3UX9B

Structural insights into a human anti-ifn antibody exerting therapeutic potential for systemic lupus erythematosus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
251
structure length
229
Chain Sequence
b'IVLTQPPSVSGAPGQRVTISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCQVRDNNENEWVFGGGTKLTVLEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYIDFGDHMDFWGQGTLVTVSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon alpha-1/13
publication title Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 54
structure length 229
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B01
1PQZB 2VE6B 1FNAA 3IDUA 3MRGA 1EBPA 3I02A 3EJYD 1NEZA 2NY4C 4FRWA 2V5YA 1RJCA 5KN5A 3QEQD 3MRLB 5DJ2A 1X9QA 1F6AB 3T77A 4GKNB 2V2XB 1I3GL 3G6DH 5DEGA 1ZT4A 4PJAB 5D1XC 1CD1B 2IAMB 1A6PA 1D9KC 2VZUA 4OI8A 4M6MH 2ERJC 5D8JH 2D0FA 4I5BA 1BFVL 1FP5A 1XCTA 1MNUH 5JPNA 2QQNL 1NH6A 2M8XA 4G9FE 1BX2A 4NN5B 5IMMA 3X12B 1U6AL 2C4FU 3T1FB 2HT3C 3QIBA 1A6VH 2A0LD 4JE4B 2NLJA 4QHUA 4NRZA 3BP5A 4O51B 1ZSDB 1K4DB 4ZS7H 4CUCA 1KGCD 4GAYA 4J6RH 1MI5E 3LDBC 1YY8A 3P77B 2DM7A 4U7KA 5LGJB 4Y4KB 3HR5A 5C07B 1RSFA 5EUOF 2WBJB 4LDLB 5E6IC 1QKZH 3ZDZE 4LLDB 3VDAA 2R29L 1DN0A 1NC4B 4MD0B 5DEFB 1HHJB 1U93B 5ITBL 5JZ7C 4XBPB 4RMUA 5FFLA 3T0AA 4GUPA 4NN6C 3RTQA 3QI9B 2J1KA 3X3FH 5DRWB 3VA2C 5C6TL 1QSEA 5DHYA 1OQOA 1MHCB 5JOFA 1WTGT 5CBEA 1A0QL 4IIQB 4LCCB 4GG6B 3P40A 4PY7A 4QYOA 3T0WA 5GSVB 6FABH 4P3WA 2MKWA 4XPTL 1IEAB 4K55A 1MCQA 3MJ8A 2P7TA 4KDTC 2EE2A 1MHPL 2J8UE 5E8NA 4Z76B 4YQXL 4ZO8A 3X11A 4X98B 4LLQB 4PJEB 1JHKL 4IRJA 5C9KA 3EZJB 2VDOL 3GSVB 1UCTA 2A6JA 3GSQB 5GRUH 3V7AE 5HGHA 4XMKL 5CAYB 1NAML 2OR9L 4Z78B 5J6HA 3VG0L 2Z31A 4LGSB 5DMGD 1PSKH 1E4WH 2ID5A 5DC9B 5BMFL 3QUKA 4Z77A 3DROB 5BS0E 5GRZA 2DKUA 5LAXA 1S7WB 4IOIA 1KXQE 4ELMA 3S7GA 2IADB 4OFDA 5C86A 5I75B 3CSYB 2XFXB 4P59L 2DQJL 3G5VA 5KVFH 1CICB 4XMLL 5GGTL 2DI9A 1J1XH 4Q2ZA 3DV6B 1QFOA 3DETD 2UVFA 2Z91A 32C2B 1AJ7H 1P7KB 1XGYH 3STBA 4LKCA 4OD3H 3MNWA 4Y2DB 5H94A 3OKLB 3UTSD 3Q5YA 5I30H 1S7TA 3DGCR 1DUZB 4JLRA 2BSSB 5CEXB 3TCLA 1FZJA 1S8DA 3L3GA 4WI7A 2UZYB 4MA8L 1CLOL 2BNUB 1KB5H 5LBSH 3V9FA 4FQXD 1IGIL 5JTWA 3MNZB 1A22B 2YUVA 3U9PH 1KNOA 4YXLL 5C6WH 2XWJB 3WJLC 4NFCA 4QCIB 3DARA 4LFHG 1RK0B 1EFXD 2NNAB 4P2RB 3DHJA 3ROOB 4HEME 4MVBC 5KANI 2RBLA 4X6DE 5EZOL 4XXDB 3FQXB 5B39G 2FBJL 2FO1A 4ORGA 1UB6A 4WHYG 2VLLB 4HG4K 3SJVD 3MA7A 4OLWL 4UBDD 2X9YA 4ZUSA 5IG7B 1DE4B 1NCCH 1NGWB 4EQ2A 4E42A 4RWHA 3P0GB 2RFXA 4KROB 3OAZH 1FFQA 3U9UA 4YNYB 4Z7OF 4CVXB 5JXED 1AGBB 2Y7QA 3VXRA 3IF1B 1E27B 3SBWA 1NAKL 3EO1B 5SWSE 2ITCA 1JJUA 2E7BA 5TJWK 4OZIB 1MOEA 5CJXA 3D1MC 2VXSL 4QTHB 1QFWL 3I2CH 4PJIB 1S9YB 4WFGE 3L3KB 2FJFA 3PWLB 4FFZH 3I50H 2FSEA 4KMLB 2D4FA 3NN8A 4HW6A 4NBXB 4NGHL 4G8GE 4F8QA 4GMTL 2A74B 1JGLL 4JO3L 2EDRA 3O9WC 1W72A 5DD1L 5DJ6A 3BGMB 1I7TB 3JUYA 3RKDD 3W0WD 1AHWC 3BD4A 5DT1L 5L9DL 4TRPH 2F19H 1AQDA 5GIRA 2HMID 4CMMB 5IMOB 3EUUA 3NABL 5ANME 1QLFA 4Y89A 2OTUA 2R1XB 2VDML 4PP1C 1OSZA 5EFIA 1FZMA 2WIMA 4NUGH 1ZT7B 3MLWH 3UTTB 1UXSB 4G80A 1MCBA 4O2CA 1KSRA 5HHPB 5HHQA 1RMFL 2PTTB 2D7TH 3ZE0F 2QL1A 5CD5C 2D31B 5BW7C 2E27H 5ISZA 5HYQA 2CMRH 3ZMRA 4JRWA 5CJQH 5J1TC 5DMKB 3QFJB 3TN0C 2CDGA 4YFDB 4AT6A 5E08L 4PV9A 3GJFH 4L3EE 1ITBB 1XF3B 3DYMA 5F3BA 3I85A 4Y4HB 1IM3A 1UB5A 3O4LB 4NIKB 3ZSTA 1GVIA 1YNKH 2CIIA 3IYLW 1B88A 1U8HB 1NMCC 3VXNB 4CJ0A 4XTRC 1U8QA 4YWGL 4UT7L 1BP3B 3RWIA 1ZLWH 3NPZB 3RZCD 2UWEE 1I3GH 5CMAB 4P2YA 2R0LL 1OAQL 5KSUA 5I1CL 1I85A 4I18C 4Z7NE 4WTWA 5ADPL 3CFBA 4OQTA 2G75A 4G8FA 1BFVH 1F90L 3O4OB 3QBTB 5TE7H 4Y16A 4ZOBA 3VD7A 1U6AH 2X4UA 2X7LB 4JHZA 4OZFB 5I2IA 2CK2A 4KQ4L 1EO7A 3S3SA 2AP2A 4Y4FB 4M6AA 4PJ7E 3RJQB 1QLRB 3N9GH 4LIQL 5C2UB 1U8IA 4D0BB 2AJYL 3AAZA 4F9PA 1B0WA 1IBGL 1FIGH 1OGTA 4GXUM 3N1QC 5I74B 1M6OA 3KPQB 4Y1AB 2BSRA 4XB8A 4NM8L 1IAIL 5EU6E 1RFDH 4XVTH 3IFPA 4JN1H 2DYPD 2HLFC 2FIRT 4RWYL 1KIPA 5DJ8B 5DD6B 2HTKD 1B3JA 4G8EB 3MV7D 3FRUA 2W07A 3VXQB 2A6DA 4R4FL 3EO9L 4PG2A 1AI1L 2X89A 1A3RH 2ZG3A 3U4AA 5AUMB 1H3WM 3RVXD 3G9VA 2BVOB 1ZS8B 2HLAB 3EJZD 4NC0B 3IKKA 1GOHA 2H8PB 5BV7B 5C6TH 1M71B 2VDKL 5DO2C 5GISH 1JZ8A 2C3VB 2HN7A 3KPSB 5EU4B 3QR2A 3CIQA 5LVEA 1A0QH 2CDEB 4HFUL 4NHUB 4EN3B 4M5ZH 4JFZH 2D0HA 1P84J 4UOW0 1OAXL 5IBTH 3LKOB 5D5MA 2BOBB 1D5BB 1U2HA 1RUQH 4DN3L 4P2CG 2FRGP 4PJDE 3QIWD 3VRLF 3MMEA 4YQXH 4Z7WB 5ESQB 1LHZA 4P48A 1JHKH 2A9NL 1CFQA 1X6NA 5E8PB 2JE8A 1A4KB 5JW4M 5I1DA 3PDDA 2VZOA 5E0QA 4BSWB 5KSAB 4JN2A 1FFOB 1HYSD 4O00A 4OZGE 1A1OB 1MIEH 2NXYB 1FCGA 1NAMH 2OR9H 4M93C 5D1ZA 3VG0H 2ITDB 1CFSB 5IGXH 4OGAC 5EOQH 4EDXA 5BMFH 5IEHB 3U6RB 2FEDD 5C70A 3IS0X 3SDAC 3Q6FB 3NGBC 3ROLA 3SDCB 5BXFA 1UH2A 5T1KA 4PJCE 4NNXB 4V1DA 3FO2A 1UZ8B 2YPLB 4PREA 25C8L 3N0PB 2BFVL 3H9SB 4HUWA 2RGSA 2DICA 3JV6B 3PV6B 3W82A 4F7MA 3WFBH 3QIUD 1LWRA 4JFDA 1MFDL 5D93C 4JKWA 1PYWB 4HPOL 3TFKD 4JDVA 3ARBD 4I9WD 4ODUB 2Q8AH 1FG2B 2UZIL 1JZ6A 3DXAD 5DJ0B 1XH3A 1JWUA 2ZUQB 4MDJA 3TIDA 4A2LA 4XVJH 5JDSB 4M03A 4S2SA 3I75A 5I8EB 1CFBA 1TZIA 2F54E 1T04B 1I7UA 5D7LE 1VKXB 3CCHA 3IVKB 4BZYA 3FO1A 5T3XD 4MA8H 4HS3A 4HWBH 4HIEB 5LKNA 1NFIB 4CW1B 5D4QA 3MA9H 4QRUB 4BK4A 4QHNA 2GT9B 1MCPL 3VXPB 4PGBB 4I0PD 3BN3B 4LNVA 3MUGA 2ADJA 2AK4A 3VXSB 3BKJL 4GAJL 1EDQA 4MX7B 1ZEAL 2Y72A 1V5JA 3BWAB 5H2BB 1IL1A 1BVKB 3KJ4B 3FFCE 1SJHA 5EZOH 1EXUA 1R5WA 1BQSA 2FBJH 3ZL4H 4E5XA 1DVFB 3QDJD 7FABL 1JNNL 3V0AC 4LU5H 4OLWH 4U0QB 1Y6KR 3CXHJ 5KG9A 4HUNB 1NC2D 3ZDZF 4NQEA 4GG8B 2A73A 4L3CB 3V7AG 5HI5D 4OB5L 1HXYB 1IGTA 1UJ3C 5MEOA 1U3YA 1I7RB 1ZGLA 4PJ8A 3WN5C 5CIPH 2OBGA 2CPCA 2PYEE 3QUZD 4JANA 5ALBL 4F7TA 1I9IL 4LCYA 3GSOB 3LEXA 4RFEB 1IKFL 4PJ5B 4FXGA 3LKNB 1QFWH 3O2DL 3QULB 4NO0D 1CYGA 4FFWD 1G6RL 1A02N 3NTCL 2GUOB 4U33A 1MJ7H 3NCJL 5F97E 3STLA 1IM9B 4NGHH 1CK0L 1GGBL 2BNQD 3RIAK 5EUOB 4JO3H 2ATPA 1C16B 2QSCH 5IVXA 1KBGH 3MBXH 4LSQH 1YECL 3E6HA 2J8UF 3MV11 3I3EA 5L9DH 3WXWH 1GOFA 4KJPC 5CZKA 5IIEA 2XXCB 4Y19B 3WV0A 1RZ8B 5C0CA 2OK0L 4KC3B 3GMMB 1M05A 2VDMH 1NCUA 4WNQA 2B1AH 1TJHL 4BQ8A 5I73B 1NCBH 2DD8L 5DK3A 5HGAA 5EO0B 1X5KA 3MV9D 2H2SD 5LG1A 4QXUH 43C9A 3T0EB 5E08H 5T1DH 4HQQL 4HXBH 9CGTA 2VYRE 3VFPA 4N5UA 3DWTA 4WFED 1HXMA 3CPLB 1MQKL 1A9BB 4YWGH 4UT7H 4FZEL 2CH8A 2JJSC 3FRPA 4JPIA 2X4PB 3BZ4A 3PHSA 2J5LC 2R0LH 1OAQH 3AU1B 3LRGA 4AEHL 3VI4E 5F88A 5TDPA 4MCZB 3GEWB 4X8JB 4TOYH 5FKAA 3DMMA 4QRRD 3U7AA 3ARDD 2W1NA 4V2BA 2A83A 5ADPH 1WT5A 1L7IH 1OTTD 2EXYC 1F90H 1G1YA 1I8IB 3OSKA 2ZOLA 3SGDI 5TF0A 5I8CA 4P46B 1QA9A 3ALPA 4PJXA 1EEYA 2FJHB 4MS8C 5J11C 5DSCA 3O11B 4KV5E 2PW2A 5IMLA 1RIHH 3QXDB 1U3HC 3HZKA 1MFBL 3KDMA 2AJYH 3L6FB 3LD8C 4KY1L 1YNTA 2PW1A 4FQ1L 4ZOEA 1IAIH 4MNQD 4NC2B 3BH9A 3F7RA 4X6DF 3U46A 4ELKB 3G08A 2Z93B 4MZ2A 4NPYA 4L4TA 3ETBF 4LLVA 3DRTB 2Y23A 2BXZA 3HZVA 4WWKA 1AI1H 4NUJA 4NP4H 3AMLA 1RULL 4YHYC 1HIML 2BP3A 1YN6B 5GSRA 2VDKH 4ZDHB 5JPMB 5INCA 5FDYA 1JZ3A 4HFUH 2DQIH 2EYSA 3IFOB 1K6QL 3B2UD 1OAXH 1P7HL 4AZ8A 5MEQB 3TIEA 5E56A 4LF3A 4DN3H 4OJFL 2IPKA 1BBJA 2F8XC 2WMPA 3VFVB 4MJ5A 1ZHNA 4MQXD 2GTWA 3KLHC 1CDBA 2VLRB 1A8JH 3N85H 5CLWA 4M1DL 2DKSA 3QEGH 6CGTA 3GMOB 1BF2A 3K7UA 4OGXL 5TPWH 1CXHA 1OLZA 5A2IH 2A1WL 2VR4A 4JR9L 4DEPB 4GQPH 2YWZA 2IBBA 3TZVD 1H15B 4JCLA 4M9PA 5I0DA 1UWGL 2VQTA 5C9JB 3SKOB 3VWJB 4RISL 4AYFA 4GRLA 1C7SA 5FM5M 4NQCA 3LV3A 3ZHKA 5D7JA 1EK3A 5HY9A 3RX8A 3MGOA 2NY6D 3MRDB 1FVDB 1UENA 5CHNB 2APWA 4HPOH 4K9EC 2OSLA 4N0FA 3SGJA 3CFIC 1LP9A 1AGEB 2UZIH 4ZFZA 1X5FA 5B39B 5IR1A 4WO4A 2DQHL 3QUYB 5E8OB 1EGJA 4K2UL 3ARYA 1D5XA 3BZDA 2UWEF 4F58L 3O6LH 4RBPH 4IMKA 2O26U 5I71B 4HGWB 4Z7NF 4L8SA 4KRPC 4IMLB 1KLGB 2CLZA 1G1CA 3AREB 4R7DB 1CBVL 5GGRA 3VWKB 2GAZA 4H88H 4CVUA 3QA3B 4NZTL 1GZQA 5EZLB 5EH1A 1MCPH 5JNYA 4DGVH 1QSFB 3HI5H 2XXMB 3BKJH 4GAJH 3OAYH 2XTJD 3V5DB 1ZEAH 3VXRE 2B20A 1LO0L 4PJ7F 3QUXB 2IH1A 2MMXA 4DW2L 4GW4B 3TT1L 3EOBA 5DD5L 3ZT6A 1KT2A 2PO6A 1U8JB 5I19H 3PL6C 3C5SA 1J1OL 3TNMB 1NCAL 4Q6IB 2NXZB 1UH4A 5EZJB 1DEEA 2IMMA 2ICWJ 3D9AH 4N0RA 2ZKHH 2YS4A 1IAMA 3QFDB 5JW5B 3DETC 4OB5H 4AH2A 1ZKAA 4YDLB 2WBJD 4ZSOA 3QQ3B 1XR8A 2VUOA 2DTML 4NRXB 3MLXL 2DQDL 4UDTB 5H8DA 3JWDC 5ALBH 3H9HB 4K3DL 1BQUA 2ADIB 1IKFH 4QRTB 1OTUD 2FLBT 1MCIA 1MQ8A 3NTCH 2CGRL 1LQSR 3KPOB 1DTUA 1TCRA 1JPFA 1CK0H 2DBJA 3TCXA 1GGBH 5I1AB 3MREB 3MJ9A 4M1GH 1DQQA 4MA3B 1IGFL 3QNZB 3AMKA 1MHEA 3ILQC 4YX2H 4KH2A 4OD1H 1MAML 3W39B 1BOGB 3QH3B 3O45A 5ISZE 2CR3A 1YECH 2WINB 1FNEB 4I77H 4PJDF 1YEHH 3QEUA 2HH0H 4OLUL 1F4XH 1YQVL 3M07A 3IGAB 4HZAA 2OK0H 1WICA 5J6GB 1M7DA 4IDJL 5JW4N 3PP4L 3KNBA 5DK2A 4OZGF 8FABB 1NFDE 1D5MA 4H1LH 5JXEC 3HPJA 5GGTA 4LRIA 1Q9KB 1RUML 4Y5XB 1Q9LA 1ZLSH 4NQDD 2GCYA 4QHLB 4UZGA 4PJCF 1L7TH 3LKSB 4YH6A 4HV8A 5IEKA 1C1EL 3ELAT 2AABL 1QRNA 4JHWL 1A1NA 2RCSL 3N1MC 3MGAA 2AK1H 2Q76B 2NY1B 1OF2B 2X70A 3HZMA 4LVHB 4WW2F 5D96B 1OAUH 4JQVC 4F7CA 4S1RH 5DJAB 4GRLC 3HAEA 3WNOA 5ICZA 1MCCA 1T1XB 3JTTA 4JHBA 2CIKB 2FH6A 1J1PH 3LKPB 3HE7B 3NPSC 3VRJA 3D69B 5E2UL 3QDAA 3IJHA 1OW0A 4AEHH 5EU5B 1WFOA 5IHBA 5J57B 3CLEL 3O81A 1SBSL 3FOMA 3RKDC 2E5EA 2P43B 2CXGA 4EUPA 1LO4L 3K0WA 4LPWA 1OT1A 2LTQB 3HPLB 1OSPH 1FFNA 4X9GA 5D9SB 1FYTD 2ZCHL 3VH8G 5I1LA 1N6UA 4I3GA 4U49A 5DYOB 3MRNA 3T8XA 4TSAL 3MRPB 4JO1L 4XP9H 5IUSA 1F97A 3O8XC 3Q0HA 1JPTH 2XQYG 3RWJA 5IVOA 4XPAL 1IGYA 1I1AB 3TYFA 2B5IB 3CC5A 5FYLD 1UXWA 3HG1B 4YEFA 5F72S 1DBKH 4MDIB 1CXLA 2AV1B 4FQ1H 3MJ7A 5FIEA 4LEXH 4QXTA 1IKNA 12E8H 3AS3A 5IMKB 4ZO6A 1PZ5A 3BPCB 3EOAA 3VFOA 3MOQA 4IRZL 5ID1A 3P4NB 4YHKH 4HBQA 4K9EL 3HRZB 4FS0A 4LSUL 3QDMD 5I1HL 4P2RD 1NEZG 4U2YA 3T2OA 5D5ME 5DTFA 5HGBA 2ZNXA 1X4XA 1HCVA 4NO3B 1XIWA 2X1WL 2NW3B 1QNZL 4DZ8B 5J0BA 2FYYA 3TPUB 4GAFB 4QT5A 3RBSA 5E1AA 4KROD 2VDQL 1P7QB 1GXEA 2ZSWA 1DUYA 2V2WB 3BUYB 4OQTH 1HOCB 4CNIA 1LEIA 3REWB 1PKQE 2GSGB 4ONOA 3DVGA 1JTTA 2Y06L 2O61B 2HFEB 1TJIL 1WBXA 3MLRH 4OJFH 3EGSB 1MI5B 2EDBA 1G0YR 3BIAX 3BP6A 5A2FA 5BVPL 2HRLA 2ENSA 1AD9B 1V7NL 3RGVB 2Z4QA 4JM2F 5F7EL 5DJXA 1MIML 3NFSL 1Z6JT 5KVGL 1WCQA 1WBYB 3EYUH 4M1DH 4U3XA 4WIQA 4X4XB 3GKWL 4JFDE 4OGXH 1DZBA 2HT4D 2Q7YA 4XVSL 3MRBA 3C60C 1FFPA 4JR9H 4F7PB 3AUVA 3EJZC 2VO5A 3KYOB 4OCNC 2IH3B 2W9DL 3D6GA 1B4JL 1AO7A 3JWDL 4E9LA 5HPOA 3TO4D 3UTTD 1INDL 4X5XB 4U1GB 1VGKA 3ARFC 3PJSA 3LQZA 3BRFA 1LO3L 3FN3A 1U8MA 1T7ZA 2X40A 4YJZL 4OQ1A 1AP2A 2J8UB 3FFDB 1R3JB 3SDDB 4EI5B 3IDJB 3KPLA 5JLZA 3HE6B 3MGTA 2EYRA 5IF0B 2LQRA 1SJXA 3VI4F 2R9HD 3P9LA 3L7FA 1OW0C 4P5TB 1JE6A 1WWAX 3RWGA 4K7PH 3EYSL 3NCFB 4C56B 1CFNA 5KZCD 2EIEA 4NZTH 1CQYA 4XXCC 4PGEA 4NQEE 2FEDC 4UILL 2R2BB 4J8RA 5BS0B 1EPFA 5GGUA 5FGRA 4KV5F 5DJZB 2NTSP 3KLAA 2BNRD 3HMWH 5D1QB 4PRPA 5HVGB 3PNWB 1UM5H 2JELL 3TT1H 5DD5H 1UM4H 2R4RL 4P4KB 3WE6A 2AJZA 1J1OH 1U8NA 4RCAA 4XRCB 4PPTA 3HNVL 3TH4T 4EI6A 2JCCA 5HHMD 3FOLB 5A2KH 2FNBA 4UQ2B 3JSSA 2X4OA 2Y36H 1F6FB 1QHOA 3QWOB 3MC0A 5CP3A 2DTMH 2NCMA 3C2SA 2D7OA 1GOGA 1WBZB 1CGWA 2IJ0C 1K3IA 3LHPL 1MLCB 1CE6A 2PTVA 3O3DB 1QBAA 5J1AB 1NCNA 1TZHA 1S7QB 3SE3A 2CGRH 1ORSB 4RGND 4D8PB 4JQXC 4GBXA 3OKKA 5D7SH 3KPSD 2BJMH 3FO0L 1IGFH 4XWOD 4QHMB 2V9TA 1RJLB 1C5BL 3P9WB 4X6DB 3CVHB 4IRSD 3RWDB 3HUJB 4FQLL 2Q87A 2OTWA 5J9PA 4OLUH 4DCQA 5IJVB 1NLDL 4AEFA 2UY6A 1GGCL 2EC8A 4OLYH 2IALB 3DUUB 1YPZA 3FQTA 5FXCH 1LEGA 4QRQB 4IDJH 2DMBA 2AJ3A 2R39A 3MODL 4Y5VB 3X14B 4H1LG 4KK6D 4K3EL 4XP5L 5F7DA 4HF5L 5SWSB 1RUMH 2NXYD 4YHOL 1CXKA 2Z92A 5FUOL 1QFUL 5SV4A 3V6OE 1R24A 1WJ3A 4XZUA 3IFNL 3RWHA 1C1EH 2NTFA 2RCSH 4X6EB 1T0NB 1VDGA 2YC1B 4MJIA 4U6YA 4G8GB 3O6FA 1S7VB 4ODTL 5J06A 1B0RA 2F74B 3O6KL 1TITA 3H9SD 2H2PD 2PYFA 5DK0A 3O6MH 5C0GB 5E2UH 2KQMA 4ZD3L 1FAIL 2FB4H 3H3PL 4JAMB 5M95B 1ACYL 2N7AA 3CLEH 4DOHE 1SBSH 4S11A 3FHQA 4A6YA 2J4WL 3EYOA 3RDTA 1LO4H 1O7SA 4MA1B 4RZCA 3VFWB 5DRZB 5ANMB 2ZCHH 3U2SA 4OZ4B 1T1YA 2F58H 4ETYA 4N8VA 5DHVB 3V6ZB 5MEND 3V8OA 4L4TE 4JO1H 3H0TB 5DC4B 4W6WB 4ONFH 4GXVH 2QSQA 4FQJL 4U3CA 4MHHG 4D9RD 2H2SC 1XR9B 4FN0A 3GI8L 1EHNA 3BZEA 2VLKA 3LEVL 5FCUH 1TCMA 3OX8A 1PQZA 3SPVB 1A1MB 3MV8D 4FOMA 3CFCL 4YHIB 1WQVT 4K9EH 1YEFL 5I1HH 1JMZA 3TVMB 3O2DA 1H3UA 2QEJA 1KJ2L 2UWEB 3SO3B 3C09C 3MYZA 1QBLL 1G6RA 4OLVL 4R2GB 1YDPB 5JW4R 4XCCH 3EYFA 1SJEB 1D6EB 5GS1C 1J5OH 3DUHA 3ESVF 2E8YA 1W8NA 1LNUB 3MO1A 4PJAA 1VADB 1OTTC 1SQ2N 4GT7A 1A9EA 4R8WL 1K5NA 5AD0A 3OQ3B 1VFAB 2HJLB 2R1WA 2EXWD 3TYGL 1QBBA 1MF2H 1RJYB 3CNKA 2DLIA 1OAKL 5FHBH 3QHFL 2HFTA 1N2RB 4RA3A 4L3AA 4PIRF 5C0DB 2C26A 3X12A 4ENED 2GJJA 4NKMA 4BSVA 4DWHA 3OHXA 1MFAH 2QKIB 4AENA 3CDFA 4JJ5B 5T33L 5EU6B 1V7NH 3QNXB 1B4RA 4KK9C 5DJCB 2K7QA 5F7EH 2Y5TA 4UV4L 1MIMH 4Y8DC 5KVGH 3DX8B 4NQCE 4D9QE 4P2OA 5ESVB 4WFHD 2LAAA 3VGFA 5I8OH 1JTOA 5HI3D 4XVSH 3FB6B 2EH8L 1HHIB 3ZKSD 2R2EB 5J12B 2YD2A 1C12A 1FVEB 4KZEL 3SKMB 2CD0A 1LP9E 4FQQB 1DDHA 1NFDF 5KOVC 4I48A 3LKRB 3JWDH 1CXIA 4NKIL 3B4NA 1ADQL 2XOTA 1SBBA 1MCNA 1G9MC 4PS4L 4YR6B 2QADB 5T3XL 4MAYA 3VGAC 4GRMA 4ZXBD 3BOVA 4N0YL 3SCMD 4BQ9A 1LO3H 3REVA 3S88H 1ES0B 3B2UC 4JJHA 1JBJA 1LE5B 5ICYA 2D7PA 4GG6A 4QOKA 4PJDB 3T0ED 2YD4A 5EN2A 4UUJA 1TQBB 4P23C 2EICA 3MRFB 1H5BA 2DMKA 3O3AA 1D6VH 3NCMA 1RVFL 2ICCA 3JZ7A 4U3HA 4Z76A 3C6SA 3OKMB 4LLQA 4OZGB 4XH2A 3MLZL 1IGJA 1BREA 3PWNA 2PXYB 4ZYKA 3H7BB 5GPRA 5K59E 1Y6NR 1FPTL 5GJTL 3BEVB 5EIQA 3TZVC 3U48A 1AXSB 3NFNB 4JO2L 1T5WB 4JFPB 4ZSOE 4P46D 1CIDA 4DKDC 2CLVA 3HCVA 4WW2B 1NUGA 2JELH 2LFGA 2BHYA 2EDTA 3C6LA 2DQEL 5K9QG 2NY6C 3HI1B 4NDMA 5IHLB 5DS8B 1CQKA 5T1LB 2X4TA 3HNVH 1T83A 3CSYA 1C5DB 4TVSa 2GK0B 4LHUD 4JRYA 5GRVK 1YNLL 4KVNH 3BH8A 3DVNB 4OD2B 3RGHA 1NEUA 5TGBA 4G6AC 5D5MF 5JOPD 1WWCA 1XEDA 2F54B 2FGWL 5D7LB 4CVWA 1NGQL 1FL3A 5TQ0L 5E9DD 4LLMB 3IT8D 3MROA 4TVPD 4KJYB 5A3ID 1K8IB 3MFFB 3IDMB 3UTQB 2H9GB 2IAMC 1T20A 2QBWA 1IGML 2EYTB 1P84K 1W8OA 3ULSB 5JW3L 1GCFA 2AVGA 3ZKMC 4RDQG 4M43L 4NN5C 1C5BH 4F57L 4QCIA 2YUZA 4P2QB 3TA3A 3WL9B 1J0ZA 3RL1B 1IE5A 3P73B 5IW1B 5BVJA 1BFSA 1NLDH 5C08A 1GGCH 1QRNE 1BD2A 1I9JL 2MNUA 3MCG1 3BUTA 3UTPE 4Y4KC 4K3EH 5IFJA 2WBJC 2DWEA 2VLRD 1Z9MA 1UVQA 3VH8B 1L0XA 1HH9B 4LCWA 5FUOH 5TF1L 3GSNB 3IF1A 1E27A 4LK4A 5C8JB 4M6OH 1BMGA 2X42A 4RAUB 4AG4L 1ZHLA 2WWKT 1HKLL 1A7PL 1JV5A 1R5IB 5EBWB 4PYGA 3QI9C 1ONQB 4AK1A 2BSTB 2PF6A 1LMKA 2RJMA 3VFMB 4E0RB 1IAOB 3L3KA 3GSXA 5HTSA 3O6KH 1KPVB 1J05A 1CWVA 4JM2B 1F3DH 3WFHA 1KYOJ 4IIQC 4RQQB 1FAIH 2W9EL 4RDQF 4LCCC 3RIFF 1ACYH 3CFDA 3OKYA 4XP6L 2J4WH 4Y88A 3MRMB 3L9RA 4K23L 4XPHL 3MRGB 1N0LA 3MJ9H 3SGKA 1I8LA 3WXVL 5AAWA 4U1KA 5A43C 1AGDA 2FEEL 1ZA6A 1F4WH 2E6PA 3I02B 1NEZB 4LSDA 1F42A 3STZB 3V79C 5HSFA 3HC4H 3O41B 5C3TA 5DR5L 3UJTL 5KN5B 1E4KC 3QUYD 5DJ2B 1A6ZB 1AY1L 1U92A 4OT1L 4KKBC 3S35L 2R56L 3T77B 3HZYA 1D7FA 5DEGB 1ZT4B 4F9LC 5C0AA 3GMNA 5CJ8A 5C2BL 2GITA 3VWKD 3GHBH 1JWSA 3GI8H 2OX5A 4WI6A 1EH9A 1G9ML 3I3DA 3BHBB 4I5BB 1XCTB 4KHXL 5JPNB 3RKPA 4LOUD 1QSFD 4XPFL 4XNQA 4K8RC 4ISVA 1BX2B 2C4FT 3TBTB 5IMMB 3CFCH 1JK8A 4X4MA 2RHEA 3QIBB 1XAUA 1YEFH 4QHUB 2NLJB 4NRZB 5D71L 5IW6A 1KJ2H 4OLVH 3BP5B 4D9LH 5I75C 2D7NA 2FHBA 2AEWA 4GAYB 2D4DA 4YHML 2NXZD 1YY8B 4U6TA 1K4CA 3ZDXE 1CICC 4XC1L 1OAZH 4TQEL 3FRPG 2X41A 2B4CC 2CKNA 2F9BT 3HR5B 4PP2A 4R8WH 3HA0A 4JRXA 3H2WA 3LQAL 1DN0B 1P6AB 4Y2OA 3CLFL 1OAKH 1NFKA 3OTTA 2HJKB 5HHOD 4WI8A 4Y2DC 4P57B 4GUPB 3ULVD 2H32A 3F7YA 4DKEH 3RTQB 2IQ9H 4Y5YA 2QQLL 4KGLA 2BRQA 1UYWH 3QXAA 4JZOA 3FMGL 3GSUA 4Y4FA 5DVLA 1LD9A 5T33H 4HHAA 1QSEB 3VG9B 2MKLC 2FR4B 3FTGA 1AO7E 1M7XA 3EO0A 3KPQA 2ZZUT 2YRPA 3D2UD 4S1QL 5CBEB 3F12A 5I1EL 4TUKL 1L4IA 3SO5A 3E3QC 4PY7B 4QYOB 4ZODA 5EU3A 3FQWA 3FT4A 3RZWA 2EH8H 3VXQA 3LN5A 3NZHH 3MJ8B 2P7TB 4KZEH 5E8NB 3ZYJA 1L0YA 1ZANL 1QPPA 3X11B 1CDYA 5CILL 4O58L 3P4OA 4IRJB 1UZ6E 4B41A 4UAOB 1I8MA 3BAEL 1CDHA 2A6JB 2KDGA 4YBLB 4PS4H 1G0DA 2YHGA 4KROC 3ARGD 3ARWA 4LIQE 5HGHB 2ZSVA 4DQOH 4XC3L 1DN2A 1LDPL 2V17H 5DRNA 4BQCA 5J6HB 2Z31B 3L7EA 4HCRL 2LVCA 3KYAA 2B7DT 1WIUA 4IS6A 4LSTL 1EVUA 1PG7L 3QUKB 1PDKA 3INUL 2JLLA 5MP6H 2OMBA 2RB8A 1F5WA 5FYKU 5E2WL 5LAXB 5T3ZL 1KENH 4YO0B 5IKCA 4YAQA 4HX1B 3HLAA 4IOIB 4ELMB 1WAAA 3WIHL 1HYRC 4PRPE 2C7UB 2DQGL 5HHNA 3HE7D 3G5VB 3OJMB 3R8BB 1WWWX 3R06A 5KW9H 4Q2ZB 4KUZH 3EHBD 5BRZD 2H3NA 2YK1L 2Z91B 3CU7A 5IB4B 5GJTH 1Q0YL 1F45A 5DQ9A 5CEYB 1RPQA 5CP7A 2MHAA 4JO2H 4LKCB 5EORL 1KELL 3MNWB 5H94B 5JR1L 5E7FA 4NNXA 1OD7A 1KULA 1S7TB 4HZLB 4JM4L 5KS9A 2ZUSA 1F6LL 4JLRB 3TCLB 1FZJB 1S8DB 3WS6C 4Y0GA 4CVZA 5C0BD 2HVKA 1RIVL 3DV4B 3U36A 3V4PL 2WIIB 3OBAA 2XA3A 1KNOB 5A1AA 1YNLH 4ETQA 2IAND 5D2LA 1H0DA 2VAJA 2VUYA 1H3TA 4FP8L 4Y4HC 3ZHDA 5ABDE 3L5XL 1FG2A 5D72L 2NY7H 4XGZA 3G5ZB 1PBYA 2FGWH 3QQ9D 2R9HC 1HHKA 4MJ2A 2LV4A 4RMVA 5TQ0H 2NY5H 4PB0H 4ORGB 1VERA 2OXGA 4HAFA 1UB6B 3PHOA 3S4SA 2YZ1A 3K81A 5CZXD 4JFHD 1RZJC 2VLJE 3MA7B 4OF6A 4KFZC 4ZUSB 3CAFA 1BECA 1XF1A 3IVKA 1IGMH 4E42B 5LQBH 4HIEA 2RFXB 3U9UB 2JJTC 5JW3H 3QQNA 2GT9A 2Y7QB 3VXRB 4QXGL 4M43H 2ITCB 4ODWA 1KC5H 4I2XA 5HBBA 4L4VD 1CFTA 1NGZA 1RHFA 3WLWD 5CSZA 5D6DA 3W2DH 1X44A 2AJVL 4ZUUA 5F9WB 5IVNA 1T03L 3TBWA 2FSEB 4AQ1B 3UTZA 5I74C 3NN8B 1B2WL 3KS0H 2CKBL 4WV1B 1SHMA 2CRMA 4FQXA 3UYRL 1W72B 4BZ1L 5TF1H 3ARTA 1OTSD 1LP9F 4BK5A 2B4CL 1AQDB 5GIRB 1A7PH 5CP3H 4L9LB 1IC5L 5F9JA 1F00I 1QLFB 4HS8L 2OTUB 3KXFA 4RFEA 3K8KA 5DLML 2ORBH 1OSZB 4G6MH 1FO0H 1FZMB 5BV7C 4G80B 4QRPD 4O2CB 3VXOA 3T2NL 5IROA 3GRWA 3NCYS 4ERSL 5HHQB 2F53E 3SJVA 2Y6SD 1JRHL 1QHPA 4HWUA 3VFUB 4R4ND 3UO1L 5A2LH 4EN3C 5ISZB 4U1JA 1QVOA 4IRSC 5HYQB 4XP6H 4YDIL 2VXUL 3T4YA 5EUOA 2B1HL 2CDGB 4XPHH 4AT6B 3WXVH 3CDYA 4PV9B 3BZFA 3K1DA 2X1PA 2P24A 2KH2B 2VLKE 1T1WA 1OP5K 1IM3B 1UWXH 1UB5B 3SDDD 2R69H 3MRCA 5DR5H 4U6XA 5F1KC 3UJTH 3HE6D 2CIIB 1FGVL 2KKQA 4XNXH 1QEWA 1U8QB 1AY1H 1GSMA 4OT1H 3RWIB 3RX5A 5KSAC 1TTUA 4P5TD 4WTXA 5KSUB 1SYSA 2NXYC 3MBED 5K59F 4M3KB 4C56D 2XWBA 2GK2A 1F8TH 3CFBB 2G75B 4RX4D 1G9MH 2EDOA 4LSPL 4KHXH 4XPFH 4LAQL 4Y16B 3SDCC 2X4UB 5I2IB 4FQ2L 2BZDA 5D71H 5IP4A 5H35A 4R7NA 3CX5J 4P4KD 1U8IB 4XP1H 1RQ5A 3AAZB 3HAEG 4M3JA 1HH6A 1OGTB 4Q58C 4YHMH 1OY3B 2X4PA 1M6OB 2OXHA 2BSRB 3BDXA 2V5SA 2GW5A 1MJUL 4XC1H 5CFHA 5I18L 3IFPB 1UKSA 1ROWA 3RAJH 1Z5LA 1KIPB 5MEPA 1FRGL 3FRUB 2ZUQC 1I8IA 2K3TA 3JVGA 3UAJC 3VXUD 3DX6B 1MWAB 1OAYL 2UZXB 2RR3A 1IZKA 3I6LE 4OI9A 1FSKC 3RX7A 1OWRM 4LRNL 3FMGH 4LLWA 4M02A 5C09E 2OCFD 4KPHH 4J7RA 4ZAKD 3QG7L 3RZCA 2HN7B 2LVEA 2HKHL 3EDKA 4HK3N 4RFNB 1F11B 1P6FA 3NAAL 1A6TA 1BOYA 5I1EH 4TUKH 4MYWB 1HSAA 5GJSL 5D5MB 3QO1A 3VXMD 2VOTA 3KJ4C 4NSKA 4RIRA 1QFWI 2W60A 1YEKL 2YD8A 4QOKE 4UNVA 4FABL 4AIZA 3MMEB 1ERNA 1DVFC 5HDOA 2I60L 2ARJA 3DRQA 4O58H 5CILH 1CFQB 4WEBL 4X5WA 5I1DB 3BAEH 4ZPVA 1MPAH 4JN2B 3RY6C 2Q1EA 1L6ZA 3JXAA 3TWCL 4ZDHA 1YZZA 1RZJL 1PEZA 5I1IH 2VDLL 5D1ZB 3T3PE 3DI3B 4O5LH 4R4BA 4HCRH 4NWTL 2DYPA 2AV7B 1A5FL 1PKQB 4JO4L 4P99A 4MNHA 4LPVA 2LU3A 1DLFL 1VSCA 2NW2B 2XZQL 1P53A 4UINL 4NCC2 3ROLB 1GPOL 5BXFB 5T1KB 4V1DB 3FO2B 2MQ3A 5GQBA 1CD8A 2GSIB 4PREB 5T3ZH 2MCPL 1AR2A 2ESVE 4J3SA 4HUWB 3BQUB 3HC3L 1EHAA 5DXWA 1NGPL 2DQGH 4F7MB 1FL6A 2O5XL 3GK8H 1F4YL 4WI4A 5E2TH 2BHUA 2VWEE 4JFDB 1NCWL 5B38A 4OCRL 4JDVB 1JZ5A 1GC1C 2QTEA 2YK1H 1RURH 1JNLL 1JWMB 5ACMA 4U6VH 1Q0YH 4JRYE 3L1OH 3TH2T 5ADOL 1XH3B 1JWUB 4MDJB 3TIDB 5EORH 4PRHA 1KELH 3HMXL 1H15A 3ARSA 3I75B 4S2SB 5DC0A 5I73C 3QIWA 1TZIB 2XZCH 1I7UB 2XN9D 2BVYA 4KWUA 1OM3H 3CCHB 5GHWL 5CWSA 3SKJH 4GW5A 3VWJA 4HS3B 1G0XA 1RIVH 1PFCA 4KVCL 5BV7L 4JFFD 4QHNB 3V4PH 1HI6A 4J12A 5CHNA 3QRFM 1SEQL 3T0EC 3MUGB 2ADJB 3BP7A 4D94A 2AK4B 5D2NA 3G5XA 5J56B 4WUUA 3L5XH 2WUBH 5D72H 1IL1B 2Y07L 4WDIA 1SJHB 4OGYL 4AEIL 3OZ9L 2JK5B 1EXUB 4F2MA 5SWZA 4GMSL 4E5XB 3ZDXF 4FZ8L 4R2GD 1BF8A 5C08E 5IV2A 2F5AL 3PQYD 1E6JL 4L8DA 5KG9B 4NQEB 1R3HA 2A73B 2WZPD 1IAII 3G5YA 3LRHA 3QIUA 1IGTB 4LVNB 5FOBA 1J9CT 5MEOB 4LPTA 1SJVA 1TNNA 3CH8A 1ZGLB 4PJ8B 3IJSA 3BJLA 3KGRA 4TSCL 1BFTA 4P46C 4FTVE 3ARBA 5L2KA 4JANB 4LCWE 4F7TB 2WM0A 4XX1G 4LCYB 3LEXB 3DXAA 3T0DA 3VGGA 4FXGB 4G3YH 1XT5A 4K8RH 5ENWA 4HUUA 2ARJQ 2GI7A 1T03H 1ADQA 3KLSA 3RRQA 3B9KD 5EZJA 4K94L 3IAPA 4NJ9L 3S3JA 3MR9A 3TBYA 2YUXA 3UYRH 1K8DA 3L5HA 5TH2A 2ATPB 4BZ1H 4I0KA 4I0PA 5IVXB 1C5CL 4JFED 3E6HB 2AGJL 4D0CA 2E7LA 2B4CH 1I4FA 4KRLB 5IIEB 5GZND 3WSQL 5C0CB 5C0IA 1IC5H 3U4BH 1UZ6F 1M05B 5DLMH 1CTNA 4WNQB 3MXWH 2P5ED 2R2HA 2HA1A 4IBLT 4XCEA 3T2NH 3QDJA 4POZD 3ZSSA 4ERSH 2AQ3A 5HGAB 4PRID 1JRHH 4TSBH 1FVCA 1NC2A 3BIBX 3UO1H 2XRAL 2Q6WA 5DZLA 4AQOA 5C0AE 2VXUH 5CD3A 2B1HH 43C9B 3QCVL 1CGYA 3KPRE 3QUZA 1BBDH 1DQJA 4QF1A 2MQCA 4ONGL 3VFPB 1SM3L 1HXMB 2NY4D 3IGAA 1FGVH 2CJUL 4O4YH 1PX3A 4KKCD 5L88H 4JPIB 3BZ4B 3VW3L 2DLGA 5TDPB 2E6QA 5FKAB 2BX5A 3DMMB 2A83B 1C8PA 2UV3A 4G5ZL 5EDXA 1FORL 1TJGL 5D1XD 5LXGH 1T21A 5JIKA 2NY3B 1NMBL 4DEPC 4PJGA 4JRXE 4LAQH 3IXTA 2ZOLB 3LKSA 5I8CB 3BMWA 3BSZH 1QA9B 2ZUXA 4PJXB 1HILB 3R4DA 5DSCB 2GYSA 3GGWA 3UEZA 2PW2B 5IMLB 5DGQA 1FDLH 3HZKB 1G84A 1V3MA 1MFEH 3QNYA 2CIKA 4DOHB 3KDMB 1YNTB 3QEQE 5EZIH 2PW1B 1JPGA 1MJUH 5EU5A 5E6YA 5TDOA 1KCVL 3MV9A 1BVZA 3BH9B 3U46B 3S98A 5EC1B 2AEPH 1P9MA 1FRGH 3G08B 5C0ND 4NPYB 4L4TB 4APQD 3QUYC 5E6ID 1T4KB 1MHHA 4LLVB 1EVTC 2E7MA 2X2YA 3HZVB 4WWKB 1GC1L 3NA9L 4NUJB 3CK0H 1EMTL 5JZ7D 5I71C 4N8VG 4LRNH 2YPVL 3AREC 5GSRB 5CGYC 3VWKC 3QG7H 3FB7B 4HIJA 3VGDA 5INCB 2HKHH 1H8NA 1UCBH 4MDIA 3RWCA 5I15H 1KTLB 2FX9H 1KGCE 2VITB 3GMLA 4QRRA 3ARDA 2BVTA 2EYSB 3KYNA 2AJXH 4PRAA 2J8OA 2OZ4A 2FX7H 5FO8B 3H42L 3QUXC 2Q8BH 3TIEB 4P2QD 5FYJL 3BKCL 4LF3B 4FABH 2IPKB 2C1PA 5KBNC 1BBJB 4Q6IC 1QFPA 2NXZC 1OHQA 4J4PA 4MJ5B 3C5JA 4WEBH 2NW3A 4YXHL 3S37H 3H8NA 4N90E 2GTWB 4CADA 1JP5A 1WAAE 4X99A 3SKNA 4IOFD 4NQTA 1KIUA 4YDLC 4NC1E 1RZJH 3QUMA 3LN9A 2XKNA 1JNJA 1KB9J 3VFSA 1IARB 3UP1A 4G9FA 5CJOH 4MNQA 3GHEL 3NACL 4YPGB 1A5FH 1G7IA 4NZUH 1DJSA 5E5UB 1FNFA 1DLFH 2AXFA 2XZQH 4UINH 4LHJB 3MXVL 5DFVD 2HFFA 4JPKH 2MCPH 3MLVL 1T0MA 3HB3D 3I3BA 4OZFH 1VENA 2BSED 2EECA 4JHAL 5IJKC 4NQCB 3LV3B 5LWYH 5D7JB 3RGVA 5HY9B 2O5XH 5KS9E 1F4YH 1R5VA 4G42A 4LGPB 3MGOB 2ZG1A 4D3CL 1I9EA 3DO3A 1Z0NA 4UNUA 2OSLB 4N0FB 4DGYH 1FFRA 5FGBA 1JNLH 1LP9B 2ZG2A 4ZFZB 2Q86A 3S35X 1QR1A 5IR1B 4WO4B 1JF6A 1QYGL 5D2LE 1N4XL 1CF8L 3WYRA 2CRYA 1D5XB 1JGEB 2EDHA 2JIXD 1IQWL 4OSUL 4TVPL 4L8SB 4F37K 2GKIA 2CLZB 1XMWA 4PYHA 1I1FA 4Y5XC 2GAZB 5A16A 4Q74A 2B2XL 1OP5H 4KVCH 5BV7H 1GZQB 4AY0A 1SMAA 3FB5A 4ODHH 5JNYB 3FN9A 4IOSD 5BO1L 5BJTA 3LOWA 3T0VA 3PDOA 1NDMA 4JVUA 4KKAC 3ULUD 1OD9A 3FFDA 2NY1C 4LVHC 4XPBH 5D96C 2IH1B 2Y07H 2AEQL 1J86A 3EOBB 4AEIH 3OZ9H 1KT2B 2PO6B 1FN4A 1IZJA 2JF1A 3H3BC 3HE7C 4TULL 4U1NA 3C5SB 1NSNL 5IB2A 1DEEB 4N8CL 2F5AH 5IHUL 1E6JH 2ZUVA 3EHBC 1DL7L 2EKJA 3A6BL 3UTSE 4HT1H 4JREB 3WO3B 2LTQC 4IEFB 2BOCA 4RGOH 3FHAA 4UV7H 4ZSOB 4U0RB 5EA0L 5JHDD 1XR8B 4KTEH 1PLGH 4TSCH 4DGIL 1OGAD 1FLRL 4MSWA 4OIIL 3D0LA 1DSFL 3KWWA 1N5YL 1I1AC 3L95A 3RTQD 2B5IC 3KXFE 4XRCA 1JPFB 4RAVA 1QSED 5E5MA 3KPTA 4HK3J 3SJVE 1DQQB 3F58L 4M48L 4NJ9H 4MQTB 2FDBP 4WFFD 1MHEB 1NCDH 4HUXA 1MCOL 4YPJA 5BOZG 2DIBA 4OI7A 5EOTA 3O45B 4WI5A 1QR4A 2AGJH 3O9WD 3QEUB 1UKQA 5AYUL 3WSQH 2BC4A 3A67H 4OTXL 1BQHA 3WIHA 3KNBB 4JPVH 5DK2B 1D5MB 1XF4B 3GSWA 3T3PF 3HPJB 1YEIH 5DMYA 1PG7X 3QHZH 3R0NA 4LLAA 4Y8AA 3DIFA 3QISA 2XRAH 1Q9LB 2OI9B 4P5MA 5JMOC 2GCYB 3OXRA 1JGVL 3EJJX 4K3GA 3AY4A 1CLYH 5CD5D 1A7NL 1H3GA 3WLWC 1XFPA 4PTUB 3T08A 4HV8B 5IEKB 1DBML 4XB7A 1BHGA 1QRNB 1A1NB 1KOAA 3TN0D 5I66A 3VD5A 3HZMB 1SM3H 2X70B 3W0WE 4F7CB 1RUKL 2J6EA 5IJVA 1YEEH 5LJYH 5DUML 3HAEB 5ICZB 3JTTB 3DUUA 1CFVL 4C58B 2CJUH 3IU4H 3VRJB 4PJ9A 5IT2H 3IJHB 2Z8SA 3GKZA 1KJ3H 1CGSL 3FOMB 3F5WA 4EUPB 1FFNB 2E7CA 1E28B 1BVLA 5I1LB 1NMBH 4WHDA 3U30B 3AFLA 3MRNB 4X6CE 3EOTL 3GBML 4JKLA 4KKLC 3PGFL 4HJ0C 5B21A 1NMAL 3T8XB 4ALAH 4OV5A 3GDBA 5FO9A 1GYAA 4M7JH 1BEYL 3ZTJH 1IGYB 1T0PB 3TYFB 4U1GC 3CC5B 2CDFA 1HWHB 1UXWB 3MUY1 4HMCA 4EVNA 3V4VL 5J8OA 3MJ7B 1XGUA 4HKZA 3RVTC 5HVWA 2N7BA 5DMIL 5EOCL 4QXTB 1HKFA 3AM8C 1KIRA 4NQDA 4S0SD 1KCVH 1PZ5B 3VFWA 3EOAB 2ZJSL 3SDDC 1T6WA 3L3DA 3VFOB 1O7VA 2VZ3A 4EI5C 3MYJA 1YYLL 3HE6C 5ID1B 4NYLB 3BPLB 1JF5A 4M9OA 3U0PA 3FN0L 1RAMA 1WZKA 1GC1H 2OR7A 3NA9H 4HH9A 5DTFB 1EAPA 5HGBB 1EMTH 4P5TC 5HYJA 1XIWB 1F2QA 3KYKH 3MZGB 2YPVH 4BFIA 4TNVK 1V3LA 3ZZ1A 5FO7A 2FYYB 1ZT1B 4G6FD 4QT5B 5E1AB 3S97C 3P2TA 3BIKA 2EZ0D 1N6QL 4M6ML 5L7XL 4L3EA 3RHWK 1FHGA 2ZSWB 1RZFL 5DVMA 1MNUL 4CNIB 5IVZA 1FYTA 1LEIB 3H42H 5D1QC 3DVGB 5FYJH 5FDWA 1WBXB 4P4KC 3TVMA 3BP6B 3MV7E 2YRLA 1UFUA 4ZS7L 1WTLA 2Z4QB 4UMGA 3D3VD 3UX9B 4D0DA 1ZLUK 5ILTH 5DJXB 1BIHA 4EXKA 5B3JE 4RFOL 3IDNA 2I5YL 1F58L 1KCKA 1QKZL 2P8LA 1MH5A 3GHEH 2Q7YB 1VFAA 3MRBB 5CLTA 1VEOA 1FFPB 1A14L 4WUKL 4MMZC 3MXVH 4PJ7A 3QDMA 4OGAD 2VXQH 3LS5L 1AO7B 3MLVH 4M6NL 4HJGA 1VGKB 1TVBA 2EDJA 5GRJH 3PJSB 3LQZB 3Q6GL 1BIIA 4D3CH 1T7YA 4HIXL 5F1IA 1NQBA 3UDWC 1U8MB 3LEYH 1Q8MA 1NGYA 3ZYZA 1AP2B 2BY1A 5FYKE 1VGEL 4N9GA 2DJUA 3KPLB 4FXLA 4OFVA 5JLZB 3LIZH 3MGTB 5D2NE 2EYRB 1CF8H 4MXQD 1A21A 2VAAB 3P9LB 4Y5VC 1IEBA 5FUZH 3LKRA 1IQWH 4OSUH 1YQ2A 5GS2H 3FZUC 3HR6A 3WJJC 1CFNB 3IU3A 2B2XH 5FA4A 4PGEB 1T7WA 2EEBA 1E4WL 5GGUB 4P3DA 1ZGLM 4H26A 4M8VA 3OG6B 2ZOKB 3KLAB 1P4IH 3QJHA 1MFNA 5F96H 5F1OB 4PRPB 4OUOA 5EBGA 3IB4A 5HDQL 4OM1H 1UADC 3DXAE 3WE6B 1XCQA 5F6HJ 2AJZB 2GHWB 2D03L 1U8NB 3WFCH 3TO4A 1NSNH 5JO5A 4EI6B 2JCCB 4NQUA 5IQ9A 1Q0XL 1DL7H 4ZFGL 2ICWI 4MA1C 2GJ6D 3AXLA 1KPRA 4CAGA 4XBEL 2X4OB 5T3XE 4OKDA 4MWFA 3ZKQD 1M1SA 1LEKA 3W9DB 4PJCA 4DGIH 4HUVA 4POUB 4QHKI 1RZGB 1AJ7L 1CE6B 3HNTL 4OBRA 1TNMA 1XGYL 2H6PA 4GRWE 3PWPD 4OD3L 5FA3A 3UYPA 1EIBA 4OIIH 2X89D 2MOVA 5I30L 2B0SH 3MLSH 1TZHB 3DO7A 2VXTH 3CMOH 5TDNA 3V5KA 5FF6A 5E4IA 5DS8A 4GBXB 2I9LB 3OKKB 3WDJA 3QDJE 3VGHA 1MVUB 5E8EA 4JGMA 1A7RL 4RMSA 1MY5A 1MCOH 5EUKA 1QLEH 3EYVA 4ZFOA 2OTWB 2X6MA 1S7XA 3LZFL 3F6LA 5J9PB 4DCQB 4LDEB 3SO3C 5HHVL 1X4ZA 4R2GC 3C08L 2BNRA 2IC2A 4OTXH 4BH8B 3FQTB 3F62A 2QHRH 4WHYH 1WAAF 2AJ3B 2OQJA 3LN4A 4KJPD 4KJYA 2PN5A 5HYIA 3S4SG 4C54A 4JB9H 1J8HD 1Q1JH 2D7QA 1SEBA 1J7VR 2Z92B 3GIVA 3GJEA 3ULSA 5D1ZD 4JDTH 2W91A 5A40E 1Q72L 1R24B 2BNQE 4XZUB 5CS7A 3RWHB 4J1UA 3FFCA 1DBMH 3HC0A 2NTFB 4PJGE 4ONHA 1I7ZA 3HMXA 4MJIB 4U6YB 3UJIH 4V1DD 5FGCB 3JV5A 2HWZL 5KS9F 1B0RB 5DK0B 2PYFB 3BMVA 1LGVA 3Q1SL 4Q0XH 4N1EA 1H8OA 1CR9L 4JFXA 1DFBL 1CGSH 2YOCA 4A6YB 4HXAL 3EYOB 3RDTB 4L1HA 5J89A 1WWBX 2PYEA 4RZCB 1S78C 4OFYD 4P5KA 3RY5A 5D2LF 3U2SB 5HPMA 3VFNA 1T1YB 1R3LA 5C8JA 2DLHA 4N8PA 2G5BA 4FHBD 4TRPL 5J12C 1FE8L 2V6HA 3MV9E 2F19L 5SX4H 2YZ8A 4N8VB 3EOTH 3GBMH 2X4NA 2EXYD 1NMAH 1N3NB 1BZ7A 3CSGA 3GNML 3S5LA 1A7OH 4HIHB 4NUGL 3MLWL 1BEYH 4MS8D 2QADC 2OTPA 3WUWA 1T89C 4WFEE 2IQAA 1TMCB 1U3HD 5C6PB 1UEYA 4KZDL 2E27L 2HKFL 3BZEB 2VLKB 2HG5A 5EG6C 2CMRL 5DMIH 3ES6A 5CJQL 5EOCH 2YBRA 3P0VH 5E4EB 3D5OF 3OX8B 2ZJSH 1QSVA 1TQBC 2AK4D 1H8SA 4FG6D 4QRRE 1YYLH 3OB0K 3KHOA 3VD4A 3STZA 2L7UA 3FN0H 4NZRH 1YNKL 3O41A 4X7FC 1FIEA 4KKCC 2FZ3A 1G6RB 4W4OA 1A6ZA 3EYFB 3GSRA 1P5VA 5DD0H 4NFBA 2VERN 4KDWA 1T22A 4RMWA 3MO1B 2PXYC 2WANA 3O2VL 1A9EB 1K5NB 5AD0B 1N6QH 4KTYA 5L7XH 2NY2D 3OJVC 2R1WB 2C3XA 3ALWA 3BHBA 1RZFH 4XWGL 1GJIA 5D70H 1P2CA 1PY9A 5TE7L 4JZJC 5K9JL 4MNQE 3TBTA 4WW2C 2ADGA 2AXJA 5B8CA 3CSPA 3S34L 4NKMB 4BSVB 3OHXB 5HDBE 4UIKL 1DQML 3N9GL 4AENB 1DQLH 3EIFA 1A6AA 1FIGL 2Y5TB 1A7QL 4RFOH 1GAFL 1YMHA 2I5YH 2OL3A 4CL7A 1RFDL 1F58H 4XVTL 4JN1L 5C0NC 4P2OB 4APQC 3QZWA 3KLHD 2AI0H 3WDHA 3MV8A 1A14H 1KJVA 2HJKA 2FO4A 1C12B 3RPIA 4WUKH 4F80A 4P57A 1A3RL 1DDHB 5C0CD 5F89A 4I48B 5L8JB 3LS5H 1JI2A 5H37H 4M6NH 2WLZA 1H3VA 2QLVB 2O5ZL 4OLXH 2EE9A 4MAYB 4GRMB 5GISL 2FR4A 3OMZA 3Q6GH 3REVB 2DM2A 4HIXH 1FH5H 4HUKB 4PJHE 5ICYB 3B5TA 5GGVL 2HYMA 1R3IH 3LPWA 4M5ZL 4JFZL 4QOKB 2ZUTA 4NM4H 1FNHA 4JGJA 5IBTL 5EN2B 1VGEH 4UUJB 2OZ4H 4X5LA 2DOCA 1H5BB 3O3AB 2QSVA 2DRUA 1RUQL 5DJDA 3ZDYE 3OR7A 1S9KC 3SE4A 3C6SB 2LU4A 3CFJA 2BXYA 5GRWA 1R3KA 4KMTL 4XH2B 4X7TA 4ZTPH 1IGJB 4NQXB 4IOFC 3QDGD 5GXBB 3FQRA 3PWNB 1HZHL 4WU5A 1MIEL 4KRPD 4ZYKB 5E70A 3BFOA 1XF5A 4KK8C 3VDBA 4X6CF 1IGCH 5IGXL 5DFVC 5IB1A 3SGEH 4YFLI 4M7KH 5E8DH 5EOQL 3B2VH 2DF3A 3HB3C 5EU7E 2CLVB 3HCVB 1K3ZA 1C7TA 4Q9QL 4YO0A 5HDQH 4HX1A 3C6LB 3UPRA 3T0BA 2D03H 4NDMB 4JM2C 3NCBB 1RIUL 2X4TB 2C7UA 4KI5D 4U7MA 1Q0XH 4PG9A 3WFBL 3PL6D 1EERB 4KRNA 5FKPA 4ZFGH 3TP4A 4HK0A 1TPXB 3ESUF 4ZXBA 2XQYK 4JRYB 3SCMA 4FFYH 4NNYB 1QUNA 4XBEH 3O3BA 4HBCH 3BH8B 5B38G 4NHCH 3QO0B 5TGBB 3WNPA 2Q8AL 2FX8L 5IB4A 1Z0MA 4ZFFA 3QPQC 3MNVA 2WP3T 2EDWA 3HNTH 3BDYL 5CEYA 3ECBA 1FL3B 3BO8A 4XVJL 3MROB 2G60H 2XTJE 1CTOA 2J12B 5GGVY 4HZLA 2E9BA 4PJFA 5FOJA 1T20B 1DR9A 2IFGA 5AYQA 4LP4A 4HWBL 1CN4A 1EEQA 3MA9L 4J3TA 2VTFA 3DV4A 1T2JA 3ULUC 4RGMB 2WIIA 3L5WA 3OGCA 2A77L 1A7RH 3ARRA 1UA6L 5E1HB 3QIBC 3TA3B 3LZFH 3S36L 4L29A 2VLMD 1A7BA 3ILQD 1QO3A 4R6UA 5BVJB 3WN5B 5HHVH 3G5ZA 5C08B 3C08H 1BD2B 3ZL4L 5B3JF 3CSBA 4DTGH 5KANG 2VH5L 4LU5L 1BQLL 3GO1L 4HLJA 1W0VA 5IFJB 2DWEB 3HS0B 5ICXB 1UVQB 4LCWB 4LHUA 1Q72H 2VZ1A 2GJZA 4KGJA 1U91A 1ZHLB 1F2XK 2J8HA 1JV5B 1A2YA 3RTQC 1OB1A 3RQ3A 3PWUA 4WU7A 4LBEA 1EUUA 1G9NH 1EV2E 5F1NA 5E9DA 2HWZH 3VG9C 3GSXB 8CGTA 1J05B 3Q1SH 1MJ7L 4M4PA 4GRLD 3VXTB 1CR9H 3WFHB 3I6GB 1OWWA 3LRSA 5DGRA 4WV1A 1DFBH 3CFDB 3QXVA 4J3OC 4HG4J 4HXAH 3L9RB 4G7VL 1D5ZA 3BD5A 1EFQA 4U1KB 1AGDB 2QSCL 1ZA6B 1KBGL 3MBXL 4LSQL 2VXVH 1MCFA 4NQDE 3SE4C 1FE8H 3WXWL 4PFEA 2R0KH 4L9LA 3MPCA 1VACA 4LASH 4IM8A 3GNMH 4IRJC 1TQCB 4UAOC 1U92B 1MREH 5E2JA 2F5BH 1PAMA 2FH8A 3HZYB 4YBLC 2B1AL 1QQDA 1YA5A 1NCBL 5C0AB 2JB6A 3O8XD 5HYJE 5HYSB 3GMNB 3ZKNC 2GITB 3VFUA 2Z31C 4E41D 4KZDH 1JWSB 2HKFH 3KPRB 5D7IA 3SQBA 4QXUL 3SY0A 4XNQB 5T1DL 4ISVB 3MTRA 1JK8B 4HXBL 2Q20A 3AS0A 1RK1A 3CVHH 3C5ZA 1FYTE 4OCMC 5IW6B 4XPGH 1NFDA 2D3VA 1MUJB 1SY6A 4FMFA 2J6EH 2PKDA 4NQVA 4QLRA 3AS2A 3B8YA 3VRIA 1K4CB 2PCPA 5T5NG 3O2VH 4TOYL 4PP2B 4JRXB 1L7IL 5FYLE 2XZAH 1JI1A 3EDEA 4IDLA 2R8SH 4GRWF 4I8DA 4XWGH 1U8LA 2VISA 4I4WA 1RJZA 3VGBA 3GSNL 4HC1L 3RVWC 5K9JH 43CAA 1KCRL 2H32B 3F7YB 3S34H 5ESAA 4Y5YB 4PY8I 3QXAB 4JZOB 1GIGH 3GSUB 3N50A 1RIHL 4UIKH 1DQMH 1LD9B 5IOPA 1J10A 3QDME 4HHAB 4P2RE 1WVZA 4LCUA 1FQ9C 3FTGB 5F9OH 3NFPA 1TVHB 3EO0B 4OLEA 1WCBA 1S5IL 3F12B 1A7QH 1ZLVH 1GAFH 4UDUA 3O2WL 3LSOA 5GGSA 1AGCA 3FQWB 5EU3B 3FT4B 4F37F 1EHLH 3MACH 2NYYC 1FAKT 3LN5B 3DX6A 1MWAA 3C60D 4NP4L 4RRPA 3S3PA 3P4OB 5T5NF 5DHVH 2I07A 4XAKD 4OZIE 1I8MB 3E0GA 3U0WL 1BGXH 2EZ0C 5H37G 4URTB 2O5ZH 5C0FB 3BKMH 2ZSVB 4Z0XA 4RMTA 2EO1A 3QDHA 5DRNB 3SBWC 1F11A 5KVEL 3DNKA 3L7EB 3BKYH 4CJ1A 3G6JE 5GGVH 3ARFD 2P1YA 2DQIL 5EULV 4FQHA 4IS6B 4PJGF 5CJXC 4NOBA 1AQKH 1LILA 1F13A 3ULUL 4CU6A 1YYML 5F7YC 4PD4K 5F9WC 5IK3A 5IKCB 4YAQB 1TTGA 3HLAB 1DANT 1N6VA 3FQUA 4KMTH 1IT9H 5HHNB 1C08A 1W0WA 3R0MA 4B7IA 4F15B 5ETUA 3UBXI 3V0VA 2JJWA 1BJ8A 3N85L 4M8QA 3R06B 2ARWA 1HZHH 3OF6D 3QEGL 3UTTE 2H3NB 2FEEI 3RNKA 4XCYA 5TPWL 1BJMA 2AV7A 1PKQA 2IPTL 3DBXB 1VFBA 4KJWD 4ZTOH 5DQ9B 3QCTL 5CP7B 2MHAB 1MJJA 2NW2A 4DUVA 3R1GL 3IXAA 2GSIA 4Q9QH 5KS9B 2I27N 2J88L 3BQUA 4CVZB 5C92A 1DLHA 2HVKB 1RIUH 2Z35B 3U36B 3ARGA 4NQSA 3QP3A 1NUFA 1OOAA 4M7ZB 3L3HA 4ETQB 5D2LB 1H0DB 2G9HB 2WW8A 1RHHA 3F7VA 1N64L 1JWMA 2FX8H 3IJYA 1TETL 4MXQC 4XGZB 3BX7C 3BDYH 4X4YA 1HHKB 2BVQA 1ORQA 5DURB 3S4SB 3PHOB 3O6LL 4JGUA 1FNLA 1XIWD 1YEDA 1I85C 2BNRE 2E8ZA 3CFEB 3B9VA 5ID0A 2GEEA 4H8WC 4H88L 3H3KA 3WFEL 5FK9A 2R0WH 3ARUA 4M4RA 4Y16C 5EO1A 5HHME 2A77H 2VRAA 5BRZA 4DGVL 1M4KA 3HI5L 4ODWB 4I2XB 2PR4H 1UA6H 4QRSA 4YK4B 5HDBF 2KL6A 1CFTB 4PLNC 1NGZB 3S36H 5CSZB 4ZUUB 1WC7A 3QRGH 4WEMB 3W5NA 3TO2A 4L8BA 3B6SA 3X3GH 2JK5A 1Q9OA 2HRPH 4LCIH 4ODVH 3UTSB 3QAZB 2JB5L 2VB5A 4F9PC 5I19L 3TBWB 1PY4A 5CCKH 3UTZB 5EC2A 5DHXB 1P69B 4S1DD 2XKSA 2VH5H 4MD5A 1BQLH 5C0BA 3D9AL 2ZKHL 3GO1H 3EOYG 4FQXB 5T5FL 2CRIA 2WP3O 4Z7UA 4RGNE 2R0ZL 1AE6L 3VDCA 2IANA 4AM0A 4PG2C 1CGTA 3KPSE 3WNLA 4TYUA 1EFXB 5F9JB 5I6XB 3KXFB 3PWJA 1JFQL 1I1YA 3VXOB 3SJVB 3OR6A 4PJHF 4U1LA 4RFNC 3OXSA 3IS1X 4U1JB 1QVOB 4M1GL 1UQSA 1CT8A 2X4RA 2OMNA 3T4YB 3D39D 1G7HA 1EO8H 3PE9A 4G7VH 4YX2L 4TNVF 4OD1L 3BZFB 3ZDYF 2P24B 1T1WB 2VL5A 4I77L 1ZK9A 1YEHL 4B5EA 1M7IA 2HH0L 1F4XL 5BZDA 3MRCB 4L4VA 1WK0A 4U6XB 3BW9A 4AIXA 1U42A 2GFBA 1QEWB 3RHWF 1TVDA 1ZXQA 2A38A 4IJ3C 4KTDH 3RWEA 1BQHG 1SYSB 2VN7A 5D1ZC 2O93L 4M62H 5I76A 3H9SE 2XWBB 1DBBL 1ZLSL 1RY7B 4KMQA 1KXTB 1L7TL 2W65A 4R97B 4YIQA 1L9NA 2AK1L 1T1ZA 1REIA 1OAUL 1RI8A 4S1RL 3CDCA 5H35B 1U36A 3GUTB 3TJEL 4R7NB 1J1PL 1HH6B 3IKCA 4CDGC 5MENE 3MFGB 1KB5A 4KJQC 1RZIA 3V6OA 5F7LB 1Z5LB 4NKOB 4X6CB 4PUBH 5MEPB 1OSPL 4D9RE 2LAGB 3LQMA 2NX5D 5E2VL 1W72L 1Z2KA 3PUCA 5FHAL 2NR6D 5J1SC 4IHOA 3GSNH 4HC1H 1KCRH 1V05A 3G6AA 2L4OA 1HILA 4XP9L 3MV8E 1FBIH 1JPTL 2QQQA 4LLWB 1RZKC 3A6CL 3OL2A 4C59B 3RZCB 2EDFA 1DBKL 3MBEA 1S5IH 2EC9T 1A6TB 4FG6C 3O2WH 4KK9D 4LEXL 12E8L 5F3HA 2E9WA 4RX4A 1HSAB 3QO1B 5EC1A 1IILE 5F7WC 4NSKB 4X9BA 4RIRB 4LQ1A 3KPMA 4N0CC 4YHKL 2W60B 1T4KA 3TH3T 2A9MH 2MTPA 4OIAA 4AIZB 2HJFA 4YLQT 4X9FA 3RIFK 2ARJB 3DRQB 1GZPA 4X5WB 3T4AA 3U0WH 4ZPVB 1A64A 5GRYA 2X09A 4LVNC 3GBNL 2W0KA 4MMXC 2NY2C 2OJZL 2EIBA 3FB7A 1AIFA 5IBLC 1U8PA 3DX7A 1QRKA 4PJ8C 4R4BB 5KVEH 1KTLA 2VITA 2DYPB 4MNHB 4OQTL 5JA8B 4H8WL 1XGRA 3MV7B 4R0LA 4UB0H 5KOMC 5FO8A 3ULUH 2F15A 1YYMH 2C3WA 4WFHE 3VXUA 1F4HA 1NBQA 4BZ2H 4EKXA 2CUIA 3Q2CA 3MLRL 4MJID 4P23D 3O6FD 4MGXA 1HQ4A 4DVBA 1JRHI 5GGQL 1FL6B 3MCLH 4ZAKA 1I3RA 1LK2A 1KN2H 1AKJA 2MJWA 5B38B 4GS7B 3PHQA 3EYUL 5IWLA 5F21B 2E3VA 4D2NA 3CVIH 2I9TB 3GJFA 4YPGA 2IPTH 3P9MA 2DLFL 3QCTH 3E8UL 2R23A 4PRHB 3NIDE 5IFHL 1LO2L 3R1GH 1EX0A 3T0EE 3QIWB 5KJRH 1MFCL 2J88H 5CWSB 4GW5B 1PJ9A 5CKGA 2M2DA 5HD8C 4ZG1A 4UTAH 4PJFE 1A3QA 1HI6B 1JVKA 4LKXA 2XPGA 4WENB 1YC7A 3BP7B 1NPUA 3PABA 3T3ME 5D2NB 3G5XB 4WUUB 3S8WA 4R9HA 2QQKH 1UH3A 1N64H 1TETH 2UVEA 2DLEA 3AROA 1IVLA 4WDIB 4JFOA 4G6AD 4F2MB 5SWZB 5CZVL 1JGEA 3R8QA 2BDNH 5IV2B 4L8DB 1BZQK 1ZA3A 3BP4A 1CD0A 1R3HB 1MRCL 3DMMC 3G5YB 4K7PL 2BVPA 1WT5C 3QIUB 4OF5A 4BA8A 5FOBB 2IAMD 4JKPL 3WFEH 1E4JA 2NY3C 3IJSB 3EDJA 1HNGA 5T1MA 3ARBB 4Z0BH 5L2KB 5K33A 1CG9A 1X7QA 1N5AA 3ZKMD 3DXAB 4FQPA 5T3ZD 4TTGA 2V2TA 3HMWL 2CK0L 3P30H 4CRPA 3DX9A 4GQ9H 1UM5L 5JOPE 4MQ7A 5ENWB 2L0DA 4HUUB 1UM4L 4KI5C 4M1CC 5CBAB 3DGGA 2JB5H 1EEZA 2XN9A 4GXUN 2Y9RT 3TNNA 3KYMA 3V52L 5E9DE 3S96A 2WBWB 1KIQA 1MLBA 2AS5M 4TVPE 3MR9B 3TBYB 5T5FH 1K8DB 4X6FB 5TH2B 2AKRA 1K9TA 4P4RA 4MD4A 2P46B 2R0ZH 4Y4KD 4I0PB 2AXGA 2Y36L 4QHKJ 4GRWB 5C07D 5SV3A 1AE6H 4MXVE 4PR5A 4D0CB 4WWKC 1I4FB 1NC4D 3RA7H 5C0IB 4OZIF 2KPNA 3CDGB 4ZMAT 4BQ6A 3OAZK 5J3HC 1JFQH 3QI9D 2R2HB 4XCEB 2BY2A 3QDJB 4UT6H 1EEUA 2FLRT 1IC7H 2EKSB 3PQYA 1WF5A 3CD4A 3SQOL 1FVCB 1NC2B 3FO9A 3G6JF 3Q3GA 3GI9L 2Q6WB 1CDIA 5K9OB 5D7SL 1NAMA 1RZKL 4DUXA 2BJML 5CD3B 5E94A 4HD9A 1RD6A 3F6IA 5D7IE 3QUZB 4XNMA 1DQJB 1WLHA 4QF1B 4K7PY 4ZUWB 2ZUYA 4OLYL 2D9CA 4WY7L 5E99H 1ZWIA 4PBXA 3MLYL 5LCVH 4KUCD 4HIIB 4LVOC 4EZMA 3B9KA 1XF4A 4GSDH 1T5XA 1VFUA 4KKBD 4R26L 1T3FA 4OV6F 5E6ZA 1DBBH 2BHZA 2IFFH 4MB5A 1T21B 3RVVC 4X0KA 3ARXA 4PJGB 3JV4A 1NLBL 1LO5A 3IXTB 4JFEA 4HKXA 1WV7T 4PTUA 1IRAY 1YY9C 5DFWH 3L3JA 1YEJL 1YMMA 3GGWB 4DN4H 4K8RD 2ED7A 5BZWA 3QNYB 5D7JC 3TJEH 3C6LD 2P5EA 3O6ML 1QOKA 3B5HA 2VABB 4OF8A 4HWBA 4JFQA 2FB4L 4J3WA 1JPGB 4O2EA 4PJBA 3SGJC 5TDOB 1CICD 3MV9B 3QEHA 5JA9A 1FJ1A 1E28A 4OUUA 3ZTNL 1UT9A 4WO4C 5E2VH 1W72H 4EQ3A 2F58L 1MHHB 5FHAH 1TTFA 4IMKC 1QSFE 4NCC1 1P1ZA 1F3RB 4L8SC 3D48R 1OP9A 4Y2DD 3EDDA 4ONFL 4GXVL 1ZV5A 2CXKA 3S5LG 1EAJA 1PVHA 3A6CH 1NJ9A 2ZCKH 3HN3A 3AB0B 4H25A 5DA0B 4DAGL 1HDMB 3CJJA 5MERA 4HIJB 1J8KA 3S9DB 3WUWG 3ZO0A 3RWCB 4B0MM 2Z8RA 3GMLB 2HT2C 4MXWH 4QRRB 3S36X 3ARDB 1S3KL 2PUQT 5DDHA 3KYNB 4JG0H 5ITFA 4PRAB 5D1XA 5FCUL 4AL8L 5CIPA 4NZDA 1D9KA 2P45B 2ATKA 4NYLA 4CU7A 3TA3D 4WTZA 2PO6C 5I16A 4NJAL 2C1PB 4ZQKB 3F7PC 4GFTB 3VI3E 3EAKA 5HHOE 3D25A 2CQVA 4XCCL 4N0UA 1BD2D 3C5JB 3ULVE 3GM0A 1J5OL 4JREC 4CADB 3FCTA 4X99B 2VIRA 3GBNH 1DEDA 4LPXA 2OJZH 3SKNB 1ZT1A 3QUMB 4U0RC 2XKNB 3VFSB 5JUEH 1UM6L 2GTZA 4G9FB 4MNQB 1DBJH 1NUDA 4LCWD 1G7IB 1TIUA 1MF2L 3F7QA 5FHBL 4PGZA 2AXFB 1U95A 4LSVL 4H8WH 1MCJA 5E6IA 2QSTA 1UC6A 4O9HL 2HFFB 1LDSA 1T7XA 4HUMB 1U8KA 2P5WA 1FZKA 1T0MB 2FCBA 4CGTA 1MFAL 1G9EA 1OQXA 2VC2L 1ITCA 3D18A 2MWCA 3QWRD 5AZ2H 4TNWK 5GGQH 3BYYA 4OKVB 1R5VB 4G42B 3V6FA 2DJ4A 2VSCA 1JUFB 4CMHB 3OKOA 5I17A 2MCG1 4HMDA 1GRWA 1JZ7A 4S10A 5I8OL 3LKQB 3QZWG 2Q86B 1QR1B 4CN6A 2DLFH 2XWTA 3VMOA 5IM7A 1HINL 5HVHB 2HTLC 3E8UH 5IFHH 1LO2H 3VD3A 4ZNEA 4HMEA 1MWAH 1UJTA 5TQ2L 1HQRA 1MFCH 3MLUL 4FFVD 4KDTA 3U7YL 3H9YA 1JZ2A 1I1FB 4LRIC 2R1YA 5A16B 2H26A 3S88L 3FB5B 5BJTB 4JDZA 5JORA 3PDOB 1NDMB 3HNSL 1UACH 3KJ6H 3DOSA 3D85A 1CDUA 3QFJD 2V5MA 2EDNA 5BRZE 4DUWA 4YBQC 5BOPA 3KPNA 5JQHC 3TZVB 4Y4HD 3WKML 1URLA 3O4LD 1D6VL 1FN4B 4PRDA 1F3DJ 5CZVH 1XF2A 4U1NB 2V5TA 2VAAA 5IB2B 1JNHA 2VQ1A 5HHXL 1MRCH 4G6KH 2BOCB 5C0BE 1CD9B 4U05A 4JKPH 4KJWC 4OZHA 3TT3H 1NDGA 3U30C 4W4NA 3OKEB 3DPBA 4Z7UE 2DI7A 2XIDA 1HEZB 2ZOKA 3D0VA 5HVFB 5FV2A 4MSWB 3D0LB 2IANE 4PGCA 1P4BH 3KWWB 2CK0H 1MSPA 3L95B 1S7UA 4G9DA 3FT3A 5AWNL 4KKNA 4Y4FD 2JIXA 4RAVB 2VNCA 5E5MB 3V52H 2ICEA 1DBAL 4WEUD 1IKNC 4JFHE 4Z8FH 4Y1AD 1AFVL 4U2ZA 3UZVB 4HUXB 2IBZY 1N7MH 3NCCB 3OPZH 3QCUH 4KVNL 5EOTB 1WZMA 3BPLC 1Q9WA 3JWOH 5DZNA 1OCWL 3W9DA 2XTJB 1RZGA 3B3IA 4PTTA 1EJOH 5I1JL 2FHCA 4FNLL 2BC4B 3U1SL 1XIWC 4NKQB 3WJLA 4DKAA 3JWNC 1BQHB 4JCMA 1EGJL 4L4VE 3DYPA 4NRYA 3C2AH 2YA1A 1ACZA 3GSWB 1S7RA 4YEEA 1S9XB 3SQOH 3DIFB 2I9LA 3GI9H 4P5MB 3NA4A 1RZKH 3OXRB 1MVUA 1CL7L 4WGVB 4X7SH 4CDHA 4OCWL 4S0TD 4EN3D 5JHDA 1RU9H 2F8OA 1V7MH 2YMXL 5I66B 1OGAA 3PIQA 1G7MA 4EOWH 2VLJA 4LLYA 4S1DC 2KBGA 2BY3A 4N90D 4WY7H 4BH8A 3MLYH 1KN4L 4HGMA 1KTRL 4PJ9B 1R6VA 2F8VA 2ZPKH 3CUPA 1HE7A 1GHFH 1N8ZA 3ABZA 5MHSD 4YHNA 3QPXH 3WMSA 4R26H 1QTYT 3TM6A 4QRPE 3F5WB 5KSAD 4N1CA 5IESH 1BPVA 2EDQA 5ELIA 1BVLB 3HRPA 4U1HB 4YDKH 3NIDF 3RI5K 4M6OL 4LHUG 1NLBH 4OV5B 3O9WA 3MRKA 4ZS6C 4KU1A 5FO9B 1YEJH 3SDCD 1AHWA 3DSNA 2YPLD 4UTBL 4PJFF 2CDFB 2DL9A 4EVNB 5DRXB 3T3MF 3MUJA 4YE4H 4JZNA 1XGUB 4HKZB 4DJMA 2UYLA 4RSVA 5F7FA 1KIRB 1TENA 3K4ZA 4NQDB 4U6HA 3MJ9L 3GMRA 3L3DB 3ZTNH 3MYJB 2NY5C 1F4WL 3SDXA 5BW7A 4C56E 3VFRA 3U0PB 3HC4L 3TN0A 4HH9B 4JY4A 1EAPB 2YRZA 2I24N 1N3NA 2BY0A 5HYJB 2F53A 5GGRY 3UAJD 5DURD 7CGTA 4HIHA 4BFIB 1HN1A 3BN9C 4HEPG 1OL0A 5FO7B 5L6YH 2CKBB 4XT1C 4DAGH 2VDPH 4QKXB 1GGYA 3BIKB 4I3RL 5DQJA 4N5EC 3NZ8A 5DI8B 3GHBL 3H7LA 4L3EB 4LMQI 1S3KH 4AL8H 5IVZB 1FYTB 4I18A 1PEWA 3Q5TA 4GKSA 3VXSD 1HNFA 2EDEA 3IDXL 5FB8A 3SOBL 2Z9TA 5KTEH 5FDWB 2WNGA 4NJAH 3K46A 4GLRH 5BQ7A 4D9LL 3X13A 4BKLA 1JCKA 3VXUE 2YD9A 4WCYH 2YXFA 1DVFD 3BGFB 4D0DB 3THML 1OAZL 4W70A 3JV0A 3IDNB 2FATL 3ET9F 1IQDB 4MXVF 2XACC 2P8LB 1MH5B 4XNZB 1UM6H 2NR6C 1ZVSA 5C0EA 3DJ9A 2BMKA 3IRPX 4OFKA 5TE4H 4LSVH 1CVRA 4PY8J 4PJ7B 1WZ1L 4OAWA 4DKEL 3QDMB 2YD1A 4O9HH 2IQ9L 2WUCH 4Z6AT 2EDLA 5IQ7H 5KSVA 3SE3C 3KXFD 3VXME 1UYWL 3O0RH 4PJ5D 3HUJE 5F6IB 5DUBB 2MQ0A 2VC2H 4EJ1C 4GBXC 4U1MA 4HJGB 1F02I 1TVBB 4H1LA 1U8OA 1X5JA 3OKDA 1D3CA 1BIIB 3MLTA 1IM9D 4OGZA 5IFAL 5F1IB 4HH8A 3HHRB 5D7IF 1D5IH 1NGYB 2EIDA 4N9GB 1HINH 3NZHL 2BRRL 1E4XH 1AR1C 1JPSH 5C09A 4Y19D 5EPMA 4XCNA 3KS0J 1IEBB 4JY6A 3BI9X 5TQ2H 4LDOB 3C87A 3MLUH 4RRPG 3U7YH 3RL2A 4YC2B 3B43A 3G6JB 3D3VA 1JL8A 3IU3B 4DQOL 1AXTH 2V17L 5FA4B 4MLIA 2Z8WC 3K2UH 2YA2A 3B8SA 3HNSH 4P3DB 2V9QA 3UYOD 4H26B 5SX4I 1X5HA 3V95A 5MP6L 1MRDH 1F3JA 3K4DA 5FYJD 3QJHB 3O6FC 1KENL 4PLJC 3WKMH 3TV3H 1XCQB 1A4JA 3SDAA 1J88A 2P8MA 2DWDA 2YUWA 5JO5B 3TO4B 4J2XA 5IQ9B 5ERWB 4NQXA 1KEML 5HHXH 3LS4H 3RDTC 2XN9E 3AXLB 1KPRB 5KW9L 1KTDB 4KUZL 3X17A 4MWFB 3IDYB 4RBPK 4LEOA 1LEKB 1CI5A 4HLZG 4PJCB 1B0GA 2EH7L 4JFFE 4HUVB 1JHLL 5DZOA 2ESVA 2H6PB 3V0WL 5FA3B 2YKLL 1Y0LA 5AWNH 3DO7B 5TDNB 3V5KB 5FF6B 1KF9B 1O0VA 2ZWLT 2NZ9C 2NY0B 3OAYK 1G7LA 3MRHB 1DBAH 5E4EC 5KZCB 1AFVH 5E8EB 3PQYE 5K93A 1S9WA 2LU7A 2YD7A 4HWZA 5EUKB 4NNYA 4XAWL 3EYVB 3QO0A 4ZFOB 1S7XB 5I9QB 3TF7C 1OCWH 3VI3F 1H9VA 2AJUL 2QQNH 2NY7L 4GW1A 5I1JH 4FNLH 2BNRB 3U1SH 3ULVF 2LABA 2C3GA 1BJ1H 2NY5L 2ZUWA 4PB0L 2DJSA 2OQJB 3LN4B 3WIIL 1EGJH 1FGNL 1S5HA 5GS2D 1JN6A 3BPOB 1ND0A 5HHMB 1Y18A 5LQBL 1SEBB 1YUHB 3PGCA 2GJ6A 3GIVB 3GJEB 4LLUA 4B53A 1S7SA 4RNRA 1CL7H 4OCWH 4R90L 1BZ9A 4J1UB 1CU4L 1CDCA 1KC5L 1MAJA 3FFCB 4F7EA 1IMHC 3HC0B 2R29H 2YMXH 1UJ3A 5ITBH 4ONHB 1I7ZB 3W2DL 3WN5A 3PWPA 4JFEE 1WFUA 1Q38A 1I1RA 2SEBA 4LGRB 3V8CA 4Z7QE 1YMME 1KN4H 4P3CL 1U58A 5HI4C 4JFXB 1I9RL 4ESKA 4RGNB 4WI2A 3DECA 4P2OC 2P5EE 3HS0A 5ICXA 2PYEB 2QJDA 4FTVA 4QNPE 4P5KB 4PRIE 2V7HA 5HPMB 3VFNB 4PJBE 1CGXA 1R3LB 1H3PL 2D2OA 3QSKB 4IRSB 1T7VA 2G5BB 3SN6N 3IRZA 3VE0A 2X4NB 1BZ7B 2C1OA 4XPTH 3S5LB 3GFUA 4PRHD 3W11D 2ORBL 4G6ML 2EE3A 1WISA 1FO0L 5CGTA 4Q9RL 3L3OB 1MHPH 4UTBH 3IDGA 3WUWB 4BH7A 4MAYC 3PF2A 1TFHA 3FONA 2IQAB 4WRLA 2UUDK 4OFPA 3VWJD 4X8XA 3VXTA 2VDOH 3I6GA 1J8HA 3CZFA 1TLKA 5DJYA 1U3ZA 2HG5B 1VB9A 3M1BA 3ES6B 5FYKD 2WBKA 2YBRB 3SGEI 4XMKH 4TUOA 4DFIA 1VHPA 3WHE0 5ALCL 4LFHD 4FMKA 5F70A 3T2QA 4WUUD 1KTKE 1H5BC 2R69L 1FC2D 5F7NC 1JHTA 2FZ3B 1INEL 4K7PX 3VGEA 4WHTA 4XNXL 3GSRB 1QACA 5SWZD 4H5SA 3FQNA 3B5GA 4MJ4A 1T22B 4CBPA 5HYSA 4N0UE 2ZNWA 3ARED 4EBQL 4X9IA 4I3RH 3BRDA 5CGYD 4N9OB 1F8TL 4Z7UF