3UWTA

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 2.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
197
Chain Sequence
GAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(U)-binding-splicing factor PUF60
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 49
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA01
3CPWR 2MHNA 4J5OA 2CPJA 3SMZA 4WCEQ 2AYEA 2EK6A 3BEGB 2DNYA 2AYBA 2DNQA 2DO4A 3G6ES 3P49B 3EGNA 3BO3A 2MQNA 3H2UB 2X1BA 3U1LA 2VOOA 1RK8A 2CPYA 2JWNA 2MZJA 3CCQS 3VAHA 3CF5Q 1X4EA 3MOJB 1X4GA 1FT8A 2RNEA 2ADCA 1YJWS 2VOPA 1NO8A 2L9WA 2OJ3A 1YIJS 2RQCA 2FHOB 2FC9A 5DDOC 2LXIA 1X5TA 2YH1A 2KH9A 2N82B 2DB1A 2XNQA 3THPA 2LMIA 4IOAQ 1WHXA 5DM7Q 3V4MA 3UWTA 1ZH5A 1WTBA 1X4AA 1UP1A 2RS8A 2XSFA 2QEXS 4PR6A 2DIVA 1XN9A 2CJKA 1UFWA 2NLWA 3FEXB 1WI6A 2G0CA 2Q79A 3S6EA 2CPZA 2CQIA 1P1TA 1Q86T 1X0FA 2LECA 5IFMA 3CMAS 4UQTA 2M52A 4P6QA 2DH8A 2A3JA 1NJIT 1WHYA 1JMTA 2ZJPQ 1OIAA 1HA1A 4V19X 2MQOA 3R27A 1H2UX 2D9OA 1VC0A 2RRAA 3CMES 5D77A 2V94A 3MD1A 2CQ2A 2CQCA 2DHXA 1M5KC 3VAMA 2M2BA 2PEHA 2ERRA 2XNRA 2DGUA 5HL7Q 3UCZP 2XS5A 4F02A 3BO2A 2X1FA 1N8RT 1VBYA 5CA5A 1FHTA 1HD1A 2MZSA 2L41A 2M4MA 5ITHA 4QQBA 1VQNS 2DGOA 1X4DA 4WFAQ 2KM8C 1U1NA 3MI7X 5BJRA 3SDEA 2RU3A 3CCRS 1SJ4P 2KHCA 3LQVA 3P6YC 2YTCA 2K8GA 2JVOA 1FXLA 2DGVA 1RKJA 1U6BA 1WEZA 2EVZA 3TP2A 1QVFR 3MUMP 3B4MA 1H2TZ 5IM0A 3HI9A 2F3JA 1KOOA 1WF1A 2CQDA 2MKJA 2MQLA 3TO8A 3VAIA 5LSLA 2E5HA 4PRFA 1X4BA 1BY9A 3VAJA 3LPYA 1YITS 5GAHU 2RRBA 2DH9A 2MYFA 1O0PA 1DRZA 3ZZYA 2MZQA 1SJFA 4IUFA 1X4FA 2DNRA 1VBXA 2RQ4A 2E5JA 2ZJQQ 2WBRA 1F9FA 5MLCV 3FEYB 1U2FA 2DNZA 1HL6A 1VQKS 2M8DB 2UP1A 2MJUA 2LCWA 2OTJS 5JVHQ 3S7RA 3ZZZA 3NNCA 3UD3P 4CH1A 1Q7YT 3R1LA 3RW6A 4YB1P 1YJNS 1R8HA 3P5TL 1FNXH 2DGXA 5HO4A 4F26A 2HGNA 2B0GA 3CCVS 4FXWA 5DDRC 3BS9A 2VODA 4YOEA 4QPTA 3CD6S 3I56S 1X5SA 1VQ5S 2KT5A 1YWXA 2DK2A 1H6KX 2JVRA 1DZ5A 1WEYA 2CQ1A 1WELA 1WHVA 2CQGA 3Q2TC 2MQMA 4Y0FA 3VAKA 4ERDA 3J7YU 1FJ7A 2YKAA 2MMYA 5LJ5Y 5IM0B 1KC8T 3VALA 1KQSR 1NU4A 3P3DA 1N52B 4TU8A 2RVJA 3UCGA 4W90B 1ZZFA 3EGZA 1WI8A 1X5PA 2LA4A 2I2YA 3CTRA 1M5PC 4EGLA 3J7ZT 1KOHA 2CPDA 2MQPA 4OZ1A 2DGSA 2DHGA 5GVQA 3MUTP 3CCLS 1U1OA 2M9KA 4LMZA 1D8ZA 3US5A 2X1GA 4LIRA 2OIHA 2J8AA 2KG1A 2MPUA 4OZ0A 2KXHA 2MXYA 3G4SS 2BZ2A 3CC4S 1PO6A 2JRSA 3S01A 3NMRA 1VC5A 1M5VC 1HD0A 2E5GA 3NNAA 2MKHA 3PIPQ 1YJ9S 2MKCA 3PIOQ 1S79A 3MURP 1AUDA 1VQ9S 2KN4A 1VC6A 4ED5A 1WG1A 2DNMA 2MGZA 2CPHA 4WKRA 2BOPA 2N3LA 5GAEU 1U1LA 1URNA 4CIOA 2CQ3A 4TU9A 1UAWA 3VAFA 2KRBA 2KXFA 2M8HA 3R1HA 5CXTA 2MZ1A 3U1MA 2RT3A 5IQQA 3VF0B 2KVIA 4U67Q 1L3KA 2LYVA 3MDFA 1W2BR 2J0SD 3CCMS 4FXVA 1G2EA 1ZZNA 2HYIB 2GHPA 1VQ6S 2KXNB 1WG4A 5LJ3Y 3MUVP 1QM9A 3CCUS 1SJ3P 4YUDA 2AYMA 2U2FA 3JB9k 4TLQA 2L08A 2GO9A 1Q82T 2KRRA 3D2WA 5GADU 2MB0B 4UY8T 5D78A 2YWKA 2M0GB 2D3OR 2DNGA 2CPFA 5GMKa 1OPIA 2DHAA 1WHWA 3IRWP 1OWXA 2NZ4A 2D9PA 1WF2A 2I38A 3DLLQ 3CC7S 1YI2S 1YTYA 5LSOA 2LQ5A 4RU2A 3G71S 4PKDB 1WEXA 3G8TA 1KD1T 2LEBA 1VQOS 1S72S 2KG0A 2OSQA 2CPIA 2QFJA 3HHNB 1X4HA 2DGTA 1A7GE 1VBZA 2PE8A 2CQPA 1JJ4A 2DGQA 2RUGA 2XS7A 2DH7A 3ULHA 1VQLS 2M88A 4IO9Q 1N88A 2LA6A 2CQBA 4W92B 1VQ8S 2J76E 1VQ4S 2CQ0A 3MD3A 1Q81T 2DNHA 2CQ4A 2O3DA 5EN1A 1U1QA 1FJEB 3SDEB 3H2VE 3NNHA 4Z2XA 3CCES 3UCUP 2DNLA 3CUNA 2HZCA 5CYJA 5GAGU 2SXLA 4CQ1A 2FPHX 2M70A 2MKSA 2DITA 2K3KA 3BO4A 2J0QD 1N54B 5DDQC 3EX7B 2KM8B 1DHMA 3RW7A 4TU7A 4WFBQ 1K73T 3NS6A 2N3OA 1U1KA 4QU6A 2E44A 2N7CA 2G1DA 1X5OA 2U1AA 4Y00A 1WF0A 5LXYA 1WWHA 1VQPS 1PGZA 3CCSS 5JVGQ 1B7FA 2HGLA 3Q2SC 2FC8A 1IQTA 2EK1A 2DNNA 2XB2D 3TYTA 1X4CA 2E5IA 3CCJS 2CQHA 1M5OC 1M1KT 2DISA 2YH0A 1R8PA 2QA4S 1K9MT 1U1RA 2MKIA 1U6FA 3DXBA 1P27B 2LKZA 2M7SA 2KFYA 2OTLS 5FJ4A 2MZTA 1UW4A 3OW2R 1U1MA 2DNKA 4BS2A 4A8XA 2DGWA 2MZRA 2OSRA 2X1AA 1SXLA 2MY7A 1FO1A 2CPXA 2LXUA 2VONA 2F9DA 5DDPC 4QU7A 3B4DA 5DETA 2MSTA 1D9AA 2MQQA 5DM6Q 2DIUA 3CC2S 4WF9Q 3THTA 2MJNA 1JJ2R 4C0OC 1FJCA 3N9UC 2LEAA 2MSSA 5LXRA 2XS2A 1SJRA 1SJQA 2HGMA 4C7QA 1U1PA 2KU7A 2RS2A 2F9JA 3NS5A 2ADBA 3G8SA 2KI2A 4WIIA 1VQ7S 1CVJA 4IOCQ 3UD4P 5H1SV 2JX2A 1A9NB 3IWNC 2AYGA 2DNPA 2FY1A 2CPEA 4ZKAA 4LJMA 3UE2A 1QVGR 4M5DB 3G96A 4C4WA 3S8SA 1DBDA 2HVZA 3CXCR 4CH0S 2AD9A 1YHQS 2DHSA 1M90T 2ZJRQ 3MXHP 1VQMS 4WFNQ 2G4BA 2MY8A 1H2VZ 2MKKA 1JJHA 4F25A 3CULA 1K8AT 3K0JA 1OO0B 2DNOA 3SXLA 3I55S 1WG5A 3L3CA 2KYXA 3G9CA 2DO0A 2MGZB 3VAGA
chains in the Genus database with same CATH superfamily
1KRPA 2RQMA 3M2RB 2MHNA 5HI7A 1AT1B 4F4ZA 2WVDA 2YXLA 1Q7LB 1RP5A 1SV5A 3IMQJ 2ILZA 5D0EA 2MQNA 3DRPB 3NBPB 1Q95G 1LV5A 1RK8A 3T1HF 2KB2A 1X4EA 1VQSA 5KT7A 1V3ZA 5EX3A 2KT2A 2RHQB 1T8EA 3T5JA 2LXIA 1UFLA 4XIUA 2UXDF 4ZJLA 3SQOP 2DB1A 1F5AA 2XNQA 3THPA 3MR5A 2J9DA 5T14A 3TQEA 2B8PA 1ZH5A 1X4AA 1ZETA 5D3GB 4C8MA 1UEKA 2XULA 2GVZB 2DXFA 4IFVB 2LDIA 1LW2B 3WQPA 4C8KA 1OPZA 4Q2MA 1BWVA 4XPEA 3CDBA 1MROA 4WKYA 2RRAA 4OHYA 1CEZA 3FBEA 4HR2A 4L73A 3N79A 1N36F 1N34F 2QRRA 2G13A 3I9V9 3MMCB 4DV3J 3UCZP 1HW8A 1XNRF 2LQ8A 1XNQF 1HR0F 4Y3CA 2O67A 2B4PA 2R9LA 3MI7X 1QSLA 2KHCA 4U8VA 2C2MB 1GXUA 3CIZA 3EJMA 3DYAA 3B4MA 1KHVA 4ICLA 4XPCA 4DCJB 4I69A 4PRFA 1T9YA 1S4EA 2R2SA 4GKJJ 3RTVA 2NPIA 2A6OA 1JXVA 5C5JA 1IKXB 1HNIA 1NHUA 4OI4A 2RQ4A 3K7RA 2N4DA 4LF4J 4EK2A 4KGXB 3PW4A 4X84A 3V2UC 3R1LA 2ZZTA 4ZLPA 4YB5A 3I4PA 3J81j 2DK2A 2AZ1A 1A6LA 3D0GE 3W1YC 1JLCB 2FGCA 3P3DA 3ENAA 3D67A 3KG0A 1WI8A 2ROPA 1Q4RA 4C0HA 4QBUA 1KTQA 4JI3F 2Q1LA 1FRIA 3I31A 3IA0A 2XSJB 1PYSB 4O3RA 4FF3A 3M05A 1RKIA 3JAMY 4ED6A 1R3NA 2MXYA 4OYXA 1GFWB 5KFBA 4TYBA 4DV3F 1IM4A 2IBKA 4ED5A 2MGZA 2N3LA 4NCBA 3KMSA 3DNCA 3P96A 1I51B 2M8HA 3R1HA 3M32A 4KR0B 2BMBA 4KHPJ 1QY7A 4UZCA 2B5JB 4TY8B 3CCMS 2CFXA 1J5OA 5HBMA 3OTOJ 1WKKA 4ZPBA 3WIUA 2AYMA 1F6TA 3CWJA 1RWKB 4GKJF 3MMAB 1DTQA 2G9OA 1KFDA 4HACA 3X3UA 2I38A 1J2VA 4RU2A 4LF4F 1LWFB 1WEXA 1TQLA 2ZOMA 3BYRA 3TW0A 2W8KA 1VBZA 3BDEA 3AXMA 2DH7A 1S4FA 4LR7A 5E41A 3RB6A 1TK5A 2NYHA 2YKNA 1R43A 3W2WB 1F1BB 1XTZA 3PRVA 4KJIA 2PMWA 4IR9A 1AYEA 5GAGU 4WP8A 3KLHA 2DCUB 3DFEA 4B9UA 2MDAA 3D68A 2N3OA 2Z56B 1KP6A 3T19A 5ADZA 4Y00A 3M1VB 1QJHA 3QLHB 4RNOA 4EZ6A 3ET6B 1BWEA 1PGZA 5E0OA 4URGA 3Q2SC 3I32A 5SZTA 1DTTA 1E6YB 3DHWC 2FJEB 2RAQA 4M5DA 5F0UA 1YVFA 1NMEB 1S9EB 3IAS9 2FLPA 4CH7A 3GR0A 2M7SA 1S1VB 5C25A 1NZ8A 3RYLA 2P9GA 1F2HA 2QFIA 3CMQA 2ASLA 4NXMJ 4JI1F 1MWZA 5F8NA 4KHPF 2Y9HA 4ZN3A 2VL1A 5F9LA 2WCXA 1UPMB 3OTOF 1IN0A 4HEA9 4IOCQ 4P2MA 2F65A 2XQCA 3RRGA 4PG6A 3TX0A 4ZKAA 3UFCX 1AFIA 1NRKA 3UQSA 1YX2A 2JEGA 2WBMA 1RBLA 5KTQA 3HSGA 3GTYX 4KGKA 3K0JA 3L3CA 5BR8J 1FD2A 4J5OA 4MIBA 2AYEA 1PYTA 2QSWA 3CD7A 1N48A 1WSVA 1DQ8A 3EGNA 4CLYA 1EQMA 2IJRA 3FSXA 3HZEA 4HT7A 3U1LA 4PG8A 3NOCA 2OLWA 1FKPB 3TX8A 3G82B 2XEXA 3T5KA 3RAXA 1NO8A 1S1UA 3A8EA 3M6UA 1S0NA 1KBRA 1WHXA 4WYLA 4BWJA 1FX4A 4RW4A 3MEEB 3TAPA 3GSIA 2FZKB 1J27A 1UPPA 4N7TA 1REGX 1B7YB 3GE9A 4P6QA 2QC3A 1NJIT 2VF3A 3W5YA 2R7OA 5A6WA 3LUYA 1ZTWA 4LF6J 1VC0A 4IG0A 3DU5A 2HZVA 4WP9A 4QIFA 4NEZA 1QLNA 3C16B 2HFUA 2YKPA 4USVA 2HQFA 4DFPA 4NXMF 2PEHA 1KDNA 5BYRA 1LWXA 3EDQB 4RNMA 4ECVA 2HQ3A 5ITHA 1LXNA 4DDFA 1FCAA 2B9EA 3SDEA 3MCSA 1N5VA 3SQGA 4CT8A 2HVHA 2JH3A 1MSWD 4RNNA 1SC6A 4I67A 5E5NA 3MFIA 3D5MA 1T9VA 2WVCA 3A8IA 1TKTA 4QR2A 3DLGB 1IKVA 3DLBA 1YITS 4O23A 1HQ2A 3W2VA 1SC4B 1BE4A 5BR8F 1GTHA 4ATNA 4D3HA 2D3O1 4J9RA 5JVHQ 1U0SA 3BKFA 1N56A 3PFEA 2ZBPA 5HO4A 4F26A 2HGNA 1L3TA 2B0GA 2NYIA 2QL7B 2JLFA 1LFPA 1UETA 3R6GB 4ZJQA 2VBZA 1DLOA 1H6KX 3KG4A 2CQGA 4ENOA 2OPRA 2J8SA 4CO1A 3CE8A 3VALA 4MKAA 4C0BA 4C8ZA 5HQMA 2QLXA 1NU4A 3GJQB 4U8YA 1N52B 4W90B 2DY1A 4NZ0A 2R2RA 1TV6B 2JNJA 2HVDA 4ZVTB 1U1OA 2EBEA 1TR0A 2ZH8A 2CNLB 4ID5A 2D69A 2OIHA 2J8AA 2AEFA 1SV5B 3IXQA 5DLFA 2LU2A 4B9NA 4LF6F 1PO6A 3QGGA 3NMRA 3MHYA 3C3LA 2A18A 2MKCA 2H65B 3QMQA 1IVZA 3DOLA 1TL7A 3D9BA 4TKTA 1H3DA 4PUOA 2GZOA 3U1MA 1SC1B 4FP9A 2KVIA 3M8RA 1RAJA 3MDFA 4I68A 1RWVB 1TTHB 4GKKJ 4P52A 1ZZNA 3AD9C 3FBFA 5KG6A 2GQ2A 4J9KA 4DL5A 3JB9k 4B9VA 5D0RA 2XYHB 4DCOB 4J9PA 4UUWA 2CPFA 3PYFA 1KLNA 3UO0A 4UUXA 4YQWA 1MROB 2HZAA 4CO3A 4DPOA 3KKFA 3D0HE 3AB2B 3RAMA 4J91A 3J80U 2DGQA 5L8RC 4F04B 4ZLJA 3N0VA 4WK1A 1ACMB 3DYAB 1EQ0A 2VV5A 3ILOA 2B8QA 3CJQA 3NMAA 1HNVA 4ICLB 3BO4A 3EX7B 4JV2A 5CCMA 1UWBA 1MW7A 1HNIB 4K4WA 5IT4A 5KFOA 2MEWA 2IIHA 1ITPA 3AODA 2V68A 4LSLA 2VUGA 2OD4A 1YRTA 3DXBA 4L6V3 3N6MA 1W25A 2MZTA 4FVMA 3BQ0A 2QA1A 3HKZD 2J7WA 4A8XA 2EFGA 5BYSA 3PKMA 2BM0A 3K5OA 5AXMA 4O0NA 2VONA 5DETA 3KUHA 4J9MA 4DSEA 4GC7A 3BB5A 1H7WA 1TL1A 4DLEA 2UUBJ 4GKKF 2XY6A 3CCWA 3E01A 2V4QA 5H1SV 1TAQA 2OPPA 4RW8A 2A1BA 3W9IA 5J2MA 1JIHA 2VFUA 2XLIA 3JSBA 2CZVC 5HP1B 1BXNA 1K8AT 2VG7B 2FJAB 1OY8A 3I55S 5L46A 3FKBA 1PC5A 2MGZB 2FHJA 3BV8A 4A8MP 5J2PA 3M32B 1WNEA 3P49B 2HS4A 3FVYA 3QFWA 3DRYA 1J5OB 1T9UA 5IT0A 5HBMB 2UVVA 1UVMA 1X4GA 2WRMA 7FDRA 4B9SA 2VOPA 4H4KA 4OX9J 1DTQB 5IV3A 4ZPAA 3UDVA 4HACB 4J9NA 1WC0A 2WB1D 2R7QA 1DFDA 3I0SA 1L3VA 1RLDA 4KC5A 4CLPA 3K57A 5KFAA 4FNHA 1TKZA 1R7IA 3QNWB 3GSDA 4KFBA 3OXFA 2Q43A 2YKNB 6AT1B 5K8NA 4J9LA 2L9DA 2QLBB 4XDCA 3R27A 3OXLA 3PV8A 3KTQA 3B82A 2D9OA 3NXZA 1XMOJ 4AE5A 2CQ2A 4CYUA 1D9DA 1TUVA 4DV2J 3KLHB 5B0GA 1BQXA 1SQEA 4MH8A 4YY3J 3K2YA 1HD1A 4X65J 2UUBF 1EB0A 3D4JA 3QJJA 1NK5A 4OLPA 2XYGB 1DTTB 3HHLD 2DR7A 2H5IB 3IR5B 1FXLA 2AGPA 2ZE2A 1EZZB 4ELUA 1WF1A 2MKJA 3WBZA 2D74B 5LSLA 5C25B 5T41A 4URQU 1SPBP 3TUJC 2XHCA 4USKA 2F5GA 3UD3P 3CD5A 2V4RA 4GO5X 1EKRA 4GMKA 1S10A 3BS9A 5U47A 4QYZK 3D0IE 4HYKA 2BE2A 1CQNA 5CZVA 1FDBA 3FSIA 4OX9F 4E2FB 1C4CA 4Y0FA 3J7YU 4MKVA 3VZIA 4USUA 4Y34A 4TU8A 4IYQA 2BUNA 3RG6A 1YBAA 1M5PC 2ZHOA 4WTYA 4TXSA 3NWRA 3MUTP 1RA6A 2CJQA 4MK7A 1D8ZA 1OSCA 1TK8A 4UW2A 1GXLA 4W98A 1U8WA 1JWWA 5F9NA 3KLEB 1XMOF 1EETB 3D28A 2XC9A 3O8WA 4ITSA 3LTOA 1F9HA 4DV2F 1RWOB 1S1UB 1VQ9S 3KUEA 5A8RB 2DNMA 1DARA 4B9MA 1X9MA 3Q23A 2JDJA 2MZ1A 4CNZA 2C2NA 2CUYA 4RW4B 2F8EX 1L3KA 1WC1A 4FXVA 5HK4A 1G2EA 3GYNA 4QJVA 2X3GA 2IDLA 4NOHA 1SKWA 3O5TB 1FRKA 1S0MA 4OYAA 2MB0B 2LEPA 2QJ3A 4JP8A 2NZ4A 5J2NA 4IG0B 2PA8D 2Z2MA 2CPIA 3H8YA 4OYPA 3ITHA 2PE8A 2Y0SD 4QWEA 1C0UA 3RRHA 1FK9A 4DI6A 2IY5B 2C2ZB 3SDEB 4FF2A 4HTIA 3SQGB 4ZVSB 2ACMA 2BKPA 4TLRA 1T7PA 1N5QA 2I6WA 3GFYA 2HQDA 2JC1A 5ETKA 1TKTB 1IKVB 3IR7B 3UVJA 4UQGA 4Q45A 3W2VB 3W3SA 4BHQA 3KNAA 5ETOA 4J7CA 2AJ1A 2R7SA 1P1LA 3CJKA 3MF5A 1X4CA 3MPYA 2QA4S 2FTRA 1UVKA 2CJ9A 3W65A 2RKIA 2KFYA 2WHOA 1U1MA 2ZH2A 4B3MJ 2X1AA 1SXLA 1SKUB 2OPRB 3LWMA 3IAM9 4LF1A 4NASA 3LP1A 1QTNB 5DM6Q 1VRUA 3ETMA 3U02A 3THTA 2MJNA 2UV8A 4QZVB 3EPIA 3IGVA 3P8BB 3OSPA 2XS2A 2KU7A 4DMZA 1ULRA 2KI2A 7FD1A 2GVDA 3HK2A 3HCXA 2BJEA 1WTFA 4ID5B 4ILMA 1X8DA 5KFHA 4C48A 4NYOA 4DFJA 1S9FA 1R0AA 5KFUA 2DO0A 5M2UA 2A10A 3DOLB 4DV1J 1TL7B 2CPJA 4DBQA 3SMZA 3ZTOA 2MLZA 4PUOB 4ECUA 1GMVA 2BKNA 3D3CJ 5HN0A 1T95A 5CHCB 2APOA 3EZOA 4OZJA 1U7LA 2XMVA 3PRBA 3KYLA 1GEHA 4QWDA 2IRYA 4LREA 3EPGA 4IRKA 1LQ9A 1HKAA 4C2MA 3LP0B 1C1BA 3IP0A 1N32J 2OEKA 2H5EA 5ETPA 1HWKA 2MTLA 4F3MA 1UFWA 4DR6F 2NLWA 1URRA 3TA1A 1C2PA 2AIRB 4I2PA 1FVSA 4I56A 4UQTA 2DXDA 4Q2LA 3D7SB 4I7FA 1H2UX 4B3MF 2CQCA 2DHXA 1HNVB 3UNGC 2CA9A 1Q8IA 1JLBA 4C97A 4N5SA 3R7BB 3C6UB 1NDLA 1YJUA 2CVEA 3R5AA 3TUZC 1UWBB 1ZM3A 4IH7A 2XM3A 1HBUA 1RUSA 2RU3A 3MPDA 1CG2A 1HWIA 3TP2A 1SIZA 2FVCA 3DXSX 4LSLB 2CQDA 4HDHA 1HBNA 2E5HA 2E66A 1NDPA 1X4BA 3GIMA 3KXDA 2RRBA 2ZD1A 1JLGA 2LVWA 2QA2A 4P7TA 1IJFB 5LOQA 4DV1F 2ZJQQ 2DNZA 1U49A 1NSAA 4FXDA 1E6VA 4CP5A 3MWBA 4CLZA 4F4WA 2ZVIA 1T3NA 4C8YA 5D15A 1TL1B 4RUAA 4EZ9A 1S1XB 4CTAA 5A2QU 4DV7J 3ENWA 3E01B 4IFYA 3CD6S 1TELA 2IC3A 2OPPB 4Q5VA 1JXLA 4TY9A 3LP2B 4RW8B 1X31C 3BDPA 3HHEA 2HNZA 3KDNA 5J2MB 2GFFA 4CO0A 1N32F 1GNKA 2AJQA 5CD4A 2VASA 3EGZA 2G1HA 3PJWA 3B6BA 2VFRA 1K0VA 5D4NA 3CTRA 2KHDA 3HT3A 1IBLJ 2QN6B 3BR9A 3EGWB 2VFSA 3HP6A 1YJ7A 5KFIA 2OKQA 5J2PB 1ZAWA 2FB0A 3ZNUA 2ZH5A 4ES2A 4OZ0A 2I9SA 2BZ2A 1PYOB 5E3RA 5KOWA 4X4TA 3CC4S 1F2GA 1M5VC 3W5XA 3QT8A 4MAKA 1S79A 4JUZA 3WX4A 4DFKA 1N4LA 2PGCA 4FS2A 3UD5A 3BZQA 4LSNA 2EFQA 2KXFA 3I5BA 2FLNA 4DUZJ 2DBBA 2ZOFA 2ACYA 2PEBA 4AXJA 4C6AA 3LPEA 3NGTA 3ZZUA 3OVBA 1TKZB 1IKYA 2BYCA 3HMJG 3KK1A 2NXCA 1OY9A 4TLQA 4KFBB 1TFYA 2CJYB 4UY8T 3NL0A 2IMWP 2R8IA 5IC4B 3IRWP 1OWXA 4EBDA 2UU9J 2X51A 5E33A 1F3VA 4CYUB 1VQOS 1U02A 2QFJA 1VRTA 2KZZA 1ZTTA 4JV0A 4RUHA 4W92B 3I9ZA 1QAYA 3MD3A 4JI5J 5EN1A 1KLMA 1NBEB 3CJ0A 4KTQA 2JL9A 2EBGA 1MG7A 2PFDA 1D9FA 2YX4A 2NXEA 1PAEX 3V6KA 2V2ZA 1RCXB 4DR5F 3V5RA 2NS1B 1BLUA 1NJWA 1VQPS 4I6YA 2FC8A 1XJWB 4DN9A 5HLFA 3AHPA 2NXUA 3P4UB 4YDDB 2QX0A 1MN7A 1K9MT 1U1RA 5KG5A 1SL2A 1FRMA 3PO5A 1HYSA 1S0OA 4N8NA 2BE2B 3QAUA 4MTPA 3AOCA 2MZRA 2PI5A 4PQUA 1OYEA 2Q6BA 5DG7A 2KDOA 2A2DA 3N4WA 4DJBA 4I6AA 4WF9Q 4YB7A 4HI1A 3T5HA 1SCJB 3BQ1A 4DUZF 1SJRA 4DS4A 2NUHA 2FLOA 3RJMB 1YJTA 4YP3A 3D1HA 3UD4P 4DL3A 9RUBA 4ANEA 4I0WA 1DBDA 2AD9A 4USTA 3MXHP 5AXKA 4USIA 5A76A 4G65A 2VKRA 2BV3A 1IJEB 4B9LA 5F0WA 2XZWA 2CWKA 4JI5F 2GX8A 4QPXA 3C19A 3NGSA 3V6DA 4P9SA 4RLEA 1V3RA 2OP5A 2QTWA 1CJKA 4NA3A 1KVIA 1FE4A 4CLTA 3AB4B 1X5TA 2QLFB 5J2NB 4KT0C 2OI2A 3BGLA 4PPDA 1NK6A 4U7UK 1DJ0A 5HMZA 4O4GA 1XN9A 4LIWA 3ITHB 4Q8FA 1SH2A 1HWJA 3Q83A 3DDNA 2RD5C 1C0UB 1FK9B 3N6NA 4XO0A 1WHYA 2VB6A 3KJFB 1CC8A 4P71A 4O4RA 3CNQP 2UUWA 1CQMA 3QIPA 2V34A 1N8RT 1VBYA 5DZ6A 1YQHA 3UVJB 3OSNA 5M2PA 2DR6A 1M1GA 4OZ5A 2DPIA 5E7OB 3CJKB 3H40A 2FHJD 2IFXA 1IR2A 4PXEA 4DX6A 4U6PA 2VPXB 1U6BA 2EVZA 1RHMB 2V63A 2C2DA 3PDNA 3BR8A 2RKIB 4M1KA 3DGVA 1UEVA 3LP1B 1NDCA 1VRUB 5KFKA 1VQKS 5B0AA 3LW5C 3D54A 3EYZA 4QIVA 3CO9A 4MYTA 3RB0A 2DJWA 3HSJA 4EO8A 1RWXB 2JLEA 2OD6A 3R8YA 3CCVS 4YOEA 2GVDB 3QRQA 3UPFA 4O3QA 4DPXA 2GAGC 1UZHA 4ZP9A 5J1EA 1JQGA 1XERA 4E0DA 4AXIA 1LFWA 1IQZA 4ED8A 2BQ3A 1R0AB 2LA4A 1NXIA 3J7Z5 4ZVHA 4DQPA 1W7WA 1U0HA 2BACA 2YKQA 3T9ZA 1R6YA 2Z30B 2QSFA 2W7PA 2F1FA 3WX8A 2BE9B 1C1BB 5T7LA 3G87A 1NB2A 1FKOA 8RUCA 1WKLA 3CCUS 4YMEA 4I2PB 3HJVA 1ZPVA 3D2WA 5E3PA 2M0GB 3RBZA 1HNWF 4I7FB 2YWHA 1WHWA 3QRPA 3PW2A 5LM7E 3CC7S 1ZAXA 2JFKA 2QMXA 1JLBB 5HVFA 2QE5A 1UCNA 5IT9U 1JJ4A 2HK2A 4C3LA 1FDAA 2A6MA 3VGSA 4EUVA 4O3OA 1V5IB 1HBUB 3BREA 4P72A 3EXCX 2J76E 2BE7D 2CQ0A 1FE0A 3M8WA 1RU2A 2K7JA 3M8ZA 3OFEA 1Y10A 2W9BA 3RUBL 2FPHX 4JI2J 4B3SJ 1KHWA 4KE5A 3KHHA 1HBNB 2E1RA 3TA2A 2OMLA 4WFBQ 2ZD1B 4JV1A 1JLGB 4QU6A 3K5NA 2BW7A 3DRRA 2N7CA 4LRFA 3TEHB 3CCSS 3MR6A 5EHHA 1E6VB 1FFGB 4RU9A 2ZH7A 2AJ2A 3MM9B 1FEEA 4CTAB 2CJXB 4UOFA 2KFNA 3H7HB 4IFYB 1UW4A 2DGWA 2IC3B 2W2PP 5KFLA 3TJAA 2CWXA 4OV6A 2YVSA 2MSTA 2ZUGA 3H4DA 2HNZB 2P9CA 4CDIA 1MN9A 5JXSA 3QGPA 5C2GA 3TZYA 1VJQA 1RDRA 2RILA 1VQ7S 5LT5A 1H73A 2V8PA 3IWNC 3RR7A 2HLTA 4LJMA 2ZHBA 3TJ8A 1VCTA 2VQFJ 1X0PA 4Z7CA 5RUBA 3CXCR 4DX5A 3QT7A 1QE1A 4R5PA 4K4YA 3DLHA 3KLFA 3SBMA 3MR3A 5K8OA 1UFKA 1RTZA 1YJVA 4URSA 2DNYA 4WJBA 4ZVGA 3OL7A 2Y8WA 1RE1B 1IKYB 3DOKB 3I5AA 4JI2F 3JQJA 3KK1B 2MHEA 3HJFA 2WONA 3CJTA 2ZZMA 3R7SB 1YIJS 1C4AA 2OUGA 2FC9A 1HBOB 4OHZA 4NCAA 4B3RJ 5F41A 3TARA 3V4MA 4F0MA 1NH8A 2W1BA 2EFOA 1VRTB 2WAQD 1IM6A 1ZM4A 4OYZA 3G2XA 1FTCA 3AQPA 1S5ZA 1Q86T 3PX0A 3QSIA 3CMAS 1YBUA 1NSPA 4AL6A 3Q8VA 4OZLA 1Z4UA 1KLMB 2LLZA 1RHKB 1HW9A 1X9WA 4NLWA 5D77A 3MD1A 4OYOA 3SZ2A 1B70B 4LT6A 2VJUA 1TKDA 3W7BA 4QW8A 3GG1A 3PM9A 4P2SA 5SUHA 4NWBA 3OTCA 4L3KA 3NP5A 4WFAQ 1U1NA 5BJRA 1NKCA 2JJ4D 2QL9B 5HLFB 2FHMA 3J80Y 1IWGA 2VQFF 4OFZA 1FFSB 3TO8A 3CDUA 4HVZA 2XY5A 4I64A 1HYSB 1FWLA 4B9TA 1NLKL 4PQUB 2VBWA 1Y0HA 3N5FA 3M6XA 2B4UA 2VKZG 4P7VA 4M95A 2OTJS 3OFHA 3S7RA 2DEIA 4DQSA 4O3SA 4YHHJ 2HBRB 4NPOA 1OS5A 2BABA 2H1YA 1UVLA 2ZNZA 3KJQB 1WEYA 1UKUA 5CYMA 1Z1ZA 2M3DA 2EKNA 4B3RF 1NEEA 4F2RA 4K4XA 5EUHA 4ZVOB 4RW9A 5D6GA 1N5SA 5KFJA 4DF8A 4DU7A 3BGOP 4EBCA 3SCKE 3KLGA 1S9GA 4PYDA 5A6PA 3US5A 1UA1A 4ECXA 2KKHA 3V6DB 1JLQA 1RWPB 2V8GA 1VC5A 1RTHA 2JFDA 1CJKB 3BF4A 3GIJA 1OQ6A 4ZA1A 2FJWA 4CLSA 3D1QA 4A8WA 2VD3A 4NLGA 3G86A 1GAOA 2FVSA 4ZHRA 3T41A 5KFZA 1HFEL 1BQNA 1M5SA 2U2FA 4G1QA 4C98A 5EWFA 3BGRA 3E51A 4M8LA 2YWKA 3TZXA 3TQ1A 2D3OR 4LF5J 4NI2A 1WF2A 1JLEA 3ZZPA 2QT7A 2KG0A 3HHNB 4Y6IA 2WSFC 2XYPB 4CZCA 3QIPB 4OI0A 4LBHA 1YZ7A 2N4CA 4RJVA 1EKSA 1SIWB 4F3QA 2YWWA 2OO4A 2HZCA 3OJSA 1T02A 4FPRA 2V2QA 1DHMA 3VGVA 4RBTA 4DV5J 1Q78A 1U1KA 3VHQA 5LXYA 1WWHA 2AU0A 4WU2A 6FD1A 3UDCA 3O2IA 3Q86A 2XB2D 3TYTA 2E5IA 3OR1A 4LQ3A 5AE1A 4KH0B 3QYYA 1P6TA 4YEAA 4NLRA 2B56A 2OELA 1KWMA 1G1XA 2MKIA 2J6TA 1VHFA 1ZBTA 2HNDA 4HL9A 2VQEJ 2F9DA 5J1EB 4QU7A 2RMLA 2HQIA 2GC8A 1Y3KA 2BJ1A 5B0FA 2MSSA 3SV4A 3ZTSA 2RS2A 1WC5A 4PAAA 1S6OA 1B4SA 4UY85 2OHDA 2HVZA 4LF5F 3TVYA 3N01A 3F73A 2KYXA 4ZVUB 5F8LA 2HHSA 1HNZJ 3QPIA 3HSDA 4NLVA 5T7LB 3BO3A 4X4VA 3ZZRA 1FKOB 5I42A 2VOOA 4C8LA 3G8QA 4UF4A 2XMAA 2VH7A 2DXEA 4DV5F 3HT0A 3BH6B 1APSA 1XR7A 1VOMA 1TP7A 4MKBA 1YSJA 4DR1F 2IM3A 3W63A 1D09B 4X4RA 2HRUA 3MOZA 3PO4A 2Z2LA 3PNIA 3PCOB 2AGOA 3TVZA 4E8UA 4FN5A 3G6XA 3TZZA 1JNZB 4ZK7M 1X0FA 3JSMA 2H4YB 2DH8A 2B6AA 4AT1B 2ZJPQ 3MPWA 1W2IA 4BDPA 5DQIA 3TJ9A 4K4ZA 1VK3A 2V8DA 4UOCA 3QBCA 3O1LA 4L72B 2VQEF 2W9BB 1SKSA 2UUCJ 2ZUAA 3JSRA 1KR4A 2V0NA 2XS5A 3BO2A 3QSYB 3R7NB 2AW0A 3DHXA 3DRRB 3TVKA 2IYGA 1KVKA 3IWXA 3EWGA 1X4DA 2ZBQA 2XMWA 2EC0A 3CCRS 1K1QA 3M2VB 4HHHA 1NSQA 3K5PA 1GTEA 1RT1A 3P45B 2BXJA 2ZDOA 3ISNC 2BJ3A 2XLKA 5GADI 1HI8A 2DNRA 1VBXA 1LKZA 1HNZF 4OHWA 4KGMA 3FMWA 4CH1A 4Z7YA 3PXGa 4ZS6A 4DWIA 4FBUA 2PMHA 4U9RA 5L39A 1NPKA 4DSJA 5E3QA 4MKYA 2WK4A 3VV2B 2QMUB 4LR9A 1FFWB 4QYRA 3MAAA 2HNYA 2UZAA 5IM0B 3CJSA 5KG4A 1MMNA 3GFXA 1QE1B 2RVJA 3UCGA 4R5PB 2CKWA 2R7TA 4NCGA 4NMXA 4NZ7A 3KLFB 5HQ8A 3MM7A 5F8IA 3DDKA 2WOMA 4CM2A 4RZRA 5D4OA 2JRSA 2UUCF 2E5GA 2WONB 4ANDA 2BR0A 1VS3A 4OHVA 3M30A 1UAWA 3VAFA 2KRBA 1I3OB 1RAFB 3TNVA 4M5JA 3LH2S 1U6ZA 2Y1LB 2J0SD 2ZH6A 2KXNB 1WG4A 4ZCMA 1UL3A 1RGVA 5CQGA 4EFAC 2VG5A 4ZOSA 2BEFA 4LBIA 4OI3A 3KK3A 1ZM9A 5F8JA 5CAAA 4NYPA 2PC6A 1SB6A 4CO5A 4B17A 5F8HA 2XMUA 2BM1A 1SH0A 2XI3A 3GFHA 2ROEA 3ULHA 1XIQA 1MNEA 4HLBA 2G0IA 1FJEB 2VZ9A 1UW9A 2W2MP 5CYJA 1B99A 3ICLA 2YNGA 5LMUF 4JI4F 1G7CB 4CCHA 4EO6A 3VR1A 2G2ZA 4DV6J 3R9LA 4N56A 2G1DA 2ZH3A 1N33F 2JLGA 2YWFA 2QG9B 2YQ3A 1LWEB 4KSEB 1XC9A 1M1KT 4JI3J 2HK3A 1S48A 2NPFA 4E98A 4HTJA 2LKZA 4KGZB 4DU8A 2OTLS 5FJ4A 3DMJB 2IA0A 2PO4A 3MR7A 2DRBA 5CYMB 1YK9A 4PCQA 1X9SA 5C7PA 2YPZA 2BA9A 2KYZA 4KIAA 5LXRA 4NLQA 2HGMA 2XHWA 3G8SA 2Q6CA 3KLGB 1S9GB 5B0BA 3UE2A 2D7SA 4RX6A 4CH0S 5A2QY 1FI4A 1JLQB 2WB4A 3AA8A 2DRDA 2J9DE 5EGYA 2V8HA 1AXQA 2H48B 1RTHB 3UDLA 4OI1A 1TAUA 1VISA 2DNOA 1X60A 3HVRA 1BQMA 3D66A 1PJ5A 2HEKA 3FFIB 5GMDA 1CC7A 5A8WA 3PRDA 4DL4A 3Q8QB 3EM1A 2JWNA 3MM8A 3CGIA 1U09A 4D3GA 1EP4A 4G1QB 1M5HA 4DV6F 3BGRB 2FVPA 5H9FJ 2FHOB 5LSRA 4F4XA 1MWYA 2N82B 4NI2B 2GQQA 4UOHA 2MQ8A 2LU1A 1F5CA 1OSDA 3OTBA 3F44A 1UVJA 2ZM6J 1LK5A 3IWLA 2BRLA 1P1TA 1WOOA 3LANA 2C42A 4MK8A 2HFNA 2MQOA 2RDJA 4ZVRB 3EMTA 3M9NB 1OY6A 3SCIE 2V94A 2H51B 2NXNA 3MFHA 3TANA 3OVAA 3NCQA 5KFRA 3HHDA 4JI1J 4QR0A 4OJGA 1SJ4P 3J7A1 5CH7B 4F36A 1SBRA 2DTJA 3OR1B 4AYBD 3A8KA 3HKWA 2CG8A 3VAIA 3HX9A 3BJYA 4QR1A 4ZPDA 1AFJA 2JZ5A 1GK8A 3I87A 2HNDB 1WC3A 4F4KA 4H4MA 1F9FA 2EPIA 4HKQA 4OQJA 5CD4H 4JB8B 1C0TA 1PBUA 4H4OA 2IM2A 4Y65A 1AB8A 1ZS6A 1T03A 4DXLA 4ZPCA 3W66A 2ZKUA 5J2QA 1D8YA 1YJRA 3KHGA 3I82A 4OX8A 3VAKA 3OLBA 4C3KA 2IJFA 2EKYA 2IRXA 4PXCA 4DL2A 1DQAA 4IQMA 3PYEA 1DAXA 2ZM6F 4OYMA 3AFGA 4OZ1A 5KT5A 4WPAA 3GB0A 3CCLS 2CJBA 1WORA 4PABA 2HFSA 4NA2A 3UDEA 1SJ1A 1DY3A 4LF2A 3G4SS 5I42B 2J5AA 5HMWA 2J6SA 3GIKA 1VI7A 1HD0A 2W2NP 2GA7A 1EAYC 4NLUA 1FEHA 2VHGA 4Z37A 4C3MA 4ZIVA 4ZN1A 3GV8B 1YRUA 2D3UA 4USJC 3VF0B 4U67Q 5J1PA 1RAGB 2LYVA 2YQ0A 4NLDA 1NSKL 4PZVA 4A8QA 1QM9A 3JYTA 1JLAA 1LK7A 4LSZB 2PSZA 3LALA 5GADU 2GIRA 5CABA 2DHAA 1U24A 5EX0A 1R8BA 4KPYA 3KDOA 3AD7C 1NPRA 5HMYA 4PXDA 4A8KA 3QGIA 3QRRA 1KONA 3PG9A 3VZHA 2E29A 1S77D 2M70A 2MKSA 3NCRA 2V4JA 2K3KA 3CJ8A 1N54B 1RT1B 5G0RA 3RGIA 2E44A 5L9NA 1WF0A 3J7YI 3W9HA 3OQ2A 2ZC4A 1LEOA 2ZITA 1HHQA 3CJ3A 1ZPWX 3RR8A 1L3UA 3QO9A 1UJ5A 4NLSA 2UVUA 3H5UA 5HATA 2LXUA 1O8BA 1RXOB 2UXCJ 2R7RA 4CO4A 4OX7A 3IS9A 3MAAB 1D9AA 4S0MA 2MQQA 4QWCA 2HNYB 1MMLA 4MFBA 4C0OC 2KZMA 3JTOA 3NOGA 3N9UC 4O3NA 3BYPA 4FKXA 4RBVA 2ZKTA 4H54A 3C6TA 4FF4A 3MM7B 3HPOA 2R8JA 2Q66A 4K50A 4LRAA 2JX2A 4UZBA 2WOMB 2FJXA 1TL3A 2YBVA 1QVGR 4LRDA 3DOMA 2B9XA 1VIOA 3ETOA 3H20A 4ZCKA 3L7OA 3PJXA 4FPIA 4YFUA 4NRUA 1WG5A 2GVZA 3IM8A 4KV8B 2ASDA 1Q79A 4WYWA 2POKA 5DG8A 2EK6A 3M30B 2HWTA 4DUYJ 2DNQA 1HWUA 3CDEA 2VDHA 2MZJA 3ZTQA 4GC6A 2JSXA 3V4IA 3WIVA 2G2YA 2F40A 1FXRA 1H7XA 2VG5B 3G6YA 3KK3B 2K7KA 3A4TA 4WXOA 4ZMMA 1RT2A 2J0XA 5AT1B 2XMTA 2V67A 2ZBCA 2I5JB 4YS2A 3GONA 3L7UA 1M1HA 3HHLB 2YWGA 3DGPA 4RUBA 5IOLA 2LFVA 4G1IA 3CJ2A 4MIAA 4ER8A 2AV5A 2UXCF 2YNGB 3KJVA 5EDWA 4N76A 1MLAA 2KTQA 3GV5B 2DT9A 4CLLA 4HHUA 1GQEA 2VPWB 1VQNS 3CB4A 3LQVA 2N7YA 5IT9Y 1RHJB 1WEZA 1XR6A 2NCKL 4RW7A 3HI9A 2F3JA 3MTJA 2YNIA 3TR5A 1JLCA 3A3OB 4FYDA 4ED2A 4DFMA 4ZDNA 1X4FA 2V9WA 2GAHC 2AF6A 4K8RA 1VRQC 4RUCA 1S12A 2RE1A 3FEYB 1NM2A 1SL0A 1HL6A 4DUYF 1Q7YT 4NLPA 3W64A 5HJYA 2HAFA 1GX6A 3GYGA 1OQ3A 3Q8YA 1Y00A 1UVNA 3MMJA 1RAHB 3FGVA 1DZ5A 3AT1B 4X4NA 3QWUA 4OL8A 2YKAA 3OBIA 2E9TA 4HT5A 4WWSA 2YQ1A 4TY8A 4ECRA 4AQYJ 3NGKA 2I2YA 4EGLA 4WU3A 1TVRA 1BQMB 1WKJA 2FUG9 5A8WB 3R5GA 4DL0C 4KQZA 3VGUA 1PBAA 1NK0A 2KG1A 2MPUA 1UJ4A 4OJ1A 4K4UA 3MM8B 2IDEA 3BBFA 1RT3A 2OEMA 5CZXA 3ZZ0A 2KJWA 2QL5B 1EP4B 2ATCB 2HURA 1SL1A 2KN4A 1WG1A 1HHTP 2DVIA 4USWA 1S0VA 1U1LA 3Q8PB 2DCLA 3N5BA 4K4SA 3VQSA 4DR2J 1V3SA 3POTA 5IQQA 2LXFA 4A8OA 3KK2A 1NKBA 3PKYA 4P73A 2QZ8A 4WZQA 3BSCA 4JI7J 4DOZA 2FZCB 3NGUA 3MEDA 1SJ3P 4A8SA 1XMBA 4ANCA 4M5GA 3FUYA 2FQQB 1OPIA 1MWQA 2ZWOA 2V50A 3UN5A 2WVEA 1H0HB 3IO1A 3DLLQ 5KFPA 1YTYA 2RSQA 3G8TA 4OHXA 5HMXA 2LEBA 4NXNJ 1V6HA 3IG1A 1X4HA 3JQMA 3LAKA 1TMJA 2M5YA 3K58A 4B3TJ 4OYWA 1RT5A 4AL7A 2PMZD 2R8KA 4W4MA 3MCMA 4EI2A 1SI9A 4LVOP 3KJNB 2HPUA 3UCUP 1VR6A 1XMQJ 1EJ7L 1IR1A 3L09A 5KFEA 3C66A 3QGHA 2Y0BB 2C3YA 4I2QA 2FHKA 1VBKA 2MLXA 4NYZA 4TQSA 1K1SA 4AQYF 2ZHAA 4DPUA 5L1JA 1VK8A 3GMGA 2IAJA 4FKYA 2EK1A 2NSBA 1CJTA 3OFGA 5C2CA 1S99A 2ABYA 2IVYA 1C0TB 4H4OB 1M5OC 1DURA 2V69A 3EDRB 1T03B 3FQLA 4Y2CA 3M9OB 1NH7A 5KG1A 1NHKL 5J2QB 2HWHA 4IH5A 4WTOB 4YN3B 2C3UA 2HHVA 1WDTA 5FLXU 2P8IA 3JSYA 4RBUA 4DR2F 2LEAA 4Q44A 3GZ7A 1SJQA 1U1PA 4JI7F 5HANA 1CJVA 3ZC4A 3R5CA 1YRXA 1IBMJ 4M5DB 4BC7A 3S8SA 5ETTA 1NK9A 3OHAA 2RDIA 2RDDA 2R8HA 2GGPA 1VQMS 4WFNQ 2ZNYA 5H9EJ 3AXKA 4F25A 3CULA 4NXNF 4A48A 2XG8A 2VJVA 3G9CA 1NB7A 4B3TF 3OL6A 3LGNA 3CJ4A 5D4PA 3BEGB 2FVRA 3R5BA 4DR4J 1XMQF 1IUJA 2DYAA 3KOAA 4ED4A 4OMFG 3SI8A 3JYTB 2RNEA 3B78A 1YJWS 2L9WA 2GHWA 4BCAA 4P10A 1JLAB 2GJIA 5DDOC 3C46A 4CM0A 4X4OA 1UMJA 2LMIA 5BYQA 3UWTA 4HHJA 1S6QA 3MECA 3CDWA 3I6PA 3FEXB 2CIMA 1QAJA 2F4FA 2X3DA 3QWPA 3PR5B 3SFUA 4V1Ak 4V19X 2ILYA 2QV6A 2MKYA 1KS2A 1RZMA 3U1NA 1BUXA 4AL5A 2E1MC 3K8WA 3NGRA 2V4JB 1LOUA 4F02A 5G0RB 3PW5A 3QT5A 3QFHA 1AUSL 5ETLA 4F67A 3Q0AA 1R8AA 2AX0A 5BXIA 1YZ6A 1QDUB 1IBMF 5F8MA 1BY9A 1JKHA 5G4DA 3M8SA 2DH9A 3QO9B 3L9ZA 1YGYA 2HWIA 4NLYA 3IS9B 5MLCV 2EG1A 1U2RA 3ZZZA 4MFBB 1NDKA 2OFHX 1Q5YA 4YB1P 4DR4F 1NCLA 3FSYA 3NY0A 2J0WA 3C6TB 3BH7B 3I56S 2KT5A 1YWXA 1VLOA 2JVRA 3A1YG 1TL3B 3O3LA 1FJ7A 1EHWA 3DOMB 1U4BA 1VFJA 3A12A 2QLJB 4DN0A 4JI6J 3EVMA 3V6HA 1RYSA 4CNYA 3MAQA 2DGSA 2K3IA 1BC6A 2X1GA 4F4YA 3K5LA 4ES3A 4DR6J 2LDYA 4NL5A 3DDIA 1IBKJ 2HMIA 5KG3A 2ZEJA 3V4IB 4DR7J 2ASYA 1DLOB 2CPHA 1RT2B 1S57A 5E2QA 2GIQA 4YDXA 5CXTA 4FYYB 4OJHA 1RTDA 1VQYA 1W2BR 2GHPA 4PWDA 5LJ3Y 1KQGB 4MMOA 3OL9A 3DGPB 1Q82T 5HJXA 1FERA 3H0PA 6FDRA 4G6VB 2D9PA 4NMLA 1YI2S 1R89A 2LQ5A 3CW2C 4PKDB 1KD1T 1RAEB 3KWMA 4Q7AA 2OMOA 2OSQA 4U7CA 3KJVB 2VC1A 2YNFA 2HW3A 1HIYA 4QWAA 1RCOB 2LA6A 1B0VA 3B8HA 2VFVA 4Y2MA 3TAMA 2CNKB 3ILJA 3LWLA 4LF8J 3NNHA 3CCES 4N77A 2SXLA 2R7VA 2KO1A 4X62J 4RW7B 4CQ1A 2DITA 2YNIB 4HDGA 4JI6F 2KM8B 5IXUA 3RW7A 4TU7A 2HVIA 2E1CA 2U1AA 3CVKA 2XY7A 2EI5A 1LW0A 2WW8A 3IC1A 2IVMA 3AJ1A 3O6QA 2RRNA 4XAKA 2C2OB 4DV4J 3H5YA 5DQHA 3HXMA 5HP1A 2AJFE 1IBKF 2VG7A 1Y4ZB 2C1EB 2XGQA 4BS2A 4DR7F 2ZH1A 2BJDA 2RJZA 1FWKA 5H9EK 1RYRA 5DDPC 1U45A 5ETRA 2LQBA 3NCPA 3H4BA 1JJ2R 5ETNA 2HHWA 3ILLA 5DLGA 3H98A 2ADBA 1TVRB 2PT0A 3MMBA 3HVAA 2ZH9A 4FS1A 1NZAA 3HSZA 1FD8A 2P2CB 4NRTA 2HHQA 3THVA 4FF1A 3AJDA 4BBYA 4NA1A 5ETQA 1VGYA 2C2EA 1Q0NA 1JJHA 1RT3B 2FJVA 1RWWB 1X7VA 3VAGA 3ZXWA 3V81A 3V6JA 3D6FB 3QATA 3POTB 5KG7A 4LF8F 3KK2B 3H2UB 2H3EB 2HIQA 4PYAA 2HHTA 2Z58B 3KLVA 3CCQS 4X62F 3DLEA 3MEDB 2BKOA 4FZVA 1Q53A 1RT6A 1RT4A 5A8KA 2ADCA 2ROGA 4X4UA 3AJ2A 2MLYA 4ZVFA 2HHPA 3LGHA 4IOAQ 4N8OA 2O66A 3MEGA 2JEJA 2XSFA 3IG1B 1C1CA 1OYDA 2V8VA 4M5MA 2VPYB 5K20B 4DR5J 4DV4F 3UR0A 3NEKA 3EZUA 1RT5B 3EXYA 3SFGA 3C2PA 4M5KA 2XWYA 2Y1IA 4B02A 4K2XA 5DGAA 3MCNA 1PJ7A 4EYIB 3AY0A 4O3PA 5IC6B 4G3IA 2BQUA 4MYUA 4DSFA 3UI3A 4OZ3A 4WE1A 3TRGA 4I2QB 1R31A 2B9WA 2ALYB 4CI0B 4ECSA 3I0RA 3GIIA 1WOPA 3B54A 1ZOTA 2W8LA 2GO8A 2DGOA 5KOXA 2IAJB 1RSCA 4I6WA 3I0SB 1CJTB 3JXOA 1U48A 2CNOB 2W01A 4OYBA 2I8EA 2HSEB 3Q22A 4F8RA 3LPYA 1DRZA 2B4VA 3KHRA 3U7JA 3PACA 1RAAB 3FDSA 5J1NA 1T0TV 2EG2A 4PWUA 4J9VA 2BDPA 2HHXA 2XMMA 4J9QA 4C8NA 3PR4A 3KLEA 4LF7J 1EETA 1OJ4A 1QSSA 2GJFA 3RBDA 3GCXP 1CJVB 1S1WA 4QPTA 1VQ5S 3HO1A 2BX6A 3M8PA 5A8RA 5KG2A 2KL8A 2A0FB 4KBIA 5D0GA 1F60B 2ZE2B 2R7UA 1RADB 1Y7PA 4EEYA 1KQSR 2GGPB 2F8MA 3VVUA 2C2KB 4ZJOA 2W24A 2QLWA 3BN7A 5I4MA 2DHGA 1NPPA 3T5LA 2YY3A 4LMZA 3WZ0A 3BN4A 2UUTA 2W7AA 4LIRA 2VG6A 2P6TA 2ALZA 3OT9A 5D4LA 1S49A 3GCWP 4ELTA 1SVDA 4F0KA 3R2DJ 3PIPQ 2QYGA 4MJKA 4X4SA 3PIOQ 1FDDA 3HD2A 3MURP 1AUDA 1G4CA 2W2QP 3BPDA 4IH6A 1O5JA 4CIOA 1RHQB 3UW1A 3DLKA 1S6QB 3SIPB 2PFFB 3MECB 2D3ZA 2OPQA 3UNYA 1Y9OA 3OUYA 4DG1A 1RJJA 2W4DA 1FKAF 1NAQA 4YUDA 2VBYA 3RBEA 3FMBA 4LUBA 3J81U 1T9XA 4RR5A 5LSOA 1CJUA 2RH3A 1REVA 3G71S 3Q89A 1S72S 2DHHA 4QIWD 1UEUA 4IRCA 5KFVA 2RUGA 2AJ4A 4LF7F 1N88A 2HKEA 3FCWA 2CQ4A 1O51A 3H25A 4OI6A 2B51A 3RBXA 1J5EJ 1N5YA 1XBWA 2PIIA 4Q8EA 1JKHB 2CZ9A 1F0XA 2X7IA 1X5OA 4R0JA 2YX1A 4RNHA 1KFSA 1WDDA 5K5MA 5HROA 1HNXJ 4USHA 4FYWB 4QYZJ 3IBCB 4XK8C 3GJSB 2Z0GA 1R8PA 3R3TA 3K8VA 4BC9A 2E9ZA 2R7XA 2YNHA 1QTMA 3I4HX 3HFVA 2CDQA 1SQGA 4ETXA 2BW2A 1FRLA 4DLGA 3F41A 4ZCLA 2OGUA 3NS5A 4R8UA 2CG4A 5KFDA 3MPVA 5IZHA 4A8FA 4LQ9A 1A9NB 3M4XA 4ED3A 4IQXA 4CO2A 2ASJA 4C4WA 3LP0A 2DHSA 2AWZA 2G4BA 2HMIB 2NQPA 4QIEA 3SXLA 2BJ9A 1HNWJ 5JUMA 3HVTA 4JYAJ 3ONQA 3A8JA 1XQIA 3MEKA 4I1TA 2DD8S 4AFFA 2B43A 4R25A 1RTDB 1NK4A 1Q8BA 4C11A 2XBPA 1FNOA 4PWDB 4X4QA 5KFFA 4JI0J 5L1KA 2IYIA 3QZ8A 1J5EF 2CNNB 3C6UA 3AQOA 5C42A 3JQKA 2RHSB 3K89A 2E7WA 3EICA 2YH1A 1WTBA 4ZLLA 1UP1A 1HNXF 2HRTA 2RS8A 1WD6A 3D6TB 4K4VA 4PR6A 3W5ZA 2VU5A 1RB0A 3PTWA 4GVBA 2VA2A 1WI6A 1N6QA 2DPJA 2YNFB 3K5MA 1VYAA 4KGVB 5IFMA 1S7IA 3TAMB 4ZVEA 1OIAA 2PD1A 2CJAA 2GHVC 1BMQB 4ZVPB 4Y2IA 2IPOB 2DEJA 2BQRA 3M8QA 3C15A 3W8PA 3GIRA 1S1XA 4F0HA 3GJRB 4LFAJ 2W25A 2BJ8A 1FDNA 2GNKA 4DF4A 3KLIA 3GR1A 1T11A 1WC6A 1LW0B 3A13A 3LP2A 2JVOA 1RKJA 3R2CJ 3MUMP 1B0TA 3UN3A 9ATCB 5I3QA 1KOOA 1PG5B 3F0NA 3L7PA 5DGBA 4UOGA 2C3PA 3VAJA 2R8GA 4IKAA 5LL6d 1O0PA 4PXBA 4ED7A 1S6PA 1TMMA 4JYAF 1P9QC 5KFMA 2J9EA 3FBBA 1HBMA 2MJUA 3T6BA 4WZMA 3MZIA 4NEYA 5AXLA 5DDRC 4KHMA 2B3TB 4JI0F 1TUGB 4OZNA 1S1TA 3MMBB 1X5SA 2FGOA 2ZBIA 4DPYA 3OTEA 3Q2TC 2MQMA 2P6SA 2WZ1A 1GX5A 1I1GA 3BBCA 5I3UA 1WC4A 3PEHA 3IRXA 2AGQA 1ZZFA 1V9OA 1X5PA 2R2TA 1JJCB 1Z2LA 3J7ZT 2K06A 4EWTA 4WFZA 3V81B 2FIUA 1EIYB 1KEKA 1KKHA 2J9CA 4CLWA 3BSAA 1FNMA 3DLEB 1PC4A 4F2SA 1RT6B 1PJ6A 2FY8A 1YJ9S 1RT4B 5A8KB 4X4PA 3CCTA 4WKRA 3W8GA 4LFAF 1FJGJ 5KFYA 4DZ6A 3MEGB 2HLUA 2NUUG 4EBEA 4M94A 1C1CB 1FRHA 2F4VJ 1T9WA 3Q8SB 4R0EA 2O01C 2VFTA 3W61A 5D78A 2AQ4A 5GMKa 4RWWA 3UN2A 4OI2A 2HBZB 3VGTA 5D8HB 4DV0J 4WE1B 1Y3JA 4V19J 2DY9A 2DGTA 3CT9A 4DPWA 5DZ7A 3Q24A 3E3XA 5K9FA 3I0RB 2XO6A 2CQBA 5HVHA 1R8CA 1YG0A 4LSNB 1Q81T 1U1QA 5ETVA 2GMJA 3H2VE 3SSQA 4AD6A 4Z2XA 2DNLA 2QIFA 4Q43A 5DDQC 5F8GA 4QWBA 1S59A 3NS6A 1FA0A 1UTAA 5IWAJ 1S7HA 1JXEA 3RRKA 5K14A 2YKMA 2E7XA 2CQHA 4OJ3A 1B64A 2XCAA 2OPSA 2HAIA 3N6LA 1S1WB 3OPKA 1I94J 3OW2R 1SUQA 3GLJA 3M8PB 4RO0A 4ZPVR 4YY3F 1P8GA 1Q8LA 4X65F 2HFVA 1UVIA 1FJGF 4J37A 1H98A 5F3TA 4OYIA 2VA3A 2F4VF 2F9JA 4JI8J 3ISND 1OMSA 3MTKA 2AYGA 3PJ9A 2FY1A 2CPEA 4CLKA 2VG6B 2HHHJ 4KB7A 5D0HA 3AD8C 2MKKA 1TK0A 4DV0F 4U96A 5GAHI 4ZPTR 3QIDA 5E3AA 2CYYA 2ZVSA 3CPWR 4M63A 4WCEQ 2R4FA 3DLKB 4LF9J 1Q1KA 2OPQB 2X1BA 1HQUA 3OUYB 3CIMA 4DG1B 4IRDA 3GU0A 1VDHA 2IHR1 4DL6A 4KKOA 5K8PA 3TWZA 4MK9A 5IWAF 1N0UA 1CJUB 1REVB 2CRLA 2EWHA 1ZYQA 1FWPA 2DIVA 3BBBA 4QCLA 2B7BB 3HHKA 5B09A 3S6EA 2CQIA 4K0KJ 2HBYB 3FK4A 2LECA 3PHEA 2GMLA 2WSCC 2A3JA 3PY8A 1I94F 3FZBA 1HA1A 2IBOA 2AEJA 3LOUA 3JTPA 3MM5A 1MMDA 1K44A 2M2BA 1N5YB 2Z2ZA 2MZSA 4TQRA 2M4MA 4CRJA 4JI8F 4P2XA 4QQBA 4ZP7A 4ECQA 2HVEA 3CSKA 5HROB 1T9TA 3KNGA 2YTCA 2NREA 2YKOA 2DGVA 4O4GB 2HHHF 1QVFR 2W9CA 1U2CA 2AMCB 3GQCA 1H74A 3K59A 2E1AA 1NJZA 3IR6B 4ZP6A 4DR3J 3JTNA 2MYFA 4DSIA 3HDSA 2LQJA 1CSJA 2YNHB 4IUFA 4ZP8A 2R2UA 1H72C 5ETMA 2PDAA 3ZO7A 3D1OA 1JB0C 3DKDA 2M8DB 4L3NA 2L9NA 2LQ9A 2BVZA 2F7VA 1FNXH 4LF9F 3ZTRA 1N5TA 8AT1B 1Q5VA 4R8UB 2VODA 4ZLNA 1WHVA 4ERDA 2GV1A 4N41A 2MMYA 4LFBJ 1QD1A 4K4TA 2K1RA 1UZDA 1HMVA 1NK7A 4HH0A 3DCAA 1GT8A 4DR1J 3HVTB 5HAOA 1VHIA 2MQPA 3QAEA 4K0KF 5FLXY 3OD2A 1FRXA 3T1AA 2L3MA 5AE3A 1TFWA 1TL5A 4C11B 3JS9A 2R3VA 4XDDA 5KT4A 4F3OA 3NNAA 2MKHA 4JBCA 5C42B 3HFKA 3HD1A 1URNA 2CQ3A 2FVQA 2GCFA 2FJBB 3WC0A 2GIFA 1SKRA 3HZGA 2RU9A 4ED0A 3DU6A 3D6HB 2ZFHA 1RACB 4GVBB 5LMNJ 1KQKA 1N6QB 2QO3A 5GMEA 3RB4A 3ELHA 2KRRA 4DR3F 3W9JA 3M7VA 5JMNA 1CS4A 2AX1A 1U0HB 2VBXA 3HHLC 3M8QB 3C15B 3NWGA 2J6UA 3MM9A 1A7GE 4KHRA 1GMWA 4WXWA 3AH6A 5DS7A 2RIJA 5KG0A 1FRJA 1B3TA 1QAXA 3KLIB 2GMHA 2HHUA 1MU2A 5AXNA 1NJYA 5AJ3J 4ZITA 4F7VA 3D6MB 4USMA 3ISZA 4LFBF 2HS3A 3DRXA 1S6PB 4F50A 2R42A 5JVGQ 2Z8QA 2HGLA 2DKOB 1KQFB 1HBMB 1NHVA 4QIGA 1RABB 2DISA 5A0YA 1U6FA 4RW6A 1LWCA 1S1TB 2RF2A 3GPAA 2LP4A 2AP6A 2OSRA 3RB3A 4OZ2A 2EEYA 5I3UB 2DIUA 2D41A 3H90A 1I6JA 4Q0BA 3IRXB 1BD6A 1S76D 3JAMU 1FJCA 4OV1A 3AOBA 4ETZA 4ECZA 2AT1B 3DOKA 3WHIA 2V6AA 1HI0P 5LMNF 1Q8KA 4TVAB 4CLUA 5B0DA 4I4BA 4MIWA 1HBOA 1WJ9A 3MAHA 1KN6A 3AOAA 2CVIA 1YHQS 2ZJRQ 3CJRA 1H2VZ 3FJ2A 4DS5A 1CULA 3GILA 1G3OA 4KYZA 2E7VA 5L38A 4DV7F 3NAIA 3Q8UA 2IMOA 2AYBA 5E3CA 2DO4A 2GJ2A 5KFCA 4ILLA 4PWWA 2FLLA 2IRUA 1TZ0A 3CF5Q 5AJ3F 1Q16B 2WSEC 1YKWA 4WFXA 5L1IA 3BKUA 5B0EA 3QQCD 1IBLF 3ENVA 2ZBRA 1R0CB 5LMUJ 4JI4J 1XR5A 4FYXB 4K5SA 5FDLA 1TU0B 2EFPA 4AUKA 2Q79A 1BGXT 1N33J 2M52A 1RWMB 1RQ0A 2A2CA 1QSYA 3MM6A 3CMES 5IV4A 2C2RA 3LA0A 2G0JA 1M5KC 1R27B 2XNRA 1D0EA 4ID8A 2DGUA 1JNRB 2X1FA 3M6WA 4EMDA 5KT6A 3TEGA 5K14B 2AHOB 3FC9A 2YKMB 1I5OB 2BRKA 4DZDA 1LXJA 1CBKA 2UU9F 3HLUA 2OPSB 4EU0A 4FBTA 3KUGA 1R6VA 4IR1A 5GAHU 4M5NA 2HIYA 3ZZYA 1T05A 2MZQA 1SUQB 2Y8YA 3EE3A 4NLXA 3SCLE 3GJTB 4ZPWR 1U2FA 1GH8A 3BKTA 3HVWA 3NNCA 2HFZA 2EXUA 3S1TA 1TKXA 1Y11A 4DEZA 1YJNS 1R8HA 4PG7A 1GXTA 2GW8A 3QJPA 4LR8A 3GV7B 1S6UA 2CQ1A 1WELA 3VCDA 4BWMA 2WW4A 3M2UA 4GRSA 5LJ5Y 3D3BJ 4JOUA 2Z57B 4B3OA 1RHUB 2F63A 2W9AA 4RNFA 3EVOA 2CPDA 3R5JB 1JX4A 4O44A 2VDIA 3K17A 3ENQA 3PYGA 4RL1A 4GO7X 1NK8A 2E5LJ 2KXHA 2VICA 1HQUB 4X2BA 3BGFA 3J7AN 4J9SA 3OXGA 4PG5A 4J9UE 3DM2A 3GWCA 2FYXA 1VC6A 4DQQA 2Y1JA 4X66J 3KG1A 4KKOB 3IFEA 3NAHA 2ZC3A 1RT7A 1ZAVA 3WDOA 4UT4A 2RT3A 3OV7A 3T3FA 4IG3A 4RW9B 3KMQA 4X64J 2HYIB 1T94A 1VQ6S 3HF5A 3MUVP 3PEJA 1IWAA 2GO9A 2V2VA 1CPZA 3OR2A 4KY3A 1XWLA 3ZTPA 4OLOA 3CDAA 3MM5B 4C8OA 2Z2YB 3H5XA 4F4AA 1O6XA 3DRSA 1WACA 4RWXA 2EW9A 4A46A 2HS0A 4TN2A 1VQLS 4IDKA 3I5CA 5KAKA 4IO9Q 2H54B 3EZ5A 1VQ8S 4P74A 2F8HA 4NLOA 4DX8H 1WUUA 3EUNA 4ZHRB 1F9EB 2H4WB 2JOQA 2W9CB 4L76A 3T6JA 1IBCB 1BQNB 2EFNA 2W4CA 2ZWPA 2FDNA 1K73T 3RAQA 3LO3A 2J7UA 3C14A 1PSDA 4DSKA 4DQRA 1JLFA 1B0PA 1P9YA 1JLEB 5B7WA 3M8YA 1M0SA 2E5LF 2VIHA 3DN9A 4Y28C 2UVWA 5HQLA 2DNKA 2W7OA 4L75A 1L5UA 1FO1A 2CPXA 2J7KA 5KFQA 4X66F 3B4DA 2B9YA 4ZIWA 1U25A 5ETSA 4K59A 5JJBA 5EWGA 4J9OA 1HPZA 2K1RB 3DI6A 1HMVB 3FCHA 1TL4A 3DC2A 4WBFA 1FTRA 2ZOGA 1RBAA 5HVGA 4X64F 4LRCA 2HRYA 2DNPA 1N0VC 2AEMA 3SEOA 3NS7B 1M90T 2K2PA 1VIXA 2YWEA 3TAQA 3OJUA 2XCPA 4HI2A 2BOAA 1HLWA 4GVLA 2ZH4A 2HBQB 4JV5J 4QOTA 2FZGB 4OX6A 2KFZA 1PILA 1D1UA 2COLA 3G6ES 4HH1A 3FCVA 3AAWB 2C3OA 2CPYA 3VAHA 2XMKA 3QJLA 1RLCL 4KO0A 2PI4A 1Y5LB 2CAJA 2HFOA 1FT8A 2OJ3A 2P9EA 2ZZNA 1CS4B 3RZAA 1HQEA 2OAUA 3NLCA 2WVFA 2KH9A 1KSPA 5DM7Q 1RI7A 5B08A 2QEXS 2PN6A 4YR2A 2WVBA 5AE2A 3I96A 4LBPA 3M2VA 3VTIA 4NX9A 2G0CA 3BSOA 3W60A 4YR0A 4PG4A 4Y2AA 4B08A 1AROP 1JMTA 1KVJA 3LGMA 4WFYA 3W62A 2XTJP 1MU2B 8ATCB 2AJ0A 2FJDB 3VAMA 1NJXA 1QUVA 3EVWA 1RTIA 5HL7Q 3HULA 2KVQE 1IR0A 4ED1A 5CA5A 2G2OA 4IO1A 3J81Y 2L41A 5GAEI 3NG8A 5F3ZA 2KM8C 1WSRA 5M2RA 3P6YC 3FQKA 1F3FA 2HG4A 4M5IA 3U27A 3AA9A 1H2TZ 5IM0A 1D3WA 4FDFA 5KFGA 4ZVQB 5C24A 2XO7A 5A0YB 2QA4G 4RW6B 3JSMB 1LWCB 1S97A 2B6AB 4DSLA 2RF2B 1SJFA 1RAOA 3QT6A 3Q8RB 4ILRA 4TYAA 4JV5F 1ICEB 2WBRA 5DO2A 2UP1A 1HARA 3QZ7A 3PW7A 4CWBA 4Q0BB 2IA6A 1IKWA 3RW6A 1F5BA 3M6VA 4G1PA 1SH3A 3HFZB 5CYQA 2NXJA 1AZSA 1EARA 4B3SF 7AT1B 4Y2KA 1YDLA 1XK8A 4A4JA 4A8YA 1VJWA 1PKUA 3IGNA 1KC8T 1RTJA 2VPZB 1SQFA 1CULB 5L1LA 2BANA 3PW0A 1KOHA 5GVQA 2DR5A 2M9KA 3BGUA 3FBCA 3FZ2A 5KFNA 2NR0A 4U95A 3NKYA 4A47A 2VC0A 2XGPA 3S01A 2CDRB 2D1CA 2DRAA 4YR3A 2UVRA 3A3NB 1ZA2B 3M2RA 3NGDA 2V9KA 4DHVA 3MPUB 3F56A 1A0OB 3E8OA 3DRPA 4ECTA 3H42A 1RISA 3NBPA 3TUIC 4NCGB 5FDLB 4N47A 2CADA 1U8SA 2Z4PA 4WP3A 2L08A 2UV8G 2ZDPA 4O0IA 3KHLA 3MM6B 4DQIA 1LWEA 5H9FK 5D3GA 3TA0A 3PZPA 2B7CB 2BJ7A 4IFVA 1LW2A 1YBTA 2M88A 5DG9A 3ZZTA 3GYXB 4DX7A 1Y5IB 3DMJA 2DNHA 2O3DA 4DUTA 4DCPB 4H4KC 3CUNA 3DLJA 1ROFA 2JEIA 1NKEA 4TNOA 2H5JB 3FEZA 3MMCA 2OFGX 2V5HG 3EGVA 4CT9A 1T05B 1RWUA 1W26A 2JC0A 1NUEA 4WIQA 1Z2ZA 4DL7A 1B7FA 2C3MA 2YX7A 3IN5A 1Y5NB 1TKXB 4P75A 2YH0A 1P27B 2CXEA 4ELVA 2CZ4A 4CLFA 3BPSP 1IKXA 3R97A 3IBFB 1TUWA 1ZM2A 1FF2A 1CLFA 3FFIA 3M2UB 5DRKA 5K8MA 1FVQA 3R5DA 4P2FA 3CC2S 4ZCIA 4B3OB 1RU1A 1RA7A 4PQAA 2IM0A 5DJBA 4C7QA 3BQ2A 1LNQA 2XZTB 2GQCA 2BBEA 1CVJA 5CCLA 3VWSA 4M5HA 1GMWD 3O44A 3LAMA 4O44B 5FIIA 1FESA 4KRWA 3PHTA 2MY8A 2NZCA 3SCJE 4K5RA 1OO0B 4EYHB 2R7WA 3DM2B 2XWXA 4YHHF 2W4PA 4IOBA 2XSJA 4LRBA 1RT7B 2AKWB 1NNDA 2DR8A 3SYZA 4IG3B 1AW0A 4KAIA 1H38A 1HHSA 3MOJB 1G6BA 2HQGA 4LFCJ 2XZDB 1UJ6A 3OVSA 2UXBJ 3OR2B 2RQCA 3NRBA 3VVTA 3LF0A 5IQ6A 1VLYA 2XI2A 3T1YJ 5KFTA 2B5JA 5DQGA 2JHEA 5MAOA 2E1PA 2CJKA 4M5LA 4L74A 2C22A 3DRSB 2KT3A 3OTDA 2CPZA 2C28A 4IDKB 3T9NA 5L9XA 3MMAA 4MT1A 2I1RA 1KNZA 2YPYA 1UA0A 3L4BC 1L3SA 3MGJA 1R0BG 1LWFA 2HQCA 2ERRA 4U7UD 2RB7A 4PEOA 2GS8A 3A3PB 2QGFB 1FHTA 3M9MB 3C14B 4KH1B 2XMJA 2OEJA 3HM9A 3FRZA 1HI1A 1HWLA 1JLFB 3P5BP 2L48A 3W2WA 1FXDA 5FD1A 1RAIB 3N28A 2K8GA 2AZ3A 5KT3A 3PFOA 1T3OA 4ECYA 4FVCA 2MQLA 2QYCA 2QMWA 3CEDA 1XEZA 3M1VA 3QLHA 3ET6A 1QAIA 1YLXA 2E5JA 3GFZA 4NLTA 1E6YA 3WC2A 1QUPA 2LCWA 3MR2A 1K0TA 2FD2A 2RQKA 1HPZB 4UTGA 3DI6B 3P5TL 3RU0A 2DR9A 1S9EA 2DGXA 2P5VA 3SV3A 4FXWA 4OIXA 2PA3A 3PX6A 1S1VA 4LFCF 2EC2A 4NZ6A 2XLJA 4K7QA 1U47A 3ADAC 2UXBF 2NSCA 3PX4A 4LVNP 1GMUA 5GAGI 4FNIA 3T1YF 3OL8A 3C8YA 3BM7A 1PIEA 3TI0A 3TZWA 2Y3YA 4QW9A 3ZNJ1 4ALZA 2Q3PA 4BLGA 4H4MB 1SC3B 2UUAJ 1WOSA 3H59A 3TUPA 3ZFVA 5I3PA 1KTVA 1IXKA 5KFSA 3SSRA 5EWEA 3X1LB 4KO0B 2V2KA 2BOPA 1HQEB 5GAEU 2JEFA 3CD0A 3CCZA 1PCAA 4ES1A 4TU9A 2B4OA 3IBWA 1PAUB 3OFFA 1RHRB 1RWNB 1V5VA 1FKPA 3GP9A 2RUSA 4NE9C 3G82A 3UR3C 3TOQA 4C9DA 2O5DA 5THWA 1U26A 5KFWA 2DNGA 3BSNA 3PVXA 1BHNA 5HSPA 1ZA1B 3MEEA 5KT2A 1RTIB 2Y1RI 3KFWX 2CQPA 4KPCA 2XS7A 2OH2A 2WTFA 3H5SA 2IM1A 4RKUC 1VQ4S 4K2JA 3SSSA 1EX8A 1VMBA 3OHBA 5KFXA 3T1HJ 3VQTA 2W2OP 3C16A 4DPTA 5C24B 2IJNA 2J0QD 3OLAA 5IS2A 3R6LB 2IVFB 3MCOA 2UXDJ 3ILIA 2O1PA 3E2EA 1IQTA 2DNNA 4ECWA 2UUAF 3CCJS 1IKWB 3CO0P 5CYQB 1AZSB 2ATLA 3IM9A 3DLGA 3GG0A 5B0CA 3L95X 1K47A 4KV8A 4J90A 2E9RX 2MY7A 1JK9B 2H9ZA 1N36J 1N34J 4XTTA 4FYVB 1RTJB 2I0XA 4YB6A 4WK3A 1XNRJ 3CJ5A 2EFVA 1DQ9A 2BANB 1XNQJ 3FRYA 1HR0J 1ELOA 1UWAA 4WIIA 2KJVA 4PPZA 1FX2A 1RBOB 3FNNA 3ZZOA 1AA1B 3G96A 3PYDA 3G6VA 4RPFA 2I5JA 3H2LA 1TV6A 3HHLA
chains in the Genus database with same CATH topology
1KRPA 2RQMA 3CPWR 3M2RB 2MHNA 1Q79A 4WYWA 5HI7A 2ASDA 2BV3A 1IJEB 4B9LA 4M63A 2POKA 5F0WA 5DG8A 4WCEQ 2EK6A 3M30B 2HWTA 4F4ZA 2DNQA 2R4FA 1HWUA 2XZWA 3DLKB 1Q7LB 1RP5A 1SV5A 4JI5F 3CDEA 2ILZA 2MQNA 3DRPB 1Q1KA 2GX8A 2OPQB 2X1BA 4QPXA 3NBPB 3V6DA 4DR7F 1LV5A 1RK8A 1HQUA 4RLEA 1V3RA 2MZJA 3T1HF 2KB2A 2OP5A 3OUYB 3CIMA 4DG1B 1X4EA 4IRDA 1VQSA 4GC6A 2JSXA 5KT7A 3V4IA 2F40A 1FXRA 4NA3A 1KVIA 1FE4A 1V3ZA 1H7XA 5EX3A 2VG5B 2IHR1 2KT2A 3AB4B 4DL6A 3G6YA 1T8EA 3T5JA 4KKOA 3KK3B 2LXIA 1UFLA 1X5TA 2K7KA 5K8PA 4WXOA 4ZMMA 4XIUA 2UXDF 2DB1A 1F5AA 2XNQA 4MK9A 1RT2A 3THPA 5IWAF 3MR5A 2J9DA 2J0XA 5J2NB 1N0UA 4KT0C 5T14A 3BGLA 1ZH5A 4PPDA 1X4AA 1REVB 2CRLA 2XMTA 2EWHA 2ZBCA 1NK6A 4U7UK 1ZETA 1DJ0A 5D3GB 4C8MA 5HMZA 4O4GA 1ZYQA 2I5JB 2DIVA 1XN9A 4LIWA 3ITHB 4QCLA 2B7BB 2XULA 4Q8FA 1SH2A 3HHKA 5B09A 1HWJA 4IFVB 3S6EA 2CQIA 2LDIA 3HHLB 2YWGA 3DDNA 1LW2B 2LECA 3PHEA 2RD5C 1C0UB 1FK9B 3DGPA 3N6NA 2GMLA 2WSCC 4XO0A 2A3JA 4C8KA 3PY8A 1OPZA 1WHYA 1I94F 2VB6A 3FZBA 4Q2MA 1HA1A 1CC8A 2IBOA 4G1IA 3CJ2A 4XPEA 3CDBA 1MROA 4MIAA 4O4RA 4WKYA 2RRAA 4OHYA 3LOUA 1CEZA 2UUWA 2AV5A 3JTPA 3MM5A 2UXCF 1MMDA 3N79A 1N36F 1N34F 2M2BA 2QRRA 2G13A 3I9V9 1N5YB 3MMCB 2YNGB 3KJVA 3UCZP 1CQMA 3QIPA 1N8RT 1HW8A 1XNRF 1VBYA 5EDWA 1YQHA 3OSNA 5M2PA 1XNQF 2MZSA 4N76A 1HR0F 4TQRA 2M4MA 4JI8F 2KTQA 3GV5B 2DT9A 4OZ5A 4Y3CA 4QQBA 4ZP7A 4ECQA 1GQEA 2VPWB 1VQNS 2O67A 2B4PA 3CSKA 2R9LA 5HROB 3MI7X 2DPIA 1QSLA 5E7OB 3CB4A 3CJKB 2KHCA 3LQVA 3H40A 2FHJD 3KNGA 1GXUA 2IFXA 4PXEA 3CIZA 2N7YA 2YTCA 2NREA 5IT9Y 2YKOA 4U6PA 2DGVA 2VPXB 3DYAA 1U6BA 1WEZA 2EVZA 4O4GB 1XR6A 2HHHF 3B4MA 1KHVA 1QVFR 2W9CA 4RW7A 2C2DA 3HI9A 2F3JA 3MTJA 4ICLA 2YNIA 3PDNA 4XPCA 3GQCA 4I69A 4PRFA 3TR5A 3K59A 1JLCA 2R2SA 3RTVA 2E1AA 2NPIA 3BR8A 2RKIB 1NJZA 3IR6B 4ZP6A 4FYDA 3JTNA 4ED2A 2MYFA 4DSIA 4DFMA 5C5JA 3HDSA 1IKXB 2LQJA 1CSJA 1HNIA 2YNHB 4ZDNA 4ZP8A 4IUFA 1X4FA 2R2UA 1NHUA 2V9WA 2PDAA 4M1KA 2RQ4A 4OI4A 2AF6A 3D1OA 3K7RA 2N4DA 4RUCA 1UEVA 3LP1B 2RE1A 3FEYB 1JB0C 3PW4A 1VRUB 5KFKA 1SL0A 1HL6A 1VQKS 5B0AA 2M8DB 4DUYF 4L3NA 2L9NA 4X84A 2LQ9A 2BVZA 3V2UC 3LW5C 3D54A 1Q7YT 4NLPA 3R1LA 2F7VA 3EYZA 4QIVA 3CO9A 4MYTA 1FNXH 3RB0A 4LF9F 1GX6A 1N5TA 2DJWA 4ZLPA 4EO8A 2OD6A 2JLEA 4YB5A 1OQ3A 4R8UB 3CCVS 2VODA 4YOEA 3I4PA 4C8YA 3UPFA 1Y00A 1UVNA 3MMJA 3FGVA 4O3QA 2DK2A 1DZ5A 4X4NA 1WHVA 4ZP9A 3QWUA 4ERDA 2GV1A 5J1EA 4OL8A 2YKAA 3OBIA 1A6LA 3D0GE 4N41A 2E9TA 1XERA 2MMYA 4HT5A 4E0DA 4K4TA 4AXIA 1LFWA 1JLCB 2FGCA 3P3DA 1IQZA 4TY8A 2K1RA 4ECRA 4ED8A 1HMVA 3KG0A 1WI8A 2BQ3A 1R0AB 1NK7A 2ROPA 2LA4A 4HH0A 1Q4RA 3DCAA 3NGKA 4C0HA 1GT8A 4QBUA 2I2YA 1KTQA 4EGLA 3HVTB 4WU3A 4JI3F 2MQPA 2Q1LA 1TVRA 3QAEA 1FRIA 3J7Z5 4K0KF 3I31A 3IA0A 2XSJB 5FLXY 1BQMB 4ZVHA 4O3RA 4FF3A 4DQPA 1FRXA 2FUG9 3M05A 5A8WB 1RKIA 4DL0C 3JAMY 4ED6A 1R3NA 4KQZA 3T1AA 1NK0A 2KG1A 2MPUA 2L3MA 1UJ4A 2BACA 2MXYA 2YKQA 3T9ZA 1R6YA 5AE3A 4OJ1A 1TFWA 1TL5A 4C11B 4K4UA 3MM8B 4XDDA 5KFBA 1RT3A 5KT4A 4F3OA 2QSFA 3NNAA 5CZXA 2MKHA 4TYBA 3ZZ0A 2W7PA 2KJWA 4DV3F 4JBCA 1IM4A 1EP4B 2IBKA 5C42B 3HFKA 1SL1A 2KN4A 4BS2A 4ED5A 1WG1A 2MGZA 1HHTP 2DVIA 2N3LA 4NCBA 3KMSA 1S0VA 3DNCA 1U1LA 1URNA 3P96A 2F1FA 2CQ3A 2FVQA 3Q8PB 2GCFA 2FJBB 2DCLA 2M8HA 3N5BA 3R1HA 3VQSA 3M32A 3WC0A 1V3SA 4KR0B 4K4SA 3POTA 1C1BB 5IQQA 1QY7A 5T7LA 1SKRA 3HZGA 2RU9A 2LXFA 4A8OA 4ED0A 3KK2A 3DU6A 2B5JB 4TY8B 2ZFHA 1NKBA 1FKOA 3PKYA 3CCMS 2QZ8A 2CFXA 1J5OA 4WZQA 3BSCA 5HBMA 4DOZA 3MEDA 1KQKA 1N6QB 4ZPBA 3CCUS 2QO3A 4YMEA 1SJ3P 2AYMA 4I2PB 4A8SA 1XMBA 3CWJA 3RB4A 4GKJF 3MMAB 1ZPVA 2KRRA 1DTQA 2G9OA 3D2WA 4DR3F 5E3PA 2M0GB 2AX1A 1KFDA 1HNWF 4I7FB 1OPIA 2YWHA 1WHWA 2VBXA 3X3UA 3PW2A 1H0HB 2I38A 3HHLC 3IO1A 5KFPA 1J2VA 1YTYA 4RU2A 3CC7S 3DLLQ 4LF4F 1LWFB 1WEXA 1ZAXA 2RSQA 3G8TA 1TQLA 4OHXA 3M8QB 5HMXA 2LEBA 2JFKA 2QMXA 1JLBB 1V6HA 2ZOMA 3IG1A 3NWGA 3TW0A 2QE5A 1X4HA 2J6UA 3LAKA 2W8KA 3MM9A 2M5YA 1A7GE 4KHRA 3K58A 1VBZA 1JJ4A 3BDEA 2DH7A 1S4FA 4WXWA 4C3LA 1FDAA 1RT5A 3AH6A 4EUVA 4AL7A 5DS7A 4O3OA 2PMZD 2R8KA 2RIJA 1HBUB 3BREA 5E41A 5KG0A 3RB6A 1TK5A 1FRJA 1SI9A 3EXCX 4LVOP 2YKNA 1R43A 3W2WB 2J76E 1XTZA 2CQ0A 1QAXA 3KLIB 1FE0A 2HPUA 3UCUP 2GMHA 4KJIA 2HHUA 2K7JA 1MU2A 5AXNA 4IR9A 3L09A 3OFEA 5GAGU 1NJYA 2W9BA 5KFEA 3C66A 3QGHA 2FPHX 1KHWA 2C3YA 4KE5A 3KHHA 1HBNB 2E1RA 3ISZA 3KLHA 4LFBF 2DCUB 3DFEA 3TA2A 2OMLA 4I2QA 2HS3A 4WFBQ 2FHKA 4B9UA 2MDAA 4NYZA 4TQSA 2N3OA 2ZD1B 3T19A 4JV1A 1JLGB 1K1SA 5ADZA 4QU6A 3K5NA 4AQYF 2ZHAA 3DRRA 2N7CA 3DRXA 3M1VB 4Y00A 1QJHA 3QLHB 4RNOA 1S6PB 5L1JA 1VK8A 4EZ6A 3GMGA 4F50A 1BWEA 1PGZA 3CCSS 5E0OA 4URGA 5JVGQ 2IAJA 2Z8QA 2HGLA 3Q2SC 3I32A 5SZTA 1KQFB 1DTTA 1E6YB 1HBMB 2EK1A 2NSBA 3MR6A 1NHVA 3OFGA 5EHHA 3DHWC 1S99A 2ABYA