HAFA 3UWTA 5KFQA 3RAQA 1HKAA 2J6TA 1X8DA 1UVNA 2AGPA 3MEDB 1R27B 4MFBB 2R2TA 2R7RA 1CPZA 3CD7A 4A8OA 2VU5A 3A3PB 1NK8A 1QTMA 2R42A 2EKYA 1FE4A 1NSKL 3C2PA 4FF4A 3KXDA 1LFPA 3JXOA 1H74A 2EVZA 1FTRA 1F6TA 1IWGA 1VRQC 2FHKA 5JXSA 4ECXA 4DSKA 4F8RA 5KG7A 4IDKB 4N76A 3G71S 4CLTA 3O1LA 4JI6F 1S99A 3M2VA 2GAGC 3CE8A 3CDEA 2VF3A 4OL8A 3KYLA 4LRFA 3K5OA 1PO6A 3ENVA 3GZ7A 1WHWA 1FTCA 1VCTA 3T3FA 1YGYA 2M8HA 1M1GA 4OJGA 4MYTA 3JSRA 2NYHA 1NHKL 3SQGB 2JX2A 2OUGA 2MLZA 2XMMA 3IWLA 2ASDA 4WK3A 1B0VA 2MHNA 4QW8A 2LU2A 4V19X 1N0UA 3ETMA 3I5CA 2ZVSA 2CJAA 1D3WA 2BOPA 2BJ8A 2P6TA 3MAHA 4DPUA 3CC4S 1HLWA 4KB7A 3D6HB 5T14A 1RJJA 2CNKB 5CYJA 2Q6BA 2VPXB 3UDEA 2BQUA 3IAS9 3HK2A 2HNYB 1HNIB 2DXEA 3PW4A 2XY5A 5G4DA 2JC1A 1H7XA 2CQHA 4M5GA 4WZQA 2GA7A 3ZC4A 3CJ0A 4DU7A 2HLTA 1N36F 1Y3KA 5LJ3Y 1BHNA 2E7XA 2O1PA 3PEHA 4TQSA 2EC0A 1X4GA 2CPEA 3LGMA 1WTFA 2CDQA 3BBBA 3O44A 3SV3A 2ATCB 4OQJA 4PG5A 2WW8A 2HBRB 2P9GA 3KMQA 4OI6A 1BD6A 2IJNA 3R97A 5F8GA 3V6DA 4ZKAA 3QMQA 3G6YA 3CGIA 4FVMA 1NM2A 1Q8KA 1UCNA 2DNHA 2NS1B 2RU9A 2J7KA 4ZN3A 3MURP 3G6XA 4C8OA 1YX2A 2BRLA 3NP5A 4NLYA 4BC7A 4DV2J 1U2FA 4EWTA 4UT4A 3AA8A 3V81A 1JLQA 4DX7A 3FFIB 4I2QA 2DEJA 3DOMB 4XK8C 3V6HA 3PEJA 1NZAA 2K1RB 4X84A 5KFEA 1SL1A 3HZGA 3I0SB 4HHHA 2XQCA 2PC6A 2YQ1A 4DQIA 4DWIA 1TKZA 1KR4A 2DH7A 4P10A 1S1WA 4J9QA 1FRLA 2J6UA 1UFLA 2GV1A 2W9BB 2LP4A 1GQEA 4C3MA 4NCGB 3HX9A 3KK1B 4DSEA 2DNOA 5GADI 2IRUA 4RW6A 4M5LA 2R2RA 3K5NA 4K4SA 5E41A 2QV6A 2E5LF 2QMUB 2NSBA 3KLGB 1EB0A 5ITHA 3PYGA 4MKBA 2D7SA 4WBFA 3TZZA 1FWPA 4PYDA 4A4JA 4DUZF 3FSYA 4B08A 1FEEA 1XR5A 4QBUA 1WWHA 2JFDA 2W4CA 4CIOA 3FC9A 3DRXA 2VJVA 3QPIA 3OTCA 4A47A 5CXTA 4JI1J 2HEKA 4HHUA 4I7FB 1LNQA 2C3YA 2R8KA 3KJVB 4NX9A 4C11B 2ZDPA 1KTQA 3PIOQ 1LWXA 2HWTA 1VHIA 4YEAA 3W62A 1IUJA 2YWEA 3GCWP 4L3NA 2AEMA 4CLPA 1QTNB 3GIMA 1JXLA 2HRUA 1A0OB 1UKUA 3B4DA 5AXMA 3TAQA 2LFVA 2V2KA 4CO5A 3UD4P 4B9LA 1G1XA 3IP0A 1F1BB 2F1FA 2MZ1A 5F8NA 2YX1A 3VAJA 3PW7A 4GVLA 1PSDA 2VDIA 2ZH3A 2R7WA 2MZQA 3FBBA 2ZITA 3CDUA 2CJQA 2A2DA 1QSYA 3EVOA 7FD1A 4RW9A 3JQJA 2D74B 2YWKA 2HFNA 1XMOF 4ED4A 1K8AT 2XI3A 2A10A 2CJBA 3BPDA 2WW4A 2FLOA 2W2PP 5A8WA 3M6VA 2VFUA 4M5KA 3I55S 4ILMA 2GFFA 2NXEA 3WQPA 3CVKA 2CPZA 2UXBJ 4AQYJ 2GJFA 2Q43A 3V4MA 3HHNB 3FDSA 2JEJA 1LV5A 5IQQA 5CAAA 2HHTA 1S79A 1PIEA 3L4BC 2IHR1 4EK2A 3K2YA 4WWSA 1FX2A 3SIPB 2HS3A 4X65J 3AJ1A 3HVTB 3T9ZA 2YBVA 1CC7A 2CQPA 2LVWA 4K4WA 2IIHA 4YB6A 5J1NA 4A8MP 1KP6A 3IBCB 4AXJA 1FKOB 4YS2A 4MYUA 4DZ6A 1UZDA 3G82A 4MK8A 1RWOB 3M1VB 3LWMA 1SB6A 4MFBA 3TO8A 2YH1A 1CJUB 1RA7A 2A6MA 4C11A 2CA9A 4U8YA 5M2RA 4DQRA 4CLUA 2IC3B 1NJWA 2DNQA 3BSAA 1D8YA 4K50A 1C0TA 4BLGA 4MTPA 3GV5B 1YG0A 3JQKA 1S0OA 2X1BA 2HQIA 1RAAB 1S1VA 2HIYA 3ELHA 4EGLA 1SKRA 3SQOP 4ZLLA 5SUHA 5A76A 4KHRA 3PW0A 1S48A 2O3DA 1X5OA 2HKEA 3QT7A 4QR1A 3LP0B 3S7RA 4CO0A 2W24A 3UDCA 1WHVA 1TKXA 2XSFA 4NCBA 4I68A 5CYQA 2HS4A 2C2ZB 2RHQB 3TJAA 3PIPQ 3RRGA 2C3MA 2L9NA 3NCRA 5KFCA 3EZ5A 1I1GA 3WHIA 3LQVA 3IO1A 4Q43A 4WXOA 1RT7A 4J9SA 4WTYA 5B0FA 4AQYF 3VVTA 3I31A 2IM1A 4WKRA 2JC0A 4OJ1A 1Q8BA 1D9AA 3IGVA 1N5YA 4WPAA 4DR7F 3ISNC 1KQGB 3DLBA 2R9LA 4M5HA 1HNWJ 3TP2A 3H2VE 1G6BA 3TZWA 1YRXA 3NEKA 3R6GB 3GYXB 1OY9A 3N6NA 1NUEA 5H9FJ 3ENQA 2ROGA 2KI2A 4UY8T 3D67A 2L9DA 1RK8A 1UWBA 1O6XA 2CPXA 2DGSA 4Q7AA 1JLGA 2AZ3A 2GIQA 3DI6B 5J2PB 1Y5LB 2J8SA 2DYAA 1QD1A 4DL6A 4JI7F 4YR0A 4JI2F 2DY9A 1N8RT 3W9IA 1FKPA 2J0WA 2XMWA 3CJRA 1HMVA 4PKDB 1SKUB 5KFRA 2HVIA 3PKMA 4TY9A 1T95A 3MMJA 4O3OA 2UXDJ 2QL7B 3MHYA 2DNRA 5BR8J 2DB1A 1X31C 2RDIA 3I87A 1FKPB 3QWPA 3M8RA 1MN9A 2ZVIA 3CW2C 2VC1A 3ADAC 5F0WA 3ZZTA 5HAOA 2CDRB 1GNKA 4CI0B 3P96A 4IQMA 3TNVA 3I0RB 3GILA 2E5GA 4V1Ak 2LECA 4FZVA 2V4JA 3U1MA 3FJ2A 3NBPB 2LEBA 5KFWA 4OI1A 4P7VA 5GAHU 3DLKB 4F02A 2CQ3A 3EUNA 2V63A 2V4JB 2PT0A 4OZ2A 4HKQA 4FF2A 1U6BA 4CH1A 4P75A 1RBLA 2WRMA 5J1EB 4EO8A 4OX6A 3HHEA 2HHUA 3JSMB 2OD6A 2RH3A 2B7BB 4MIAA 2OI2A 1VK3A 5KFFA 1U49A 3BBCA 4CDIA 1SH3A 5C25A 4RNOA 2AGOA 2R7UA 1FFWB 2HG4A 1CSJA 1XMQJ 1JIHA 1RTJB 4C7QA 4CTAB 4K5SA 5HMZA 3M2VB 1RT6A 5BJRA 1FJGJ 4URSA 5L1IA 3V6KA 3KK3A 4TN2A 5DDRC 4RNHA 1N5YB 1NK7A 2ACYA 4M5MA 1VYAA 5DQGA 4I67A 1RHJB 2HK2A 2IRYA 2MZTA 3SCIE 3M7VA 5KFXA 4CO2A 3TJ9A 2CADA 4LF5J 3NGDA 2HFZA 2GVDB 4ANCA 1RT4A 3QT8A 2VASA 1YJVA 3LA0A 5CCMA 3CULA 1C4CA 4F0HA 3CDAA 6FDRA 1LFWA 2B5JB 2LXUA 1BLUA 1KQKA 1TKTA 1QE1A 1S9EB 2LDIA 2PFDA 3TZYA 4DV4F 2COLA 4QIFA 3W8PA 1NHUA 3TOQA 1RT2A 2R7OA 4AUKA 5C5JA 2G4BA 1WC0A 3CSKA 2K3IA 2YKMA 5AJ3F 1KWMA 1FKAF 3QLHB 1RT3A 1LW0A 1VJWA 4IKAA 2PO4A 3MPVA 4OHZA 1QJHA 3LGNA 1CQNA 1AW0A 4N8OA 4HR2A 5K14B 5KT5A 5DG7A 3VGSA 3H5UA 1V3SA 1ULRA 4DPYA 5EGYA 4QYZJ 2OPSB 3OFEA 1C0TB 2WCXA 4DR3J 5CZXA 4KE5A 2UV8A 4J91A 2OKQA 1RHKB 1IQZA 1VMBA 1EETB 1CJVA 1S97A 2MKYA 2F4VF 1S49A 4Z2XA 2Y8WA 2GQQA 1HL6A 4QPXA 2PI4A 4M5JA 3TQ1A 3VGVA 3CIZA 4KH0B 2WSCC 3CDBA 1S1UB 4DL0C 3SFUA 1KBRA 3JQMA 4B17A 3TAMB 3V6JA 2QSWA 3C15A 2B56A 3H4BA 1N54B 4J9OA 3A1YG 2RS8A 3FQLA 3BB5A 5DDQC 1IR0A 3DGPB 4HLBA 1JLAB 2GIRA 1N6QB 4RBTA 4LBPA 4X64J 1UJ6A 2J5AA 3OXLA 3J80Y 2VBWA 3PO4A 1I5OB 2WBRA 3Q89A 3ZTSA 3VHQA 1NLKL 3NAIA 2VG5B 2HLUA 1PC5A 2HGMA 2Z58B 1PYOB 2HFSA 3JSYA 2Y1RI 5F8IA 4F4WA 4ZLPA 2MKIA 2C3PA 3GIKA 1JXEA 2F40A 2SXLA 3RYLA 2VICA 1ELOA 1RHMB 3OFFA 1IR2A 5KFDA 2XLJA 3PACA 4ZP8A 4IO9Q 1J5EJ 4H54A 4BDPA 5KT3A 3NNHA 2WSFC 4NZ6A 1VBXA 2GJIA 1RWMB 5A0YB 3KLHB 3CD0A 6AT1B 1R31A 4Y2IA 2W9BA 3R6LB 2DNNA 1RWXB 5T7LA 1ZBTA 2IRXA 4DF4A 3GPAA 3DHXA 4OYAA 5BXIA 2XY7A 2NXCA 2O01C 3BS9A 1GMUA 2RF2B 2PDAA 4F3MA 3J7A1 3ZXWA 1S7IA 2LQ5A 4TYAA 4ER8A 3UN2A 5BYSA 2KKHA 3CC2S 1AYEA 3L95X 1KHVA 2HZCA 4ZVUB 4ZCMA 5C2GA 2E7WA 3EZOA 4C0HA 4DG1A 3ILLA 1DLOA 4NZ0A 3D1HA 2AJ0A 1WEZA 5F0UA 5A8RA 4WFBQ 2ZH8A 4J9NA 3FCHA 3LPYA 2PI5A 3U7JA 1WORA 3QRQA 4QIEA 3VQSA 2XLIA 5I3PA 2HZAA 1AXQA 1IXKA 2D69A 3R5AA 2HFOA 2H4YB 4O3RA 3AJ2A 2HHSA 2LU1A 4B9NA 3DGPA 4QCLA 3W2WB 1U7LA 2H51B 3MUMP 1RTZA 2P9EA 3MR7A 5L1LA 2KXFA 1S9EA 1TQLA 3Q2SC 3GTYX 2XYPB 2KRBA 4QPTA 4BWMA 1UFWA 3RU0A 1IKVA 3L09A 3LOUA 4NL5A 3BDEA 4NRTA 5IM0B 1ZM4A 1HA1A 3W7BA 1YJRA 2KTQA 2LKZA 2IVMA 1EKRA 3HT3A 2B6AA 2XMJA 4FKXA 4YUDA 5IM0A 2RT3A 4F3QA 3FFIA 4N56A 4P2FA 1IBLF 3CB4A 2LLZA 1B4SA 1X9WA 2B7CB 2VOOA 4PWDA 2BUNA 2HNDB 2D3O1 2XEXA 2JEGA 5HATA 3CCUS 3ZO7A 4E98A 1X5SA 1FI4A 2ZE2B 2Q66A 3FBCA 2XNRA 1AFJA 3CCVS 2JHEA 2AIRB 1NAQA 5HK4A 3CJ5A 1LW0B 4NZ7A 2F5GA 5DDOC 4FF1A 3SQGA 2RKIA 3MR2A 4L3KA 4O3SA 4DV6F 1HYSA 5AXLA 4JI0J 2BQ3A 3F41A 2YNFB 3TVKA 4DG1B 1GMWD 2O66A 4B9TA 2IYIA 3CO9A 3W5YA 3MM9B 2L3MA 4M5DA 3ISZA 1C1BA 3LP1A 4ZA1A 5I3UB 3K89A 3OQ2A 4HT7A 2F4FA 3AAWB 2DHGA 3W3SA 3W2VA 1TL4A 3KKFA 3QIPA 1S9FA 3IS9A 3L7OA 4PG4A 3NBPA 3UE2A 3T5HA 4LF8F 3RG6A 1ZS6A 3OTOJ 2GVZA 4AE5A 2BJ1A 5HVGA 1X5TA 2EWHA 3MM6B 4DUTA 1M5PC 1UP1A 2WVBA 3G8QA 2KFZA 2B8QA 1PJ5A 2CQ0A 2CNLB 2DR7A 2XY6A 1U8SA 2BBEA 2QL9B 2XI2A 3AB4B 3M4XA 4ID8A 5B09A 4NLPA 4F50A 2EC2A 1EQMA 1U1KA 4QU7A 5E3AA 3HHKA 3HHLD 2WK4A 3HHLC 1VC5A 4DR1J 2ZZTA 3M8PA 4WTOB 2GAHC 3CCTA 4O3QA 2AP6A 1NEEA 3K59A 4LF7J 4K4UA 1KVIA 5E2QA 1N5QA 1JLAA 2DCLA 3FMBA 1FEHA 3ULHA 5A8KB 2C3UA 4OHWA 2AJQA 3T1AA 2ATLA 2AF6A 1YI2S 3I56S 2ZM6F 2AD9A 2UUBF 3H59A 4YR2A 5HLFA 1IWAA 3BH7B 3EGVA 5E5NA 1S9GA 1RU2A 3DOKB 4LMZA 2QTWA 1TL1A 2NYIA 2MQNA 3MMBA 4RW8A 4NRUA 1CJVB 3GFHA 5ETSA 1RTIA 2AJ4A 5L39A 3DRPA 2I6WA 4DV5J 1DTTB 4CO4A 1YHQS 1NH7A 4FF3A 1FRXA 2AHOB 3W2WA 1URRA 4B3TJ 3PXGa 2L41A 2L48A 4P6QA 4OJ3A 3KJQB 4ZS6A 5LSOA 2GQCA 5LM7E 5E3RA 2DK2A 3WC0A 4CLLA 1HWIA 5KOWA 5IS2A 1T7PA 4C8NA 1JLCB 1YJ9S 4RW6B 1AZSB 2HRYA 3B4MA 4WFYA 2C42A 4E8UA 1DY3A 4ZVHA 1N48A 1TK8A 4NCAA 1DLOB 1B70B 1WD6A 3DYAA 3I4PA 1QUVA 1RTIB 4X62J 2X3GA 1JK9B 3N79A 3NS5A 2D3ZA 1RKJA 1ZH5A 2E5HA 4MJKA 1IQTA 3AOAA 4DQSA 3MAAA 3FEYB 4USIA 3TQEA 4U7CA 5CHCB 4J9RA 3U1LA 4M5NA 1S6UA 4LSNA 4YY3F 3KLFA 4HT5A 2U1AA 2Z8QA 2VHGA 4ZPVR 1VLOA 1S0VA 3IAM9 3FRZA 5HQMA 2VA2A 2XHCA 4PUOB 2CQBA 4KFBA 2EW9A 3MDFA 4FYWB 2A2CA 2MMYA 1IBKJ 3DLHA 4OZ3A 4IH5A 4BHQA 2Y1IA 3DM2B 3VF0B 3W64A 3MPUB 2PEBA 4ZN1A 3R7BB 1FRMA 1SL0A 2ZH1A 3DC2A 4ES3A 5KT2A 3BGUA 4PPZA 2FIUA 1GXUA 1JJ4A 1UW9A 1S6PB 2CQDA 2HGNA 2ZOFA 4NA3A 4UUXA 4ZLJA 2H4WB 1MN7A 3LP2B 1MMNA 4UZBA 4RBVA 3QJJA 5G0RB 2OELA 4NA1A 4NLGA 1UAWA 5KFYA 1REVB 2A1BA 3GFZA 1Q1KA 3DRPB 2NXNA 2V8DA 4NE9C 5GAGI 1NB7A 3AD7C 2MLYA 1CJUA 2KFYA 1RT1A 2EEYA 2KT2A 1RT5A 5HQ8A 5GVQA 5KFAA 4DFMA 4KKOB 2MHEA 3UVJB 4WCEQ 4KPYA 1HBNB 2AEFA 2EFQA 2OO4A 2FJVA 5HP1B 1Q7YT 5HBMB 2B51A 5IFMA 2XO7A 1W25A 3JYTB 3SMZA 4KR0B 2UVUA 4FXWA 3VAGA 1QAYA 3T1YJ 2QEXS 2FGCA 5F41A 3P49B 3CT9A 5FIIA 2BE7D 3DYAB 5F9LA 5FDLB 4H4KA 4XPEA 2ADBA 1MROA 1EARA 2DGQA 2Z0GA 3BR9A 4LRBA 4KRWA 2XZDB 3KLIA 2F8MA 1Q5YA 3M8YA 4JI8J 1BGXT 5ETPA 3I6PA 4F4AA 3UR0A 2DGUA 4B3MF 1TKXB 2ZFHA 3C6UB 5HSPA 5D0HA 4JUZA 1NHVA 3QAUA 3OL7A 3VZHA 1F5CA 2ZKUA 4B3SJ 1C2PA 2JNJA 4YP3A 1U8WA 1WDTA 3GLJA 3HKWA 1YQHA 3GG1A 3QGHA 1CBKA 4AT1B 5D4NA 3C19A 2ZDOA 4CWBA 1YJWS 1H2VZ 3GONA 1R0AA 2XS7A 2LCWA 2XC9A 1VQOS 4B3MJ 3B82A 4KV8B 2KM8B 3CCZA 1BY9A 1DZ5A 2R7QA 4K4ZA 3KHHA 1BC6A 4ZVPB 2A3JA 3KLFB 1PJ7A 3MCMA 4HYKA 1L3UA 2OMOA 4GKKJ 4OZNA 4TNOA 2J9CA 2CNNB 1U2RA 1RAHB 4P9SA 1G3OA 4NLQA 4OV1A 5BYQA 3DOMA 1MU2B 5I3UA 2ZHBA 1FNMA 2GO8A 1N36J 3D0GE 1X4DA 3OT9A 2LDYA 3TUZC 4DL3A 4LF4F 4JI3F 2KFNA 3FKBA 2B0GA 3GR1A 3NAHA 3CCQS 2C3OA 3C16B 3FBEA 4CO1A 2UUCJ 2XSJB 1DARA 4P7TA 2F3JA 1XERA 2LXIA 3KMSA 1NJIT 1OQ3A 4B9SA 1IR1A 2YNHA 2BX6A 3ENWA 5IOLA 5A6PA 2V8HA 2YX4A 4ZMMA 1JLFB 2FLLA 3LO3A 2MLXA 3KDNA 4K2JA 2BR0A 4I2PB 4K4TA 1FDBA 4DUZJ 5J2QB 3CF5Q 3IMQJ 4RW9B 3PZPA 3W5ZA 3B8HA 1CG2A 4F04B 3D68A 2VD3A 2E5LJ 2RJZA 4WIQA 4Y28C 1CJKA 3MPWA 5LMUF 1KOOA 3RUBL 3M2RB 1L3TA 5K8PA 1WSVA 1S12A 3UPFA 4Z37A 5M2UA 2PSZA 2MYFA 2DGTA 2V68A 3M30B 1JLBA 1XJWB 2D1CA 4JI6J 5CQGA 2CJKA 3P6YC 4LIRA 1HARA 2CVIA 1TU0B 2W8KA 4DSFA 2PFFB 1NMEB 1PBAA 1FERA 1EAYC 2DNPA 2VFTA 2UZAA 3PDNA 3LALA 5D15A 4YN3B 4U7UK 2YTCA 4ZITA 4DQPA 3GU0A 2OMLA 1LWFB 1S1XB 2CVEA 2WONB 2BA9A 1W2IA 4C8MA 1RTHB 3UW1A 3Q8QB 1X4AA 1LK7A 1BXNA 4L74A 1U1RA 1U4BA 1RWVB 1EJ7L 1QM9A 2Y1LB 1DRZA 3R2DJ 2W9CB 1Y00A 1I94J 4J9LA 3NCPA 5CYMB 1S6PA 2DO4A 4HI1A 4DV5F 2LQ9A 2MY8A 2AJ2A 3BO2A 3OSNA 1HQUA 4I56A 3H42A 3KUGA 2CQCA 1OMSA 2QC3A 4WFXA 5K9FA 4ELTA 4ZPBA 4DR4F 4QZVB 1P1TA 3T1HF 1CVJA 3HLUA 2DNLA 3FBFA 2OPQA 2KN4A 3RR7A 4W92B 1U24A 1TUGB 4MT1A 3BQ2A 3GSDA 1NPRA 2X1AA 2AW0A 2F65A 4H4MA 3ZTOA 4CH0S 3T9NA 3TANA 2CRLA 5EWEA 3P8BB 2H3EB 3TX8A 2IDLA 4I2QB 1UETA 4U95A 4PG6A 3NNAA 4UF4A 3EXCX 2W9AA 1WI8A 4RNNA 3QRPA 3HSZA 1S0NA 3WIVA 3GFXA 3Q22A 5KFUA 4TVAB 4U9RA 1VBKA 5I4MA 3D1OA 3VV2B 5L9NA 1LW2B 2BE9B 3G4SS 3MM5A 4WKYA 1AROP 2DBBA 3MD3A 1FFSB 2XSJA 4M8LA 1WOOA 3ONQA 2JH3A 4IFYA 1I94F 5MLCV 4IR1A 3M8QA 3L9ZA 3NCQA 2E5JA 4IO1A 4X4QA 3KHGA 2VQFF 4WU2A 1UA0A 4OX8A 1PYSB 2BJ3A 3MPDA 4DI6A 1XK8A 2JRSA 3KLEA 4XAKA 1SBRA 1SKSA 3SCLE 2XLKA 2JEFA 2IPOB 2IMOA 1QUPA 3X1LB 3WDOA 4OYIA 2BDPA 1RB0A 1MWYA 4G1QA 2IM3A 5B0DA 3OVBA 4A46A 3HFVA 3AJDA 5T7LB 3VZIA 4GO7X 2B9YA 3T5KA 1S6QB 3QGPA 1B99A 1RBAA 2E7VA 4F4YA 4ZLNA 3RBEA 4C6AA 1GXLA 2W1BA 2MQ8A 3M8QB 1N32J 3HHLB 3NS7B 1LKZA 2UVVA 2MEWA 4ZVGA 3RJMB 1U1PA 1NJZA 5KT4A 5IWAJ 4DDFA 3RBZA 1IBLJ 4A8FA 2R7TA 2BOAA 1R8HA 3TVZA 5K8OA 2M7SA 1UEUA 1NSPA 2YKMB 7FDRA 3OLAA 3OR1A 3PYEA 3EDRB 1FHTA 1K9MT 2YQ3A 3CC7S 4RUCA 3GIJA 4A8KA 3J7ZT 1VOMA 4IRDA 1OPZA 1HD0A 2ZZNA 2NCKL 1QE1B 3IBWA 2YWWA 3U1NA 3T5JA 4O3NA 1HPZA 3HKZD 3GJQB 2CQIA 2W25A 5A2QU 2DR5A 1KONA 2O5DA 4H4MB 4I64A 4LFBJ 4FYYB 1JKHB 2EI5A 4JV0A 4ALZA 4OZ0A 2GVZB 4ED6A 4EZ9A 1U09A 4XO0A 4DR3F 5IT9Y 2DY1A 2LYVA 4ZPAA 3HMJG 6FD1A 1JQGA 2BANA 2VB6A 5DG8A 1FD8A 5GMEA 3D5MA 1DBDA 2ILYA 2OP5A 4DF8A 1IKYB 4U8VA 1ZOTA 1RYSA 1EIYB 1XNQF 2HBQB 3A8IA 1HBOB 3M6XA 4HH1A 4P71A 2OFHX 2FGOA 2WVDA 1WC6A 3KJFB 4NASA 4DX6A 3NWRA 4B9VA 2KHDA 1YRUA 4ECQA 4MK9A 2C1EB 3KLVA 1R43A 2GW8A 3R5GA 3J81j 2RS2A 4C8YA 1U0HB 1HMVB 4QWBA 2W9CA 3PO5A 3PYDA 4YHHJ 1H3DA 4NYZA 2ZWPA 4A48A 4Y2KA 5KTQA 2D3OR 1R6VA 3EZUA 5SZTA 3OVSA 1QDUB 2XYGB 4DFJA 4NLUA 4FP9A 2PN6A 3R7NB 4EO6A 5KFPA 4O0IA 4RBUA 1Q82T 2YH0A 1HI0P 1HNZF 2HQDA 1FO1A 4RPFA 4RR5A 4WK1A 2YX7A 3BO3A 3R1LA 4IG0A 4IRKA 1UL3A 5EDWA 5K5MA 2E9RX 2XS2A 2VFRA 2W7PA 3NKYA 2I1RA 2DNGA 2AKWB 3UNGC 1J5EF 1B0TA 1OS5A 4O0NA 3T6BA 2QZ8A 1R3NA 4RNFA 4EYIB 5DM7Q 2Q3PA 3MD1A 3X3UA 5B0BA 4Q0BA 1BWEA 3GYGA 2Q6CA 1N56A 2MQQA 4RX6A 3UD5A 1SQEA 4IQXA 1T9VA 2J8AA 5B0CA 2P6SA 3SDEB 4I6YA 4QWAA 4G65A 2RRAA 2B4UA 1R0AB 3T1YF 3DNCA 2V6AA 4DUYJ 2NXUA 2K7JA 3BREA 2F8EX 2CNOB 4X66F 1JNZB 2KM8C 2E1MC 2HVEA 3IRXA 4D3HA 2LQJA 2G13A 1GAOA 2LA4A 1HQEB 2QYGA 3EMTA 3Q8UA 4ZVSB 3G86A 2QA4G 4TLRA 2RQKA 4OYZA 2GQ2A 2LMIA 4RWWA 3VTIA 3ZNJ1 1UPPA 2JVOA 5LOQA 2HBZB 2UXDF 1NCLA 2POKA 2CQ1A 2QN6B 3CCWA 3FK4A 3MR3A 2IC3A 3FGVA 2ZD1A 1L5UA 3JSMA 3QO9A 1HW8A 2VBYA 5DLFA 4CYUB 3QSIA 4ZPCA 3D9BA 4WE1B 5B7WA 1ZTWA 4O4GB 3SEOA 1U6FA 1Q81T 1FKOA 1IJFB 1YDLA 3S01A 2BJEA 2PEHA 4ZIWA 4Q45A 2VQEJ 4UOGA 5ETTA 3CJ4A 4EBEA 4FYVB 1T0TV 4DSIA 2GCFA 4LFCJ 2C2DA 2HHPA 1YJ7A 1Z2ZA 5E0OA 3TZXA 4RUAA 2IA6A 4QIWD 2DT9A 2H1YA 4OLPA 1M90T 3N6LA 3ZZZA 2KG1A 4DSLA 3J7YI 1KVKA 2FHMA 1HWUA 2CPHA 1YJTA 2FJXA 2PE8A 1TFWA 2RUSA 4C8KA 4X62F 1WG1A 2FQQB 3H5XA 4M63A 4LF4J 3PJXA 1HQUB 4Y00A 1UEKA 1CJTA 3W60A 1NK6A 1GFWB 1HNVA 3R5DA 5D78A 3PY8A 3M32A 3MCOA 3R5CA 3JTOA 1DTQB 4UOFA 4UZCA 2IBOA 3M9MB 3CD6S 3OLBA 2M52A 3FMWA 4J9UE 3WX4A 5IZHA 3DLEB 4CLWA 4Q5VA 4PPDA 2RHSB 1FXLA 3GP9A 3DLGB 1M5KC 3VCDA 2XO6A 2HHHJ 2GJ2A 3PR4A 2FB0A 2K2PA 4I69A 2Q79A 2Y0SD 1VRTB 2HNZA 4QYZK 4RLEA 1WHYA 2NUHA 4FNIA 1I51B 2J0SD 3QT6A 4GKJF 4OHVA 1JKHA 4PXBA 1C0UA 1S1UA 3W2VB 3BZQA 4DUYF 3FQKA 1N5TA 4DU8A 5EWFA 2CZ4A 3KWMA 4X4PA 2ALYB 1MSWD 5KFJA 2GS8A 3SBMA 4HHJA 5F3TA 2UU9F 2BM0A 3C46A 2ZEJA 2ZBCA 2HQGA 5ETLA 3GYNA 4QIVA 1MLAA 1QVFR 5EWGA 2WZ1A 4I2PA 4I4BA 3QYYA 4ELUA 1MNEA 3ZZYA 1TL7A 3HJFA 4DPOA 4Y2MA 3M2UB 3ZNUA 5ETQA 4OHYA 3T6JA 3LP0A 3MOZA 4KO0B 3TEGA 4PWDB 4ZP9A 2E1PA 1WJ9A 4WU3A 1LWEB 4C3KA 1NPPA 3H40A 2DPIA 1TK5A 3WX8A 2WOMB 4JB8B 2FUG9 2AU0A 3N28A 4N77A 2ZH9A 4LSNB 3GIIA 1MU2A 4CNZA 3G6VA 4GC6A 4XTTA 4USUA 5THWA 1U25A 2R4FA 2BJDA 5HLFB 5D4OA 4WJBA 1NO8A 4HL9A 2NUUG 2FJBB 3CPWR 3DMJB 4IG0B 1K73T 1H0HB 3F56A 4I7FA 3E51A 1VRTA 3UR3C 1P6TA 1Q95G 3G9CA 2GGPA 3IC1A 1XMOJ 1GH8A 3O3LA 2DRBA 4JI7J 4FS1A 3D0HE 3H25A 1Y0HA 3LP2A 2XYHB 3NY0A 2HAIA 4RL1A 4UQTA 2XMAA 3NGKA 3VALA 3BGOP 4MK7A 4DFKA 4ZVQB 1MG7A 3I5BA 3EGZA 1AFIA 2QLXA 1M1KT 3QGIA 3W65A 4DR7J 5EUHA 1K47A 3O6QA 2QLFB 1E6VA 1R8PA 2Z2YB 1RLCL 3MECA 3MTKA 2VH7A 4X66J 4DV6J 2VUGA 4HDHA 3WC2A 3B54A 4V19J 5IT9U 2X51A 3CO0P 2KVIA 2ZBQA 4BBYA 1S9GB 3DOKA 3MOJB 1FRKA 2V8GA 4FBUA 3ISND 3TA2A 1XTZA 2GNKA 2N4CA 2NPIA 1KHWA 5L1JA 2KZMA 4TXSA 3AXMA 3IGNA 3DXBA 4QW9A 2WTFA 1BQMA 2FVSA 5GAEU 2R2SA 1RT1B 3MTJA 3HM9A 4N8NA 2D9OA 4ILRA 5KT7A 4DLEA 2N4DA 4UQGA 3P3DA 3TUIC 4F2SA 2YNFA 2MZSA 1F2GA 1RAFB 2CYYA 1S4EA 2GO9A 3UN5A 4F7VA 4QYRA 5DZ6A 1FCAA 1RAIB 1HBUA 1FWLA 2RKIB 3EM1A 5DZ7A 3OJUA 1SJQA 3W63A 4EU0A 1RA6A 2E1AA 5AXNA 2WONA 4NXNJ 2B4OA 3NGTA 3NXZA 3BPSP 2AT1B 1IN0A 1E6YA 3NOCA 1FD2A 2FPHX 4X65F 1H6KX 2GGPB 3D7SB 3MFIA 3FSXA 1S1TB 3AQOA 5F9NA 2E5IA 2ZNZA 5CABA 2YPYA 3C8YA 4X2BA 1RLDA 2DEIA 2FC8A 4YQWA 5RUBA 4ZPTR 3VAIA 4DLGA 1B7YB 5D8HB 1CJKB 4EYHB 5LMNJ 2IDEA 2WVFA 1HPZB 3AA9A 1W2BR 2M88A 2MJUA 3AOBA 4GVBA 1NDPA 1K1SA 1ZM2A 5KG4A 1BQXA 1FJEB 2RMLA 3G87A 3OTBA 4ZVEA 4NLVA 5BYRA 4CM2A 2JEIA 1WC4A 3N5FA 4YB1P 2AV5A 3H98A 3ZFVA 5J1PA 1R7IA 5F8JA 1SH0A 1T3OA 2DXFA 3ITHA 5HO4A 3KHRA 5C24A 5DGAA 3POTB 4M94A 4LR7A 5CYQB 3LPEA 2GX8A 1SUQB 2V50A 4ZP7A 3SXLA 5KFVA 3WBZA 3E2EA 2HWHA 4X4SA 3ITHB 1VIOA 4FKYA 2EBEA 3FZ2A 3N9UC 3OFGA 3R9LA 1KFSA 3PYFA 4DPTA 5L38A 2L08A 2YQ0A 4JP8A 1WF0A 4U6PA 4DCPB 3Q83A 1C1CB 2HQCA 2AYEA 2YPZA 4GRSA 3UQSA 2ZH4A 5I42B 1PGZA 1UJ5A 2V9KA 3QQCD 2EFVA 2XBPA 4WFZA 2FHJA 3CJKA 2A0FB 4OLOA 2WBMA 4ECUA 2BZ2A 5ETVA 1GK8A 1RGVA 4ZVFA 2B3TB 5C42A 1VQ7S 1R0BG 2PGCA 1RP5A 3BGRA 4USHA 3EGNA 4ZPDA 5A0YA 3KDOA 3KLHA 1M1HA 2VG7B 3OUYB 2CG8A 4P2SA 2ADCA 3W1YC 4B3TF 5A8KA 4C8LA 4JI1F 4OI0A 3QRRA 1W26A 4KTQA 1XWLA 1BE4A 4OHXA 2PA3A 3TAPA 1TFYA 1GEHA 1NH8A 2MB0B 2ZH2A 1ZA2B 4RKUC 1SJRA 3Q8RB 3Q8PB 4C9DA 1JB0C 1FX4A 3JTPA 4MAKA 1RHRB 2OGUA 3L3CA 1LW2A 1NKCA 2F4VJ 2BABA 4NLRA 1SQFA 4OV6A 4EBDA 1JLEA 1SV5A 3E01B 1H2UX 3IG1A 2AGQA 4FBTA 1RWPB 5DS7A 2F9JA 4HEA9 4DV3J 1MWZA 4R0JA 4DCJB 3RRKA 5GAHI 5AJ3J 1QSSA 4G3IA 3NGSA 1IKYA 2KDOA 4K59A 4DOZA 4ES1A 4B9MA 5ETNA 2KH9A 1WG5A 4CLYA 1B0PA 4ZP6A 3H5SA 1S6QA 2DGWA 3GCXP 3HSDA 1S59A 4TYBA 2FLNA 1PKUA 2QFIA 1ZAVA 2QMWA 4DR1F 1U6ZA 1HIYA 1N34F 1QY7A 3NGRA 2FYXA 2EFGA 3PV8A 1VIXA 4ILLA 4YOEA 4NOHA 2W2QP 3MM9A 3OTDA 3K5PA 4M5DB 2B4VA 3VQTA 2NZ4A 4I1TA 4HTJA 1BUXA 2YNIA 2LQBA 1KD1T 4P52A 3DDNA 4IYQA 4LSZB 2N7YA 4C98A 4EEYA 1HYSB 3S1TA 2OD4A 5IC6B 1NK4A 3KNGA 3PM9A 4YB7A 5IQ6A 4WXWA 1VQNS 4XDCA 1TMMA 4C97A 2NXJA 4XIUA 1QAXA 3SYZA 4N47A 1F9EB 5KG5A 3BV8A 2ZE2A 4KFBB 4Z7CA 1X9MA 1RWNB 2DKOB 1OY6A 3MMCA 4LQ3A 4CP5A 1GMVA 1Y3JA 4LVNP 1A9NB 4TQRA 5KFZA 2W2OP 5C42B 1RACB 4RZRA 2D9PA 2KU7A 2KO1A 2DIUA 1F3FA 1V5IB 3RAXA 3MFHA 3V4IB 2AZ1A 3T1HJ 1HNXJ 2XCAA 4NA2A 4J9PA 2HWIA 1FRJA 1Q5VA 3CJKB 3GFYA 2R8IA 1T9XA 3PNIA 2AYMA 4Y2CA 2KVQE 5FD1A 4C48A 4AXIA 4ELVA 4PXDA 4C4WA 3KLEB 1S1TA 4FS2A 1V3RA 5KFSA 3K5MA 4LRAA 2OHDA 3EJMA 2CWKA 2IAJB 1YRTA 2MKJA 1CLFA 3KTQA 2CPJA 4P2XA 2W8LA 3D6FB 9RUBA 4ES2A 4DS5A 5B0AA 2GC8A 3IRWP 5KFKA 4DZDA 4OJHA 4XPCA 1SL2A 4F2RA 2IVYA 3DRSA 1RU1A 2E66A 2RVJA 1S1VB 4LBIA 4OYPA 1N33F 3DRRB 2PMHA 4DV7J 2YKNA 2O67A 2APOA 1AB8A 2DHHA 3DOLA 4P74A 4DPXA 3DMJA 5FDLA 4JI2J 2MJNA 3MM8B 2V94A 3RW6A 2RE1A 3GR0A 3D6MB 3M9NB 1VJQA 1TL1B 3IN5A 1BQMB 4KH1B 3VAFA 2AX1A 4A8XA 3ZTPA 3MR5A 1OQ6A 4FXVA 3SSQA 5KFLA 2VQFJ 1VI7A 4LFAF 1LEOA 1S5ZA 1WKKA 1TK0A 4C0BA 5H1SV 2OAUA 5DETA 4ED1A 3C3LA 2CPIA 1SC4B 2JWNA 5CD4A 1UVIA 2FD2A 3ZZOA 3VR1A 3LH2S 2BVZA 5E7OB 4PXCA 5D0GA 1BQNA 4K4YA 1E6VB 3MECB 3DDKA 1UWAA 1LWCB 5J2NB 3T19A 1WTBA 5J2QA 3AQPA 4TU9A 1VR6A 2ZC3A 1I3OB 5AXKA 1VISA 1HBMA 2MSSA 1KN6A 1GMWA 2DGXA 2XMKA 4PABA 4L75A 1N5VA 4NLWA 1HBUB 1JLFA 2JOQA 4DCOB 5GAGU 2MKCA 5HANA 1NJXA 1RAOA 1FA0A 1VHFA 1B64A 4CT8A 2CAJA 1RT3B 3AFGA 2RB7A 3CCRS 2VA3A 3PCOB 3CJTA 3GJTB 3SI8A 1VRUB 4DXLA 4JV5F 1TR0A 3P5TL 2K7KA 1Y9OA 4WP8A 1VQ5S 4ZCLA 2J76E 1VQLS 4M1KA 3MZIA 3P4UB 3OL6A 1C0UB 4AL6A 2DISA 1RYRA 2NLWA 5F8LA 5D0RA 1RTDA 5HP1A 2QJ3A 4FN5A 2OJ3A 4HDGA 2JLFA 4K8RA 3DN9A 5DJBA 2HNZB 3D54A 3EVMA 3OVAA 4Z7YA 3IM9A 2DNMA 5H9EJ 4USMA 3MM8A 4AD6A 2H5JB 4ZOSA 2KJWA 2ASJA 3BQ1A 4LT6A 3EVWA 2DR6A 2G9OA 3FSIA 1NDCA 4TU8A 2DVIA 1S76D 1VQ8S 3TR5A 2J0QD 3TRGA 3D1QA 4ID5A 3KK3B 2F8HA 3DLLQ 1ZM3A 4KO0A 3G8TA 2UXBF 2FC9A 1CJTB 3QFHA 2GIFA 2BV3A 1R8BA 3GSIA 4CO3A 2ERRA 2LQ8A 1WI6A 4ID5B 2J7UA 3A8KA 3S8SA 5C25B 1FRHA 2DITA 2XB2D 5D4LA 1UWBB 2B9EA 4M5IA 4UUWA 4ECYA 4A8YA 2DGVA 3OHBA 2ZH6A 2CZVC 1MROB 2CG4A 3QIDA 3BH6B 1IKXB 1TV6A 1RE1B 4MIBA 4CCHA 4KGXB 4DV0F 3M8SA 4F26A 2FY8A 4OX7A 3MEGB 2I5JA 1HWJA 4ZVTB 3RW7A 2FLPA 2DNZA 3NRBA 3M8ZA 5KFBA 1X4CA 2OLWA 5E33A 2FHJD 3DLKA 4P2MA 2F7VA 2XWYA 4DV1F 3F73A 3PW5A 1WF2A 3QO9B 4NLDA 4QOTA 2WOMA 4KKOA 3UVJA 3WZ0A 3K58A 1ACMB 1M0SA 5DO2A 5LXRA 2Z4PA 1T9YA 3CCMS 1KEKA 1Z1ZA 3I4HX 2MKKA 1RHUB 2OPRA 4YB5A 4CLFA 3OTOF 4H4KC 2UXCF 5KG6A 2WVCA 5HMYA 3MAQA 3M9OB 1KDNA 4LF2A 4USTA 3AHPA 2VL1A 3BN4A 3QWUA 5A8RB 4N7TA 3OD2A 3UCZP 1TL7B 3OTEA 3CCJS 3A13A 2ACMA 1J2VA 1YJNS 1T05A 4PQUA 3ZZUA 1DTTA 2E44A 3KOAA 1FESA 1CULA 5C7PA 4KJIA 1QSLA 4USJC 3BSNA 4DV7F 1HNIA 2HNYA 4ZIVA 4YY3J 1H2TZ 2NSCA 2OEMA 3LW5C 3PX0A 1H38A 1KTVA 3UNYA 2ZHAA 3CJQA 4KGVB 3H0PA 1DHMA 4PWWA 1W7WA 4DN9A 5DQHA 1N88A 2M3DA 1YWXA 2UV8G 4J90A 1OSDA 2ZOMA 1YK9A 2HIQA 4UOHA 1U1OA 3HHDA 4G1PA 1C1BB 1V5VA 4IOAQ 4K4XA 4JV2A 2HHQA 2HQ3A 4KT0C 1ZZFA 2BW2A 2ZKTA 4QJVA 3VAKA 3CJ2A 1ZZNA 1YLXA 2L9WA 4DHVA 1I6JA 5D3GA 2YVSA 3ETOA 3THVA 1RDRA 4NLXA 1HQ2A 1L3SA 1YBAA 4HACB 1RQ0A 3EPIA 2ZZMA 2PD1A 2BE2A 2P8IA 1J27A 2ZJQQ 2CPFA 4ZVRB 4S0MA 4E2FB 3TUJC 1TL3B 5E3QA 4F25A 4B3OA 1UFKA 1ZM9A 2B4PA 2YNGB 5K8NA 4ED5A 4WFAQ 4CLZA 2HW3A 1T9TA 1XMBA 4IFVB 1S57A 2H5EA 2QE5A 3QATA 3A3OB 4Y65A 2E29A 3FZBA 3MI7X 1FF2A 2NQPA 4P73A 3TVYA 1L3KA 5LJ5Y 1N0VC 1PJ6A 2ZBPA 4RW8B 4DSJA 1O51A 2IMWP 3KG1A 1EP4A 1PBUA 1Q7LB 2CFXA 3MUTP 2HPUA 2VBXA 3W8GA 1HNZJ 2HS0A 2BKNA 4KY3A 4X4RA 1L3VA 3VGUA 1FNXH 2BQRA 4OYMA 1DQ8A 3BYPA 4CYUA 3PTWA 3V81B 2QL5B 4MKVA 1N34J 1C4AA 2M9KA 3BEGB 5F8MA 2W2NP 3OR1B 3US5A 2CQ4A 1HFEL 3UI3A 1WELA 1P27B 4JBCA 1RWWB 1TAQA 2KB2A 3BBFA 3MEEA 3W66A 4CM0A 2XGQA 3PW2A 2W4PA 4WP9A 3BF4A 1NK9A 1F3VA 2HK3A 4ZPWR 1GXTA 5LSLA 4JI4F 4HH0A 3MWBA 3FEXB 3JB9k 2R8HA 5ETRA 2WSEC 4JV1A 4PRFA 4F67A 3TYTA 1SCJB 3R1HA 2XHWA 2V69A 4DR4J 3KLIB 3MEKA 3PRBA 4Y34A 3QZ8A 1HBOA 1Q79A 5DG9A 1P9YA 4ED7A 5L8RC 4IUFA 4F4KA 1ZA1B 2RRNA 4W90B 2CPYA 3I9ZA 2A18A 4KAIA 1SJ4P 3G82B 2GVDA 4JYAJ 2XTJP 3IA0A 1F9FA 5LSRA 5D4PA 4X64F 1KQFB 5GMDA 4LVOP 2VKRA 2YNGA 4Q8FA 5F8HA 2MQLA 2FY1A 2H48B 2C28A 4ECTA 2MDAA 3CJ3A 2VKZG 3IR7B 4UW2A 2KYZA 2UUWA 2CIMA 2NPFA 4OX9F 1Q8LA 4ZCKA 4Y0FA 1FJ7A 1R6YA 1Q16B 1FXDA 5DDPC 4DL5A 4F3OA 3NNCA 3N0VA 2HRTA 3C14B 3TARA 2AEJA 2J9DE 4RWXA 2OTJS 3LUYA 4AL5A 4DR5J 3A3NB 4MKAA 3W9JA 3KLGA 3L7UA 3DM2A 5JVHQ 5J2MA 2X1FA 2JJ4D 2HURA 3D66A 5HI7A 1VDHA 1HNXF 2K3KA 1T94A 2WB1D 2UUTA 2WB4A 4NCGA 4RNMA 4JI4J 1YVFA 3M30A 1U45A 4LF7F 4QWCA 4LF6F 1AT1B 3DKDA 2Z2ZA 3A8EA 1UEVA 4WP3A 3GJRB 4DV2F 5KFNA 3ENAA 3KFWX 2LEPA 4AYBD 5U47A 4PR6A 1ICEB 4NEYA 3ZZRA 2FVPA 3HCXA 4WE1A 4IR9A 1JLQB 3HD2A 4XDDA 1K1QA 1EX8A 2VG6A 2DH8A 3DHWC 4AFFA 4C0OC 3HSGA 5CYMA 3OL8A 2XCPA 3BDPA 1WOPA 4U96A 2PMZD 4LF5F 1SIZA 1SIWB 4FXDA 2VG5A 1JLCA 2D3UA 4DV3F 4J9VA 1H98A 3AODA 2RRBA 1DJ0A 2OPRB 3LGHA 1CEZA 3PHTA 2KHCA 3DU5A 1JLGB 1LWFA 1RCOB 1S1XA 2RILA 1XNQJ 2CJ9A 1VGYA 3BGLA 2HBYB 4RUHA 4GMKA 4LFAJ 4DFPA 4OI3A 4LFBF 3QSYB 2YNIB 1SC3B 4ENOA 5CD4H 2XGPA 3VAMA 2KZZA 3LWLA 2X7IA 3NS6A 4DQQA 4EFAC 2DGOA 2NZCA 4BS2A 1HWLA 4CZCA 3Q8SB 1IKWA 1GTHA 5IV4A 2JFKA 5KFTA 3KG4A 3GV7B 3N6MA 2ZBRA 1TKZB 1FRIA 3CD5A 3UN3A 2UP1A 1R0CB 2QRRA 4DBQA 9ATCB 2CZ9A 1BMQB 3DFEA 4J37A 1G4CA 1TZ0A 5FLXU 4ECRA 3CDWA 4IG3A 2LA6A 1FDDA 3C66A 2FHOB 3OR2B 3UO0A 3L7PA 3C6TA 1ZETA 1S0MA 3Q2TC 1A6LA 5JVGQ 4H4OA 2LXFA 4ECSA 1XR7A 5GADU 3PX4A 3OW2R 1Y11A 3M2UA 3OV7A 3C14A 4AL7A 4C8ZA 1SV5B 3E01A 2QLWA 1JXVA 3RGIA 2RQCA 1VQSA 2UUAF 5KG1A 1F60B 3HJVA 4CRJA 2V8PA 2HMIA 1JWWA 3JTNA 1WSRA 4ITSA 4TY8A 4LR9A 3V5RA 2QMXA 4ZCIA 2HVDA 2N82B 3DDIA 2IM0A 3QNWB 2XG8A 2FDNA 3JAMU 4USVA 2BMBA 4OYOA 4NEZA 2MZJA 2AJ1A 1OSCA 3B6BA 1H7WA 4GO5X 5JUMA 4QIGA 5E3PA 3MM7A 3ZTRA 3RRHA 3HVTA 5ADZA 4ETXA 5D6GA 1OPIA 1GX6A 1OWXA 2FZCB 2YKQA 1U0SA 5KAKA 1T8EA 4U7UD 4OYBA 3R27A 3J7YU 2G0IA 4F0MA 1ROFA 3MF5A 4N41A 2EXUA 3LF0A 3PFOA 4OI4A 2M70A 1VQ6S 1XIQA 1HNWF 4A8QA 4NLSA 1VQKS 1VLYA 2R8GA 4X4UA 2I9SA 3RR8A 5JMNA 1VQ4S 3C6UA 2HSEB 2KT3A 3QGGA 4L6V3 1TVRB 2GMHA 3AD8C 3K8WA 4CLSA 5K14A 4PXEA 2FJDB 5LT5A 2E9ZA 2MGZA 5DM6Q 3G96A 2YNHB 2Q1LA 1NRKA 5J2NA 3PRVA 4EI2A 2I2YA 1BQNB 4X4VA 1XMQF 4PEOA 2EG2A 1WKJA 4DV4J 5J2PA 5AE1A 5J1EA 3K17A 1FVSA 1FK9B 2JVRA 2J0XA 3CCLS 1JMTA 3BGFA 2DNKA 4I6WA 2BEFA 4IDKA 4ANEA 4ECWA 3JYTA 3R2CJ 3CTRA 4KHPF 4R8UB 3PJ9A 4Q2MA 3ZTQA 4LSLA 5DLGA 4NXNF 1O5JA 2BJ7A 3EDQB 1JJ2R 4R5PA 2I5JB 3FEZA 2ZJPQ 4PAAA 1YZ6A 1RT5B 1S6OA 2RIJA 2VZ9A 3O8WA 4OZ1A 4G1QB 3I0RA 3FCVA 2WHOA 1VBYA 4OX9J 2F9DA 1X7VA 4UY85 3LAKA 1NNDA 5I42A 2YKNB 2Z2MA 4KGKA 3ET6B 4IFVA 1WEYA 1P8GA 3BO4A 4ERDA 3QT5A 1J5OA 3VVUA 1SH2A 3DU6A 1Q53A 2BW7A 3FCWA 4J9MA 2I38A 5KFGA 1D9FA 2Z2LA 1KSPA 2HHHF 1RT6B 2BACA 4Q2LA 2HHXA 4FYXB 3OPKA 3N01A 3H4DA 1G7CB 2OIHA 3P5BP 3HZEA 3QLHA 5L9XA 4Q8EA 2VFVA 1TUWA 4WIIA 2DPJA 3CIMA 1HD1A 2MSTA 3SDEA 4LFCF 3H20A 3NLCA 1U1MA 1T9WA 2QT7A 2V34A 5L1KA 5EX0A 2DHSA 4M95A 1VQPS 2DCUB 3FVYA 3PR5B 2NR0A 4Q0BB 3GV8B 3Q23A 1U1QA 1KVJA 4ZHRA 3TA1A 4O44B 2RF2A 2V2QA 3KUEA 1X9SA 2EK6A 4FPRA 2C2MB 5HJXA 4DR2J 2R7VA 1JNRB 3D2WA 2HQFA 3A8JA 3PG9A 5BR8F 1ZTTA 4OZLA 3FNNA 3CMQA 3ILIA 5HROB 4DR2F 4I0WA 2EK1A 2G2OA 2HGLA 2KXHA 4K5RA 3IM8A 2ZH5A 3M8PB 3M05A 2M2BA 2VJUA 4EZ6A 2QO3A 3DRYA 4YMEA 2G2ZA 1YJUA 5A8WB 1H73A 1RKIA 3EYZA 2G1HA 3ZZPA 3HT0A 4HACA 1YBTA 3CJSA 4CLKA 3HXMA 1NKEA 2DR9A 1X0PA 2G1DA 4G1IA 2WAQD 2ZHOA 1TTHB 3EICA 2DHXA 3Q0AA 1RTHA 5KG0A 1R8AA 2GZOA 2C2KB 5IT0A 3OHAA 3HSJA 2JLEA 3NG8A 3N5BA 3SSSA 2ASYA 3IR5B 3UDLA 4R5PB 2OSQA 4NXMJ 1D0EA 2ILZA 1WG4A 2XMUA 5K8MA 3BKFA 2HZVA 2J7WA 1RAGB 1FJGF 2IA0A 5KG2A 3TAMA 3QIPB 5GAEI 1AA1B 5KFHA 2GMJA 4J9KA 1KRPA 1Y4ZB 1X4FA 3I9V9 4DL4A 3HO1A 2V2VA 3M2RA 1NK0A 1RHQB 4O4GA 4RJVA 3Q24A 8AT1B 5HQLA 2XS5A 1O0PA 2ZM6J 1WKLA 3KJVA 4F4ZA 4OYWA 3QZ7A 2Y8YA 1Y7PA 1SC1B 1U26A 3NGUA 4PQUB 3AY0A 1AZSA 4CH7A 4LR8A 3R3TA 5K20B 1CC8A 1TVRA 3DRSB 3MUVP 2P9CA 1YIJS 4KQZA 1HQEA 1UVMA 4H4OB 4NI2A 2UU9J 1F5AA 3D4JA 5IT4A 4GKJJ 3F0NA 5HROA 2W7AA 3K7RA 4NMLA 2EFOA 1T03A 2FVQA 1QLNA 1HI1A 3AD9C 2KRRA 2JZ5A 4DPWA 2CQ2A 1RABB 2C2OB 4ETZA 1VC0A 1SQGA 3UFCX 3NMAA 3CXCR 2DO0A 2RQMA 3R5JB 3AXKA 2CJYB 1IKVB 3DXSX 4G6VB 1OY8A 5CA5A 4LF1A 3A12A 2RU3A 3GIRA 3LP1B 1SJFA 1RTDB 2M8DB 1LXNA 1R8CA 3QJPA 3IR6B 2EFPA 1UW4A 2V4RA 4K0KF 2HVHA 4ANDA 4PG7A 4WYWA 4JI5J 2VFSA 1SI9A 8ATCB 1LWEA 2GHPA 4O3PA 1VRUA 1XEZA 1KOHA 1IM4A 3TWZA 2B8PA 1U02A 3HVAA 1TL3A 3QJLA 5C24B 4PYAA 4IRCA 1IBMF 2HFVA 3HFKA 1U0HA 3OL9A 1DTQA 1X4EA 2UUAJ 1DFDA 2BRKA 1S7HA 1PAEX 2QSFA 2HHWA 1OYEA 1UVKA 2GHWA 1LOUA 4L73A 3ET6A 1URNA 4MKYA 5KT6A 1F0XA 3LAMA 1RUSA 3UDVA 1VK8A 4W98A 4ICLA 1N32F 1GT8A 2RD5C 4LRCA 2BKPA 1FWKA 2CPDA 2P2CB 3SFGA 4OZJA 5ETOA 1S4FA 1XQIA 4J5OA 2C2RA 3KUHA 5HJYA 1FDNA 2OEJA 3KG0A 1F2HA 2K1RA 1Q0NA 4YFUA 4DX8H 3O2IA 3MM7B 5IWAF 1TAUA 3IS9B 1NSAA 3HVWA 2M0GB 3GWCA 4URGA 3BKUA 1SJ3P 2B43A 3JAMY 3KHLA 2ASLA 1FVQA 2ZC4A 3I82A 1WF1A 1WACA 2XMTA 3BYRA 2DJWA 1PC4A 2UVWA 1MMLA 4HTIA 4LQ9A 4JYAF 4DEZA 1KLNA 2V2ZA 3KK2A 3MGJA 1PYTA 2MQOA 3J81Y 1ZAXA 1RSCA 4URQU 3H2UB 4JOUA 4KC5A 3CCES 4I6AA 4QWDA 2UUBJ 3CMES 1NDLA 2BYCA 1G2EA 5LL6d 4FVCA 3M6UA 3SCJE 3SZ2A 2R8JA 2DRAA 2RNEA 3R5BA 3JS9A 2BANB 3QAEA 4X4OA 1WC5A 4JV5J 2ZOGA 4RW7A 5CH7B 4OI2A 1UMJA 2GHVC 2AQ4A 5HVHA 1WDDA 2X1GA 2J9DA 1S72S 1JJCB 2H54B 1EETA 4U67Q 1M5SA 2X3DA 3H2LA 2C22A 5B0EA 1D8ZA 5HL7Q 1EKSA 2XZWA 5ETKA 4RU9A 1Q86T 2OFGX 4CT9A 1XC9A 1GX5A 2H5IB 3VWSA 2YWHA 1KLMA 1TMJA 1Y5IB 3CJ8A 4YHHF 4TU7A 2QLJB 4IFYB 1V3ZA 2EKNA 5E3CA 4C2MA 5LMNF 1YITS 3N4WA 2N3LA 2XMVA 3W9HA 1VFJA 2YWFA 1QAIA 2LEAA 2XNQA 2VC0A 4RW4A 1YBUA 1K44A 2AWZA 3DCAA 3HULA 2W7OA 3HF5A 4QU6A 3C16A 3Q86A 1HHSA 1SVDA 2VG6B 5KFOA 2H9ZA 1D1UA 3D3CJ 4PQAA 2NREA 4IG3B 3K57A 4LJMA 2YY3A 3E3XA 3RBXA 2B5JA 3TX0A 1HW9A 2WVEA 2ZUGA
chains in the Genus database with same CATH topology
1FNOA 3ICLA 3MMAB 4OZ5A 3BN7A 2ROPA 1RISA 3EGWB 5AE2A 1M5HA 3I0SA 3CMAS 2I8EA 3NL0A 3THTA 2HVZA 2VPYB 4HVZA 1B7FA 5KFIA 4R8UA 1T03B 1XBWA 1R89A 5KG3A 3V2UC 4IH6A 1VC6A 4RU2A 2J9EA 3GMGA 3RAMA 5J2MB 1E6YB 5B0GA 4IH7A 4ED0A 1XNRF 2QYCA 1QAJA 4X4TA 5KFMA 2MZRA 3V6DB 3MM5B 1X5PA 3RB6A 1N52B 2DH9A 1VS3A 1FT8A 2JSXA 5KOXA 2IYGA 1ZPVA 2AYGA 2MKSA 5D77A 4EUVA 3NWGA 4IOCQ 2R7SA 2ABYA 2KT5A 1T02A 1RWUA 3AB2B 4B02A 3PX6A 1TP7A 3VAHA 3PVXA 2IM2A 2OPPA 2FVRA 3BGRB 2CQGA 1KNZA 3MR6A 1Z2LA 1LXJA 1VQYA 4NLTA 4ZK7M 3CCSS 4ECVA 1TL5A 2OPPB 3RTVA 3MEDA 3FRYA 4JI5F 4ICLB 4NPOA 2C2EA 2OPSA 3DLEA 3JSBA 5CCLA 2RUGA 5FLXY 2OSRA 1RTJA 4PWUA 4CTAA 3B78A 5HN0A 1WNEA 4MIWA 1KS2A 4TY8B 1JLEB 3SSRA 1HI8A 3DRRA 5GMKa 4ED3A 5DGBA 1TKDA 3H8YA 4GKKF 2VV5A 1VBZA 3NMRA 4MH8A 1SUQA 1KQSR 1FJCA 1DAXA 3POTA 4LIWA 3I5AA 1SKWA 5AE3A 4OFZA 4MMOA 1KC8T 1JX4A 3GQCA 2HNDA 3EX7B 2YKOA 2VG7A 3OUYA 2R7XA 1LK5A 1JLBB 1TKTB 3OSPA 3IFEA 3K8VA 4WF9Q 3OXGA 3CWJA 2MQPA 4BWJA 4YR3A 4ECZA 2Y1JA 2EBGA 4OMFG 1IKXA 1TV6B 4D3GA 3I32A 2KYXA 2ZD1B 1GTEA 1A7GE 3IWXA 4NXMF 2ZH7A 2GMLA 4B3OB 3PRDA 4CQ1A 5CZVA 1FXRA 4HI2A 1JJHA 4QWEA 2ROEA 2ZNYA 2BE2B 1HWKA 3EXYA 4RW4B 5DRKA 4E0DA 3U02A 1K0TA 3GB0A 2MQMA 2G0CA 5MAOA 3CEDA 2XULA 4GC7A 5A2QY 1Y5NB 2ZJRQ 1U48A 2VBZA 3BJYA 4EBCA 3BR8A 1VQMS 4FNHA 3MEGA 4LUBA 1OO0B 1EP4B 2MPUA 2QA1A 2JLGA 3RB3A 1S10A 4QR0A 2E9TA 2IFXA 4KBIA 1HBNA 1V6HA 2V8VA 4RW7B 2FJEB 5IXUA 1RT7B 1DQAA 2BM1A 3RZAA 2YKPA 5I3QA 3MCSA 2AJFE 3TI0A 3HPOA 2FTRA 1D9DA 3O5TB 5HMWA 3UCGA 1NU4A 3T5LA 4YDXA 4DL2A 4K4VA 3KK2B 2QFJA 5D3GB 4B3SF 2YKAA 4DJBA 3OXFA 1X0FA 2B9WA 2IJFA 4L72B 2PA8D 3U27A 3G8SA 3DI6A 1M5VC 1U1LA 2NREA 2HHSA 2I0XA 3M1VA 1LQ9A 3D0IE 4JI8F 4BCAA 2QA2A 2AYBA 4DR6F 4QR2A 1RAJA 3GE9A 2V5HG 4OIXA 2FJWA 5F3ZA 1F5BA 1RI7A 2E1RA 5EX3A 4ZHRB 2D41A 4B3MF 5EHHA 1MW7A 5EN1A 1NK5A 4ATNA 1X4HA 4O4RA 3TW0A 1WEXA 5DQIA 2QIFA 3ZZ0A 1YSJA 1S77D 4B9UA 1FDAA 4KV8A 3UCUP 2V0NA 1T05B 3SCKE 2HYIB 2KJVA 2DNYA 2MKHA 3SV4A 4DS4A 1HNVB 2EPIA 1UVLA 1TUVA 2N7CA 2N3OA 1AUDA 3PHEA 4NWBA 3LANA 3MEEB 2EG1A 3OR2A 1PILA 5T41A 4BC9A 4A8SA 1J5OB 3K0JA 2VOPA 1M5OC 2W4DA 2P5VA 1NKBA 4QQBA 4R25A 1RT2B 3I96A 2DHAA 1NJYA 2JL9A 2B6AB 2V4QA 2HHVA 3J7Z5 3MMBB 5FJ4A 3V4IA 4C3LA 3RB0A 2KXNB 2DTJA 3MMAA 4WYLA 1ZAWA 4O23A 2ALZA 4LSLB 1RT4B 1UVJA 1U47A 1ZPWX 2MY7A 4KSEB 3MMCB 3RB4A 4FYDA 2RQ4A 3DOLB 3CUNA 2IBKA 2RSQA 2UUCF 3HP6A 4Y6IA 1Q8IA 1V9OA 5A6WA 1U1NA 3DLGA 2VONA 4WZMA 4JI0F 2MGZB 4X4NA 3IRXB 3BQ0A 1WHXA 1UJ4A 1IBKF 2FJAB 2BXJA 1HBMB 4DMZA 1DQ9A 2DD8S 3K5LA 4NLOA 1SXLA 3PFEA 2DIVA 4UOCA 2VPWB 1QVGR 1N4LA 1P1LA 1S1WB 3KNAA 1T3NA 3E8OA 1XN9A 4PG8A 5LXYA 4PUOA 1MMDA 1N5SA 3HDSA 2DR8A 2YWGA 3BSOA 2XWXA 5HBMA 2OPQB 1HR0F 4O44A 3PJWA 5JJBA 4F4XA 2JDJA 3THPA 4YDDB 5M2PA 3EPGA 3IG1B 1FE0A 2CKWA 1REVA 3BSCA 5G0RA 2B9XA 4KGMA 1CQMA 1Q4RA 1Z4UA 4IOBA 5HMXA 1P9QC 3M32B 2V9WA 1X4BA 3OFHA 1Q78A 3M6WA 1IJEB 2M4MA 3HHLA 4Q44A 3BM7A 1LWCA 2EFNA 3G6ES 4DN0A 1N6QA 1SJ1A 3C6TB 4R0EA 4CNYA 3RBDA 3MM6A 2ZBIA 3S6EA 4LF9F 3KK1A 2K8GA 4Y3CA 3UD3P 4K2XA 2IVFB 4PCQA 2OH2A 1ZYQA 1HHTP 3IXQA 4NYPA 1XR6A 4TKTA 4A8WA 3MPYA 1IKWB 1OIAA 3HI9A 4TLQA 1KFDA 1SC6A 2U2FA 4KHMA 1C1CA 2MXYA 2KG0A 2M5YA 3H5YA 3PKYA 4DL7A 3D28A 4KIAA 3OBIA 1YTYA 1FK9A 3AH6A 4NYOA 2HMIB 1K0VA 4N5SA 4ED2A 4DR5F 2VPZB 1UA1A 3F44A 3DLJA 3TA0A 2FVCA 3HVRA 1O8BA 5B08A 2RDJA 4Y2AA 2VODA 3MXHP 4ED8A 2R2UA 4WFNQ 2UVRA 4FF2A 3GG0A 1DURA 1KLMB 3IWNC 2VQEF 2AX0A 2IAJA 1VQ9S 2E1CA 3OJSA 2PIIA 4ZDNA 5KFQA 3UWTA 3RAQA 2J6TA 1X8DA 1UVNA 2AGPA 3MEDB 1R27B 4MFBB 2R2TA 2R7RA 1CPZA 3CD7A 4A8OA 1NK8A 1QTMA 2EKYA 1FE4A 3C2PA 4FF4A 1LFPA 2EVZA 1FTRA 5JXSA 2FHKA 4ECXA 4F8RA 4DSKA 4N76A 5KG7A 4IDKB 3G71S 3O1LA 4JI6F 1S99A 3M2VA 3CE8A 3CDEA 4OL8A 3KYLA 3K5OA 1PO6A 3ENVA 3GZ7A 1WHWA 1FTCA 3T3FA 1YGYA 2M8HA 4OJGA 4MYTA 3JSRA 3SQGB 2JX2A 2XMMA 3IWLA 2ASDA 4WK3A 1B0VA 2MHNA 4QW8A 2LU2A 4V19X 1N0UA 3I5CA 2ZVSA 2CJAA 1D3WA 2BOPA 2P6TA 3MAHA 3CC4S 4KB7A 5T14A 1RJJA 5CYJA 2Q6BA 2VPXB 2BQUA 3IAS9 3HK2A 1HNIB 2HNYB 3PW4A 2XY5A 5G4DA 2JC1A 1H7XA 2CQHA 4WZQA 2GA7A 3ZC4A 3CJ0A 1N36F 2HLTA 1Y3KA 5LJ3Y 4TQSA 2E7XA 2O1PA 3PEHA 2EC0A 1X4GA 2CPEA 3LGMA 1WTFA 2CDQA 3O44A 3SV3A 4OQJA 4PG5A 2WW8A 3KMQA 2P9GA 4OI6A 1BD6A 2IJNA 5F8GA 3V6DA 4ZKAA 3QMQA 3G6YA 3CGIA 4FVMA 2DNHA 2RU9A 2NS1B 3MURP 3G6XA 2J7KA 4C8OA 4I67A 2BRLA 4NLYA 3NP5A 4BC7A 1U2FA 4EWTA 3V81A 3AA8A 1JLQA 3FFIB 4I2QA 4XK8C 3V6HA 3PEJA 1NZAA 2K1RB 4X84A 5KFEA 1SL1A 3HZGA 3I0SB 2PC6A 4DQIA 4DWIA 1TKZA 1KR4A 2DH7A 4J9QA 1S1WA 1FRLA 2J6UA 1UFLA 2GV1A 2W9BB 1GQEA 4C3MA 4NCGB 3HX9A 3KK1B 4DSEA 2DNOA 5GADI 2IRUA 4RW6A 2R2RA 4K4SA 3K5NA 5E41A 2QV6A 2E5LF 2NSBA 3KLGB 5ITHA 4MKBA 2D7SA 4A4JA 4DUZF</