3UWTA

Crystal structure of a rna binding domain of poly-u binding splicing factor 60kda (puf60) from homo sapiens at 2.50 a resolution
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
197
structure length
197
Chain Sequence
GAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVGKAVTPPMPLLTPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa (PUF60) from Homo sapiens at 2.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Poly(U)-binding-splicing factor PUF60
total genus 49
structure length 197
sequence length 197
ec nomenclature
pdb deposition date 2011-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA02
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3uwtA01
2DNQA 2OTLS 3VAGA 3CMES 5CXTA 2CPFA 3U1MA 1U1NA 4UQTA 2MKCA 2RRBA 3I56S 2KM8C 2MMYA 1VQ7S 2NZ4A 1G2EA 2J76E 2RU3A 2DNPA 4RU2A 4QU6A 4QQBA 1VC5A 1Q82T 2J8AA 1X4AA 2M52A 1KOOA 1HA1A 2JVRA 2MY7A 1SJFA 3CCJS 1WI6A 1WHXA 2YWKA 2ZJPQ 4WCEQ 2DNKA 3SDEA 2JX2A 2KHCA 2N3LA 3P3DA 2FC9A 2RQ4A 3B4DA 2M88A 1WG1A 2OTJS 2CQGA 2M7SA 4FXVA 1OPIA 5GADU 2DHAA 2NLWA 3TYTA 2HVZA 2J0QD 3CCQS 2CPEA 2LKZA 3MD3A 3L3CA 5H1SV 1P1TA 1WELA 1X4HA 1X5PA 2JWNA 4C0OC 1S79A 2YKAA 1VQLS 2U1AA 2AYEA 2CQDA 2F3JA 2FHOB 2DGVA 1YIJS 2MGZA 3VAFA 2LEBA 2OSRA 2EVZA 2F9DA 3G8SA 1WG5A 3UCGA 3CCLS 3NMRA 1WI8A 4IUFA 1WG4A 3MUTP 2MZSA 3D2WA 4ED5A 2U2FA 1YI2S 2XSFA 2F9JA 1PO6A 2DNLA 2MZTA 3ULHA 2OIHA 1CVJA 2DHGA 2DNHA 3EGNA 1M5KC 1N52B 3UCUP 2XS7A 3TO8A 2DNRA 2AYGA 5GAHU 2MQLA 2KRRA 2CQPA 4YUDA 1Q86T 3N9UC 2OSQA 1A7GE 3MDFA 1FJCA 5DDRC 2DGOA 4Y00A 2CQHA 3EGZA 2DIVA 1QVFR 2MKSA 1VQMS 1RK8A 3MURP 3U1LA 3BS9A 3CUNA 2CPZA 2DHSA 2HGMA 3THTA 2KXFA 4PR6A 1FHTA 2CQCA 1JJHA 1YJNS 1VBYA 2RVJA 2AYMA 3R1HA 1U1OA 5IQQA 3UWTA 2DGUA 4WF9Q 3NS5A 2BOPA 1QVGR 3EX7B 1X5TA 1N88A 1JMTA 3LPYA 2DO0A 3I55S 1M90T 1VQNS 1U1MA 2E5JA 4EGLA 5LSOA 1U6BA 2MKHA 3H2VE 3BO4A 5JVHQ 2DGSA 2MKKA 1X4FA 2V94A 2MXYA 3SMZA 2CQ3A 1FNXH 2DH9A 2MSSA 2LEAA 2HZCA 2A3JA 2RNEA 1M5PC 2QEXS 1UP1A 4YB1P 3FEXB 3VAHA 2DNZA 2RS8A 1YJ9S 1WHYA 2AYBA 1U6FA 5FJ4A 3CC2S 2MSTA 3VALA 1ZZFA 3BO2A 2KXNB 2L9WA 1ZH5A 4CQ1A 5GMKa 3UD4P 4YOEA 2YH1A 1VQ4S 1VQ8S 3G96A 2EK1A 1SJRA 1XN9A 1VQKS 3G71S 2M8HA 3CULA 2XS5A 2CPIA 2GO9A 2D3OR 1Q7YT 5LJ5Y 2KXHA 3UE2A 2MQQA 3CCRS 2E5HA 3S01A 1X4BA 2KG0A 2B0GA 1YHQS 2AD9A 2EK6A 1VC0A 1KC8T 4WKRA 2SXLA 1H2TZ 2MQNA 1SJ4P 2M70A 2LCWA 5GVQA 2KRBA 2CPHA 3Q2SC 1PGZA 1RKJA 1Q81T 1L3KA 5DDPC 2MZRA 2LYVA 2KG1A 4WIIA 1WEZA 3US5A 1M5OC 2DIUA 3SXLA 2KH9A 2HYIB 2VOOA 1HD1A 2E5IA 1R8HA 2RQCA 3DLLQ 1SJ3P 2OJ3A 2CPJA 1UFWA 1YWXA 3ZZYA 1VQPS 1U1RA 3UCZP 4LJMA 4IO9Q 1X5OA 3S7RA 3NNAA 3B4MA 2I2YA 1X0FA 3H2UB 5DDQC 2DNGA 2X1FA 3V4MA 1OIAA 2J0SD 3TP2A 2O3DA 1WWHA 3CCSS 1WEYA 4QPTA 2CPXA 3THPA 3IWNC 3VAMA 3RW6A 2CQ0A 2KU7A 5MLCV 3CTRA 2MYFA 4LMZA 3JB9k 4J5OA 3PIOQ 4M5DB 2MJUA 1NO8A 4Z2XA 2DO4A 5D77A 2CQ2A 1WF1A 5GAEU 2N82B 3J7YU 2MY8A 3G8TA 4F26A 1ZZNA 1HD0A 3G9CA 1FXLA 1H2UX 2X1BA 4F02A 2DH8A 2ADCA 2M4MA 4TU7A 1YJWS 2G0CA 2K8GA 3K0JA 5LXYA 1FO1A 4PRFA 2M0GB 4CIOA 2M8DB 2DGTA 2VODA 5CA5A 2KM8B 4C4WA 2DITA 2KYXA 4V19X 4ERDA 1FT8A 1WTBA 2ADBA 4TLQA 1K73T 3J7ZT 2KI2A 2CQ4A 5CYJA 2MHNA 1DZ5A 3MOJB 1K9MT 2KVIA 3HHNB 4WFBQ 2DNMA 2CQ1A 1H6KX 1H2VZ 1QM9A 3ZZZA 1U1QA 2MZJA 2KN4A 4W90B 5EN1A 3VAIA 3G4SS 1BY9A 2YTCA 2LXUA 1P27B 2XNQA 2YH0A 4U67Q 2L41A 3CXCR 1WHVA 5D78A 1VBXA 5DDOC 4IOAQ 2ZJRQ 4WFAQ 5LSLA 2JVOA 2HGLA 4CH0S 5DM7Q 2DNYA 4LIRA 2MPUA 1VQ9S 2MQMA 1VQ5S 1OO0B 2GHPA 2UP1A 1D8ZA 2CQBA 2DNOA 2Q79A 1URNA 2X1AA 4BS2A 1W2BR 2DK2A 2LMIA 1JJ4A 1KOHA 1YITS 2JRSA 5IFMA 3NNHA 5DM6Q 1VC6A 5ITHA 4A8XA 2QA4S 1FJEB 1HL6A 4Y0FA 1X4CA 2MZQA 4QU7A 2KFYA 2DISA 2FPHX 2CJKA 2HGNA 3P49B 2M9KA 4P6QA 3G6ES 2LXIA 2PE8A 3VAKA 1NU4A 3S6EA 5LJ3Y 2RT3A 5IM0A 4UY8T 2DH7A 3HI9A 4TU9A 5JVGQ 4PKDB 1M5VC 2D9OA 1D9AA 3BEGB 2PEHA 4C7QA 1FJ7A 2CPDA 3VAJA 2MKJA 1A9NB 2DHXA 2LA4A 4W92B 5GAGU 5DETA 2FC8A 2E5GA 1YTYA 1U1LA 2QFJA 4OZ0A 3IRWP 3CC4S 2G4BA 1X4GA 2CQIA 2KT5A 1U2FA 3UD3P 5HO4A 5BJRA 1JJ2R 2MZ1A 2DNNA 1OWXA 3LQVA 3MXHP 1B7FA 1X5SA 3CMAS 2BZ2A 2LECA 2E44A 1U1PA 4WFNQ 5LXRA 4F25A 2VOPA 1DRZA 2D9PA 3NNCA 4FXWA 2FY1A 1DBDA 3RW7A 1AUDA 2K3KA 1UW4A 2MQPA 1U1KA 1IQTA 2G1DA 5IM0B 3P5TL 2DB1A 1SJQA 2LQ5A 3CCUS 2RUGA 1KD1T 2L08A 1KQSR 2DGQA 3MD1A 1VQOS 3CCVS 1WF2A 3MUMP 3CF5Q 2DGWA 4IOCQ 2XB2D 2MJNA 3DXBA 2N7CA 1S72S 1M1KT 2XNRA 2VONA 1N54B 1SXLA 2ZJQQ 3MUVP 2RRAA 2I38A 2XS2A 1DHMA 1R8PA 3VF0B 4TU8A 3R27A 2MQOA 3CPWR 4OZ1A 2LA6A 3R1LA 2ERRA 2CPYA 1X4DA 2X1GA 3SDEB 3P6YC 3CC7S 3Q2TC 3CCES 2WBRA 1VQ6S 1F9FA 2N3OA 3FEYB 1VBZA 3S8SA 3BO3A 2MB0B 4ZKAA 3NS6A 2MGZB 2MKIA 1K8AT 3MI7X 1WEXA 1NJIT 1UAWA 2M2BA 5HL7Q 1WF0A 1WHWA 1O0PA 1X4EA 3PIPQ 2RS2A 3CD6S 3CCMS 1N8RT 3OW2R 4CH1A 2DGXA
chains in the Genus database with same CATH superfamily
4OLPA 2CUYA 3D5MA 3I4HX 3V2UC 1I94F 4I2PB 2OTLS 4JV0A 2I1RA 4ZOSA 3R97A 3HHLA 1DTQA 4URGA 1TUWA 2WB1D 4H4MA 2RRBA 3I56S 1LOUA 3DLEA 4GKJJ 1V3RA 1NPPA 4ED7A 4OX9J 2C2DA 4DF4A 1WOOA 3VQSA 3N6MA 1QSLA 3QJPA 2AJ1A 4NLOA 4DV0J 4AQYF 5DG9A 2J8AA 1GQEA 1X4AA 5GMDA 2BYCA 3TR5A 2V4JB 1RGVA 2JVRA 2CXEA 5CYMA 1I5OB 4KGZB 1R8CA 1RHJB 1FFSB 5D0HA 1WI6A 1L5UA 1I6JA 4CLTA 2HHWA 4JI1F 4YN3B 4MJKA 5KFRA 4WCEQ 4LFAJ 1U25A 2DNKA 3A8IA 2KHCA 2ZC4A 3PTWA 3IP0A 2GZOA 4DEZA 3RYLA 2YBVA 2VIHA 3T5LA 4RW6B 3DOMA 4J9PA 2OTJS 5B7WA 5U47A 1IVZA 1UL3A 4WPAA 2B51A 2BW2A 3CJ2A 1HQEB 1OPIA 1QD1A 2HVDA 4KGMA 1LWCA 2BE2B 2Y1JA 2W2OP 2HVHA 1NDPA 3TYTA 2HVZA 2J0QD 1HBUA 2ZH3A 1P9YA 2LKZA 4G1PA 4E98A 2AHOB 2I5JB 2JH3A 3LP2B 3MD3A 4WBFA 4DV0F 2HW3A 4FP9A 5AJ3J 3KLIB 1X5PA 4WXOA 2JWNA 3B6BA 4ZK7M 5HMYA 1S9FA 2VU5A 1FWKA 4CYUA 4A8QA 4JI2F 3KHGA 4BDPA 2OP5A 2IM1A 3M9NB 4GC6A 5KFYA 2W9BA 2HFUA 2R2SA 1F9HA 4PAAA 2GMJA 4C8YA 4KPCA 2GVZA 2GIRA 2HRYA 1YIJS 2HNYB 4M94A 2LQJA 3TUPA 2EVZA 1RTHB 2QLBB 3GSIA 4YB7A 4K4VA 1WG5A 3DKDA 3UCGA 4RLEA 2JEGA 4LF6F 2M5YA 4DR7F 4A8YA 5IC6B 1TAUA 4PG4A 2DR9A 4IUFA 1WG4A 2C28A 1D9DA 1XERA 2I5JA 3K2YA 4DR3F 1TFWA 2KYZA 2XSFA 2OKQA 3KLIA 4F04B 2DNLA 3U27A 1IKVA 4QIVA 3MEEB 2PI4A 2DNHA 2EXUA 3IM8A 3IRXB 4PQUB 4ECVA 5KFBA 3RB3A 3UCUP 4WZMA 4CO0A 2QSWA 3FRYA 2Q66A 2D7SA 4F3OA 1TMJA 3PNIA 1HBMB 1VLYA 2CNNB 2W9BB 1Q86T 1V5VA 4RKUC 2Z57B 4WKYA 1RYRA 2ERRA 1A7GE 2B4PA 1NZAA 3MDFA 4WP9A 1FJCA 2AT1B 4QIGA 2CQHA 4AD6A 1T3NA 3EGZA 5HP1A 5C2GA 4F4KA 2IBOA 4JI6J 5J1EA 1HNWF 3HJFA 2XSJA 1HFEL 1WC6A 1TL3B 3BS9A 2CPZA 3GJRB 4PR6A 4BC9A 2CQCA 1N5YB 5EHHA 5A0YA 4RW8B 1VRUA 1U1OA 2LXFA 4K0KF 2QL9B 4U8VA 1BQXA 2X3GA 1I3OB 1FJGF 4HH0A 5J2NA 1QVGR 4USTA 3OPKA 4FBTA 2C3OA 5ETRA 1VFJA 1S9EB 3BSOA 2AZ1A 3IBCB 1VQSA 1B64A 1JMTA 2YKQA 2V2QA 1R0BG 1WOSA 3LPYA 4RUBA 5ETOA 4ZCKA 5IT9Y 4OYXA 3MZIA 1F5CA 3NGRA 5F8NA 1PBUA 1SV5A 2RHQB 3QAEA 3AH6A 2UUCF 1T03A 4C8LA 1AROP 3HSDA 3V81A 1U6BA 5IQ6A 1VGYA 5M2RA 4L72B 4PXEA 3KG0A 3LANA 1X4FA 3IS9B 4M5MA 3DNCA 3MM5A 4ITSA 1NRKA 3SMZA 3J80U 3JSRA 1SL0A 4JI1J 2DH9A 1LK5A 2ZVIA 2J6TA 3VTIA 4KGVB 5E3CA 2A3JA 1OQ3A 1NK6A 2OPSA 2QEXS 3C6UA 1O8BA 3A8KA 4DV3J 2LDIA 5C25A 2DNZA 3AD9C 1WHYA 2GFFA 3MMAA 3TZZA 5FJ4A 2GGPA 2CRLA 3M9OB 4FKXA 2ZBIA 3VALA 2IVMA 1ZZFA 3IG1A 5ETQA 2KHDA 2AU0A 4F2RA 3PO4A 1SC1B 1VIOA 3BDEA 2L9WA 3T1HJ 2GMLA 4Y65A 1ZH5A 1Q53A 1T94A 1MW7A 2E1PA 4MFBB 1SJ1A 3GJTB 3EJMA 4YOEA 2D74B 2HFZA 2R7QA 5EWGA 4ELTA 2EK1A 2IC3A 3GV5B 4NLWA 3L4BC 1AFJA 1N32J 1Y11A 4ETXA 1RDRA 3I0SA 2XS5A 5CD4A 3UVJA 3MAAB 3PW7A 3G2XA 1LW2A 2O1PA 1RT7A 3W1YC 2D3OR 1S0NA 2QIFA 2KXHA 2Q6CA 2Y1RI 3OW2R 5AT1B 3PW5A 1CS4B 3VCDA 1IKYB 2MQQA 2UUBJ 1J27A 2E5HA 3E51A 3F41A 1B0VA 2VJUA 2R8JA 1X4BA 1S10A 1C0TA 3O2IA 2B0GA 2IHR1 3QLHA 4Y2AA 3CNQP 2AD9A 2P9EA 3NCRA 2HKEA 3CT9A 4DL2A 3M1VA 1O6XA 2CJ9A 2P8IA 2PDAA 2VKRA 3B78A 5GMEA 3CJ8A 1H2TZ 2YKMB 4K2XA 1SJ4P 2RKIB 2M70A 2QC3A 2YNGA 3PM9A 4OI0A 2ZBQA 2L3MA 1LKZA 4EBDA 3Q2SC 1K44A 3OR2A 2ZHAA 5DLGA 3FBFA 1S9GA 2CJYB 3LW5C 3GIMA 5MAOA 2BKNA 1YJRA 4ZPBA 5DGBA 2IPOB 4KPYA 2HHVA 1M5OC 2DIUA 5E3RA 2X51A 4WTOB 2VOOA 3HDSA 1J2VA 5A6WA 5KFJA 3DGPA 1R8HA 2VDHA 1QAJA 1GXUA 2OJ3A 2E5LJ 1IBCB 5CHCB 4DN0A 5K14A 1RHQB 3DYAA 1ZYQA 1U1RA 3DN9A 1FRMA 4B9TA 3TARA 1S1VA 2RILA 3FCHA 5KFZA 2QLJB 7FD1A 1SKRA 4OHYA 1HNVA 3DRSB 4ZVOB 3OVBA 5KT4A 4DPOA 5KT6A 1CJTB 5F8GA 3GFYA 2GA7A 2FLOA 1HARA 2QLWA 1XJWB 1RISA 4X4OA 2HHHJ 5LSRA 3MFIA 2J0SD 2O3DA 1WWHA 2KFZA 2KT2A 4Y34A 1HI1A 3Q8PB 5CABA 4HHJA 2CPXA 4MTPA 4UQGA 3WX4A 2HHQA 4DU8A 3CEDA 4JBCA 4P2MA 2R7RA 2CQ0A 3OTEA 5MLCV 2R2UA 5EWEA 5A6PA 4G1QB 3H20A 2ILZA 2EBEA 3R5GA 4UUWA 1RABB 3JB9k 4EYIB 4LMZA 4MT1A 4QR0A 2KDOA 3OSPA 3RB0A 4IR1A 1BGXT 1TKTB 1ZA1B 1JLBB 4URQU 4YHHJ 2W2QP 4NE9C 2P2CB 2RQMA 5J2QB 4K4TA 3SZ2A 5HMWA 4LSNB 3W61A 1WF1A 2H4WB 4LSLA 4JI4J 1S1TB 3GJSB 4J9LA 4JI5F 3JAMY 1MMNA 2BE7D 1EJ7L 3DLGA 4DS5A 1LWFB 1HWUA 2XG8A 4UTGA 5HBMA 4CP5A 1BUXA 3OFGA 5B08A 4X65J 3CF5Q 4USMA 1ZZNA 1FXLA 4F02A 3KK2A 2DH8A 1NH8A 2WW4A 4BWJA 1NUEA 3W5XA 2M4MA 4LF4F 3HHLB 2K1RA 3BN4A 1U8WA 1KVKA 4ZCIA 4X62J 2G0CA 2NXEA 2O67A 4KQZA 3WC0A 1YJTA 4ZN1A 2AEFA 1CG2A 1XIQA 2M0GB 4RZRA 2UZAA 3LUYA 2DXDA 3IWXA 1RHKB 3NKYA 2DITA 4HH1A 3TVKA 3TVYA 5CA5A 4RNOA 4OJ3A 2XMTA 3OL6A 3RRHA 2G9OA 5K14B 2I9SA 1FX4A 4USKA 1RT6B 4J9QA 5J1PA 1D0EA 4B3OB 1LQ9A 1N5VA 1ZM9A 2GVDA 3J7ZT 3LALA 1IBKJ 3RR7A 3TZYA 1NSAA 1ZM4A 3NAIA 5LMUJ 3AD8C 3C46A 4LSNA 5CYJA 2NXUA 1Z4UA 3JXOA 3MM7B 1HWIA 4B3MJ 2B56A 4TY8A 5CD4H 4O44A 2FUG9 2KVIA 4DX7A 4ZCMA 4FNIA 2I8EA 2YKOA 4FF1A 3HHNB 1TL1B 2DNMA 2F4VJ 4FXDA 2D3ZA 2FIUA 3GCXP 1BXNA 5HI7A 1C1CB 1FX2A 3C16A 4ZLLA 1F3FA 1QM9A 5HVHA 3QATA 3H4BA 2LQBA 2PMHA 2XEXA 1IQZA 1GMUA 3M32A 3M8YA 2R2TA 3BSAA 2ZUGA 1NPKA 2EG1A 1ULRA 4FN5A 3GV7B 2ASDA 2F8MA 1HNZJ 4C8KA 1GMVA 3QPIA 4W90B 2JC0A 4XDDA 3TAPA 5E2QA 2BANA 2W9CB 4JI2J 4C6AA 4RNMA 3OHBA 5KFQA 3GIIA 3WZ0A 4EEYA 4U67Q 1FXDA 3CJSA 2B3TB 2AWZA 5ETMA 2HWIA 2VBYA 3P45B 3CXCR 1IR0A 1YBAA 4J9VA 1S97A 2XYPB 1GFWB 5KT2A 4P2FA 3MAHA 4QBUA 3DFEA 5LSLA 2HGLA 1EP4A 1TL4A 3H42A 2WONB 1CC7A 2DNYA 1XEZA 3KJNB 3CD5A 3LGMA 1NJXA 2MPUA 1NSKL 1HQ2A 2LDYA 4UOFA 5I3PA 5GADI 3V6KA 1VQ9S 4G3IA 2CIMA 1UJ6A 4LF5J 1DTTA 2V67A 2HFSA 3MPYA 4XPCA 2X1FA 3BKFA 2CQBA 2BJDA 3RU0A 2R8KA 1PKUA 5HMZA 2LU1A 3Q23A 2HBZB 3L7OA 3D6HB 3GPAA 1IKVB 3RBZA 3T1AA 1WUUA 2LMIA 3RBXA 2RF2B 3FJ2A 2DR5A 3OL8A 3FMWA 1YITS 1TVRA 3GONA 2BOAA 4DL7A 1XBWA 4CLWA 1RTJA 3I5CA 4Q44A 4TN2A 3PW0A 4HEA9 2JSXA 5CYQA 1VYAA 5ITHA 2JDJA 1SB6A 4A8XA 4DUTA 1VCTA 2Z30B 3NGSA 4P52A 2NQPA 2R7UA 1OMSA 3RGIA 4QU7A 5KFDA 2OD6A 2JEJA 2FPHX 2CJKA 2BEFA 2HGNA 3QWPA 5AXMA 5L1IA 3TQ1A 1Q8KA 1XWLA 2IRYA 2M9KA 3BN7A 3FBEA 3PYFA 2HPUA 4ZVPB 4NXMF 2PE8A 4TY9A 4MKVA 2YWWA 2B4VA 1LWEA 1NU4A 3QGHA 4PXBA 3S6EA 2ZKTA 4C0BA 3RJMB 1T02A 5D4OA 3BZQA 5IM0A 2QA2A 5KG0A 2DH7A 2JHEA 9ATCB 1XMOF 1HI0P 5M2UA 4UY8T 1TUGB 4FNHA 3UPFA 2IRXA 2CVIA 4F4WA 5KFLA 1D9AA 1VRUB 2BJ7A 4PYAA 1IBLJ 4QZVB 2CPDA 3EDRB 4K5SA 1IXKA 5KG5A 5A2QU 1ELOA 4JI0J 2QLXA 4C97A 2DPJA 1F9EB 4MK9A 4NYOA 4QW9A 4W92B 2BKPA 1RTJB 2FHKA 3GCWP 3M2VA 2HAIA 3V5RA 1IM6A 3I32A 5CH7B 5HP1B 1HR0J 5I42A 3HD1A 5L39A 4GKKF 2B43A 3LAKA 1X4GA 1YJ7A 3M30B 1Y5IB 4NEYA 2KZMA 3JQJA 4RWXA 1LWXA 1IBLF 3AHPA 1FNOA 2OO4A 2IIHA 3OR1B 4ECWA 2G13A 2VQFJ 4DQSA 1N5YA 1JJ2R 2DR8A 1J5OA 3VVTA 1DQ8A 2WVDA 1WOPA 3LQVA 1QAYA 1B7FA 5T7LB 1FE0A 4WK3A 3FCWA 1X5SA 1S4FA 4DFKA 1GXTA 5LXRA 2XMUA 3TZXA 3TA2A 4Z37A 2CJQA 3N6LA 4ZLJA 1CULB 2QGFB 4C48A 5A8WB 2F4FA 1AB8A 4NPOA 1K47A 4ILRA 3UQSA 2OPPA 1U45A 1NKBA 1HHQA 4O4GA 1JX4A 5HQMA 4PG5A 1QTMA 2UUAJ 3NNCA 2IAJA 4MAKA 2C2ZB 3VGVA 1BLUA 2H48B 1U0HA 1SQGA 2HEKA 4I0WA 4CLSA 4DV1J 1UW4A 1NJYA 1MN9A 4HDHA 3CJ4A 4YB6A 2V4RA 1N32F 1CJVB 2VG5A 5IM0B 5IS2A 3OVSA 2C3YA 4YR3A 4DV2F 1HNXJ 3ELHA 3GP9A 3C3LA 1DQAA 2LQ5A 2OFGX 1VR6A 3DDKA 4ZS6A 1S6PA 2L08A 4DCOB 3CCUS 2DGQA 3QIDA 1KQSR 3UW1A 2GV1A 5D0GA 3MAAA 3CGIA 1HYSB 5EGYA 3RBEA 1S0MA 4K7QA 1WF2A 1RADB 3A4TA 4ZHRB 5CCMA 3R2DJ 1JQGA 4X4SA 4IOCQ 2DGWA 1S1XB 1GX6A 2XB2D 2MJNA 4KRWA 2XNRA 1YKWA 4HTIA 3RAQA 2E1AA 3UN3A 4NASA 2UUCJ 1M5SA 2ZJQQ 1IR2A 3HHLD 4J9KA 1YGYA 2FD2A 4M5KA 4NLRA 4RX6A 2W8LA 3HO1A 4YY3J 4DL4A 2YNFB 1HBUB 2FZKB 2RIJA 4NLGA 2RKIA 2O01C 2YNGB 3SSQA 4TU8A 5AJ3F 4C8OA 3W63A 4HHUA 4DBQA 1NM2A 4ILLA 4FVCA 3I31A 2J7UA 4B17A 2EFVA 2R8HA 1A6LA 1X4DA 2CPYA 2ZD1B 3ADAC 3HMJG 1EQMA 3R5BA 4DV6F 1TKZB 2X1GA 1N0VC 2B4UA 1XC9A 1NEEA 3ZTOA 1EKRA 2NPFA 4KV8B 5C2CA 4A4JA 2B7CB 5L1KA 4TQSA 1KLMB 1Y3KA 2JJ4D 4B9UA 3CE8A 4WP8A 1F9FA 2AZ3A 2K2PA 1V3ZA 3M8QA 1XR5A 4X64F 5AE3A 1GT8A 2MGZB 2KT3A 2HNDB 1K8AT 3T1YF 1PYSB 1SI9A 1UAWA 2M2BA 4OYZA 5CZXA 3GR0A 2IA0A 3KLGA 4R8UB 1HMVA 4CM0A 3SQGA 5L1JA 2UVUA 5D6GA 1O0PA 1DTQB 1IBKF 2HBYB 1RAFB 1Y5NB 4I56A 2RS2A 3CD6S 4K8RA 2DD8S 3D1OA 4CH1A 3QGIA 3BM7A 3C15A 2DNQA 3KXDA 3DLHA 2CG8A 2XWXA 2ZWOA 3R5JB 4DPYA 5CXTA 2L48A 4OI3A 4DSJA 2CPFA 1MROB 2IRUA 2MKCA 3A3NB 3K5NA 3MPWA 5DQIA 1RT4B 2MMYA 1DY3A 2C2KB 2G0JA 3M8SA 3L95X 4F2SA 2J76E 4X62F 3LP1B 3N5BA 4DR1J 3M9MB 1HI8A 1R8AA 1VHFA 2EFPA 1U24A 3SQOP 3GV8B 5G4DA 5F9LA 2LFVA 4QU6A 1APSA 4KFBB 3HHLC 3POTB 1RCXB 2DHHA 2XCPA 3ET6B 3H2LA 1KOOA 4AXIA 3WIVA 1HA1A 4YB5A 4ZLNA 2LQ9A 2HNDA 3GIJA 4KT0C 2R8IA 3CCJS 2QRRA 3MEDA 1RKIA 5D4NA 3MR7A 2ZJPQ 2OAUA 4LF7J 3TJ9A 4WWSA 2IM0A 1PC4A 5GAGI 3R7SB 4DR1F 4JOUA 2Q43A 3P3DA 2JEFA 4ZP6A 4Z7YA 3D6FB 4ED2A 5IZHA 1RBOB 2HS4A 2M7SA 4IFYA 3GTYX 2J8SA 2XI2A 3OHAA 2G0IA 4IG0B 4G6VB 2R7WA 3T5JA 2CNOB 5GADU 1UVMA 4B9NA 3EZUA 2GO8A 1Q95G 1R27B 4O4RA 4K59A 2XM3A 3R7BB 4YHHF 2ZHBA 3VZHA 2XY7A 2NS1B 1RT4A 3MCOA 3OTOJ 3KUEA 3L3CA 1LWFA 5HBMB 3ENWA 5H1SV 4UUXA 5B09A 4XO0A 1X4HA 2VL1A 5G0RA 4R8UA 4DU7A 4DX6A 5DJBA 1S6QB 4DL0C 3M8PB 2W7OA 1KFSA 3K5MA 1MN7A 3AD7C 3DU6A 2RU9A 4OHWA 2BX6A 2DR7A 4O44B 1ZPVA 3LH2S 2QLFB 2YKAA 2YWFA 4H4KC 3KMSA 3MECA 1RAOA 1OSDA 3MM5B 1RWXB 3MTJA 2HRTA 2CQDA 4Q45A 2AMCB 4JI8J 4LF1A 4EWTA 3FBCA 4CYUB 2ZH7A 3Q22A 4KYZA 4LFBJ 4R25A 1WSRA 3LOUA 5D0EA 2LEBA 1CJUB 4DL5A 5KOXA 3HFKA 1YRUA 2Z2MA 3FQLA 2XHCA 4Q0BB 2OH2A 5AE2A 4FKYA 4XIUA 3NMRA 3IC1A 1G3OA 3MCMA 3QRRA 3D2WA 2R7XA 2U2FA 1FERA 2OD4A 3N5FA 3OXGA 4ECSA 5HQ8A 2HZVA 3D0IE 2UVVA 4ZPDA 4DS4A 2MZTA 2ZOFA 3TJ8A 2EW9A 5I42B 1KKHA 1M0SA 4I6WA 2DHGA 1C1CA 3DDNA 3EGNA 1MLAA 2H4YB 5D4LA 5RUBA 1QE1B 1KR4A 4OYIA 3KDOA 2W2PP 5BYQA 3IBFB 4N41A 4OX9F 2AIRB 4AL5A 2KRRA 2YPZA 1PC5A 1OY9A 2EFOA 3HZGA 3RAXA 1HNZF 1RXOB 3NLCA 5HK4A 2QZ8A 2V9KA 2FDNA 2ZUAA 5ETTA 5EUHA 3TUIC 2FVPA 3IN5A 2B6AB 1RE1B 2F5GA 2DGOA 5KG6A 3EYZA 3R2CJ 2W7PA 3N4WA 3BREA 5C42B 1R0CB 1Q16B 3U1LA 3QT8A 1OY8A 4CLUA 2OGUA 2HGMA 1UW9A 2HNZB 3HULA 3PJWA 2B5JB 3W9HA 1M5HA 5T41A 2ZBPA 1RWKB 3KJFB 4NA2A 2EKYA 2RVJA 2V34A 2J9DE 2YKNA 3HZEA 3K8WA 4L3NA 3R1HA 3UWTA 1C1BA 3BBCA 3P4UB 4WF9Q 4X4PA 5F0WA 1EX8A 4IH5A 4KHRA 3OL9A 2ROPA 1YQHA 1N88A 4GVBA 1H0HB 4USVA 3VWSA 1J5EJ 4KC5A 4KTQA 2DO0A 4S0MA 3ZZTA 1VQNS 1RBAA 1U1MA 3DLKA 1NH7A 1HR0F 1OYDA 1B0PA 1X8DA 4ZJOA 2B6AA 5JVHQ 3M05A 4PZVA 5KG3A 3VV2B 3C6TB 2MXYA 2V94A 4JI0F 1Z2LA 3WIUA 2CQ3A 4WU2A 1KLMA 2HLUA 3PEHA 4B3RJ 3BH6B 3QO9A 4A8OA 2LEAA 2HZCA 3HD2A 4NI2A 3PCOB 2DXEA 3W5YA 4TNOA 4X4UA 5KG2A 2YY3A 2DY1A 1IJFB 3D7SB 1FWPA 2YKNB 4EK2A 1EB0A 4DLEA 4WK1A 2WSEC 1U6FA 4KO0B 2YKPA 4ZIWA 4K4XA 2AYBA 1KBRA 4PG8A 2IDLA 4KH1B 2VJVA 1T7PA 2MSTA 4KHMA 3KWMA 1YBTA 2KXNB 4XDCA 4DSFA 5IXUA 3M4XA 1F1BB 1WORA 4CQ1A 1CJKB 2QL7B 3D4JA 3UD4P 2YH1A 2FGOA 1IJEB 1D3WA 3SFUA 4JYAJ 5LOQA 1OJ4A 3G96A 1SJRA 3OUYB 2R4FA 3A8EA 1X31C 2MEWA 3ISND 4ZPCA 1VQKS 4KJIA 4N5SA 2VA2A 1S1TA 2QA1A 4AFFA 2M8HA 4WTYA 3CULA 3EXYA 4OZNA 1PCAA 2GO9A 3M30A 1SC3B 2CAJA 3PW4A 1Q7YT 2UXBF 1F60B 1H7WA 2RSQA 4MIWA 5BR8J 2FHJA 2HVEA 3NOCA 4C8MA 3CCRS 2GIQA 2WZ1A 3IAS9 2FVCA 4GVBB 3S01A 1J5OB 1HNIB 2EPIA 2KG0A 2YQ3A 2VPWB 1VS3A 2XCAA 2AGQA 3DHXA 3W8PA 2OELA 2DY9A 5L38A 4LRAA 1KC8T 4WKRA 1RB0A 2SXLA 1ZA2B 3W2VA 5HN0A 4LQ3A 2RDIA 2W4PA 1VI7A 3RAMA 3MEGA 3JYTB 2LCWA 4ES3A 2VQEJ 2ZOMA 2KRBA 3T5HA 4HI1A 4ZJQA 2ZC3A 3LTOA 2ZZNA 1RKJA 1TV6B 2BXJA 3FK4A 4DV2J 2LYVA 2KG1A 3EICA 1WEZA 3J81j 4FS2A 3UO0A 2UXBJ 2UVWA 1KVIA 2KH9A 1HD1A 5ADZA 2RH3A 4H4KA 1TL1A 1D09B 2HFOA 2ZDOA 1UVIA 3DLLQ 1RT3B 1N6QA 2CPJA 2ZITA 2Y0BB 4KHPJ 1VQPS 2ACYA 1RTZA 4H4MB 3KHHA 4DUYF 2ALYB 3W62A 3KG1A 3GMGA 4LQ9A 3BF4A 3D54A 4I68A 3NAHA 3SSRA 1Q1KA 2CKWA 4RR5A 2I2YA 2AJ0A 2X3DA 1X0FA 3GQCA 1C2PA 1JLGA 1FF2A 1P1LA 2BVZA 1UA0A 1OIAA 2J0WA 4ER8A 4ECQA 4CT8A 2UUTA 2IDEA 2C2OB 3ILIA 1WEYA 4O3RA 2CNLB 2J0XA 1CBKA 2GGPB 4K5RA 4FVMA 3THPA 4C3KA 3CD0A 8AT1B 3VAMA 3MPVA 2W01A 2KU7A 4ZVFA 4QWEA 2JLGA 3CTRA 3IAM9 1UA1A 2CWKA 4J5OA 3PIOQ 2RRNA 4DV5F 2Q6BA 3CO0P 1RAAB 3NGKA 4DV7F 4FF3A 4QIFA 1T9YA 4N76A 3KLEA 2OMLA 5JUMA 3KLGB 4LF5F 2XC9A 1NO8A 2FQQB 4Z2XA 1N6QB 2HMIA 2DO4A 5GAEU 1DTTB 2HFVA 2LEPA 3LWMA 1T9VA 3Q8VA 2VFRA 1E6VA 1S59A 3J7YU 3HX9A 4EI2A 2MY8A 4AXJA 4F26A 1HD0A 4L6V3 4X66F 1H2UX 1WDTA 5D4PA 2FVQA 1HW9A 3EDQB 4USJC 4IRKA 2UV8A 2CG4A 1C4CA 4LR8A 2EFGA 5LT5A 3GLJA 1YJWS 2K8GA 1RT6A 4AT1B 1WC1A 4C3LA 3BV8A 4EBCA 1GTEA 4A48A 4NZ0A 5F8IA 3JSMA 2QTWA 3X1LB 3M2UA 2M8DB 4CIOA 2VODA 4C4WA 5DRKA 3AOCA 1DLOA 4CO2A 5GAHI 2KM8B 7FDRA 4ZVTB 2AV5A 4DR5J 2PC6A 1HHSA 5K9FA 1BC6A 4LVOP 1KS2A 3H5YA 4PABA 3W3SA 2B5JA 4NLUA 1RLCL 1PG5B 2HNYA 4BHQA 2GHVC 2ZEJA 4DI6A 2NYIA 3EVMA 5KFGA 2RAQA 3QT5A 4H54A 2HMIB 1FWLA 1FFGB 1XTZA 3ETOA 3DGVA 4CO5A 1S0VA 2MHNA 4CO4A 3MOJB 4O3SA 4ID8A 1WC5A 1E6VB 2V68A 2VD3A 4M63A 5KFHA 4YDDB 2JOQA 5H9EJ 2GVDB 5K5MA 4WFBQ 3HT0A 1UPMB 3H40A 1T11A 2V8PA 3A12A 3NWGA 2BANB 2W9CA 1H2VZ 1I51B 4G1IA 2RB7A 1NK9A 4DFPA 3K17A 2IJFA 3I9V9 4Y28C 3C2PA 1HNVB 3FFIA 2ASLA 1DLOB 4E0DA 5G0RB 3VAIA 4W98A 2A10A 5E3AA 2KKHA 2IJNA 1BY9A 2ZH5A 3G82A 3MMJA 2ZE2B 2ZZTA 1AFIA 4DCPB 4MMOA 1SH3A 2VBZA 2YH0A 5LMNF 2P9CA 5KFWA 1Q5VA 2K7KA 3L09A 1EZZB 1HKAA 1QY7A 5D78A 1QUPA 4P10A 3ZTRA 1H7XA 5DDOC 4NYPA 7AT1B 2ZJRQ 1VBXA 5JMNA 2YNHB 3MFHA 2JVOA 2IY5B 2MHEA 2VC1A 4FYXB 2V4JA 4KGXB 3NCQA 4LIRA 2PIIA 2YQ1A 3H8YA 3D3BJ 1T05A 1YLXA 1RWUA 4IFVA 3AA8A 1VQ5S 1D9FA 4QR2A 5KFIA 3EPIA 1UTAA 1B0TA 1T9TA 1OO0B 4ELUA 1Q4RA 1PAUB 1REGX 1JLAB 1HIYA 3M6VA 2DNOA 1URNA 4C8ZA 1TU0B 3SCIE 3AY0A 4RPFA 5CYQB 1LFPA 3A8JA 1W2BR 1WD6A 1Y9OA 4Q8FA 4C11A 4Y3CA 4O3OA 1FRJA 1KOHA 2R7TA 2ZNZA 1Q79A 1TQLA 1CQMA 1JLQB 1AZSB 3CDBA 4M5NA 5DM6Q 3KNAA 3LO3A 4Y6IA 1YX2A 3HVTB 3TVZA 4QIEA 1L3TA 5J2MB 1PSDA 1X4CA 4J90A 4DR5F 4ECZA 5FIIA 2C2NA 3IMQJ 2HQ3A 3QZ8A 2PMZD 1R31A 2Z8QA 3TA1A 3W66A 2F7VA 2LXIA 2NREA 1JIHA 2MKYA 3DOKA 3HVAA 4X4QA 5LJ3Y 2FTRA 1KQKA 1VISA 4C98A 1MWYA 2F40A 3HI9A 4HLBA 2A6OA 4TU9A 2JLEA 4PKDB 1BMQB 4DV5J 3M2VB 3BSNA 3BEGB 2PEHA 4OZ2A 4C7QA 1FJ7A 3TUZC 2IM2A 1PBAA 4IRCA 2MKJA 5EWFA 3PG9A 1A9NB 4B9LA 1RCOB 4DPWA 1JLQA 1UWAA 2AJ4A 2C2MB 3C14A 2ZH8A 1NJZA 1KRPA 3OFEA 5BYSA 2V50A 1JLFA 4QWCA 4DV7J 4XTTA 3IRWP 2CADA 2V8VA 4QOTA 3OFHA 1RT7B 2CQIA 2XMJA 1GK8A 5T7LA 1TELA 1U2FA 2HQGA 5BJRA 3OQ2A 5HQLA 2E1RA 3SYZA 4B3RF 4ZP8A 2HZAA 3JS9A 3QSIA 2DNNA 1FXRA 3AXMA 4DL6A 4A8FA 3SV3A 1OWXA 3I0RA 4C8NA 1Q0NA 2VPZB 3ONQA 1D8YA 3MM9A 4IG3A 3CJKB 1MMLA 2I6WA 2BQ3A 4C9DA 3WDOA 4RBTA 3QYYA 4F25A 4U9RA 2VOPA 1BQNA 4KAIA 4M5DA 4DZ6A 3KLVA 3OXLA 4RL1A 3HVTA 2D9PA 4JP8A 1N34F 4F3QA 4HVZA 3IRXA 1TK0A 3BB5A 4DQPA 5FDLB 2LLZA 4OMFG 3PRDA 1BQMA 4OYMA 2Y1IA 2W2NP 3HM9A 3BGRA 2K3KA 3DCAA 1PJ7A 4UOCA 4JI5J 3QLHB 1IQTA 2F8HA 2OHDA 3DMJA 2RF2A 4A8MP 1K0VA 3FDSA 1R6YA 4HACA 4RW4A 5AXLA 3E2EA 2BJ9A 4IKAA 2CJBA 3P5TL 2DB1A 5KFVA 4V1Ak 1VOMA 3HHEA 2NPIA 4NOHA 1KQGB 1LFWA 3ILLA 4PPZA 4PWWA 3MR3A 1XR6A 2HIQA 5J1EB 4F4XA 1XNRJ 3CDUA 3A1YG 2W9AA 5KFKA 2AGPA 3NG8A 3PYEA 2PFFB 4IG3B 1RZMA 3CJKA 3V81B 2PI5A 2W7AA 2VG6B 2DR6A 2J7WA 3DOLB 1RJJA 2AEJA 3Q8QB 4ICLA 3BQ1A 3RTVA 2P9GA 3IS9A 4EO6A 2OUGA 3SV4A 1N54B 2BJ8A 2ZFHA 1HQUB 3OD2A 1BWEA 5E7OB 2CZ9A 3D67A 3OUYA 2UU9J 5DQGA 3AOAA 2C2RA 1BQMB 3U02A 2RRAA 3M6XA 1T8EA 2I38A 3MEGB 1DHMA 2VG7A 3VF0B 2LP4A 3UFCX 4F0KA 2J9EA 2FY8A 3MM8A 3R27A 3CMQA 4M5GA 3MMAB 2MQOA 4U6PA 2MLYA 3JSMB 3CPWR 4M5HA 3OXFA 5DZ7A 3R1LA 3ICLA 4ZIVA 4DR6F 3IG1B 2YX7A 4CWBA 1S1WA 2ZH9A 4CLYA 1KHWA 3KUHA 3P6YC 4ED4A 2IBKA 2XO7A 2CDRB 3AXKA 3DRPB 4DDFA 4F4YA 4AL7A 3TAMB 3PX4A 1GH8A 2V8GA 4E2FB 2C3UA 4CZCA 2XI3A 3CCES 1VQ6S 2VA3A 1HQEA 5HJXA 4JI6F 4CH7A 1NKCA 2IVFB 2N3OA 4GKKJ 3SQGB 1VBZA 3G6YA 1FA0A 3MM6B 3NS6A 1NSPA 3FGVA 3IFEA 4UOHA 1N4LA 6AT1B 5I4MA 4DLGA 2YNIB 1WEXA 1VLOA 1NJIT 4K50A 3QJJA 3D3CJ 5I3UB 4PG7A 3WBZA 5J2QA 2FLPA 2UXDF 3H0PA 2RMLA 4HACB 4RW4B 1LEOA 3ZTQA 1X4EA 4DOZA 3AFGA 2O66A 1F2GA 5IOLA 3IO1A 1KTQA 1GMWD 3ZZ0A 3MM8B 2ZH6A 2FYXA 2QO3A 1G1XA 5B0GA 1VRQC 3LPEA 1JLEB 4X64J 3FRZA 3QRPA 1LWCB 4YFUA 4RUHA 1HBNB 2IAJB 4N7TA 3D0HE 1NK8A 2EC0A 1EHWA 1XMQF 1NMEB 1JLAA 3LA0A 1VQ7S 3LP2A 1RAEB 4GMKA 1G2EA 2EWHA 4LF8J 1LW0A 4NA3A 5A8RA 5H9EK 1X9WA 4RU2A 3O5TB 2BJ3A 4IH7A 4NXNJ 1EKSA 1N34J 4WJBA 3DM2A 1TKXA 3H5UA 3UI3A 2Z58B 4QQBA 1VC5A 1CS4A 4B9SA 3JQMA 1GEHA 2QX0A 1RT5A 4I6AA 2M52A 2HAFA 2LVWA 3MM6A 2MY7A 4PYDA 2YWKA 4TQRA 3NS7B 4ZP7A 2OPQB 4JB8B 1PJ5A 4ZHRA 3MEEA 1U1KA 2OMOA 1HBOB 2JX2A 1AXQA 3O8WA 3SDEA 5KT3A 1FEEA 2FC9A 2RQ4A 2MLZA 2M88A 1WG1A 4PQUA 5KAKA 2CQGA 5HAOA 4ID5A 4MH8A 4OYAA 2V2KA 2F8EX 2NUUG 2ASYA 4I1TA 5K8OA 3KLFB 4AQYJ 4TVAB 5KFTA 2WBMA 2XYGB 4FYYB 4DHVA 4FYWB 5H9FK 1C1BB 1HBNA 3TJAA 2NLWA 3M8PA 1UWBA 2B9XA 5KFCA 4KKOA 2ASJA 2CPEA 3ILOA 4DSLA 3HFZB 3HFVA 1UMJA 5LM7E 1VRTB 4ZVGA 1T95A 3KKFA 2GAGC 2VDIA 4C0OC 4Q8EA 1FRHA 2DXFA 1S79A 1P8GA 3PR4A 5BYRA 2B7BB 3E8OA 2DRAA 2Z56B 1VQLS 1CJUA 2P6TA 2VQEF 3NBPA 2U1AA 1UKUA 2HIYA 2OPQA 2A2DA 3TUJC 3TI0A 2COLA 2PT0A 1G6BA 2YQ0A 1S6QA 2AYEA 3ZNJ1 2F3JA 3PX6A 3CDWA 3HHDA 2ZWPA 3I87A 3M6WA 4ZVUB 1MSWD 1FKPB 2FHOB 4WFZA 4P75A 2XLKA 4DWIA 1FE4A 4YS2A 2WONA 2MGZA 3DI6A 3VAFA 5EDWA 2OSRA 4WYWA 3T6BA 2GQCA 1KVJA 2V0NA 1UVJA 3G8SA 2BKOA 1FI4A 1N5SA 1RAIB 1WC0A 2NSBA 2Y1LB 1HWKA 1EQ0A 1WI8A 3H90A 2RJZA 2D69A 1O5JA 3TNVA 1WSVA 5C7PA 1N48A 5IT9U 4AYBD 3NGUA 4LFCF 2F9JA 3NCPA 4MIAA 1PO6A 5FD1A 4EFAC 4RW7B 1RWWB 3ULHA 2V9WA 1CVJA 4Q0BA 2BQRA 1VHIA 4KBIA 4KB7A 1SPBP 2VUGA 2WVEA 1M5KC 5F8JA 1DFDA 4NLTA 1FNMA 1Y10A 3FQKA 4DUYJ 4ID5B 3JYTA 1C4AA 2ZNYA 4DG1B 3QGGA 4NLPA 3NBPB 2AYGA 3K5LA 8ATCB 2MQLA 3M2RA 2C1EB 2CQPA 5CQGA 3MM7A 1RI7A 2VFTA 1U49A 3PY8A 3K5OA 1U2CA 1UEUA 2YX1A 3PRVA 1N8RT 3UDLA 5SZTA 5DDRC 2Q1LA 4Y00A 3P8BB 4MIBA 1VQYA 2WRMA 3L7PA 1RTIB 3DXSX 3MEDB 4HHHA 2DBBA 5ETVA 4U7CA 3J81U 1UFLA 2DIVA 5F8MA 3OLAA 3ISNC 2OPRB 4TYBA 1NHKL 3PFEA 1RK8A 2CZVC 5HROB 1KDNA 4NLSA 2DHSA 4CO3A 3THTA 2KXFA 1YRXA 1JKHB 1JJHA 2E9TA 1Q78A 3PO5A 5C5JA 2AYMA 4L75A 4OI4A 3NXZA 1WC4A 3L7UA 2VBWA 1PIEA 3KJVA 3NS5A 2R7SA 2J9CA 4DV3F 3IGNA 4WE1B 1KTVA 4AE5A 3KK3A 2D1CA 2BOPA 3EX7B 3ZO7A 4K4YA 2VV5A 4JI3F 1CEZA 2H9ZA 1X5TA 3D68A 4EZ9A 1HNWJ 2V8HA 4U95A 1F5AA 1LK7A 2J5AA 3KNGA 5L9XA 4AUKA 4CTAB 2X7IA 5F9NA 3I55S 1CULA 3FZ2A 3EPGA 3VHQA 2GW8A 4LSZB 4B9MA 3QBCA 2E5JA 2D3O1 2IC3B 1L3SA 2BA9A 3CCZA 1KFDA 4KIAA 4L76A 4ZVEA 5LSOA 4RUCA 3H2VE 1M1HA 2IJRA 2DGSA 4N56A 3BO4A 3FCVA 3N6NA 4YDXA 1RSCA 4J7CA 2G2ZA 4OI6A 4ANEA 4OV1A 3QSYB 1FNXH 4ECXA 2AGOA 3OJSA 2ZM6F 1S9GB 4ECTA 3E01B 1V6HA 1ACMB 3ITHA 4PXCA 3T3FA 2IFXA 3GG0A 1FJGJ 4OHVA 3FEXB 4YB1P 4RW8A 1YJ9S 4ECYA 3GZ7A 3ETMA 3PJXA 3OL7A 2HQIA 3IWLA 4LBHA 3J81Y 3CJQA 3J7YI 2XLJA 2H3EB 2K06A 1HWLA 2OPPB 4Q2MA 4ZVHA 3CC2S 2FLNA 1KEKA 3CD7A 4ANDA 1RQ0A 2KFNA 2VPXB 2MDAA 3DYAB 3KYLA 2YKMA 4NCGA 5GAEI 2R7VA 4WYLA 1U02A 2UU9F 5GMKa 2D3UA 1C0UB 3H59A 5KTQA 3PJ9A 3B8HA 1XMOJ 1VQ4S 2XZTB 1X7VA 3CO9A 3DRSA 4I67A 3SBMA 1T03B 1XN9A 1TL3A 4UW2A 2GQQA 5DZ6A 6FDRA 1QLNA 2XMKA 4LRDA 4ALZA 4RNNA 2OFHX 2CPIA 2VFSA 4KH0B 1ITPA 1TAQA 1XNQF 4UY85 3DGPB 1Q8LA 5IWAJ 3B82A 3MWBA 3UE2A 3KHRA 4OV6A 2HHTA 3M7VA 4G1QA 1FDDA 4NL5A 2ROEA 1NAQA 3DRRA 4CTAA 4MK7A 4DPUA 3K58A 4IR9A 1E6YB 5KFEA 1ROFA 2WOMB 4NXNF 3I4PA 3T1HF 2DT9A 8RUCA 4JI8F 3HLUA 3MR6A 4J9NA 5KFPA 2MQNA 2RDDA 1VBKA 3D6TB 1A0OB 3I5BA 3U1NA 3AB4B 2PN6A 4Y2CA 3UDCA 1SUQB 4OZ3A 3KHLA 4DSEA 1IKXB 5GVQA 3AQOA 2XHWA 1PGZA 3QIPA 4NEZA 1YZ7A 4ZN3A 1L3KA 2DJWA 3W65A 3V6HA 2BRLA 1Q81T 3KTQA 3ITHB 1HNXF 2HQDA 4B9VA 5FDLA 3US5A 2VPYB 1RT2A 1S6OA 1XNQJ 3IXQA 2C3PA 1NPRA 1BHNA 3PHEA 4HT7A 3I0SB 3GYNA 4ZA1A 3SXLA 3DLJA 1ZTTA 4DV4F 1ZTWA 2PA3A 2ZBCA 3K8VA 2A1BA 1JLBA 1JXLA 4W4MA 4HKQA 2RQCA 2DKOB 1TV6A 3M6UA 4WP3A 1SJ3P 2H5EA 4ATNA 4FF2A 3KK1A 1Y5LB 1H3DA 5B0CA 4J9UE 2AQ4A 4BC7A 1UEKA 1H72C 3FSXA 2V5HG 1KLNA 1SQEA 1X5OA 1KP6A 3B4MA 3QQCD 4O3PA 1U4BA 3SI8A 3H2UB 5DDQC 1N56A 4B3SJ 2NCKL 1KQFB 3OV7A 1HPZA 4DQIA 2Y8YA 4K4ZA 5IC4B 4GO5X 2WW8A 3DRPA 5A76A 3G8QA 2KJWA 3MCSA 4ZITA 3R5AA 3J7A1 4P72A 3CCSS 3OSNA 2JLFA 5F8LA 1R0AA 2EEYA 3AAWB 2WB4A 2PGCA 3ENVA 1ZAVA 3QMQA 2L9DA 2DYAA 4H4OB 4F0HA 2E9RX 1JLGB 3I9ZA 1IKYA 1P6TA 2JNJA 3ZZPA 1Q5YA 1UPPA 2KL8A 2BRKA 2MYFA 2VG7B 2XMMA 3FSYA 4HR2A 4MKBA 5B0AA 1ZETA 2VHGA 4B3TJ 2OEJA 4OJ1A 1F3VA 4CLKA 2MLXA 1DQ9A 4WFYA 3MCNA 2FJWA 3H4DA 1GTHA 1AUSL 2CQ2A 5D77A 4RUAA 3POTA 1S49A 3KK1B 1FKOB 5E5NA 1VJQA 1UJ4A 3FMBA 4D3GA 4CCHA 1DARA 3MF5A 1N36F 5KFSA 3B54A 3Q24A 4DG1A 1FK9A 4LUBA 3OR2B 3KLHB 1RU1A 3G8TA 3I5AA 4X4TA 5HLFB 1CJVA 4NMLA 3G9CA 5B0FA 2GMHA 2ADCA 2QYCA 1AA1B 4TYAA 3OTCA 1HPZB 4F67A 3EXCX 3AB2B 2VH7A 3TWZA 5LXYA 2FB0A 3MEKA 2ATCB 3KFWX 1AZSA 1Q8BA 1TL5A 1FO1A 2V2VA 2Z2ZA 3R6LB 4LR9A 4N77A 5D15A 3JSYA 2DGTA 4F50A 2R8GA 4P7TA 2A0FB 4ED8A 1SKWA 3TEHB 4ERDA 1CQNA 5DQHA 1FT8A 4TKTA 3OFFA 5B0EA 3ZC4A 4ES1A 1WTBA 4YEAA 1RTDA 2BJEA 3GJQB 4LF6J 3IGVA 4YMEA 3FVYA 2DCUB 5F3TA 3SCJE 3F56A 4NLXA 3T6JA 2BM1A 4NRUA 1B70B 2XBPA 5CAAA 3HK2A 1T3OA 3GYGA 2LQ8A 5KFXA 2BW7A 1DZ5A 1OPZA 4RBUA 3DLGB 5C24A 4OYWA 2C22A 1FD8A 3H5SA 1T9XA 4LREA 1FRLA 1H6KX 1Y7PA 4N47A 5L1LA 1NXIA 4JYAF 1QSSA 3G82B 2QJ3A 1G7CB 3G6VA 2QL5B 4M8LA 2M3DA 3ZZZA 1YBUA 4PUOB 1SKUB 1QE1A 1TZ0A 2MZJA 4O0IA 3W60A 5B0BA 1RP5A 3BGUA 5A0YB 2IVYA 5KFMA 3I96A 3M8ZA 3H25A 3BGFA 2GX8A 1S7IA 4U8YA 1GXLA 1S76D 1S4EA 3EMTA 3UR3C 4WE1A 4LVNP 5KT7A 3PV8A 1P27B 1TVRB 1LNQA 2N7YA 2YWGA 4HI2A 3UDEA 1F2HA 3F44A 4IQMA 5JJBA 2VZ9A 3AQPA 3V4IB 3KLFA 3DRYA 2DRBA 4IFVB 3BBBA 3FFIB 1RYSA 1WHVA 4GRSA 1FESA 1RWPB 2BE2A 1H38A 4NCBA 4IOAQ 4PQAA 5HJYA 4WFAQ 3RUBL 3R5CA 1KHVA 4C0HA 1PYOB 3ET6A 4CH0S 5F8HA 1FRKA 4LRFA 3ZZUA 3VR1A 2GVZB 4HTJA 5DM7Q 2DEIA 1WTFA 4JV1A 2ZZMA 4UF4A 2W4CA 2FJBB 4YR2A 3FSIA 2MQMA 1C0UA 1FFWB 1S57A 2XQCA 1YJVA 2YNHA 2GNKA 2QG9B 1UZHA 2GHPA 1HW8A 4FYVB 2RE1A 4QPXA 2VC0A 3D6MB 5D0RA 4LBIA 3OR1A 1N5TA 4E8UA 1GAOA 4X2BA 2X1AA 2EFNA 3T9ZA 2D41A 1S48A 1MNEA 1CC8A 1NZ8A 2CJAA 2DK2A 4QYRA 3H5XA 1R6VA 4A8KA 2ZKUA 4J9OA 1URRA 3NNHA 3Q8UA 1EAYC 1RTHA 2PD1A 3SIPB 4X65F 3MGJA 4QWBA 4QYZK 1XNRF 2XY6A 2QA4S 1SH2A 1RAHB 3RZAA 1FJEB 5B0DA 3FNNA 3EVOA 4HDGA 3SCLE 2E5LF 3HKZD 4UOGA 1QDUB 3SSSA 2DISA 4L74A 4EMDA 3P49B 1N5QA 4P6QA 1RTIA 4FDFA 4EU0A 1T0TV 1SVDA 1FRXA 1S7HA 3MMBA 3OTDA 3UVJB 3VAKA 1L3UA 2NXJA 1VK8A 2RT3A 4IDKB 3BYPA 5KG1A 4X4VA 1S6UA 5CZVA 2G2OA 2V2ZA 2QSFA 2WSFC 4ES2A 2B8QA 3RB4A 1OYEA 1JLFB 1CJKA 2HS0A 3X3UA 1NHVA 2OLWA 5J2NB 2LA4A 4OJHA 2FJVA 2IA6A 2WHOA 5DETA 2FC8A 2E5GA 1W2IA 1YTYA 1U1LA 3GU0A 4FZVA 1SCJB 2XTJP 2QFJA 3MMCA 1B99A 4OZ0A 1G4CA 1RHRB 4KO0A 5CCLA 4CLLA 3A13A 4X66J 4J9SA 3CC4S 2G4BA 2HSEB 2VASA 3MOZA 3IR6B 2KT5A 5ETLA 5EX3A 3GYXB 4N8NA 4R5PB 4O3NA 2WVCA 3OTOF 2DVIA 2FJDB 2WSCC 4EO8A 2P6SA 3GILA 1HYSA 2Q3PA 4MK8A 4DFMA 1LWEB 1DJ0A 1NDLA 4PPDA 3TX8A 2DPIA 4R0JA 3MXHP 1ZBTA 1RHMB 3CVKA 4DUZJ 1R43A 4A47A 2BZ2A 2VFVA 4OI2A 5L8RC 1T05B 4QWDA 2E44A 1F0XA 1KNZA 5HSPA 3MPDA 1TKTA 4K4WA 1FTCA 1SV5B 2G2YA 2ZBRA 2I0XA 1R7IA 4WXWA 2NXCA 2FY1A 2AX1A 3BJYA 4DZDA 2GC8A 3EUNA 5IWAF 1AUDA 4Q7AA 4ZPAA 5HVGA 4XK8C 3C66A 3G87A 1QAIA 2F1FA 2FJEB 4EYHB 3FUYA 4OHZA 1HMVB 3R7NB 3TOQA 3BBFA 1S0OA 3W2VB 3C6UB 2AKWB 2Z0GA 1SJQA 5ETPA 1AT1B 2E7VA 2HHSA 3ZFVA 1VQOS 4J37A 2HWHA 2XMWA 3FEZA 4DR4J 3CCVS 4CNYA 4LF7F 1P9QC 3HSZA 4PG6A 2FHJD 3ENQA 1S77D 4DR2J 1U47A 3M8QB 2VKZG 2NXNA 2BUNA 3DXBA 5J2PA 1NDKA 4ED6A 1S72S 2EI5A 1O51A 2KB2A 3HF5A 3QFHA 4MFBA 4PCQA 1M1KT 1RACB 4B3OA 2H54B 3LP1A 2GHWA 2DEJA 4NWBA 1EETA 5KFUA 5AXNA 3PDNA 3CCWA 1FKAF 4WFXA 3CJ0A 4KFBA 3MUVP 1VMBA 4F4AA 3R9LA 2IYGA 1R8PA 4NCAA 2HS3A 2B4OA 3JTOA 4RNFA 2MQ8A 4OZ1A 3C15B 2HFNA 3R5DA 2EBGA 3V6DB 4ZPVR 4FYDA 2JFDA 4HYKA 1CLFA 4I2QB 4OZ5A 3BQ0A 3GFXA 2V69A 1KWMA 1E6YA 1OQ6A 4ENOA 4TLRA 1RBLA 5T14A 1AW0A 2W1BA 2UUWA 1V5IB 2CA9A 1SC6A 3S8SA 2F63A 3BO3A 2ZHOA 3NMAA 3UN2A 3KUGA 3L9ZA 3IA0A 3TAMA 2H65B 2MKIA 2AW0A 3T5KA 1PAEX 2AJ2A 2YX4A 4F4ZA 3LP0A 1IBMJ 2A2CA 2VG5B 1WF0A 2PSZA 1S99A 4EBEA 3RRGA 4IRDA 2JEIA 1RA7A 2H51B 1MWZA 1WACA 4NYZA 2NZCA 5E41A 3PVXA 3AJ1A 3LGNA 4OIXA 3CCMS 4XAKA 4Y2KA 2Y0SD 2KO1A 3HSJA 2DGXA 2OI2A 3PYGA 4OX7A 1X9SA 2HLTA 5KFFA 2IMWP 2N4CA 3VAGA 2R2RA 3CMES 2HWTA 4H4OA 2R3VA 3UNGC 1U7LA 3LWLA 1KONA 4DSIA 1HLWA 2BV3A 3GIKA 3U1MA 1U1NA 4UQTA 3TEGA 4NLQA 4NLYA 1IWGA 2JL9A 3ZTSA 2KM8C 4GVLA 2NZ4A 1S1VB 1MMDA 3ZZOA 4PWDA 2RU3A 2FJXA 1JLEA 2DNPA 3RB6A 1KN6A 3CW2C 1N33J 2IYIA 1NDCA 1HBMA 1NJWA 1UVLA 1Q82T 1Q7LB 3AJDA 1FDAA 3PR5B 1EP4B 4NLDA 3AOBA 4PEOA 4JUZA 4DX8H 5K8PA 1RUSA 2C2EA 3HP6A 2RQKA 1SJFA 2MTLA 1WHXA 4CLPA 4IH6A 5A8RB 4USWA 3LP0B 4DR4F 1UJ5A 1RT3A 1TKXB 2YPYA 2CVEA 1PJ6A 4I2QA 1OS5A 2N3LA 2FVSA 2J6UA 2BJ1A 4LR7A 3B4DA 2AJFE 5CYMB 2HHXA 1UZDA 4FXVA 1FCAA 4F3MA 1DRZA 2BE9B 1OY6A 5M2PA 2DHAA 4RJVA 1MWQA 2Y8WA 3CCQS 2VFUA 1V9OA 3QT6A 3DOMB 4DR7J 4OLOA 3EM1A 1Y3JA 5KG4A 2ZDPA 3BR9A 1P1TA 1WELA 4NZ6A 2FZGB 5HLFA 2E9ZA 3KK2B 2HG4A 2ZM6J 2YXLA 2HURA 3PEJA 1FKPA 3BKUA 4LBPA 4F7VA 1MU2B 3DI6B 5C24B 1FDNA 1WDDA 1NNDA 4M5IA 3KMQA 1B4SA 1R3NA 1RWNB 4OQJA 2W4DA 2ZOGA 3UR0A 2DGVA 1TTHB 1RTDB 3OJUA 2BBEA 1NBEB 3HJVA 2HRUA 2F9DA 3G86A 3JTNA 4FPRA 3PXGa 1QSYA 2XS7A 4RBVA 2VBXA 3EGVA 3MR2A 4CLFA 4ETZA 2XGQA 3CCLS 2ACMA 1TKDA 3BDPA 2GJIA 1FVQA 5J2MA 1ZOTA 1ZS6A 4QR1A 4OX8A 4P74A 4XPEA 1W7WA 1NLKL 2F65A 4MYUA 2MZSA 3MUTP 4NXMJ 2FZCB 4ED5A 4KHPF 4NCGB 1YI2S 3M2UB 5I3QA 4B3MF 1WC3A 4I2PA 4OYOA 2WTFA 4X4RA 2E7XA 2OIHA 5A8WA 4DL3A 2HBRB 2E1MC 4M5LA 3CIMA 4PWUA 1N52B 3GB0A 1CSJA 4NI2B 4QJVA 6FD1A 1VK3A 4PUOA 2KZZA 2GJFA 3M32B 2CFXA 4IFYB 5THWA 2W24A 1VDHA 2DNRA 3TO8A 3PFOA 5IV4A 4JI7J 3MECB 3K5PA 3NP5A 4IG0A 5HMXA 5GAHU 4LF8F 4DSKA 4YUDA 1LW2B 3N9UC 4K2JA 1U6ZA 4U96A 2V8DA 2OSQA 4ZVRB 3Q8YA 1NB2A 4FPIA 1S6PB 4A8SA 3Q8RB 1FVSA 3W8GA 2KTQA 3S1TA 1QVFR 2AP6A 2MKSA 3KJVB 1VQMS 1B3TA 1N33F 2VICA 3MURP 2QMXA 3CUNA 4LFAF 1HWJA 3LAMA 1ZAXA 3GR1A 2HQCA 3AJ2A 4WU3A 1S9EA 1YJNS 3W5ZA 5KT5A 1VBYA 3SCKE 1U0HB 3UNYA 4K4UA 1RA6A 3TZWA 3ISZA 1REVB 1NK5A 1IKXA 5IQQA 5J1NA 2DGUA 3WHIA 4CO1A 1UWBB 4WZQA 4LF4J 5F0UA 4KKOB 2XSJB 4OYPA 1JXEA 3HXMA 1W25A 2GJ2A 1FHTA 1ZPWX 2YNFA 2AEMA 3NY0A 1RWVB 2QMWA 1TK5A 1HNIA 3GE9A 2WVFA 3MMBB 2BDPA 3TX0A 4LT6A 4P7VA 3ZNUA 1N0UA 2C42A 1XMBA 2L9NA 2ROGA 2ATLA 1M90T 1IBMF 4EGLA 3PHTA 2J6SA 1RAJA 2ZVSA 3E01A 4OYBA 2MKHA 4ZJLA 3QZ7A 3O6QA 1S1XA 4K0KJ 2HHHF 1UVNA 4M95A 2MKKA 4V19J 2Z2YB 4CRJA 5K8NA 3G6XA 3BYRA 1LXJA 1IR1A 2MSSA 3D0GE 5LMUF 3ZXWA 4O3QA 1X9MA 9RUBA 4B3SF 3H98A 2RNEA 1JLCB 3LGHA 1M5PC 4KGKA 3NRBA 1UP1A 2ILYA 3K7RA 1IM4A 3CDAA 3OVAA 2RS8A 3VAHA 4M1KA 1PYTA 2HHPA 3DDIA 1SKSA 2VB6A 3EE3A 1R0AB 5IV3A 1RWMB 1JWWA 4DMZA 1FD2A 1SIWB 4CT9A 3V6DA 3BO2A 4X4NA 1BD6A 4DR6J 1TKZA 3BSCA 4JV5F 2XZDB 3CJ5A 2BMBA 4J9RA 4C2MA 2B9YA 4BLGA 1XQIA 3J7Z5 1SL2A 3Q8SB 3UDVA 5KOWA 1D1UA 5LL6d 1YVFA 1VQ8S 2HVIA 3CIZA 4RW9B 5HATA 4EZ6A 4LSLB 1T9WA 2XGPA 3G71S 1FKOA 1NHUA 1SL1A 1BE4A 2CNKB 1RWOB 4K4SA 5HANA 1ZAWA 1RT1A 2B9EA 3D66A 4NRTA 2DTJA 2EC2A 3DOKB 4LRCA 4QW8A 4ANCA 2XLIA 1HHTP 5LJ5Y 4YR0A 2E29A 5DGAA 3HPOA 3FKBA 5D3GB 4IQXA 3QRQA 2R7OA 3MTKA 2V4QA 4DPXA 1SUQA 3IR7B 1JNZB 3UD5A 1YHQS 2PO4A 3CB4A 4OL8A 3QIPB 2AJQA 3PKYA 2EK6A 3CJTA 2RDJA 1VC0A 5HROA 4USHA 3K57A 1Z1ZA 1RLDA 1JJCB 1TUVA 1JKHA 3TA0A 1YK9A 4U7UD 1H98A 1YDLA 3IM9A 3T9NA 4YQWA 2CPHA 2NUHA 2UUBF 2WOMA 4ZP9A 2JFKA 3PYDA 5I3UA 4O4GB 2OEKA 5DDPC 1JB0C 3F73A 2MZRA 3K0JA 4WIIA 1S1UB 1F6TA 4ZPTR 2XS2A 4TY8B 4LFBF 4DR3J 1QJHA 2HYIB 3I0RB 3P5BP 4GO7X 2E5IA 1XMQJ 5H9FJ 3O44A 1SIZA 2C3MA 3MM9B 1U09A 1B7YB 3D9BA 3FC9A 3W7BA 1NK7A 2EFQA 3M8RA 2Z2LA 3TAQA 3F0NA 2JC1A 4B3TF 1UFWA 1YWXA 3ZZYA 1RT2B 4BBYA 1FRIA 1RAGB 1U26A 2CZ4A 3HVRA 3UCZP 3U7JA 4LJMA 1NK4A 2P5VA 3W9IA 2W8KA 1NB7A 3WX8A 2BM0A 1LW0B 3BGLA 4NMXA 3S7RA 5AE1A 5IT0A 5DO2A 4IO9Q 3WC2A 3NNAA 1RHUB 3GSDA 2DNGA 4I69A 1UFKA 3N01A 3DC2A 3QAUA 4OJGA 4P71A 5E3QA 3V4MA 2BR0A 1X0PA 3BGOP 4ELVA 4KV8A 3BGRB 3TP2A 3V4IA 2UXCF 4QPTA 2QT7A 2JZ5A 1EETB 3GFHA 3RW6A 1NSQA 4QIWD 1GNKA 2Z4PA 2FVRA 2N4DA 3ILJA 2UXDJ 2HQFA 4LIWA 2WCXA 4TXSA 3D1HA 4ZLPA 3BKTA 5DLFA 4ECRA 1IKWB 4LF9F 3Q0AA 1BQNB 4M5DB 3SEOA 2DCLA 2NSCA 3Q89A 2FLLA 4OZJA 2J9DA 4QCLA 4I4BA 1CPZA 2MJUA 2CJXB 4MYTA 3RR8A 1UETA 1S5ZA 2VG6A 3DOLA 1XK8A 4ZDNA 4I7FA 4ZCLA 4DQQA 1FEHA 1XR7A 5A2QY 2XO6A 3J7AN 2W2MP 3PX0A 4PXDA 2N82B 1TFYA 3D28A 3MHYA 2GIFA 3BQ2A 2YVSA 2X1BA 1YJUA 4ECUA 2FJAB 4URSA 5HVFA 4LRBA 4Q2LA 4TU7A 2R42A 2WK4A 3VGUA 3T19A 5A8KA 4MKAA 1TK8A 4PRFA 4PWDB 3THVA 2GCFA 4R0EA 5JXSA 1BWVA 2KYXA 3IR5B 2XWYA 3LF0A 4V19X 5K20B 3GG1A 4DFJA 2ADBA 4TLQA 1K73T 2HNZA 2E7WA 2YWEA 4HL9A 4KSEB 3OTBA 4U7UK 3EZOA 1SH0A 2QA4G 3JTPA 2KI2A 1HQUA 3AODA 1U48A 2CQ4A 4MKYA 5ETKA 1N36J 1I94J 4IDKA 4I7FB 5D8HB 1Y0HA 1Z2ZA 2Y9HA 1K9MT 2XYHB 1NKEA 2CQ1A 1S1WB 5BXIA 3MR5A 3NEKA 3DLKB 3R8YA 2PMWA 3QGPA 1U1QA 2QE5A 1IKWA 2G1HA 4WIQA 3EWGA 3CCTA 2KN4A 3MMCB 1REVA 2EG2A 1CJTA 1F5BA 3G4SS 3J80Y 4C11B 2GS8A 4ZPWR 4DPTA 3C16B 2YTCA 3NGDA 2LXUA 3K59A 4LF2A 2XNQA 1JLCA 3EGWB 4M5JA 3NWRA 2YNIA 2PFDA 3M8WA 1YRTA 2B9WA 4G65A 3TQEA 4ZMMA 2L41A 4DQRA 3VZIA 2IMOA 1OSCA 4C3MA 1QTNB 3PRBA 4USIA 4LFCJ 5BR8F 5EX0A 4DUZF 2QFIA 3W2WB 4ILMA 2B8PA 4P2SA 2XMAA 1K1SA 4KY3A 4ED3A 4DF8A 5ETSA 1WKLA 2AX0A 2XZWA 4ZVSB 2EKNA 4IO1A 2K3IA 4IYQA 4DN9A 3IBWA 1NK0A 1S12A 3VVUA 2GQ2A 1J5EF 3CWJA 3W64A 4JI7F 2UP1A 1D8ZA 3OBIA 2Q79A 4GC7A 4YP3A 1Y4ZB 1MU2A 1SBRA 3FBBA 4A46A 2OEMA 4Q43A 3NGTA 2QYGA 3EVWA 4BS2A 1MG7A 4J9MA 3HKWA 1WNEA 2K1RB 1JJ4A 2CDQA 2ZE2A 3QT7A 2CYYA 4DR2F 2JRSA 2O5DA 1LV5A 5IFMA 1JNRB 3CJRA 1YG0A 1YSJA 1TL7B 2FGCA 3CJ3A 2H1YA 3C14B 4P9SA 1U0SA 1X60A 2NYHA 3JSBA 3ZZRA 4B02A 4CI0B 1SQFA 2VF3A 3PZPA 5E0OA 2A18A 3C19A 3D1QA 3JQKA 4O0NA 1VC6A 4JV2A 5FLXU 4B08A 4F0MA 2QN6B 1HL6A 4Y0FA 1GX5A 1QUVA 1SC4B 2MZQA 4RWWA 3W2WA 3CSKA 1JK9B 4F36A 3QJLA 3RBDA 2KFYA 3EZ5A 5J2PB 2ZH4A 3TRGA 3G6ES 3A3OB 1DAXA 1UVKA 3UN5A 1NCLA 5IT4A 3AA9A 1RT1B 5C42A 4QWAA 4DJBA 4CDIA 2YWHA 1Y00A 4YY3F 4FS1A 3K89A 3AT1B 4QYZJ 1S1UA 3GWCA 5JVGQ 3R3TA 4OI1A 2D9OA 3NOGA 1M5VC 4LF9J 4GKJF 2H5IB 2UXCJ 4N8OA 4NA1A 3ZTPA 3N79A 2F4VF 3DLBA 3VAJA 1W26A 1VIXA 2V63A 2DHXA 4Y2MA 2HBQB 1IN0A 2A6MA 4OZLA 4JI4F 3KG4A 1K1QA 1R89A 1TL7A 3HCXA 3VGSA 5GAGU 5K8MA 4A8WA 5C25B 1RU2A 2PA8D 2WAQD 5DG8A 1WJ9A 1H74A 1U2RA 4RW7A 4UZBA 4KE5A 5F41A 3E3XA 1M1GA 5L9NA 3O3LA 3UD3P 5E3PA 5HO4A 4L3KA 5KG7A 3GIRA 4RO0A 3C6TA 4F8RA 4J91A 3DRRB 2MZ1A 3T1YJ 3M2RB 1GMWA 3QO9B 2NR0A 3TW0A 3VQTA 3GFZA 4BCAA 2HHUA 4DV1F 4USUA 3T41A 1LXNA 2K7JA 4DXLA 3CMAS 5DS7A 2LECA 3HVWA 4CNZA 1U1PA 4WFNQ 4P73A 1ICEB 2IM3A 2APOA 4NLVA 5DG7A 3KJQB 4JI3J 4X84A 3I6PA 3DU5A 4JV5J 2GAHC 3HHKA 1PILA 4OHXA 3RG6A 4FXWA 3WQPA 4OX6A 2POKA 3C8YA 1DBDA 4HT5A 1UCNA 3QNWB 3RW7A 5E33A 4RU9A 2HK2A 4I6YA 3FZBA 3NL0A 3BPSP 4NZ7A 1C0TB 2MQPA 5ETNA 3Q83A 4L73A 2PEBA 3KDNA 3RRKA 2G1DA 5L46A 2ZH2A 2VQFF 3PACA 1V3SA 3A3PB 3IWNC 3KK3B 3M1VB 1ZM3A 3BPDA 3TANA 2CWXA 2R9LA 2KVQE 5EN1A 5SUHA 4DX5A 1WKKA 3QFWA 2RUGA 1KD1T 2LU2A 1U8SA 3PKMA 3N0VA 3MD1A 1VJWA 3QWUA 1EIYB 1TR0A 1H73A 2OPRA 3HSGA 2UV8G 3KLEB 1JXVA 1T9UA 3VGTA 2BACA 1DURA 2DRDA 2ZH1A 3MUMP 5D3GA 4AL6A 1K0TA 4UT4A 1TP7A 2N7CA 2UUAF 2Y3YA 3DHWC 1AYEA 3CDEA 2VONA 3DLEB 4NX9A 4EUVA 1WKJA 3JAMU 4O23A 1SXLA 2H5JB 2XMVA 3W9JA 4P2XA 2ZD1A 2ABYA 2E66A 3DM2B 4RW9A 3OT9A 4ED1A 4ED0A 1L3VA 4KR0B 3OLBA 4Y2IA 3BR8A 1RT5B 3ENAA 2AF6A 4D3HA 5LMNJ 2ALZA 2XULA 5KFNA 5A8KB 5KFOA 4Q5VA 4FBUA 4OFZA 3DMJB 3PW2A 1I1GA 2LA6A 2FHMA 3MAQA 1QAXA 1UEVA 4CLZA 4ZVQB 4DV4J 1HBOA 3SDEB 3KOAA 3CC7S 2BQUA 2V6AA 3O1LA 3V6JA 3Q2TC 2W25A 4RW6A 3DRXA 5KFAA 2WVBA 3SFGA 1KSPA 4FF4A 2WBRA 1FK9B 4CM2A 3KLHA 1ZM2A 5AXKA 2RD5C 3FEYB 1R8BA 1Q8IA 2OPSB 3Q86A 2XY5A 4R5PA 5FLXY 2MB0B 4ICLB 4Z7CA 4ZKAA 1EARA 2BABA 3N28A 3P96A 4BWMA 1IUJA 4DCJB 2KJVA 3MI7X 5F3ZA 1FDBA 2E1CA 5HL7Q 2UVRA 2QMUB 4RNHA 1VRTA 1YZ6A 1WHWA 4IOBA 3MPUB 2RUSA 3H7HB 3I82A 1IWAA 1MROA 3HT3A 2RHSB 4I64A 3BH7B 3PIPQ 1FTRA 1TMMA 2HK3A 2J7KA 4DV6J 3R6GB 4UZCA 2QV6A
chains in the Genus database with same CATH topology
4OLPA 1I94F 3D5MA 3I4HX 3V2UC 2OTLS 4I2PB 4JV0A 2I1RA 4ZOSA 3HHLA 1DTQA 4URGA 2WB1D 4H4MA 2RRBA 3I56S 1LOUA 3DLEA 1V3RA 4ED7A 2C2DA 4DF4A 3VQSA 3N6MA 1QSLA 3QJPA 2AJ1A 4NLOA 4AQYF 5DG9A 2J8AA 1GQEA 1X4AA 3TR5A 2BYCA 2V4JB 1RGVA 2JVRA 5CYMA 1L5UA 1R8CA 1WI6A 1I6JA 2HHWA 4JI1F 4MJKA 5KFRA 4WCEQ 1U25A 2DNKA 2KHCA 2ZC4A 4DEZA 3RYLA 3T5LA 4RW6B 3DOMA 4J9PA 2OTJS 5B7WA 5U47A 1UL3A 2B51A 2BW2A 3CJ2A 1HQEB 1OPIA 4KGMA 1LWCA 2BE2B 2Y1JA 3TYTA 2HVZA 2J0QD 1HBUA 2ZH3A 2LKZA 4G1PA 4E98A 3LP2B 2I5JB 2JH3A 3MD3A 4DV0F 2HW3A 4FP9A 3KLIB 1X5PA 4WXOA 2JWNA 4ZK7M 5HMYA 1S9FA 4A8QA 4JI2F 3KHGA 4BDPA 2OP5A 2IM1A 3M9NB 4GC6A 5KFYA 2W9BA 2R2SA 2GMJA 4C8YA 1YIJS 2GIRA 2HRYA 4M94A 2HNYB 2LQJA 2EVZA 1RTHB 4YB7A 4K4VA 1WG5A 3UCGA 4RLEA 2JEGA 4LF6F 2M5YA 4DR7F 4A8YA 1TAUA 4PG4A 2DR9A 4IUFA 1WG4A 2C28A 1D9DA 1XERA 2I5JA 3K2YA 4DR3F 1TFWA 2KYZA 2XSFA 2OKQA 3KLIA 2DNLA 3U27A 1IKVA 4QIVA 3MEEB 2PI4A 2DNHA 3IRXB 4PQUB 4ECVA 5KFBA 3RB3A 3UCUP 4WZMA 4CO0A 2QSWA 3FRYA 2Q66A 2D7SA 4F3OA 3PNIA 1HBMB 1VLYA 1Q86T 2W9BB 4RKUC 4WKYA 1RYRA 1A7GE 2B4PA 1NZAA 3MDFA 1FJCA 4QIGA 2CQHA 1T3NA 3EGZA 5HP1A 4F4KA 2IBOA 5J1EA 1HNWF 3HJFA 2XSJA 1HFEL 3BS9A 1TL3B 2CPZA 4PR6A 4BC9A 2CQCA 1N5YB 5EHHA 5A0YA 4RW8B 1VRUA 1U1OA 2LXFA 4K0KF 1BQXA 2X3GA 1FJGF 4HH0A 5J2NA 1QVGR 3OPKA 4FBTA 2C3OA 1VFJA 1S9EB 3BSOA 1VQSA 1B64A 1JMTA 2YKQA 3LPYA 4ZCKA 5IT9Y 5F8NA 3MZIA 1F5CA 1SV5A 3QAEA 3AH6A 1T03A 4C8LA 1AROP 1U6BA 3V81A 5IQ6A 1VGYA 5M2RA 4L72B 4PXEA 3KG0A 3LANA 1X4FA 3IS9B 2R8IA 3DNCA 3MM5A 4ITSA 1NRKA 3SMZA 2AGOA 3JSRA 1SL0A 2DH9A 1LK5A 2J6TA 3VTIA 5E3CA 2A3JA 1OQ3A 1NK6A 2OPSA 2QEXS 3C6UA 1O8BA 2LDIA 5C25A 2DNZA 1WHYA 2GFFA 3MMAA 5FJ4A 2GGPA 2CRLA 3M9OB 2ZBIA 3VALA 2IVMA 1ZZFA 3IG1A 2AU0A 2KHDA 4F2RA 3PO4A 1VIOA 3BDEA 2L9WA 2GMLA 4Y65A 1ZH5A 1Q53A 1T94A 1MW7A 4MFBB 1SJ1A 4YOEA 2D74B 2HFZA 2R7QA 5EWGA 4ELTA 2EK1A 2IC3A 3GV5B 4NLWA 1AFJA 4ETXA 1RDRA 3I0SA 2XS5A 3PW7A 1LW2A 2O1PA 1RT7A 2D3OR 1S0NA 2QIFA 2KXHA 2Q6CA 2Y1RI 3PW5A 3VCDA 2MQQA 1IKYB 3E51A 2E5HA 3F41A 1B0VA 2R8JA 1X4BA 1S10A 1C0TA 3O2IA 2B0GA 2IHR1 3QLHA 4Y2AA 2AD9A 2P9EA 3NCRA 3CT9A 4DL2A 3M1VA 2CJ9A 2PDAA 2VKRA 3B78A 1H2TZ 2YKMB 4K2XA 1SJ4P 2RKIB 2M70A 2YNGA 3PM9A 2L3MA 1LKZA 4EBDA 3Q2SC 3OR2A 2ZHAA 5DLGA 3LW5C 1S9GA 3GIMA 5MAOA 1YJRA 4ZPBA 5DGBA 4KPYA 2HHVA 1M5OC 2DIUA 5E3RA 2X51A 2VOOA 3HDSA 1J2VA 5A6WA 5KFJA 3DGPA 1R8HA 1QAJA 1GXUA 2OJ3A 5CHCB 4DN0A 5K14A 3DYAA 1ZYQA 1U1RA 3DN9A 1FRMA 4B9TA 3TARA 1S1VA 2RILA 3FCHA 5KFZA 7FD1A 1SKRA 4OHYA 1HNVA 3DRSB 3OVBA 5KT4A 4DPOA 5KT6A 5F8GA 3GFYA 2GA7A 2FLOA 1HARA 2QLWA 1RISA 4X4OA 5LSRA 3MFIA 2J0SD 2O3DA 1WWHA 2KFZA 2KT2A 4Y34A 1HI1A 3Q8PB 4HHJA 2CPXA 4MTPA 4UQGA 3WX4A 2HHQA 3CEDA 4JBCA 2R7RA 2CQ0A 3OTEA 5MLCV 2R2UA 5EWEA 5A6PA 4G1QB 3H20A 2ILZA 2EBEA 4UUWA 4LMZA 3JB9k 4EYIB 4QR0A 3OSPA 2KDOA 3RB0A 4IR1A 1BGXT 1TKTB 1JLBB 4URQU 5J2QB 2RQMA 4K4TA 3SZ2A 5HMWA 4LSNB 1WF1A 4LSLA 1S1TB 4J9LA 3JAMY 1MMNA 3DLGA 4DS5A 1LWFB 1HWUA 2XG8A 5HBMA 5B08A 3OFGA 1ZZNA 1FXLA 4F02A 3KK2A 2DH8A 1NH8A 4LF4F 4BWJA 4G3IA 2M4MA 3HHLB 2K1RA 3BN4A 4ZCIA 2G0CA 2O67A 4KQZA 3WC0A 1YJTA 1CG2A 2M0GB 2UZAA 3LUYA 4HH1A 3IWXA 3TVKA 3NKYA 2DITA 3TVYA 5CA5A 4RNOA 3OL6A 3RRHA 4OJ3A 2XMTA 2G9OA 5K14B 2I9SA 1RT6B 4J9QA 5J1PA 1D0EA 4B3OB 1LQ9A 1N5VA 1ZM9A 3J7ZT 3LALA 3RR7A 1ZM4A 3NAIA 3C46A 4LSNA 5CYJA 2NXUA 1Z4UA 3MM7B 1HWIA 2B56A 4TY8A 5CD4H 4O44A 2FUG9 2KVIA 4ZCMA 4FNIA 2I8EA 2YKOA 4FF1A 3HHNB 1TL1B 2DNMA 4FXDA 2D3ZA 2FIUA 5HI7A 1C1CB 3H4BA 1HNXF 1QM9A 2LQBA 2PMHA 2XEXA 1IQZA 3M32A 2R2TA 3BSAA 2ZUGA 3GV7B 2EG1A 1ULRA 4FN5A 2ASDA 4C8KA 2F8MA 4W90B 5EN1A 3QPIA 2JC0A 4XDDA 5E2QA 2BANA 2W9CB 4RNMA 3OHBA 5KFQA 3GIIA 3WZ0A 4EEYA 4U67Q 1FXDA 2B3TB 2AWZA 3CXCR 2HWIA 2VBYA 1S97A 1IR0A 1YBAA 5KT2A 3MAHA 4QBUA 3DFEA 5LSLA 2HGLA 1EP4A 1TL4A 2WONB 1CC7A 2DNYA 1XEZA 3LGMA 3CD5A 1NJXA 2MPUA 2LDYA 1VQ9S 5GADI 5I3PA 3V6KA 2CIMA 1UJ6A 1DTTA 3MPYA 4XPCA 2X1FA 2CQBA 2BJDA 3RU0A 2R8KA 5HMZA 3Q23A 2LU1A 3L7OA 1IKVB 3T1AA 2LMIA 2DR5A 2RF2B 3FJ2A 3OL8A 3FMWA 1YITS 1TVRA 4DL7A 1XBWA 1RTJA 3I5CA 4Q44A 4TN2A 3PW0A 4HEA9 2JSXA 5CYQA 5ITHA 2JDJA 1SB6A 4A8XA 2NQPA 2R7UA 4QU7A 5KFDA 2OD6A 2JEJA 2FPHX 2CJKA 3QWPA 2HGNA 5AXMA 5L1IA 3TQ1A 1XWLA 2IRYA 2M9KA 3BN7A 2HPUA 4NXMF 2PE8A 4TY9A 2B4VA 1LWEA 1NU4A 3QGHA 4PXBA 3S6EA 2ZKTA 4C0BA 5IM0A 1T02A 5D4OA 3BZQA 2QA2A 5KG0A 2DH7A 2JHEA 4UY8T 1XMOF 1HI0P 5M2UA 4FNHA 3UPFA 2IRXA 2CVIA 4F4WA 5KFLA 1D9AA 1VRUB 4QZVB 2CPDA 4K5SA 1IXKA 5KG5A 1ELOA 2QLXA 4C97A 2DPJA 4MK9A 4NYOA 4QW9A 4W92B 1RTJB 2FHKA 3M2VA 2HAIA 3V5RA 3I32A 5CH7B 5HP1B 5I42A 5L39A 4GKKF 2B43A 3LAKA 1X4GA 3M30B 1Y5IB 2KZMA 4RWXA 1IBLF 3AHPA 1FNOA 2OO4A 4ECWA 3OR1B 4DQSA 2G13A 1N5YA 1JJ2R</