3UX9B

Structural insights into a human anti-ifn antibody exerting therapeutic potential for systemic lupus erythematosus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
251
structure length
229
Chain Sequence
IVLTQPPSVSGAPGQRVTISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCQVRDNNENEWVFGGGTKLTVLEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYIDFGDHMDFWGQGTLVTVSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon alpha-1/13
publication title Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 54
structure length 229
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B01
4KRPC 1A4JA 1IQWL 1RULL 4NJ9L 2R1YB 2MKWA 1FYHB 4YAQB 2DQCH 3O81A 1Q72H 4RIRB 5TF0A 1HDMB 2OQJA 5F89A 4E42B 1MIEH 2WW8A 3GHBH 2F54A 2CUMA 1J12A 4D94A 2DQIH 4QHLB 1IILE 5EORL 4WENB 3DTXA 1RHFA 1JNJA 2R0ZH 1IGIL 5EZJB 4HWZB 1AI1L 1VSCA 3L3OA 4JM2A 5DRZB 3OF6D 3VFRA 1P4IL 4ZSOB 1LEGB 4MWFA 4U6VL 2I25N 4XHJC 4OJFH 4PRIA 1RUMH 2J5LC 2OJZL 2ZKHL 1U8MB 4PIRF 1TNMA 3DRTA 4MQTB 4NZRL 2F8OA 2G9HA 4PJXA 2VZUA 4NN7C 4OUOA 3DNKA 4RFNB 1B2WH 4UZGA 3KHQA 4NQCD 5I71B 3MRPB 5H2BA 5MEOB 2BOBB 4OUUA 2P5WE 5FM5M 2N7BA 3AMKA 3OKNA 4N90E 3BKJL 1DZBA 4Q9QL 4M6NH 5IHLB 3NAAH 3T77B 5ELIA 1LO3H 5ICYB 1DL7L 4WW1A 2BC4A 3CJJA 1WAAF 3FOMB 3VFGH 5IMMB 3AREA 3VD7A 4UT7H 4NO2B 2QBWA 2VDOL 5DJXA 2DWEA 5ABDE 4GRWF 3W2DH 5KG9A 5E7FA 2MNUA 4XCYA 4Y2DC 5KZCD 4GUPA 2Z92B 3G6JA 1NCAH 4FTVA 1WWBX 4ZFGH 2HT3C 4N5EC 1JF1B 5HI5D 1CFQB 4MAYC 3MUHL 1L9NA 3T0EC 1EAPB 4KV5F 5IF0A 4NRZA 1NGYB 5D2LA 2QKIB 2F74A 5F70A 2NY7H 2AJXH 1WV7T 1Q9LA 4KY1L 2H2PC 2WP3T 5HYSB 2VKWA 5JR1L 5L9DH 5IP4A 5KOMC 4K23L 3UTSB 1T04B 1RJCA 4LBEB 4TNWF 1KCSL 1DEDA 3TJHC 1GRWA 4GG8A 4YHKL 4X9HA 4PJEF 5EIIA 1K4DB 1FNFA 1INQA 1DFBH 2DQGH 5DYOB 3T0WA 3ULUL 2M2DA 3FQRB 3VXUA 4X6BA 1NC2B 3LS4H 2G5BA 5IKCA 2HJLB 2WBJC 4LP5A 3B8YA 4GRLB 5GGVY 4CAGA 4JJ5B 5E9DA 5CBAA 2O5ZH 4JO3L 4KAQH 2FECL 1I4FA 2WNGA 5ESQB 3WNPA 4D9RD 5JHDD 4YNYB 3B9KB 4OLYL 5E2UH 4MXVF 5D7JA 2P7TB 3NIDE 4NC1C 3RU8H 5A2KH 5DURD 2KUTA 4O9HH 4AM0A 1RJZB 4CGTA 2UVFA 4M5YL 2IAMC 5FYJU 2YA2A 5JW3L 4ZUVB 4Z7VF 2HJKA 3MGTB 5CEYA 4XX1E 1NUDA 3CFCH 2H2SC 1DDHA 3QJFB 4PTTA 4F8QA 2B5IB 1S7WA 3VFNB 2X4PB 3MJ8A 2APBA 1CICB 3V9FA 2HFFB 1C7TA 2VR5A 3NIFF 4TOYL 4D0CA 2OXHA 3CUPA 1DLHA 1E4WL 3U48A 1RULH 5BRZD 4LASL 3PL6A 4JO4H 4PY8J 4LLVB 3MA9H 3DBXA 5IHZB 4HFUL 4LPXA 4EQ2A 3DGGA 4JGJA 5F9DC 2WLZA 3K2UH 2AK4E 1IGIH 1U8NA 5C0GA 3WS3A 4H0IA 1AI1H 5FYKH 1P4IH 1H3TA 3C6LA 3VWKD 3THMH 4Y1AD 1QACA 4GMSL 3PABB 4E41D 2OJZH 4OZFA 1XIWA 4KTDH 1OPGL 4NZRH 4ZQKB 3VD9A 3KPLB 1JNNL 4QNPF 3E0GA 5KSVA 1HCVA 3JWDL 3IT8D 3EJYD 1DUZA 3HUJE 3WSQL 5L88H 1GPOL 5DTFA 4F15B 5IVZA 4Q9QH 5FDYA 2PO6A 1C12A 4XAWL 1DL7H 1E27B 4G8GE 1GC1H 3CFBA 3MLSL 2GK0B 2C3XA 4KKCC 1PSKL 4LK4A 1T66D 2VDOH 1IAII 4X6CF 4NSKA 1E6JL 3MREA 5KVEH 5H8DA 1KN2L 2QLVB 5C6TL 5IG7B 2AAVA 1YN7A 2GKIA 3WEXA 3L9RB 5JXEA 2QJDA 3BGFC 1D3CA 5FIEA 5C0EA 4NKIL 2OJEB 5JORA 3X13A 2FIRT 4G9FA 3OL2A 4QO1A 4IRSC 2DJUA 4PRHA 5EU3B 3BMWA 2QADB 1ZSDB 3GRWH 4I0KA 2QR0A 2Q3ZA 4PJCA 3L5IA 2AXFB 2BHZA 3S35X 2DKMA 4YHKH 4ODHH 2PCPB 4LCWE 3FZUD 1A9EA 3MLUH 8FABB 1MY7A 5D8JH 3RY6C 1KJMB 4AEIL 5IT2L 3CZFB 3B9KC 2VDLL 4OD1L 4QHMB 1CVSC 2NY1B 4OLVL 4U7MA 3V8OA 3BUYB 3KYOA 3UZEA 2W9DH 4H26B 5E6ZA 4CDGC 4HC1H 3U6RB 4F2MA 1OM3L 1I9RL 3EDJA 2IPUK 5D1ZA 3KJ4C 3CVIH 3L5JA 3QAZC 5E2TH 4DOHE 1FNGA 1XGQB 2JJUA 3IS0X 1MFDL 1P4BL 1KLUA 4M7LT 3SE8H 4M5YH 3ARBA 4HUXB 3QXVA 4NP4H 1VB9A 5SX4I 3T0EE 4BFIB 5IVXA 2VMFA 3S88L 3G04A 5E5MB 1RIUL 3WKMH 1E28A 3QIUD 2NY3B 1DBAH 4F7TB 2Z8VC 3RVUD 1JZ5A 4KFZC 1WTGT 3QNYA 5F7KC 4JM2F 4ZFOA 3CX2A 3X14B 1NGWB 2BVOA 4X9GA 2FRGP 2IPTH 4ZUTA 1UA6L 5I17B 3ELAT 3C8KA 1IC5L 3MR9A 4JANB 4PJAB 4PJXF 1VENA 4WU7A 5K59E 2D4FA 5T3XL 5CZXC 3SY0A 3U0PA 3OKDA 4HFUH 2AVGA 2I9LB 4AH2A 2BOCB 2NY2D 1NDGB 4XNZB 1X4XA 3O0RL 1IAMA 4NQSB 4PJ8D 5FOBA 4BFBD 1FVEA 3HI6H 3HZMA 1KB5L 2OXGA 1P7HL 1MJJA 3ARUA 4KUZL 4UQ3A 4CBPA 4MJIB 2VAAB 2BSSA 4JO1L 4X6EA 4O51A 1OPGH 2W9EL 3G6JF 3HLAA 2ZUSA 4OZHE 1QLFB 3JWDH 4XNMA 7CGTA 4JDZA 3JTTA 2VZ3A 3OJDA 1H5BC 4XX1G 2CRMA 4LRNL 5C09B 3B9DA 4Z77B 2J1KA 2ARJA 5C0ND 3O3BA 1UQSB 5F8RC 5FHAH 3MRMB 5D2LF 5GRJL 4XAWH 3R1GL 5IMLB 4QRPB 3LKRB 5HHOD 4F37K 2AXGA 5FA4B 5FB8B 5IBUG 1PSKH 5I74C 2G2RB 3T3PE 5EU7C 1JUFA 4PP1D 3U30B 1LD9A 1XGRB 2C1PA 4BQCA 2EE3A 1FL6A 3V4PL 5C0BA 2V2TA 2ENSA 1TJHL 5DJ0A 4XAKE 2V7HA 3I6LE 1T1ZA 3HRPA 4OF6A 1FPTH 1J1PL 1U93B 2VABA 3ARFA 5DMIH 3GMRB 4F7EA 3SDCC 3P2TA 3AAZA 4XP5L 1MHPL 4ZSOE 4E0RB 3SDYL 4MA7H 3GSWA 3QIWD 4HZLB 5JOPD 1I7RB 1B4JL 4KMLB 4I13B 5TDNB 5DVKA 2MMXA 3CPLA 1P7KA 4P2OD 1J18A 1C8PA 3AC0A 2EDXA 3QNZA 4LCYB 3NBNA 4GQ9H 4PRNB 1M7IB 3GO1H 3MRIB 5J89A 3U4AA 2FHBA 5T3ZL 2E7BA 3FB7B 3I2CH 1JRHI 2APWA 1HCFX 3D9AL 4JFEA 1QFUL 1R3HB 4O2FB 4GLRH 3MBED 1NFDA 3S35L 4OD1H 4MQXC 3ROOA 4OLVH 3R06A 3MA7A 5D2NA 3S9DB 3BP7A 1T0MA 4O2CA 3GBLA 2H9GB 1N0XH 5HVGB 5EA0L 4FMKA 5FYJL 4KJPD 3T8XB 1W8OA 5F7DA 1MCPH 5EC1A 1OM3H 2BY3A 1IFHL 3VMNA 4RMUA 2GITB 3JXAA 4KHXL 3PF2A 4EDXA 3P40A 4FQ2H 5I16B 5I8CA 1MFDH 3O2WH 4R4FL 3WLWC 1G7HA 3FAWA 4D0BA 2KZWA 3HC0A 3QXUA 4MD0A 1S7UB 2ERJB 3KYKL 3S88H 4RAVB 1KC5L 3VXPA 3VGEA 3UTSE 2H1PH 1NMBL 3HCVB 4DK3A 3LPWA 3EFFA 4UT6H 3GB7A 4P5MB 4JN1L 5EC2A 2YUVA 1NC4D 1KYOJ 1IC5H 1YEEL 3HI1B 5MP6L 2YKLL 4JFXB 3RRQA 4RCAA 1G7PA 2EE2A 4LEOA 4JDTH 4EVNA 2LE9A 2X4TB 3I85A 4LP4A 3MV7A 3LS5L 3OAZK 4KI5F 1DN2A 4M1GL 3OBAA 2JCCA 3F6IA 3NTCH 1PW3A 5FKPB 4DEPC 1BEYL 1JTOA 1KGCE 5JDSB 1KIRB 3CCHA 1XZ0B 1YA5A 2IGFH 4WTWA 1ZK9A 2R9HC 5SWZB 4L8DB 4ZD3H 2VQ1B 1DANU 1Q38A 4F9LC 5E8EA 1PFCA 1ORQA 2E3VA 3C5SB 4M48L 5J13B 4H88H 5E5RB 1BF2A 1KLGB 4LRNH 3P4MA 4XPHL 1R24A 3DYOA 2V5YA 4QXUL 2BERA 3ILPA 5HHNA 1ZS8B 1NGQL 1F6AB 3MV8A 3RGVA 2JJTC 2OBGA 2Z9TA 5H35A 4GG6B 4PP2B 5DJYB 2HTLC 1H15A 5DVOA 4BZ2H 1TCRB 1IEBB 4XPBL 3OG4B 2DL2A 4LSPL 3S96B 4XTRD 1VACA 4ZAKA 5DT1L 3QUMH 2EIZB 3V4PH 4PJCF 1PY9A 1IRAY 3J8F7 4MJ5B 4Y4KD 3PV6A 1A6ZB 3QB7C 1J1PH 4FZ8L 2Z4QA 3VI4E 4RWYL 5IEKB 1DN0B 4WW2B 1R5IB 1BECA 3CFKA 4ACPA 3MRQA 4S10A 4XP5H 5I9QC 1A9BB 2EDQA 4L1HA 1I1RA 1IEAB 3DV6A 4WFFE 3VRLF 4PRPD 3MRGB 4WI5A 4JZOA 2FJGB 5IEHA 5TH2B 2VUOA 1WGOA 4LVHB 2EDFA 4NNXB 1DQLL 4HLZH 3QA3A 1A6UL 2R4RH 2O5YL 3IDGB 3UEZA 1EUTA 3K74B 4Z95L 5DR5L 4XH2B 5T3ZH 3VFTA 4JREC 2DM4A 3LQMA 3NN8A 1A7BA 3N1FC 3D3VD 3EBAA 1HHHA 2F53A 4GBXB 4ZUSA 4PGCB 3O8XC 5TE4L 5IVXF 4JGMA 3IFNL 3RJDA 2NYYC 1KSRA 1A02N 3BGMB 4I3SH 4P4RA 3B5HA 1FZMB 1WBZA 1CE6B 2X5PA 2GSIB 1NCWL 1XR9A 4LOUD 4YC2B 1I9EA 3VJ6A 3PP4L 3JV4A 1IFHH 4KHXH 4ZNEE 3MCKB 4R3SA 3BX7C 4HS6B 5F44A 1FJ1B 3RVTC 3W39B 1UWGH 1RZFL 1U92A 4L4TD 2NXYB 2QQKL 5B3JE 2R69H 1JL8A 4G6ML 2V17L 5H94A 2L7JA 3EZ8A 4RZCB 1ZV5A 3X3GH 4Z6AT 3RJQB 1GCFA 2VITA 3SO3B 3UC0L 4Z0BL 1PJ9A 1L6XA 3IFPB 4RMWA 4JN1H 1MCSA 2JLLA 3HAEH 1J7VR 3TBVA 5DRWB 5MP6H 3IXAB 1NEZA 2GCYB 4Y5VB 1YEDB 4IS6A 2D0GA 1I8LC 4OFYA 1CZ8H 5F71A 3LS5H 4M1GH 4U1JB 1OP9A 3MRRA 2DJSA 4WY7L 2MQCA 5FGRA 2VLRD 2UWEB 1NLDH 2AQ1A 4R6UA 4OZIA 4Z7UF 1LDSA 1SBSL 4XCEB 1F6FB 3QEHB 1BQHA 1IMHC 4M7KL 3BP4A 4FQHA 5CINH 1OF2A 1JPGB 2EYRB 3ZHDA 4JFOB 2NXZB 2OR7A 3D18B 5TE7H 2ZOLA 3BN3B 3U4BL 4XPHH 5EBWB 3OB0K 3QWOB 3C9NA 3T4YA 1JGUH 2AEQH 4P5TA 1NGQH 1WFOA 4OTXL 4HZAA 3ZE1F 4L29B 2ICEB 1O7VA 1G1YA 1TLKA 2FGWH 3CU7A 2ZPKH 2ICWB 3BAEL 1NBYA 4QF1A 4PJAE 4XPBH 3MRBA 5J06A 1X5KA 2LVEA 4LSPH 5F6IC 3N50A 2DKSA 1Q9WA 3CVHA 4Y4FA 4I8DA 3FT3B 1B0GB 4NQXB 1UXWA 4RWYH 1RSFA 1IKNA 5CJOL 4YDVA 1ADQH 4LVHC 5DMYA 1BVLA 3QJHB 4FQIL 5ICXB 3VG9C 4MJIE 3VGAB 1A3LL 4EDWL 5J12C 3KPNB 1AHWB 4X9IA 3ULUC 1CDUA 4FQPA 3TBSB 4MNQD 1KFAL 1QKZH 3EYFB 5A2JH 4ZS6C 5IMKA 2PXYA 3QQ9D 5EG6C 1A6UH 5C09E 4U3XA 1C5CL 3O45B 2W38A 4JPKH 3MNZB 4K94L 4Z95H 5HYJD 1AD0B 1KIPB 4YHYC 4JKLA 1GGTA 3ARGB 1U3HC 4QRPE 2OI9C 2XG4A 4QRUB 5IJVA 3HHRB 2JELH 2D7TH 2R2EB 3DWTA 1EHLL 4X6DF 1SJEA 5TE4H 1U8KB 4I2XB 4XP9H 3PXHA 4RMRA 3TYGH 3PWUB 43CAA 1HHJA 2CRIA 2QHRH 4N5UA 1YQVL 2XZQL 3DO3A 1NCWH 5I8EA 4RGNB 3WFCL 1G1CA 4ODSL 4U0RC 4YDLB 1EXUA 1PAMA 1CXLA 4G80B 5ANMB 3UYRL 1ACYL 4E9LA 1D5MB 3PDOA 4JDVB 4U6XA 3PV7A 3O4OB 12E8H 3EYOB 3IDMB 1E0OB 5EO0A 1KTLA 3KLAA 3VXMD 1RZFH 3TM6A 2AJ3A 2DBJA 5FGCB 1IM9A 5C7XL 3FO2A 1C5BL 1ZHKA 2JCCF 2V17H 1MFAL 1KCVH 1MAJA 1KPRA 1K85A 1AXIB 3DUSA 3Q6FA 4LU5L 4PBXA 1QLEH 3NIGE 3R8BB 4HIIB 5J7CC 2D0HA 5FO9B 1C5DB 3PQYA 1FZJA 2XWJA 4NO0B 1U2CA 4HS3A 4HG4K 1LO2L 2DMKA 4NQDB 1BZ7A 1FGVH 1OTTD 2FJHB 5F3BA 2YRZA 1QSED 1T5XB 5SWSA 4Y16C 3U7YH 3QXDB 3REVB 1OT2A 4L9LA 2DYPB 4GS7B 4HQQL 4NYLA 4LPYA 1S7QA 1YNTA 4ZPTB 2VLLA 4M7KH 5C8JA 5DSCA 5GZNC 2NX5A 1AY1L 4HMCA 3U7WL 1CR9H 1PG7X 4XB8A 5A3ID 1I7UB 2E9BA 2LAAA 4UIMB 4Y7MA 4P59L 3LEVL 4OKDA 2VLJB 2YS4A 4WWKD 4M62H 4P46B 3U4BH 1CE1L 4Q58C 4XNUL 5KS9A 1XGTB 2YSSB 3AS3A 2CH8A 3RY4A 1OHQA 4NQEB 4OTXH 3RL2B 1MCCA 3MV9B 5FO7B 5EBLA 3BAEH 2D03H 4HJ0D 3QUMB 3JTSB 3TFKD 1CQYA 5C71A 5HDOA 3QP3A 1JZ3A 1A2YB 2K7PA 3AVEA 3T65A 4JQXC 4HUUB 2UZYB 1BZ9B 4E5XB 2RAMA 4WV1B 3BESR 4NOFA 1VEPA 2BY0A 2XTLA 2C1OA 3KPPB 5CJOH 4XP4L 5FYKE 2Y5TA 4YHPB 3GK8H 3RVVD 4FQIH 4DZBA 5SWZE 3DETC 5DD3L 3HG1D 1E4KC 1A3LH 4BSWA 3OR7A 2JJVA 4DGVL 1GGCH 1JF5A 5C70A 3IF1B 5F96L 3TPUB 3KXFB 4GXVL 5HHPB 3RWCB 4GW4A 4DAGL 3EOTL 4LSDA 4WUKL 4XVTL 4FQXA 1J5OL 4N8VG 2EE9A 3VWJA 1EGJA 3DUUB 3U36B 3GM8A 2I24N 4TUJA 4KGJA 3M1BA 2EEBA 1J8KA 5T1KB 1Y0LA 1CN4A 3W11C 5E56A 3P9WB 3WN5C 4DKFL 3ZYZA 2M26A 3TIDB 1NUNB 5E00A 1ZLWH 3UP1A 1BIIA 1YQVH 1I3GL 5I1LA 3WFCH 4ODSH 4L4VA 1YEFH 3VGFA 1Z5LB 2PTVA 1JNLL 3GGWB 1NAMA 3UO1L 5C92A 4OSUL 2ZJSH 2AK1L 3I02A 1GHFH 1ZHBB 1Q9OB 4R2GC 1KELL 4JZNA 4NM8L 1TITA 1V3LA 5DEGB 3QEQB 3VGHA 4K7PY 1PKQA 4UDUA 1M71A 3RI5K 3X3FL 4LAQH 2JF1A 4AJ0A 5KVDL 4JPIA 5SV4A 1C5BH 2NR6D 1FDLH 1G6RA 3UMTA 1ZHNB 1Q0YL 1RAMA 4Q0XH 5GS1B 3SEPA 4LU5H 1VFAA 1UADC 4OZIF 2XWTA 1V7ML 3BSZH 4I0PA 4WI3A 3GMNB 5FCUL 2YHGA 2V2WB 1WWAX 1EO8H 1AC0A 2DMCA 4L3EB 4Y4HC 4XMPH 3RHWK 3X11A 3GEWB 2CLVB 1G0XA 1GZQB 1ED3A 1B3JA 5A43C 4ZFOL 3MOAH 3C60C 2GQHA 1T7XA 1FVDA 5IBLD 4ETQB 2ENYA 2QL1A 3O41A 4Y5XA 4LPTA 4JFDD 2IQAB 2V9RA 4Z7VB 1KTKE 3EHBD 3U79A 3U7WH 4LHUD 4WJ5B 5C0CA 3QEUB 3LEVH 4FFVD 5E03A 5E6IC 2X4UB 4J3TA 4FQQB 3V5KB 2Q86A 4KROD 4XNUH 4HMEA 3SDDA 3L5WA 3ROLA 3O6FB 4L3CB 5DUBB 3TH3T 2OK0L 3V6OA 2DWDB 4NKOB 4P4KA 3OKLA 4OZFH 5LVEA 3MLTA 3WJLC 2HT2C 4X7DC 5E94B 1QA9B 4U1KB 3CFDA 1P2CB 3QT2A 4OZGA 1L0YA 2R2HB 5GJTH 4U1IA 1Y6KR 3AU1B 3F8UB 3DMMB 4PJ7A 1JPTL 3LN5B 4XCNA 1FYTA 1SY6H 2X7LA 1RZ7L 5DHXB 4UTBL 3T1WA 1ACZA 3Q3GA 4WRLA 3MCLL 3F58H 3AY4C 5HGDA 4KRPD 3QO0A 2UWEE 3TA3C 4H5SB 4JFQA 5KW9H 3DX9B 2A38A 5DD3H 1J0IA 1YC7A 5JUEL 2Q6WB 1DBKL 1WCBB 4MA3B 2HN7B 5DVNA 5KVFH 3WL9B 5F96H 4L8SA 4I5BA 1R3LB 4UB0L 4XHJD 4WFHE 1FFOA 1WC7B 2UUDK 1H3UA 4M5ZL 3P3YA 1ZA6A 1TTUA 4GAGL 4P2RD 4LCWD 4WFEE 5HPMB 2BNQB 1Z9OA 2BZDA 4NZJA 5JPMB 4JRYD 1IT9L 4DKEL 5CWSB 3VDAA 4RGMB 3CH8A 3NCCB 2VXUH 3I75B 3E6FA 3GSVA 1UVQA 4RDQG 4RNRB 3I3EA 1I3GH 4JFYA 2FZ3B 4U1HB 4F57L 1JNLH 1OGTB 3V6FB 5A16A 1NDMB 3IGAB 4OSUH 5E95B 3SOBL 4LSUL 5DUML 4OCWH 1ZVYA 4Y2DD 2DI8A 3O9WA 5F3HB 3QIBD 1RUPL 1A4KB 4RFEB 2HT3D 2AJZB 4N5ED 1NCUA 1OB1A 3VH8G 4MAYD 5GIRB 3TZVB 4HHAA 5KVDH 1JN6B 4BH8A 5IESH 3T0ED 1U8HB 4M7LL 3JVGA 1MAKA 2JIXD 4I48A 1NL0L 1NSNL 1I75A 1N59A 4IDLA 4OM0L 3IKCB 3AM8A 4CKVX 1V7MH 2H2PD 3C09C 4PJDA 5CS7A 4XB7A 4MXWH 4YDIL 1CXEA 1KJVA 1YJDL 1GOHA 3EFDL 5F1OB 3KDMB 3D0VB 1T4KA 4I2XE 3TJHD 2VLKB 4XPAL 3MBXL 5IB2B 5TQ0H 4KPHH 4M61B 1XFPA 4BUHA 5KS9F 3C5JA 1JIBA 3J7HA 3DVGA 3C5ZA 5T1DL 3BPOB 1A4JB 4IMLA 5ANME 5GRUH 2WBJD 1WBXB 2OQJB 5DZOA 3BFOA 4P23C 1KCUH 5DD0H 2F54B 4C58B 4QHKI 5MENA 2XRAL 4AMKH 1UFUA 3UJIH 2HFGH 2XA3A 3MODL 3JV6A 1Q1JL 5ID1A 1IC1A 2Z35A 5FGCE 2CGRL 4JR9H 5D9SA 3VFRB 5ACZA 1FGNH 5CMAA 4EOWL 4MWFB 1WICA 4PRIB 3ECBA 5L8JB 4U1GC 2IAMD 1KOAA 3CDGA 1K9TA 2DQDL 1ZT4A 5BV7L 2G9HB 3WFBH 3BD4A 1P1ZA 1MUJB 1U8JA 1UZ6F 2BCKA 1KT2A 5H2BB 2AJYH 3BPLC 4H0HB 2H2SD 4OUUB 2J4WL 4NQDE 3RUGA 1F90H 3OKNB 5DUPL 4P9HH 2V5MA 4MJ2A 4PJBA 5I1JH 1MHEA 1RJLA 2IF7A 1RZ7H 4V1DD 3RDTB 3IDIB 1FC1A 2HYMA 2DWEB 3HE7C 4KVNL 4XCYB 4M6OL 4D8PB 3G6JB 3H7BA 4FTVB 5EB9A 1ZLVH 3HPJB 1T83C 1CXKA 1UH3A 4JHWH 5DJCA 2QSCH 2X09A 5JUEH 2CSPA 1DBKH 5DJZA 3STLA 4KTEL 1MOEA 4FMFA 2CDGA 2VRAA 1R5VA 1X6LA 2NY0B 4N0RA 1UM6H 1H0DA 5TE6H 2R8SH 2CDEB 3KPTA 2ARWA 1SJVA 3W9DB 5IF0B 5I75B 2WMPA 2VLJE 1JYXA 1HNFA 5D2LB 4PJ5A 2F74B 5DK0A 1YNKL 1Q9LB 1IC7H 4NQEE 3DURB 4M5ZH 3ZDYF 2YPVH 2J3SA 4R97C 1JJUA 3EAKA 4YFLI 5I66B 4L8CB 3TVMC 2KDGA 4GXUM 3BH8A 4CW1A 1Z9LA 4Q6YA 1ZWIA 1XMWA 1OGAA 3ARDA 3L3DA 4WO4C 1INQB 4BQBA 2B4CH 4BKLB 3VXUB 4KH2A 1GGUA 3SBWC 3OAZH 3IU4L 4KKCD 3UJTL 1S3KH 3ET9F 7FABL 2G5BB 1J1OL 1S9WA 3ZZ1A 3H8NA 5DUMH 5E9DB 4D9QD 3EO9L 2XZZA 1MNUH 1RUPH 2Q3AA 4LLYA 1KB9K 2IBZY 4OAWA 3QCUH 4QTHA 3UTTA 4PG9A 4LDEB 4M7LH 1OW0C 3MJGX 5ESAB 1NL0H 1NSNH 5T3ZE 1AR1C 1RU9L 4IRJB 1QFPA 3TYFB 3F12A 3TCLA 1MCKA 1FO0A 1CTNA 1F11A 4IRSD 5CD5C 2HJKB 5CGYC 1YJDH 1S7SA 3NCJH 4GRWE 1FFQA 5T5NG 2FHCA 5KSAA 3H9SB 4JHAH 1TQBB 3BEWA 3I3DA 4PTTB 4C54A 1U42A 3IETA 4HKJA 5C0IA 1S7WB 4XPAH 3MBXH 4FQ1L 1AKJD 4EJ1C 5IB3B 3QUYA 3ALWA 4WEMB 1BOGA 1CXIA 2PETA 4GRLD 1S9XB 3R4DA 4ZXBA 3CD4A 4HCRH 2X4RB 4MMZC 4OKVA 4RAUB 4KKBC 4XMLH 3VXTA 2VZSA 5FUZL 3B9KD 2EXYC 4NT6A 5B8CA 1BM3H 4F8TA 3PL6B 3RIFK 3I6KB 3DBXB 4JM2C 2DQHL 3OF6A 3OKEA 1OAKH 4WGVB 3QEQE 4L5FL 4PJ7F 2WP3O 3MODH 1M7DA 2B1AL 1U8NB 3IJHA 3WS3B 2NW3B 2NY5L 1OSZA 3D85D 4OCYL 4OZFB 1XIWB 1T1XA 2RQ8A 2P43B 2IFGA 3DXAB 2Y25A 4YHZL 4LLUB 4W4NA 5GGVH 1DUZB 1Q9KA 4MNHA 4NZUH 3BKYL 3AREC 1MCFA 2J4WH 3ZDXE 5DTFB 5IVZB 4L3EE 3GNML 3K3QA 3B9VA 1CTOA 1DQDH 4MXVE 4NKMA 5D7IF 1VGEL 4LIQL 5F21B 1LMKA 3CFBB 1MWAA 4ZPVA 3NVQA 1CD8A 3KPSD 2WUBH 3FT4A 1F4WH 1BLNA 1T0NA 1V7NL 4GW1A 2VZOA 3LEXA 4M6OH 4NSKB 2Q7YA 3MREB 1A1OA 4QLRA 4K94C 1DVFB 5CZXD 1UACL 4Z7VE 1NFIB 3QDGA 1Y18A 1YN7B 3WEXB 3CVHL 2MCPL 1M05B 1LDPH 2DI7A 4L9DA 3RWIB 5IB1B 2YPLB 4M02A 5C0EB 1U8LA 3LVEA 5F9WC 3RTQB 3ULVC 2OX5A 4EXKA 1FZKA 1QQDA 1S5IL 5JORB 1YNKH 2E9WA 2VDRH 5BW7A 5KANG 3NIFE 2FLRT 3PHSA 3QXTA 5DA4A 4Y89A 3H9YA 4PRHB 1QHOA 1HH6B 2B20A 3GUTA 1IGFL 1NBQA 2X1QA 3MLWH 2QR0B 4PJCB 1TQCC 2AJUH 3HE6A 4G43A 5T1MB 1L0QA 2FNBA 1J0YA 1A9EB 5FXCH 3GJFH 3MLYH 5FHBL 2Y72A 1D7FA 2PW1A 5K9QG 1DCLA 2ED7A 1R3KA 2OZ4A 7FABH 5D7JC 4JPWL 1J1OH 1NBZA 3WFHA 2D7QA 1M1SA 3T2NL 3S3SA 3KYOB 3RX5A 1HQ4A 1EFXA 1S7VA 5HTSA 4DTGH 2EEAA 1JNHA 1MFCL 1MEXH 5GSVA 4HUKB 5D1ZB 1EMTL 4PY8I 1MCJA 3SDCD 5GS2H 4NWTL 3RA7H 1FNGB 3MNVB 1MH5B 5HJ3A 4JRXB 1KLUB 4RMQA 3OB0H 3ARBB 1QFHA 3PWPD 5F7EL 3MRKA 3TIEA 2MPAL 1NKRA 2P8MA 2BNQE 4KVCH 4OLWH 1AD9B 4X6CE 4J3VA 4IMKC 4XNQA 2CKBA 3SGEI 5C07B 2VJXA 2Z91A 1SM3L 3DHMA 2YEZA 2GAZB 2R1YA 3GSOB 4YAQA 3MFFA 3RWJB 5BOZG 3I84A 5CP3A 4XWGH 5IR1A 5C1MB 1VGKA 1Z9MA 1MF2L 4WU7B 2WINB 4QHLA 4MQXD 2APXA 2LQRA 4ZO7A 1DR9A 3QHFH 5CILL 4HWZA 3SHSA 1KEGH 3C6LC 5DRZA 1LEKB 2ICCA 4FNLL 4Y1AA 4ZSOA 3RUGF 3VWKA 4LCCC 1XIWC 1N5YH 4PJBF 3SKNA 5FOBB 1Q0XL 3B6SB 5ITFA 2B1AH 2IG2L 4PLNC 5ADPL 3SGKA 1CLYH 2NY5H 4S0SD 3SJVE 2J6EH 3HZMB 3LCYA 1MJJB 3IXTB 3WIIH 4ALAL 2A9NL 2NY3D 3MRPA 1S7XA 3MLXH 2BSSB 4QHUB 4X6EB 3NCEB 3NIDF 4O51B 3WLWD 4YHZH 3P73A 4KXZH 3HLAB 2PO6C 3HPLB 1R0AL 3T77A 2IQ9L 3OJDB 3BKYH 5ICYA 1T6WA 1BBDH 1UXSB 3MOQA 1J0HA 3FO1A 2VLKE 4NO2A 4XXDA 5FUCC 5HSFA 4PJGB 1VGEH 2Z8WC 3H0TA 2IH1B 2Z92A 5KTEH 1BHGA 4WTXA 1SVCP 4PJHA 1G9MC 1JUFB 1VEMA 4LFHD 4DKDC 4H20H 5JXEC 1LD9B 1O7SA 4U6TA 1FL6B 1ZVSA 3KHOA 4EI5C 1T21A 2F54E 5C0BB 1UACH 2ZNWA 2V2TB 2EC9U 3LIZL 3RPIA 1T1ZB 4JHZA 5IMOA 2NCMA 2F58L 3ARFB 2FATL 3ZT5A 4F7EB 3AAZB 3U0WL 2R9HD 3GSWB 4PRIE 5DFWH 4LBEA 5BMFL 3GI9L 1QEWB 2F19L 1DEEA 5EIVA 5D5MA 3HAEG 1I85C 1K4DA 1A22B 1ONQB 5DK2B 5C0RL 4UNUA 3FQRA 1NC2A 4WCYL 3Q1SL 2ORBL 5GGUA 4CNIB 5D7LD 3BD5A 4FFZL 3U2SB 1R6VA 5E8PB 3LDBC 5ESQA 4ZUWB 1NFDB 1X5HA 2HTLD 1EGJL 1KJ3L 4UOJA 2PTUA 2DBLL 4MDJB 2MQ3A 3T2NH 4KMTL 3MA7B 5D2NB 4OD3L 2VISA 3G6JE 4FTVE 2FO4B 3B8SA 1FIEA 3D0LA 3LN4B 5DHVA 4PB9L 1FH5L 5GS0H 4G8EB 1DBMH 3MV01 4EDXB 4ZUVA 4NWTH 3LD8B 1NAML 5D2LE 3MGTA 3CIQA 3QIUA 4HLJA 2WIMA 2NY6B 4X0KB 5I8CB 1J8HB 1ZKAA 3QJFA 5F1KC 5F1NB 3D1MC 3RY5A 3VFNA 1YMMD 2X4PA 2A6DB 2X6MA 1YECL 1CICA 3BIAX 1HHKA 2HFFA 1MI5D 3V4VL 5FKAB 4ZUUA 1G6RL 5MI0C 2P24A 5GHWH 1HXYA 3QFJB 3B3IB 5JZ7C 1T2QL 5TF1L 5IHZA 3VXUE 3H9HB 3LKQA 1MF2H 3SQBA 1TZGL 5JXAL 3O8XD 1G7PB 4LL9A 4LEOB 1UWEL 25C8L 5E9DE 2NYYD 3Q5OA 2IFFL 4R90H 1WISA 1HEZB 2JCCB 3PABA 2IC2A 2H8PA 1LILA 1JI1A 4YEEA 4JPVL 1RUKL 1IBGH 3OAUL 2LU7A 4X7CC 3WO4B 3BT2H 4UOW0 4QXTB 5C0AB 5D6CA 4ALAH 1PD6A 5E8EB 4QOKD 4PGBB 4KK8C 5LWYH 4K8RL 3RVTD 2FGZA 1X6NA 2DKUA 1GSMA 2N4IA 3GKWH 2MTPA 2GJ6D 4MHHG 3BH9B 2QQNL 3P4MB 3H9SE 1RIVL 3N06B 2GK0A 2DQUL 1CFSB 5HHNB 1JF6A 3F5WA 3UYOD 3QDMD 3MV8B 3VE0B 3BWAA 3RGVB 2GY7B 5H35B 1X5IA 1H15B 4EIZC 2FYYA 3NACH 4P3WA 1DLFH 4R0LB 5SX5K 4JY4B 3ZTNH 5IG7A 2FIKA 4ZAKB 1CF8L 2AERT 3QQNA 3PV6B 4GKZB 5K59F 4YQXL 4M7JL 2DOCA 2WBKA 1U91B 1ZSDA 3EYSH 4G6FD 3DV6B 4JKKA 3MFGB 2AXFA 5IEHB 5HY9A 3DXAE 3W0WD 1TVBB 5CJBA 4J12A 2AI0L 2AV1B 5C0RH 3MBEA 2H41A 3QA3B 4WCYH 3Q1SH 4KI5E 3QULA 3VFTB 3GJFB 3DPBA 3ESUF 4Z76B 3BZEB 4FFZH 2AS5M 1FNLA 1HHHB 4MCZB 4ZUSB 1EGJH 4H26A 4PUBL 4DJMA 4B41A 1GOFA 5HHQA 4M9OA 4CRPA 1I8MA 4G7VH 1UB5A 4BQ9A 3T3PF 5IB5B 15C8L 4X5LA 4OGYL 4V2BA 4OD2A 3ES6B 3JV4B 4HUXA 4CN4A 5BQ7B 4ZTOL 4BFIA 2GSGA 3LPFA 2YPLE 5E5MA 3U0TA 3NA9H 4PY7A 1L9MA 2Z93A 5TGBB 5EH1A 1U92B 1EZVY 4OZ4A 4URTB 3V0VB 4PGJA 4PRHE 3X14A 4MGXA 2I9TB 1YECH 1NGWA 3ULUD 4N8VA 4K3JH 5FK9A 2NTSP 4AQOA 1ITCA 4KDTA 4C56D 4NHUB 2X4SB 5H94B 3V4VH 1CL7L 4ZS6D 1G6RH 4GBXD 4PJCE 3H3BC 4WTZG 5DC4B 4JANA 1Q94A 2VITB 3DGCR 1DQTA 2C4XA 3O3EA 3SPVB 2YUZA 1U3HD 5TF1H 3TT3L 2I9LA 3S34L 4NJAL 5JXAH 1NEZB 4NQSA 1AXSB 2YN3A 2OTPA 4PG2A 4IIQA 5I1DA 4O58L 1U6AL 4M3JA 5BV7C 3WUZA 1T7YA 4FQCL 5INDB 1LO5B 1MIMH 3QUXC 4OZIB 2ICWJ 2IMMA 3B43A 1Y6NR 2EYSB 3INUH 4PJHF 1LK3L 5F1IB 1BQHB 3WXVH 1XCQB 2EDHA 4U33A 4JRXE 3N85L 5C09A 4RISL 4P2QD 4K8RH 1UQSA 3TBTA 3T0AA 3MRMA 3ME0A 4D2NA 1NJ9B 3CSBA 1RK0A 5CJ8A 2FD6L 3O2DH 5CJQL 2ZOLB 4PTUB 5IMLA 1HKLL 2QQNH 3KG5A 3CSYA 1P9MA 5FA4A 3FQNA 5C07E 4A2LA 2DQUH 3T4YB 4P5TB 4K7PX 4JZJB 3MSPA 5I1HL 2YD3A 2HG5A 4XBEL 3K7UA 1N6UA 1WSST 1T3FA 4YHNA 1FRGH 2I27N 1T7WA 5D5MF 4ODVH 2XG5A 2EIBA 5E1AB 3PGCA 4S11A 3MROA 1U93A 1CD9B 3CLFL 1Q9WB 4Y4FB 4Y16D 4GFTB 3WV0A 4WIQA 2XZCH 1UXWB 4PRPA 4HF5L 5F9AC 1I7RA 2J8HA 3JBG7 5TDNA 3WFEL 4TPRL 1RVFL 1GAFL 4LDOB 3CXDL 1F2QA 4HS8H 4XXCA 1NCNA 3IU3A 3VMOA 5GZND 4PRNA 1M7IA 5B4MC 3FB7A 1BFOB 2OSLA 2NQCA 2HJFA 5J6GA 4YK4B 5IMKB 2O5XL 2PXYB 3CH1B 1MQKL 3JZ7A 3VXNB 4G7YL 1CU4L 4B50A 4NRXB 4OCMC 5E8DL 4NFCA 4XRCB 5ID0A 4PJGE 4MA1C 2IANB 2H32H 2Z31C 2H9GA 5IJVB 5D1XB 4PUBH 3SCMB 1G7JA 4WHYH 3T8XA 5B39G 3ZKNC 1KN4H 3D2UD 4HSQA 1AO7B 3L3JA 4YHLL 5L8LB 5EZOH 1YEGL 5C0BE 3DECA 3DV4A 5I16A 2RCSL 3EOBA 1EXUB 1XCTB 3ARQA 4QY8B 5CSGA 3M17B 4TVPH 3PDOB 4L4TA 4MXQC 5T5FL 3O6KL 3K8MA 4U6XB 1S7UA 5EUKA 4RAVA 1OQOA 3ZE1E 3DETD 5I8KH 2LTQC 2R29L 4UAOB 4YDKL 3TNMA 3TNNB 4PJ9C 3FMGL 2APTA 1S9KC 2NPLX 1IM9B 3EZJB 3FO2B 4HFWB 5HHMB 4P5MA 1F58L 2AJSL 4KKAC 1A7PH 1CL7H 3UDWC 2OLDA 4LVOB 3DUSB 3Q6FB 3IDXH 4J23A 3HI1A 3IFLL 5MHSE 2PUQT 4XMKL 3T2OA 4RAHA 4PJIB 3HNTL 2X4TA 5C2BH 4JFEE 3TT3H 4G5ZL 2XWJB 5JHLL 1QFOA 4J6RL 1NFDE 2W0FB 1WIPA 3REWB 3W11D 1BZ7B 5FKPA 5F3BB 2IPUG 4FXKA 3KJ6H 3QDJB 5D2NE 4U31A 2CO6B 5SWSB 4NC2B 5J11C 5SWZA 4L8DA 3ZHLA 5L7XL 4F3FA 4L9LB 3C5SA 1O0VA 3MLPA 1AJ7L 1ULVA 4KRMB 5LGHH 2ILLA 4NYLB 4GH7B 2QQLL 1IL1A 4JG0L 3VH8A 3VXSD 2I60L 2HT4C 3H7LA 4AL8L 2I26N 4TTDC 3GSNH 5I15H 3CLEL 4R2GD 1ZLUK 1NQBA 5DSCB 3MMEB 3N85H 4QHNB 2B39A 5GJSL 5ISZD 3IDNA 4RISH 2HKHL 2XYCA 5DEFA 2CLRA 2XTJB 1ZS8A 1BQUA 2K7QA 3FFCD 3KPRB 3RWHA 2FD6H 4XC3H 4YBLB 1F6AA 1HKLH 2GK2A 3H3PL 1QPPA 1OP5H 4GG6A 5FUOL 1KJ2A 3OPZL 5KS9B 4IRZL 3QHZL 5DJDA 3WHE1 4NHCL 5LBSL 5T3XD 2EYTA 5GRYA 3ZKSD 2PYFB 6FABL 4U3HA 3S96A 3QFJE 1BGXL 5I1HH 2DJ4A 1R3JA 4TSAL 4YXKH 5EBLB 3LZFL 3TWCL 4K7PL 1TVHA 1YNLH 5FECA 5EUOA 1QPXA 1ZGLA 5IEKA 1DN0A 4Y4HD 1R5IA 3CLFH 1WZ1H 1G7LA 4YWGH 4JY6A 1A9BA 3ABZA 2IBBA 2JCCE 4JB9L 1J11A 3VFMA 4OB5H 2C1OB 1MWAL 2BNRB 3C2SA 3MRGA 1IM3B 3WFEH 2FJGA 2XQBH 5TH2A 4TPRH 1RVFH 3GRWA 3DLQR 4OFVA 2PXYC 4P46D 2IPKB 3ZSSA 2QSQA 3OR7B 3E1F1 3PUCA 3V6BR 3IDGA 3SKJL 4HKXA 5C6WH 3I3BA 4NQED 3WFDL 4XH2A 1VERA 3SKUD 4BM7A 5E6ID 1OAXH 4XI5C 5I8OH 4S1QH 3QPQC 1CU4H 3CC5A 2XWBB 4GW4B 4Z5RB 1A6PA 5F97E 1ZTXH 3WIFA 4G6AC 4CVXB 4FQXB 3MV8E 4OQTH 3BGMA 3VWJB 1I3RB 4C57C 1XF4A 2HT2D 1FZMA 4HC1A 3M1BB 1CE6A 3FB5A 1Y0LB 2MOVA 3PWVA 1ZT1A 1YQ2A 4GMTL 1TMCB 2VKXA 5CJXC 2FH6A 4NOBA 1YEGH 5FDWB 5DD1L 5JPNB 1AQDA 2C3WA 3MCKA 4I1NB 2CK0L 4HS6A 1FJ1A 1PBYA 2P8PB 3VXMA 4HT1H 2AABH 5T5FH 1UJ3B 2OZ4L 3N1QC 1OWWA 2K9UA 3TA3D 1QR1A 3HZKA 4LVNC 1J1XL 1UCBH 4JG1H 3X12A 3OZ9L 3S5LB 4JZNB 4L8BB 5J1AA 2R29H 4TSCL 1CD1B 1QG3A 2P44B 3FMGH 4P99A 4UDUB 1M71B 5LXGL 3RFZC 1G6RB 3BQUC 3GSRB 3K46A 4GQPH 1MRDL 4HJJL 3PDGA 2XWTB 1BIHA 2CLZA 3IFLH 5DRWA 3SE4A 1ZVHA 2E7LA 3ZSTA 3IXAA 5IQ7H 4I0PB 5FYJD 1QSEA 1FO0H 1MCNA 4UTAL 4L9LC 1JGEA 1PKOA 4U1JA 1HHGA 4KTYA 2CKBL 4MNGA 1ED3B 2WSKA 5HXMA 2PR4L 5AWNH 3VD3A 3QEHA 3T08A 5L7XH 2NZIA 1QD0A 1MCOL 1FVDB 2BHUA 4JG0H 2QQLH 3NGBB 1JPGA 2LU3A 5D1QA 1BQLL 1K3IA 2EYRA 1A5FH 1AQKH 2I60H 1RY7B 1I1FA 1II4E 4QRRB 4AL8H 5LGJB 4XGZA 4WWKA 3MJ6A 3U9PL 1B6UA 2XQYK 1N6QL 5GJSH 2HKHH 3QWOA 1DUYA 5C0CB 4K71C 4LNRB 3GBML 3WHE0 4NN5B 1YUHB 4G3YL 4YFEA 4NO5B 3L3IA 5CD3B 3SQOH 2Q86B 2ICEA 3OPZH 3L5WB 3ROLB 2DTML 5D7SH 4H8WC 2Y5EA 1WEJH 2ICWA 5LBSH 3EO1B 4QGYA 6FABH 3BDXA 1P6AB 2IBZX 3HZYB 3MLZL 5IFHL 5EWIL 2FDBP 3NIGF 1D5BB 3LZFH 3WFZA 3FT3A 4I18B 4OZGB 4NQXA 4CVUA 2DQJL 4U1IB 4ZODA 2VLME 4PJ7B 4PBWD 5DC0A 4XCNB 1FYTB 4PS4L 2X7LB 4JQVA 1CBVH 3T3ME 2APFA 3GSXB 5AZ2L 3HG1A 2SEBB 3BZ4B 5HGDB 4N9GA 1B0RA 3QO0B 4OZIE 1AHWA 4NCC2 4YE4L 2VXQH 3W9EB 4JFQB 2QSTA 4WUUB 5E6YA 3TO2A 2XZAL 4QRSB 4P23D 3HR5B 4UQ2A 2ZUWA 4K9EL 3O45A 5LAXB 5F9OH 3CK0L 1LO0L 1QHPA 1ZLSL 5I1CH 1AD0A 2W65B 4PLKC 2Q20A 4O4YL 2E7MA 4M43L 4L8SB 2DTSA 3ILQC 2VH5H 4I5BB 3MLRL 5C9JA 2DD8L 1FFOB 3H6JA 5HVHC 4I2XA 2D7PA 2H32B 3N9GH 1ZA6B 3FRUA 4NIKB 5JOEA 3PWUA 2LFGA 2EH8H 2VDQH 4PGZA 2YN5A 5HI3C 2RJMA 5KBNC 4WDIA 5IJKA 4KZDL 5ANMA 3GSVB 1T7VA 3E2HB 4JDVA 5DD1H 4DVRH 4JFFD 4KU1A 2Q7NA 3CDCA 4ELKA 3EYOA 3IDMA 2D0FA 4TRPL 4X7FC 2CK0H 4W68A 3ISWA 2BFVL 3QNXB 4S1RH 3C6SA 3HE7D 4RDQF 4YPGB 3L3HB 1PDKA 1RZJH 2WAHA 3NOIA 5DGQA 1A1MA 2AKRA 3GSQB 2B8OT 4PLOB 4YHIB 5LXGH 1T0PB 3SE9L 1OB1B 1YZZA 4HIIA 4HHAB 4Z78A 5I1KL 1I1AB 3WNOA 3N1GC 4LSVL 1F00I 3H3KA 4HJJH 1D5IL 1MRDH 4I48B 5C08B 5JOFB 1JHKL 4NQDA 4PJDB 2FJHA 2W0KA 4UIKH 3K1DA 1MVUB 3BRFA 4OFPA 2IANE 3FQWA 2VL4A 3TVMD 4HWBA 5IVOA 3MRHA 5AYUL 3TO4C 4YHOH 1BREA 3VI3E 2ESVB 3REVA 1T4KB 2CKBH 2JKXA 2X4QA 5LG1A 4Y5XC 1AO7E 1QZ1A 4GG6F 4WO4D 4JFDA 1MFBL 1NGZA 3C5ZB 5CP3H 1EVTC 4GW5A 1QR4A 3KPQA 1KENL 3GSNB 1F02I 4DGYH 1P5VA 2EEDA 4YZFE 2HKFL 2J8UB 3SJVD 5MENB 4EN3C 2VLJA 2BVYA 3SDDC 5EUOF 1GIGL 1XGTA 2YSSA 1JWMB 3P11H 3JV6B 4P4KC 3QQ3A 3GBMH 5ID1B 2Z35B 2FR4B 1W2KT 5D9SB 1J10A 3RL2A 3MV9A 5CMAB 5FO7A 1QFWH 4IOFC 2DTMH 3ECBB 3TJEH 3EDEA 1AR1D 4UINL 5FYKU 3QUMA 4YX2H 3BPCA 5DVLA 4S1DC 5EWIH 5CD5D 5FF6A 5CGYD 4HUUA 3PQYE 2BCKB 3ZYIA 2FX7H 1KT2B 2O61A 4WV1A 2DQJH 3RUGB 3ULSA 5GGRY 2ZG1A 3U82B 3QDJE 4K3EH 1MHEB 4PS4H 1RJLB 4U05A 1JHLH 5SWSE 3OHXB 1A7QH 4KKBD 4BJLA 3UZQA 1KCKA 2EXYD 3RX8A 3S7GA 1X5JA 2BVTA 1NANI 1WUNT 4MSWB 2XZAH 4MQSB 3H7BB 3MJ7B 4JM2D 4NFBA 4K55A 4Z9KB 3TT1L 2J2ZA 1RZKC 2NX5E 5IW1A 3KXFA 1LO0H 1H0DB 2KBGA 1HINL 1I9JL 4P2RA 3KPRE 4O4YH 2WUCL 4EKXA 3HI5L 2OTUA 3RP1A 4JRYA 3U36A 4PJ5B 4WNQB 3EO0A 5DK0B 5T1KA 5KS9E 2AEPL 4NDMB 5TPWL 5JNYA 1J0JA 2D31A 3TIDA 5E70A 3CSPA 3QUKB 3RWFB 1NH6A 3BH8B 2CRZA 4JO2L 3SGEH 3UTQA 4CW1B 1MFEL 3ARED 5AUMB 4DVBB 1ZWIB 1OGAB 3GGWA 1INDL 1UYWL 4OM1H 3V7AG 5I6XB 3BD3A 1ZHBA 1Q9OA 3O9WC 5EU4B 4X4MA 2C3VA 2YR3A 4OF8A 1G6VK 5DEGA 3QEQA 3LRSA 3MTRA 2BNRE 1WLHA 2UY7A 3GIZL 1OD9A 3QCVL 4ZOCA 4CMMA 4QWWC 1ZHNA 3JVGC 2P49B 3QCTL 5GS1A 3D48R 2JIXA 4WWID 1JVKA 4LLYB 2WIIA 2UWEF 4OAWB 3MUY1 4A6YA 4QTHB 3AM8C 3MGOB 1UZ6E 1HSBA 1MREL 5K9JH 5D7KD 5DHVH 5I73B 3HAEA 3HNVL 3SDAC 3GMNA 1F97A 2V2WA 5T1LB 2X40A 4Z7QF 5ILTL 1OCWL 43C9B 1HIML 2ZUTA 4XP1H 4JFZL 1FO0B 4P3CL 2CLVA 1GZQA 4X9FA 3E8UH 5KSAB 3BEWB 3HNSH 1L7TL 3IETB 5C0IB 5SX5H 1S8DA 3AB0C 3QXAA 5T5NF 4U2YA 2BY2A 1MFBH 1MIEL 3GMLA 3G5XA 3LKSB 4FG6C 1JI2A 3CGTA 4L4VE 3CSGA 3TN0C 1Z6JT 1M6OA 1KENH 2EDOA 2BVEA 4PRAB 4WJ5A 5ETUB 3QEUA 4NT6B 4R7DB 5D7JD 2DQIL 5B8CB 2EDJA 4ONFH 2X4UA 3P0VH 1CGSL 4FQQA 5TFSL 3V5KA 3RZCC 5ALCL 1TJIL 2CK2A 3O6FA 4L3CA 4OJFL 1RUML 4MAUH 1PKQE 5DUBA 1EEYB 1M7DB 3RBSA 1CIDA 4NKOA 3IJHB 4LLDA 3FO0L 3U9UA 3NFPB 4GRMB 1B2WL 4NQCB 4QRTB 5E94A 4PJFB 1P2CA 2PTTB 4TUKH 1T1XB 1VDGA 5E2WL 4UINH 5IBTH 2AW2A 2GW5A 4V2CB 2X4NB 3AU1A 1J05A 3DMMA 1IGJA 2ADFH 4MNHB 1DP0A 1LO3L 1BVKA 4HIHA 3VFGL 2VC2L 4UT7L 1ADQA 5AG9A 4CVWA 4DKAA 5KZCB 4H5SA 4R7NA 4JFHD 1S9YB 1JYWA 5F7UA 4OFDA 5GXBB 4ZFGL 3HMWH 3ZYOA 3FT4B 1WCBA 2NY4C 1T0NB 2BP3A 3QSKB 4MA3A 2HN7A 1BBJB 3WL9A 3WXWH 4XNYL 4QRRE 2Q7YB 4WGWB 1A1OB 1R3IH 1KNOB 3C6LD 4OCSH 1GVIA 5D72H 2D4DA 3RAJH 1FIGL 1XF3A 1D9KC 2B0SL 2DQEL 2AJXL 1XIWD 5C0CE 1WC7A 3UBXI 1I9JH 4KQ3L 3PNWA 3HI5H 5L9DL 2GY5A 5JPMA 5DD6B 1FZKB 1QQDB 2E9JA 2AEPH 1UH4A 2OL3H 1S78C 3ARDC 5CWSA 2ZUQC 2R4SL 1PGRB 3V6OE 3VA2C 3GUTB 2PO6D 3RWEB 1BJ1J 4ZOBA 2DQGL 4RNRA 4Q9RH 1IAOA 5I18H 2X89A 4PRBA 3LS4L 5BJTB 2FZ3A 4U1HA 3MXWH 4NRYB 4OZGE 1A14H 4G43B 4TSBL 2Y7QB 3DRQB 2ATPA 3V5DA 5ICZA 5GGTH 4PJ7E 4N0UB 1JZ8A 1FYTE 3DX8B 3LKOB 2PW1B 5JHDB 5F3HA 3LHPL 4CMHC 1R3KB 2BHYA 4RFEA 1FG2B 2AJZA 5E2UL 1NBZB 5EFIA 4F7CA 4M93C 5GIRA 1JN6A 5JXED 4HWNA 1QBBA 5DURB 1U8HA 3JUZA 4EI5D 1HQ4B 5HPOA 4O9HL 1S7VB 3TCXA 3P30L 4G9FD 3IKCA 1JNHB 3ALXA 4IJ3C 3FHAA 2ZOKA 4PRHD 1A7NH 4KUCF 3KDMA 3CFCL 3D0VA 4HULB 3CX5J 5ILTH 1HIMH 4JFZH 1I7ZB 1P84K 1WWWX 3MRKB 3QUYC 3TIEB 2W92A 5IB2A 3F7YB 4M61A 4F58H 2FBJH 1QP1A 4Q6IB 1RK1A 4ZXBC 3WDJA 3WMSA 5FGSA 3VXRA 4P2CG 2CKBB 3RY6A 3TBYB 2Z91B 5EU6D 5BRZB 1IGTB 1NMAH 2YEZB 2OCFD 3ZT7A 4RGOH 4X4XB 3MFFB 1JTTA 1WBXA 2XA8H 3PP3K 4JO4L 3MA9L 3P4NB 3WO3B 4R9HA 1E6OH 2G5RA 5IR1B 1VGKB 3F7VA 4LMQE 4TVPE 5HDQH 3IJSB 4HAFA 3K2UL 1QYGL 1HQRB 4DW2L 1CGSH 5TFSH 3D85A 5ALCH 5FYKL 1TJIH 4Y1AB 3VWKB 4N8CL 3PXJA 3THML 4E41B 3K4DA 5EOCH 2RBLA 4OIAA 5BS0D 3SKNB 1VFBB 2XY2A 4KTDL 5ITFB 5L6YH 3CMGA 3FO0H 4I3GA 2UY6A 2BRRH 3FFDB 1MUJA 4ZFZA 3IJYA 1S7XB 4ZO9A 5C08E 4Z7OE 5E2WH 4KHTL 4WTZA 5EZIH 5L88L 2P5ED 3P73B 5DDHB 4PJDE 3BEVA 5DI8A 1GC1L 3BDYH 2EKJA 5I1AB 3RDTA 1A6VH 2EDTA 3IDIA 1T03L 2VC2H 4OLEA 4DCQA 3FO1B 1KJ2L 4JQIL 4XXDB 1P69B 4I0CC 1ZMYA 3P9MB 3QI9C 5EULV 4D8PA 1EZVX 3H0TB 4M4RA 5JZ7D 3QIBC 5KVEL 3HPJA 3RZWA 3VW3H 4PJHB 5CKGA 4XNYH 2CDEA 2R23B 5IV2A 4JKPH 1ZVSB 4GSDL 3W9DA 5MENE 1T21B 3O4LA 1TZHA 4LF3A 4OIIH 3S5LG 3RPIB 1FIGH 4D0DA 5BW7C 2B0SH 1OAYL 2DQEH 5IMOB 1BQSA 3DURA 4KQ3H 2H26B 3TEUA 3M07A 3LEYH 1MSPA 5I66A 4L8CA 1VPOH 1A6TA 5J1TC 1U8OA 3GRWL 1H5BA 3BP5B 1L7IH 5DO2C 4KK8D 3HE6C 2R4SH 1DEEB 2IH3A 4UNTA 4ODHL 5D5MB 5DLMH 3MLUL 3ARSA 4EI6A 4BKLA 5D8JL 5BXFA 4MLSA 1D5ZB 2VDMH 1H3PL 5CBEB 3RUGE 4TSBH 4OLZL 3DVNB 5GGUB 35C8L 4KZEL 4AEHL 3LV3A 4PJBE 2HAZA 3N1MC 4NCC1 3ZDXF 3LHPH 4Q74A 2W9DL 4M6MH 4TN9A 2YUXA 1FSKB 4HC1L 3QUZC 5L0QC 1I9IH 3ARFD 1G9NH 2XICA 1SMAA 2VISB 2VL5A 4W4OC 1A8JH 3CVIL 5E2TL 5GGRA 5ESAA 3OSKA 3D0LB 1OSPH 1FFPA 5DHVB 3P30H 4IRJA 3SE8L 3TYFA 3PWPA 3KAAA 2DDQL 2YD1A 5H37H 4NP4L 5EDXA 1S7TB 3KLSA 3QIUB 4PJ5E 4H25A 4HJGA 3WKML 3H9SA 1T2XA 1DBAL 1EVUA 5IB3A 1HHKB 1S9XA 2IPTL 4JFED 2X4RA 4ZUUB 4RAUA 4KJWC 1JZ7A 2JK5A 2P24B 5B39A 4OF3A 1OGAE 1HXYB 3I6KA 1CK0H 2NY2B 3LKQB 2A83A 4PJ8B 1NBVL 1QYGH 5GRZA 3HI6L 4DW2H 2NW3A 5HYEA 4RFNC 1U58A 1FFRA 4N8CH 5I71C 1C7SA 4DUVA 3LPGA 2H8PB 1CVRA 3UTTE 1H3VA 4CN1A 4F7MB 4DUWA 3DXAA 2XKUA 4LLUA 4GO6B 2CD0A 2LAGB 1UKSA 5D6CB 1KTRL 5FAAA 4KHTH 3ZKXB 5J3HC 5IIEB 1SY6A 5FHAL 3B4NA 1J86A 2YWYA 5HHOB 3GHEL 4WHYG 3RVXC 2FEDC 1T03H 4LQFH 4XNXH 1K8DA 1KJ2H 4JQIH 3F5WB 1A6WH 4M03A 5JIKA 3BWAB 4K9EC 5F6HJ 2PYED 1F3DH 4NZDA 1DVFA 3MV7D 2BJML 2FYYB 1DQMH 1NFIA 3ZE2E 2ZUYA 5KSUA 1FNSH 3OGOE 1FPTL 2FIKB 1M05A 5DMIL 2W91A 4GSDH 4LPWA 5IB1A 3RWIA 3NZHL 5F93C 2YPLA 1F4XH 3RTQA 1FL5A 3QIWB 4LPUA 5TDPB 4MA7L 5E4EB 1OAYH 4F9LA 3HMXA 2NLJB 9CGTA 2ITDB 3QH3B 1U9KA 3QUXD 4P2OB 1BWWA 1HH6A 3TC9A 1MLCA 4QTIL 2OL3B 3NPSB 4TULH 4PJFE 5JW4M 4HV8B 4GQ9L 1P4LA 5HY9B 3GJEB 3GO1L 4MD4B 5T1MA 3WNKA 1DBBH 1T7ZA 1KXVC 1FAIL 4GRLC 3I2CL 5BZWB 4XPFL 1GL4B 3P77A 4DZ8B 3MBEB 4POYA 1MCDA 1P7QD 4W6YB 1PQZA 1JHTA 1H3PH 2EH7H 1H8OA 4OLZH 4KZEH 3FB6A 35C8H 3QULB 4AEHH 3VRIA 3MYJA 3E3QE 4IBLT 1N0XL 1OD7A 5MERB 2V9QA 3H2WA 3OQ3B 1I8IB 1MCPL 4GXUN 2GFBA 5JW4Q 1A7OH 5HHQB 5FV2A 1H3WM 3OX8A 3D87B 1I8MB 1TTGA 1UB5B 4HIXH 4U49A 4Z0XB 3C2AL 1CGUA 3MNVA 4FQ2L 1MH5A 4OD2B 4JRXA 3O2WL 2B5IC 3QDGE 3RWGA 1YMMA 2DDQH 2AJVH 1JBJA 2Y1VA 1CICC 2GSGB 4D9LH 3FRPG 3P0GB 3U0TB 1AD9A 1MI5A 4PY7B 3JV5A 4HH9A 3EW3B 2H1PL 4LVEA 4QRQA 5C07A 5CEZL 2Z93B 5I30H 5EN2A 3NZ8A 2VXTH 2GAZA 4OZ4B 3GSOA 5I0DA 5B4MD 2X9YA 4UT6L 4OFKA 4N8VB 4JAMB 5FK9B 3RWJA 1ZHLB 1FFNB 2A77H 2F53D 2PF6A 1NC4B 3LSOA 2V5SA 2Y06H 4OI9A 1Q94B 2CDFA 3O3EB 2WINA 4JDTL 4N0UE 4OCRL 2ZNXA 4LDLB 3IDYB 2Z31D 4JFPB 2VO5A 4FXLA 4D9RE 3KPMB 1LEKA 5JHDE 4P5KA 4U2ZA 5IM7A 3NTCL 4HWBL 4HXAH 1NBVH 3ZKND 3B6SA 4IIQB 4LSTH 1WZLA 2IGFL 5I1DB 4ZD3L 3IXTA 4P48A 3DI2B 4QHUA 1CGTA 4YO0A 4H88L 3UZVB 4F15C 1F2XK 2V7NA 3HPLA 4MXQD 2OR9H 1N26A 3G5ZA 1VKXB 3MNWB 1UXSA 3TBTB 4N0YL 4PJ9D 4ZMAT 3DVFA 1BD2D 3QDMA 1RK0B 2E8YA 4JY5H 4PJGA 4R4BA 3OJVC 3VDCA 3GHEH 2FECI 2IH1A 3CSYB 4KKAD 3FQNB 5JQ6L 2OP4H 4FA8A 3DVIA 4BZ2L 2NW2A 2CQVA 4DUXA 4TNVF 2AGJH 1JGVL 5GRVL 1F42A 4M1CC 3ARTA 3KYNB 5D93B 2HG5B 3QUML 1IARB 4YXLH 5JO5A 3O6ML 5IFJB 1T3FB 2BJMH 5DJ8B 4YHNB 4Y4KB 4NN6B 4HG4J 3G5YB 3SDXB 2YBRB 3PGCB 1QTYT 1NLBH 3MROB 1NEUA 1SJXA 3JWOC 3RPKA 4ZG1A 1OVZA 3NZHH 5CLTA 2QADC 3QWRA 4ONGH 4Y1AE 4E41E 1W72H 4PRPB 4PGDA 1QEWA 2YRLA 5BVPH 5EZLA 2ZCKH 3CDFA 2HT4D 1YEHH 4QTIH 2C4FU 4TTDD 1ONQA 5DK2A 2YA1A 3IU3B 2R4RL 2NY1C 4P5TD 2Y4SA 1FAIH 4CNIA 2P8LA 3D3VB 2OSLB 2HJFB 4XPFH 3U2SA 5J6GB 4X4YA 1HH9A 5E8PA 2Q76B 4ZUWA 2R0KL 5L2KD 1INEH 4UT9H 4DWHA 4MDJA 5ID0B 2AEIT 4YFDB 4I3SL 4OIBA 2FO4A 4PJHE 1G7JB 4ELMB 2BY1A 3LN4A 4WI7A 2A1WH 1N4XH 4G8EA 3L3JB 3C2AH 4YBHA 3DV4B 2NY3C 2BVPB 3EOBB 4X0KA 1J8HA 3MYZA 3A67H 3VG0H 5F1NA 4L4JA 1UM5H 1UWGL 2VN4A 2ZUXA 4L4TB 2A6DA 3QPXH 2H6PA 5EUKB 2R69L 4Z7NE 4C56A 1L4IA 2PXYD 5CEZH 3MACH 5FKAA 5LQBL 3QFDB 1EEUA 3TNMB 3X3GL 4U3CA 2ID5A 3K81A 4AEFA 4WHCA 2ICWI 2FWOA 4WFGD 5D5ME 4HCRA 4A6YL 3QFJA 3BKCH 1U3HA 2DN7A 3B3IA 5EPMA 4XI5D 1EHXA 4ZS7H 3H9HA 4XNZC 3QPQD 4FFWC 2QQQA 1AGDB 4PG2C 4IIQC 4XPGL 5HGAB 4OCRH 4G6AD 3UTPD 1CZ8L 1NGPH 1HEZA 4HWBH 2VLRB 3D5OF 4FXKB 2LV4A 1NLDL 2AEWA 1I1YB 5CZKA 1LP9A 1V3MA 1FC2D 1G7MB 2X41A 1BAFH 1KCRH 4QXTA 4XCFL 2CUHA 5C0AA 3TV3L 1JP5A 3VFVB 4N0CC 4F3FB 5CINL 4PGBA 5KJRH 4P2QA 5T33H 1IL1B 2VYRE 3VH8B 1MJ7H 1YYMH 1IM9D 2FO1A 1QRNA 1SYVA 1U3JA 1V3KA 5TE7L 3BH9A 1P9MC 5J4MA 4NC0B 4TYUA 1OTUC 3IDNB 1YPZA 4HGWB 3GMMA 5KSBB 4N0YH 1JGUL 5DEFB 1CFSA 2AEQL 2CLRB 2FB4L 3U30C 3RWHB 3VE0A 4UV4H 2K3TA 1MY5A 3BQUD 4ISVA 5E1HB 1KJ2B 2XN9D 3PQYD 5J57B 5JQ6H 4HUVB 1HWHB 1KG0A 5DJDB 2FGWL 4R0LA 2ZPKL 4JY4A 3BPNB 2EYTB 3S4SG 1JGVH 3FN0H 4PV8B 3LQAH 1R3JB 4ZTPL 3O6MH 1VA9A 2DS4A 4GKZA 3RKDC 5FA3A 2ZSVA 1TVHB 5FECB 5EUOB 1ZGLB 2E6PA 4RBPH 1JGDB 5IW3A 1G7LB 4M7ZB 4JY6B 4XVUC 5DK3A 1YDPB 1ADQL 2CJUH 3ESVF 1U91A 2NX5D 3SGDH 4YGVB 3VFMB 1TVBA 4MNQB 2AV1A 2R0LH 1T1YA 1QKZL 4Y88A 1N64L 3L7FB 3KWWB 3G6DL 4HKXB 4JPKL 5HYJB 3BE1L 4M9PA 2A74A 1QSZA 1MRFH 3GJFA 4Z76A 2BVQA 5JDJA 3BZEA 5HHOE 2CIKB 4HAGA 2ITCA 4DQOH 2JELL 2D7TL 2R0KH 3CC5B 4MCZA 4ETYA 4HD9A 1HZHL 5K9QI 2F15A 4F37F 4XP9L 3WIFB 1KIQA 3TYGL 5HYFA 3TH4T 1XF4B 1SMOA 2QHRL 5DEZA 3BMVA 3QBTB 5IB5A 3FB5B 4N68A 1TPXB 3ES6A 3PWVB 1ZT1B 4HIJA 3BW9A 4K3HA 5IOPB 3N0PB 1UB6B 4C83B 2ERJC 4J3XA 3WLBA 5BQ7A 1RV6X 1RZGB 1AQDB 2DQFB 1AC6A 12E8L 1BX2A 2NZ9D 2XV6B 2VE6A 5JOPE 5TGBA 3VXMB 1A7RH 3GIVB 3V0VA 1QR1B 5FYLD 2I9TA 3HZKB 5TJWK 5ITBL 2EDEA 3BDBA 3X12B 4NHUA 2X4SA 1KCVL 3Q5TA 5J1AB 3HFMH 5LQBH 3C08H 4TVSa 3T0BA 1QLEL 4OQ1A 3OJ2C 3SPVA 4A6YH 2E8ZA 4PLKD 3WD5H 2XACC 4MZ3A 3ILQD 2CLZB 1E4XH 4F80A 1XF2A 2X05A 2J88H 3KNBA 3PIQB 1AXSA 1FGVL 3Q5YA 4XPGH 3DYPA 3VD5A 1WJ3A 1QSEB 3B83A 4MJ6B 5CEXA 1V5JA 3I6GB 1JCKA 3U7YL 1JGEB 5HI3D 5J13C 4L4VD 1HHGB 4PJGF 4Y19D 1LO5A 5INDA 2J6EA 1IKFH 3ZLQC 4MNGB 3D69B 4R8WH 2GUOA 4XCFH 2EYSA 3TV3H 5F1IA 2ED8A 3U1SH 1XCQA 4B7IA 5D1QB 1CR9L 3OKYA 1GC1C 1I1FB 4MDIA 3RIAF 1NJ9A 3CXHJ 5DD5H 1QSFA 4XGZB 4WWKB 5ERWA 4PTUA 4M62L 1M4KA 1FBIH 2Y6SC 2L4OA 3BVNA 5DZLA 1DUYB 4XHQA 2DQTH 2FB4H 1IAKB 3EYQC 4JZJA 3Q0HA 1Z0MA 3L3IB 2FX8L 5EBMA 5GGQH 5F9JB 3LQZA 1A0QL 2D03L 5E1AA 4WW2C 4FS0A 5K93A 3QQ4A 3E6HA 1K8IB 4ZTPH 3DX7B 4UNVA 4ZYKB 1F4YH 2DLHA 2RHEA 5ACMA 3TO4D 3C60A 2R1XB 4ZO8A 2GI7A 3WKNA 4FQJH 1QRKA 2ED9A 1NFDF 1W72B 3GK8L 3HG1B 5IFAH 1NMCB 4LCUA 4U1MA 2OTWA 1BFTA 2GIYA 4N9GB 1B0RB 4ODTH 1OP3K 1GGCL 1U8PA 3TO2B 4PRDB 1F45A 1BFOA 1N64H 4HXBH 4UQ2B 4EN3D 4GBXC 3CH1A 3SDDD 3VXNA 5F7MC 3G6DH 3EYUH 4NRXA 3BE1H 2I5YL 4O02H 4P4KD 3RVWC 4XRCA 1N5AA 2YD5A 2IANA 4QYOB 4FQLH 3ZDZE 2DIBA 4IOFD 5D1XA 5C9JB 4YC2C 3SCMA 1G7IA 1HZHH 3B9AA 1HI6A 1AGFB 3RNKB 3FRUB 4MS8C 1CS6A 1OT1A 1UG9A 1AO7A 2W1NA 1IGML 1ZEAH 4S1DD 4K3DL 1LGVA 1A3QA 4WDIB 1YEFL 3SDXE 3K8KA 1XCTA 1ZA3A 4QY8A 4N1HB 3M17A 2NXYC 3TA3A 4HGMA 5BZDB 4ELKB 2ZJSL 4MB5A 4U7KA 3SE3C 1GHFL 2J12B 1KIUA 3EOYG 4PRPE 3TNNA 1WAAA 3SO3C 3C6SB 4DFIA 4LAQL 1AE6L 1FNHA 4HFWA 3K0WA 4R26L 1JPFA 5ITBH 1FDLL 1A1MB 2AKRB 4Q0XL 5K9OA 4KRLB 4X80H 1LP9F 4LSQH 4HUWA 2E7LC 3WHXA 5GZOC 3BJLA 4Y5VC 4Z78B 2R56L 4NWUH 1MJUH 4Y8DC 3BSZL 4PJIA 5E5UB 1KACB 3K80A 4QEGA 2HFEB 2KH2B 2W0FA 1EO8L 5GRVK 3REWA 4H1LH 1PZ5A 4XMPL 1QLRB 4B5EA 3QDJA 4I3RH 5HHVH 1YPZF 3FQWB 3MRHB 3MOAL 4ELME 4YH6A 3JWDC 2X4QB 4LGSB 4LARL 1W0YT 2NXZC 3D39A 4JFDB 3RNQA 3HC4L 3K4ZA 3LKNA 4P9ML 4Y5YB 3O9WD 1NGZB 3MMEA 4QHNA 3ARYA 4GW5B 1HKFA 3KPQB 4LHUB 1DQJA 3AS1A 3S36H 4WVRA 2UZXB 4QKXB 4L4TE 2ADJA 1KV3A 5J9PA 3KPRA 5DHYB 4KROB 4QWWD 3MXVL 4MVBC 4HKZB 1KB9J 2PW2A 1BMGA 4R4NC 3QQ3B 3GZKA 2P5WD 2M8XA 3P9LB 2PYFA 4N90D 2X10A 3CMOL 4N9OB 2XXCB 4MX7B 3ORJA 4MCYA 3SDAD 2FX8H 1NCBH 4N0FB 2BDNH 1A0QH 2HLAA 3FQXB 3BPCB 5GJTL 4JQVC 5FF6B 4UUJA 4QGTA 1SY6L 2B7DT 1OWRM 3F7PC 2O61B 3TBWB 4TQEH 4B53A 3VGAC 1LNUA 3KLDA 2VDNL 4KRPB 3ULSB 2AXJA 3F58L 2VLRE 4OF0A 1AHWC 1HN1A 2BNRA 3KYMB 4LAJH 1IM3A 5FCSH 4FABL 2V2XA 5KW9L 1HOCA 5HGHB 4P23A 1HK6A 4W70A 3QZWB 4YJZL 3B5TA 2IPKA 3TESA 4FG6D 5D71H 5I1EL 3TN0D 2KKQA 3VCLA 5KVFL 3ARGC 4TNWK 1FLTX 4APQA 4X9BA 3BXNB 2YD4A 4FN0A 2HRPH 3RZCD 5IW1B 4RRPG 1GH7A 2J5LB 3SGJA 2XWBA 4JKWA 2I5YH 4Z5RA 4PV9A 5DRXB 4P2RB 1CFVL 4LCWB 1C08B 4CVXA 3HMXL 2WWKO 1JYVA 3GFUA 4NN7B 2OTUB 1I3RA 2F8VA 1RQ5A 4JRYB 3UTZB 2D7MA 1LK2B 4GG6E 3EO0B 4KK6C 4RGNC 5IJKC 4YDLC 5TQ2L 5JNYB 2D31B 2WZPD 5AAMA 1IGMH 4HMDA 1MCHA 2VXUL 4K3DH 4JFFA 5FDWA 3O4OC 5JPNA 3L1OH 1QNZH 3UTQB 5D6DA 3ARXA 5EUOE 2P8PA 2X9WA 4X99B 3K4AA 2COQA 1UJ3A 1RFDL 5GISL 1AH1A 4Y2DB 2ZCLL 4N1EA 1P53A 4OCWL 3QRGH 2C3VB 3S5LA 4L8BA 3ARRA 1OAZH 1CD1A 3LRSB 4IOIB 3V0WL 2NY4D 4MAYB 1AE6H 3T3MF 3T0EB 4CMMB 1ORSA 4R26H 5IESL 4MNQE 4EUPH 1BJ8A 3GSRA 4FXGB 4LHJB 2XKNB 2JIXB 2WIIB 3G5VA 4U0QB 4A6YB 1D9KD 1HSBB 1I7TA 2A6KB 5DWUL 2R56H 1SQ2N 3HAEB 4MXWL 3ZTJH 4UI2A 3NCYS 4K7FA 1A3RH 2ZZUT 5IHUH 1EIBA 3AS0A 4GS7C 1CFTB 1H8SA 1S78D 3ARDD 1PX4A 5C0JB 5TQ0L 2VB5A 4KPHL 4WO4A 1D6VL 3MRNB 3QISA 4MA8H 5I19H 3SBWA 1S8DB 3X17A 3QXAB 2WBJB 2AK4D 1IAIL 4LARH 5GRUL 3V5HA 4QRRA 3HC4H 5LGJA 1K5NA 4P46C 3GMLB 4P9MH 1KCUL 3G5XB 5DD0L 1S9VA 3OXSB 1QSVA 1WTLA 5E8NA 3KR3L 4DN3L 1DE4A 1M6OB 4AMKL 5GQBA 3UJIL 2HFGL 3UTTD 3VXME 4LNRA 3O2DA 5DQ9B 1VADB 3GMOB 1YUHA 2YZ8A 4JR9L 4J3OC 4NO5A 5CD3A 2A73B 1OW0A 1MCLA 1FGNL 3MXVH 3EDFA 3UTOA 2G75A 4YHML 3MRLA 4BZ1L 1C1EL 3EO1A 5ACLA 1RUAH 2E6QA 1W0WA 2IAMB 2ADIB 4LLDB 3HZYA 3U9UB 3NFSH 3CMOH 5KVGL 2RR3A 5F7LB 3WFBL 4FFYH 4G8GD 4JE4B 1D5BA 4WV1C 5HHXL 3T1FA 4BELD 2AJYL 2YD2A 4I18A 1AGCA 1F90L 2R1WB 1YY9C 2ATKA 3QUYD 1J05B 1ERNA 3MRFB 2CR3A 1IGJB 3KPOA 4P9HL 1QSEE 5I1JL 4V1DB 1KEML 4ZXBD 1BVKB 4HIHB 3WJJC 3GSXA 5C86A 1YEKL 2SEBA 2D9QB 3BZ4A 5F8QC 4L3AA 2VDNH 2D7NA 3DARA 4FABH 1BFSA 2ZUVA 4MNGE 4CL7A 4NUJA 1U8IB 3WDHA 5I1GH 4R7NB 3W9EA 4WUUA 3VI3F 4QRSA 3HR5A 2O26U 4JHWL 1FE8L 2QSCL 5I1EH 5H37G 5LAXA 5C0DB 2XNAB 1W0VB 1UM6L 4Z7QE 5TE6L 2C5DC 2R8SL 2W65A 1KPVB 1XGUB 1J0KA 1XF3B 4HKBA 3SN6N 3WNMA 4YZFF 1IC7L 2X4OB 5DFVC 2H32A 2YPVL 1CFVH 3HMXH 3PNWB 4F33B 3PGDA 4PREA 1JV5A 4HPYH 1R5WB 2DLEA 4XWOC 4BZYA 3L95A 1J88A 3NH7H 3VGGA 5A40E 5TQ2H 3WIHH 3STZB 3ZL4H 2JB5H 4XVJL 2C9AA 2YC1A 1IAOB 2B4CL 4PRBB 3G6AB 1LEIA 3PJSB 4PJIF 3VFSA 3QNXA 1S3KL 1ZT7A 2ATPB 3V5DB 1RFDH 5GISH 5ICZB 4YPGA 3L3HA 3I9GH 2ZCLH 2PKDA 3QI9D 4LPVA 5GS1C 5JLZB 3ZT6A 1PYWA 1MNUL 3HG1E 3GSQA 4YHIA 3QDGD 3QCUL 5EFIB 3V0WH 4F7CB 1N3NA 4P57A 1AFVH 4RWHA 5L8KB 5MEQB 3BGFB 4HBCH 1I1AA 4F9PA 1XEDA 1TVDA 3NCFB 4I77H 1UH2A 5C08A 1V8HA 1JGLL 5JOFA 4XVSH 1TXKA 2XFXB 5DWUH 4WHTB 2ZOKB 4IRSB 1MVUA 4X8XA 4P49A 3NCJL 3FN9A 2VUYA 4H1LB 4JHAL 4J7RA 2ESVA 5DO2D 4U7SA 1AKJB 3C8DA 3HE6D 4OLUH 2C7UA 32C2B 3BKML 5DS8A 1D6VH 1RK1B 3VXRB 4HCRL 3K8LA 4RGNE 4XMLL 3BP6B 3FT2B 3R0MA 1IAIH 3GSNA 1BM3L 3OV6A 2J8UA 3STBA 3O2VH 3O6FC 3F7VB 5F7FA 1EFXD 3KR3H 1OAKL 4DN3H 3MRJB 4M00A 1JWMA 3S98A 2DM3A 1UM4H 3QUZD 1GZPB 2E7CA 2CO7B 3IFOB 5CEZE 2FR4A 3D85B 3KJ4B 3RI5F 3FRPA 3QAZB 3O11A 4OV6F 4YHMH 3UBXB 4HDIA 4BZ1H 1C1EH 4J4PC 2A9ML 5KVGH 5IWLA 3DMMC 5GGVL 2B1HH 4NZUL 1NAKH 4ZFZB 5HHXH 4TNVK 3IJYB 4IMKA 4OF5A 1IQWH 4NJ9H 3BEVB 1ZLWK 3FTGB 1DQDL 1JRHL 5DI8B 1KEMH 1IGYB 3RHWF 1YEKH 1EV2E 3OHXA 4XAKD 3KPSB 4KJWD 3I6LD 4DCQB 2WUBL 5EORH 1F4WL 4BH7A 1HWGB 1U3ZA 1WQVT 1ZXQA 4JFDE 1V05A 4MSWA 5B3NA 2XQYG 3QEGL 3MJ7A 4U6VH 1FE8H 4LCCA 2ZKHH 4N8PA 3DO7A 1F8TL 1LDPL 5IV2B 5EOTA 1FVCB 1LE9A 3LH2L 3O4LB 1TZHB 4LF3B 4WNQA 4Q97A 4D0DB 3JWNC 2VDRL 4NDMA 5CUSL 4OQTA 3BKJH 4PLJC 4RGMC 5SX4H 4XZUA 4LLWB 3QUKA 1A6TB 3MV9E 3RWFA 4UV7L 6CGTA 1U8OB 3MLWL 1H5BB 1FCGA 1H9VA 3L5HA 5F88A 3KS0H 3BN9C 2AJUL 5AUMA 3IB4A 4KRNA 2IH3B 4DVBA 4P0DA 5J3HD 4BUGA 3VXQB 4XVJH 3MRDB 4EI6B 3MLYL 5EU4A 5IB4A 5BXFB 4W81A 3D6GA 5I74B 2FEDD 3RVXD 3TZVC 4Z8FL 3LV3B 2CR6A 4EI5A 2EO1A 1U8QB 1CDGA 1FV1A 3LN9A 4KY1H 2EXWC 3MGOA 3KYAA 4G8FB 4RX4D 4DTGL 4EUPB 1DBJL 1GGYA 1MEXL 5JR1H 3QG6A 2VL5B 3SDCB 2I07B 3RA7L 4K23H 5GGRB 3IDJA 3SKOA 2Y36L 4Y8AA 3UTSD 1FFPB 1JGLH 1EHNA 1KCSH 3KXFE 5T1LA 3ARWA 43C9A 3PWPB 1SYSB 3H42L 4C55A 4P2RE 5A2LH 1I85A 2JJSA 4JRYE 4KVCL 4OLWL 4H25B 4HJGB 3ULUH 1KXQE 1XR8A 5EU6A 3BPOC 1NC2D 4GAYA 1DQQA 4NPYA 1IZJA 3BKMH 1AIFA 4JO3H 1AGEB 3BIKA 2K1MA 3LKSA 1OLLA 4XWGL 4OLYH 2JK5B 3VXOB 5B39B 4PRAA 4CVZA 5ETUA 4R7DA 2IEPA 1T5WB 1KGCD 4IEFB 1YYLL 1XH3A 5IROA 3QHFL 1CG9A 4ODBD 1KEGL 4OZGF 4X4ME 3Q48A 1CXFA 2GJZB 4R96B 2A83B 3GI8L 4LLMB 5BS0A 3QRFM 5SV3A 5DJAB 1N5YL 1EEYA 2Z8RA 5JW3H 2RB8A 3VRJA 1CWVA 1CLYL 2C3GA 3NFPA 4GRMA 2J6EL 1U58B 1X7QA 1BOYA 4NQCA 4QRTA 3WIIL 4PJFA 3MJ9A 2PTTA 3MLXL 2A9MH 1X5AA 2P5EA 4HWUA 3BZFA 2ZSWA 5BO1L 2X4NA 2EDLA 5DQJB 1TETL 1CICD 2V5TA 5E2VL 4TOYH 3B5GA 2DLIA 3RDTC 1E4WH 1BBDL 4LASH 1JRHH 1OY3B 2YPKB 1I8KA 1S9YA 5KTEL 3VFPB 3FQTB 4ORGA 2X42A 1K8DB 2NY0C 3DJ9A 2FSEA 4H20L 1BBJA 3LMJL 3N1PC 5I75C 3PWNB 3QEGH 1N2RA 3ETBF 4EBQL 1A47A 1KNOA 4GMSH 4EEEA 5AD0B 4WFFD 5GSRA 1FL3A 5KSUB 1FORL 1JWSB 1F8TH 4DEPB 3G9AB 1JNNH 4CUCA 2EE6A 3LH2H 4NC1E 4U1SB 3ZHKA 1FL5B 5DD6A 3WSQH 4OCXL 1GPOH 1QVOA 5CUSH 5KVMC 4NKDB 3IVKB 4C4KT 1AP2B 3RWEA 3QDHA 1MLCB 4UV7H 1QO3A 4Z7UA 4JGUA 3MLSH 2JE8A 5B38B 5BJTA 2EC8A 4NRYA 1P4LB 4JJHA 3S4SA 2Y7QA 3DRQA 5D7LB 3ULVF 1F3JB 1E6JH 4N0UA 2FLBT 3L7EB 4Z7OF 4V1DE 1EEQA 1EJ6A 1CQKA 3DX8A 3P77B 1KN2H 5C6TH 3LKOA 5JHDA 1YY8A 4GKNB 4PJDF 1PQZB 1JHTB 5EU5B 1FG2A 3FB6B 5MEPB 1NKOA 4Z8FH 8CGTA 3VRIB 4YDJA 3MYJB 3ALPA 4M1CD 4NKIH 1JZ4A 3CX5K 1VFUA 3RX7A 4IRJC 4LHUG 2GFBB 3OX8B 5GS0L 1DBJH 5DVMA 1KCLA 4KKLC 4X83A 1DBML 5I9QB 5JIIA 1SHMA 3QDAA 2QADD 2Y36H 1TQBC 3L3GA 1WFNA 3V8CA 3RWGB 2J8UF 1YMMB 2APVA 2VAJA 1I7ZA 3H42H 1ZE3C 3F7YA 4WU5A 3MQIA 4Q6IA 4CADB 5HGBB 1MI5B 4AEIH 5IT2H 4HH9B 2VDLH 4QRQB 3TBYA 5EOCJ 5FM5O 3FJTA 3WUWG 4HGKC 5EN2B 5BRZA 1IGTA 3NZ8B 2NY1D 5IQ9B 3PL6C 4X4XA 4JREB 2Y9RT 5GHWL 3VFOB 2XPGA 1UENA 3P4NA 3HZVB 1G7QB 1VEOA 3LSOB 3C8HA 4S0TD 2CDFB 3O8XB 2H45A 1I9RH 3IJSA 2MFNA 3TF7C 1YYLH 2P1YA 4D9QE 1HQRA 1ZLVK 1D6EB 4FRWA 3IRZA 2HVKB 4R90L 3QZWG 4P5KB 4E41A 1P4BH 4DGIL 3RIAK 3GI8H 5D4QA 5IM7B 1VFBA 2DM7A 1IBGL 4X6DA 1OP3H 2X9XA 3RBGA 3BT2L 5F6HI 1RIUH 3FFDA 4QOKB 4YO0B 4KI5C 5LWYL 4I9WE 3F65A 1GXE