3UX9B

Structural insights into a human anti-ifn antibody exerting therapeutic potential for systemic lupus erythematosus
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
251
structure length
229
Chain Sequence
IVLTQPPSVSGAPGQRVTISCSGSSSNIGSNYVSWYQQLPGTAPKLLIYDNNQRPSGVPDRFSGSKSGTSASLAITGLQSEDEADYYCQVRDNNENEWVFGGGTKLTVLEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARYIDFGDHMDFWGQGTLVTVSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon alpha-1/13
publication title Structural insights into a human anti-IFN antibody exerting therapeutic potential for systemic lupus erythematosus
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/immune system
total genus 54
structure length 229
sequence length 251
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ux9B01
4I1NB 1EH9A 2W9LA 4ODXB 1KPRA 1SQ2N 3KDMA 4HWUA 2E7CA 2O26U 2VDPH 2Q7NA 4XPTH 1OCWH 1FH5L 5GRZA 4X9BA 4E5XB 5E99L 3SKMB 1MWAH 2VZOA 1O5DT 4N90E 3WSQH 1ZS8B 4PJHB 4LMQE 1QYGH 3EYQD 2VISA 3O6MH 5F7NC 2W38A 4N8VG 1SYVB 1EEUA 1N5AA 1QA9B 2XICA 3TO2B 2AERT 4KVCL 2E5EA 2X1OA 4HMEA 1A7OH 2R9HC 3IDYC 5E6ZA 1DDHB 5FF6A 3LOWA 5DUBA 1DBJL 3MRKA 3VWKC 1T2JA 1QSFD 3LKPB 1BGXL 3MBED 1U8KA 2VL5A 3SBWC 2VLMD 5H2BB 1XGPA 3FO2B 3G5VA 1Q9LA 2AJSH 3EYSL 3HI1A 1C12A 3QFJA 4Z7QE 1DANU 1VGKB 1A9EA 3BIKA 3DUSA 3GSNA 4WWKC 1ZK9A 1T1YB 1RURH 5JLZA 1UFUA 3ARBB 3MCLL 5CMAA 4UILL 4Y4HD 5C3TA 5BO1H 3VWKA 5HHQA 3C6LC 4PV8B 5FO8A 5TJWK 3JWOL 5IESL 3SBWA 1DQJA 1P4BL 2VLJD 3OX8B 2VDRL 1KXVC 3H8NA 3QI9B 1JZ6A 1FNEB 1LHZA 2E7MA 3N0PB 3G6DL 5E03A 4XNXL 3SE4A 1FFQA 3MA7B 4U1IB 3STZB 1X5XA 1F42A 1I4FA 1TCMA 2JJTA 4LEXL 1V3MA 4NQXB 2VQTA 3W5NA 3GSWB 3HMWL 2EDOA 3JZ7A 3C08L 4JY6A 5JA8B 1VDGA 5IF0A 1DBKL 1MHPH 3RIAK 4JO4L 4OZFA 5JHDA 2YPKA 2VYRE 1TZGH 1VGEH 2UWEF 4S10A 2VXQL 3OXRB 1WEJL 1EMTL 5IB3A 4BQCA 3UTQB 2Z92B 4L1HA 1WJ3A 2H2PD 4MA3B 4ZFZB 4OF5A 2Y5TA 4FNLL 4K7PL 2HH0L 5H94A 4PJ7E 5CZVH 3WD5L 4L1DA 3KLHC 1CE1H 4HULB 3PIQA 5IGXL 5J0BA 1TETH 2X4RB 3MPCA 4GKOA 4NNXB 4CN4A 5KSAB 1ZGLM 4QRRA 1KT2A 3E2HB 3QEGH 1U8PA 5EZIL 2DKSA 3DXAE 3GMQB 2Y6SD 5HVHB 3Q1SL 4DVBA 4IOFC 5MERA 4MJ6B 4ZTPH 2V9RA 4ZO9A 2AABH 2KZWA 3E8UL 4NWUL 2W9EH 3QEQD 3I6LD 4QRTB 2XT1B 4X4XB 4ISVB 4E41E 2MJWA 3T2PA 3C9NB 5I8KH 1N6QH 2D2OA 3KPMA 4GUPA 4FFYL 4I0KA 5GGUA 4I77L 3NACL 1W72H 1Z0NA 2OJZL 5D7SL 5DURB 3GGWA 3FT3A 3LSOB 3I9GL 5D2LE 1S7QB 2CO6B 2R1WB 3AM8C 1BFOB 2EC8A 2X4NA 3DMMA 4JO2L 4TSAL 4EI5B 5D6CB 2HTKC 4OZGB 3QXAA 4NT6A 1DJSA 4NCC1 3P9MB 1IGYB 1DEEB 4AEFA 3PL6A 5I1KH 1YYLH 3IT8D 4URTB 2EXYC 2RAMA 1Q0XH 1Y0LA 2FRGP 4NQDB 4S2SB 3ROOA 4X5XA 3V5DA 5B4MC 4PR5B 1HHGB 3AM8A 4WNQA 5BVJA 5DD6B 3GZKA 3BT2H 5E2TH 4S1DC 2P8PA 1Q9KA 4NP4H 5FIEA 1T5WB 1AXIB 1G7HB 4UDUA 5C0AB 3IF1B 3L3IA 3TT3L 5J06A 1H3VA 4S1SL 2GSGA 1FC2D 3QI9C 4JFHD 4RIRB 3T0BA 4MD5B 4UTBL 4ELMF 2ADFH 1PW3A 1J11A 1CDCA 4QCIA 3SJVA 3SOBH 3MMEB 1NCCL 4OLVL 1EGJA 3VWJC 2W0PA 4J12A 4FQIL 4ELME 3T4AA 3TV3L 1BM3H 2EC9T 3CX2A 1G1YA 4PG9B 2NXYC 4N9GA 4XHQA 2R23A 2Q8BL 2VUOA 1QLFB 5CLWA 5IV2A 4EQ3A 3F58L 4J3XA 3WEXB 3WV0A 1BVLB 1JNLL 25C8L 2HJFA 4NQXA 5D7LB 3VWJA 1JGEB 3O2WH 1YEFL 3SGDH 2R0LH 3PWPD 1CD0A 5DRNB 4FXKA 1A7BA 1FAKT 4BSVB 3AY4A 1R3HA 2Q3AA 1INQB 1T04A 3CLEL 4XVUD 5C09E 1YMHA 3HG1B 5IFHL 4HBCL 1SEQL 3FQWA 2DL9A 1DFBL 4HIJB 3VDCA 3GIZH 5J7CC 4EN3D 2X4SA 5I1AB 3E2HC 3OAYH 3RP1A 4FFVC 5TQ2H 2VXTH 2BMKA 2KQMA 3T3PF 5I76A 3T4YB 2FX9L 4PJIF 5GS1A 5HVHC 3PDOB 1I1RA 1YY9D 1UZ8B 3LEXB 2EDFA 5EOCJ 3RVTD 1U92B 2HWZL 3NPSB 3CIQA 2VKWA 3T3PE 1AD9A 3NN8B 2OR9H 2PTVA 4XC3L 1T0NA 3DVGA 2AAVA 5F72S 4EVNB 4NUJA 1KB5L 3SKOB 2DQGL 2VAJA 2APFA 4JPWH 3F8UB 3TZVB 2ERJB 1IM3B 1H8OA 3PHQA 1KTDA 1YZZA 4GKNA 4L4VD 1BFTA 2LE9A 4HGKC 5E7FA 2DYPB 5FA3B 3UMTA 3ULVH 3BJLA 3V52L 4EI5C 4N0FA 3ZT7A 3RVXD 4K23H 4M1CC 3IAPA 1KGCD 4JCLA 4JDZB 3HS0B 2BC4B 2FHCA 2PXYA 4RFEB 3EJZD 3HKFA 2IC2A 1WBXA 2DB8A 3MR9A 1HE7A 4ZNEA 1FN4B 1CLZL 3G08B 4NJ9L 3WLBA 5IT2L 3UPAA 3HAEA 1PSKH 3MRFB 3P4OA 4HIIA 4OFPA 1F4XL 4J4PC 4Z78A 2J6EH 1FH5H 2IPUG 5L2JB 3OAZH 3HC0B 5E99H 4NBYB 4QHMA 2ICWB 2P47B 5FHBH 2IPUK 3VXSE 2APXA 1H3PL 2BXYA 1NCWL 5DFVD 2J8OA 3A6OA 1T20B 2QTEA 3F12B 4QRPA 3EOTH 4MJ2A 4LDOB 4RISL 2OK0H 1WUNT 1VPOL 1IGJB 1KJVA 5DMJB 3TPKA 1AE6H 5KAQF 2XI9A 4RIRA 4XWOC 4C83B 3MFFA 5F7HA 5HI5D 4MA1B 3D3VD 4IMKA 4JN2B 3IDMB 4GSDL 3MV9B 4PJ5B 4HPYH 3MMEA 1UENA 1QNZH 4GAGL 3SO3C 2BY0A 1A7RL 3MCLH 1BBJA 1P2CA 4XVJL 3EZJB 5JOPD 1P1ZA 5ISZA 1BD2E 1HI6A 2NYYC 5MP6L 2YHGA 3LKNB 3BDBA 3JWOH 4ZFOL 5LVEA 5IR1B 3VI3F 3L1OL 43CAA 1P4BH 4LCCA 2VDRH 2YXFA 5DEFA 4WO4B 3NFPA 1V7NL 3EYUL 1CDYA 3V79C 4OCSH 3UPRA 4JFQA 3WE6B 2RJMA 3QRGL 4HIXL 1XF2B 1X4ZA 4GW5B 1CIDA 2F54E 3BQUB 1U93A 4H1LH 1MCNA 1XCQA 4RA3A 3VI3E 4RMSA 3MLUH 2BY3A 2C9AA 5D7IA 4G9FD 5DI8A 1OLZA 3E6HA 3TPUB 2HKFL 4Q2ZB 5T1LB 2AKRB 3HMWH 3SDDA 4RDQF 5KG9B 1M7DB 3NPSC 3WS6C 1QR1B 4Q7DA 1DBKH 4YQXL 2BHYA 4JO4H 4Y16D 3T1FB 5DRXB 2B5IB 1BFSA 1YPZA 2VXQH 3TZVC 2DWDB 1WEJH 2ERJC 1RHFA 2XY1A 1QFWI 3BH8A 1OGAE 1F58L 3S35H 4HUUA 4HC1L 1TZIB 4R4BB 5I73C 4PLJC 3HE7B 2HH0H 4PJXF 1DVFD 4NZDA 1FO0H 3ILPA 4NQVA 2EIBA 5IGXH 4YX2H 3WS3A 5HGDB 4BZ1L 4PJXE 3UTSD 1D5IL 1ODAA 1FVEB 1JRHH 3BX7C 4YHYB 4HUMB 3K4AA 4NWUH 2XWBA 3B3IB 4NQCA 5IB1B 5D1ZB 4CMMB 3U2SB 3KPPB 4Z95L 1BEYH 1FN4A 1X5FA 4KROB 5DSCB 1CD1B 2VZSA 2EO1A 4ONHA 3WN5A 5C0EA 3NACH 5F7WC 3RWIA 5BQ7B 3QEUA 1DLFH 4CL7A 4H0IA 1MJJA 4LVHB 2W91A 3X13A 3DETC 3EAKA 5F7KC 1PEZA 4MNQD 1QFWL 1RFDL 3HLAB 3GI8H 3MV8E 1XH3A 1VFUA 4MA1C 2VDKH 1XR9B 1JMXA 2N56A 4HZLB 4KJWC 4X9HA 4M6AA 2OI9C 4NN6B 5FKAA 1WCQA 2ZPKL 4IRJD 5GZND 1UA6H 3MRHA 5GRVK 2IMMA 4WI9A 2NXZD 2R2CA 2XACC 2V2TA 5IHZB 2ARJQ 3EOBA 1XCTB 5KVFH 4X4MA 4HIEB 1HYSD 2X4OB 4XPBL 4YHOL 1BBDL 4XH2A 3TIDA 2XYCA 1P7QB 3KYMB 2VDLL 1CT8A 1HXYB 3QJHB 4PJ7B 3VXQA 1FIGL 3BWAA 4RWHA 5T1KB 1OP9A 4OI8A 2BSTA 1JWUA 4P5KB 4RGNE 1ZWIA 5GIRB 1GVIA 4M43H 2CRYA 2HT4C 1IAOA 1LE9B 4KQ3H 2NY2B 4XT1C 5E8OB 4JCMA 4GW1B 3DXAB 3TV3H 2IQAA 1HSAB 2NY6B 4B53A 4M61A 1OAZH 4RX4A 1R3JB 4O4YL 1DQDH 2B5IC 3KPRE 2EEAA 4Y4KD 3F58H 4BJLA 1JHLL 1W0WB 4J3SA 4CADA 3FT4B 4HW6A 25C8H 4M1DL 2VZUA 3WNLA 4PGEA 4E41B 3MLWL 2IPKA 4KUZH 2GYSA 1HK6A 3CPLB 2HLFC 3F7RA 3DX6B 3U7YH 4BQ9A 3BRFA 4L3CB 3MRPB 2H32B 4HK0B 4U3HA 5LGHL 4R96B 4WU7B 5IFHH 2AJ3A 4HBCH 1QRNE 3QUKA 4U6TA 5B8CB 5D2LB 5FECA 5HPMB 2ARJA 1K5NB 3MRNA 4PJGF 4D9LL 4RWYL 3CFKB 2VMFA 2BRRH 3CUPB 2FX9H 4YXLL 1X9QA 5KSUB 1BLNA 4EOWL 2VABB 4X6CF 5IB4B 2OX5A 4PJGE 1L7TH 4G8IA 2HJLB 4YHYC 5TFSL 3VFGL 1F6FB 2HWZH 1ZHLB 2V7NB 4OGAC 4Y89A 1S9YA 2V2WA 1EEZA 1AGEA 1FZKA 1YEKL 5KSBF 3QDJA 5K9OA 4X6CE 3KPSD 4MA8L 2H2SC 1IFHL 4UMGA 1WGOA 2BNQD 5C0RL 4KRPB 1EHNA 3K1DA 4GLRI 4R6UA 2DQGH 5GSRB 3EOYG 1QD0A 4N0CC 4PRAB 1OM3H 4YNYB 5DHXB 4LVHC 3B3IA 1OAQH 4NCDA 1D5ZB 1GOGA 4L4TE 3V52H 1VEPA 3B9KA 3H9SB 2D7TH 5C9JA 2IWGA 3OAUL 5HHNB 3O3AB 3IU4L 1E28B 4HKXB 1FDLL 2ZUVA 1FFOA 4D0BA 3V4PL 5BQ7A 4HMDA 4RZCA 3ILQC 5KSVA 3KS0J 4XHJD 2A73B 1EERB 2HFTA 4NJ9H 2DMCA 3FN0L 3MA9L 3QHFH 5IT2H 1I9RL 3QO1B 1LK3H 3QDMD 1A7QL 4GBXA 5LQBH 1BQSA 4UINL 4JFEA 1YEEH 4I3SL 4NNYA 4YE4L 2CIIA 1NFIB 3RNKB 5I8CA 4HQQH 4FFZH 5ELIA 3W81A 2ICEB 5DJ2A 5C09B 5LBSL 2XQYK 3BVNA 1XGQA 4YWGL 5IVNA 3ZO0A 4N0UA 1NCWH 4EDXA 4AG4L 5CHNA 1F90L 2BSRA 5IFAL 5ICXB 4UV4L 1DEDA 2NY2C 5EIIB 1A14L 3BP7B 3GMMA 3OG4B 5L9DH 2OCFD 5EU4B 2YEZA 3QO0A 2P5EA 2NY6C 4OUUB 2UWEA 2VOTA 3L5JA 3ZE1F 1RZIA 3MYJB 4ONFL 3VD3A 3LMJL 5J12C 4PJ9D 3SKNB 3IGAA 2IADB 1NBVH 5EZLB 2DWEB 4KUCD 2D3VA 4A6YA 3TYGL 4ZQKB 2JELL 4RQQB 1HOCB 2YN3A 3ZE1E 1SEBA 4DKEH 4F7PB 2B8OT 3INUL 4ZFGH 3OKEB 1WFNA 1HDMA 1G6RL 4BSWA 5F7YC 2A6KA 2V6HA 2ORBL 4NO2B 5MP6H 1BOGA 5C2BH 3MRBB 2D03L 4O9HL 5B8CC 1PYWB 2CK0L 5J89A 1KPVA 4KDWA 5BS0B 2CKBB 2DI7A 2YD6A 4LRIA 5F3HB 5J1AA 1RZGB 4K71B 3O9WD 2FEDD 3KPQA 3MBXH 2YD7A 2PYEE 3G5XB 1FC1A 1Q94B 5GGTL 3MROB 3HNSL 2XZQH 2HKFH 3BSZL 3G5YA 4M48L 5EU6D 3O6FB 4FP8H 4LF3B 3VE0B 1XF5B 3VXTA 1HNFA 4XP6L 4BH8A 1Y6NR 2DJUA 4X6DF 5IB5B 1U3ZA 3KYNB 4LVNB 4KRPC 4PJ8B 1R0AH 5SWSB 1KJ2B 2VABA 2B1HL 1KJ3H 5DO2C 3TN0D 1U2CA 1UWXK 2EXWC 3W9EA 3FN3A 1JYWA 1FYTD 2FJHA 3K1KC 5TF1H 1A1NA 2FLBT 1MPAH 4OGXL 2EE9A 1YNLH 4X6DE 3VXSB 5T3XL 1C1EL 4FHBD 4RBPK 2NZ9C 1QPXA 4ZO8A 4UNVA 4P2OD 5IKCA 3TT1H 2IH1A 4JKLA 4YDVB 1BAFL 3CSGA 1D5ZA 3MRGA 4PJFF 3L6FB 3OPZL 4EBQH 4XCCH 4PRID 2D0GA 4OIBA 4YDJA 5ERWA 3FCTA 1NFDA 3ROLA 4XNZB 4ELMA 3VXME 4YHNA 4U6VL 3M1BB 4PJFE 4Z95H 5DJZA 2R39A 2YZ8A 3OB0K 5FYJL 4KKNA 2FATH 4XXCA 2V5SA 3MV7D 3HZKA 5IOPB 3QQ3A 3RY5A 3PGDB 4F7EB 4YPGB 2OXGA 3LS4L 1QSED 2EDQA 2HMID 3ECBA 4QF1B 3HE6B 5I75C 1NFIA 1C7SA 3EO9L 3SDCB 4NSKA 3HPJA 2QADB 2OZ4L 4LKCB 4YFDB 2QQQA 5GGQL 1WITA 3CXHJ 4LDEB 4LU5L 4NZUL 1RD6A 2ITDA 3A6CL 4G5ZL 5KAQG 4M62L 4YJZL 2R0ZL 3HPLB 5I8OH 3O0RH 1QFWM 5HHVH 3KPTA 2DM3A 4P4KA 3TIEB 1G7PA 5LAXA 3HRZB 3T0WA 4G7VL 5FGBC 3GSXA 3LRSB 4PTTA 4WHCA 3BISA 4LHUB 1YEJH 1OGAB 1EBAA 2FGZA 1BBDH 4PJIA 5AAMA 3SN6N 1ZT4A 3MLYL 1UYWH 3RL1A 5DJCB 3C87A 4D8PA 1FIGH 4K71C 5FV1L 2OTUB 4OQTL 1GC1L 3WBDA 1K8IB 5BRZD 3TNNA 2G5BB 2KPNA 1ZMYA 3MRBA 1JI1A 4ZUWA 3SDXF 3MRMA 3FB6A 2J7LA 3UCRA 3CFIC 3QUML 5F3HA 2FR4A 3KYOB 2QV2A 3TYFB 2AXGB 4O4YH 3AXLB 4RDQG 4LVNC 5K9QI 1JHLH 4PJ8C 3FAXA 1UB6B 4KQ4L 4LHUG 2NY3D 4M1DH 4NKOA 3GJFH 3MLWH 5DS8B 3NIGF 4XX1E 5E00A 1GGIL 1SY6L 4OCRL 4NPYA 1OAXL 1DN0B 1YC7A 2W92A 5FCUH 4G42B 3O6LH 5CWSB 1HHJB 2XIDA 5C08E 3CVHA 3NIGE 5CP3H 1EHAA 4G8GE 4PJ8A 5HBBA 5TGBB 4RWYH 3PV6B 3NABL 2DN7A 1S7VB 4JANA 1C8PA 3MV8B 4YXLH 1KC5H 4MD0B 3S37X 4EOWH 4MXQD 2FWOA 3M45A 1XGUB 3EYVB 4WDIB 3PWJB 3X11B 2VN4A 5DK2A 3VFGH 1I7ZB 1Q0YL 3BYYA 1MHHA 4KKAC 4FXGA 4XNZC 1YEKH 3BP6B 3IXTB 3RY4A 3H3KA 3L7EA 5AZEL 4OZHF 3OR6A 1IFHH 1KXTB 1MCLA 3CFDA 5C0RH 4YUEL 5HI4C 2VAAB 3CDGB 5J9PA 1HCFX 2ED8A 1S7XA 4OZHE 5DTFA 2IAMA 3JV6B 3RZWA 1LEGB 3SDCC 1ONQB 4RGNB 1NGPL 2QADC 2EYRB 3OAUH 2IG2L 1JNHA 4OIAA 1I8KB 5DVLA 1BD2A 1E27A 5A16B 4PPTA 4XBEL 5HHPA 3IU4H 3CFBB 2B4CL 3GIVB 2XKUA 5IOPA 4KI5F 3V4PH 4YAQA 2YRZA 5F97E 3PP3H 1S7TA 3FB8A 2EDHA 5I1DA 3MA9H 4JFOB 1MFDH 4XB7A 3KPRB 5BV7L 1ZLWH 1A7QH 2F54A 1T7YA 5GXBB 4KI5E 4GAYB 4JDVA 4X98A 2HFGL 4FQ2L 1RZJL 1X7QA 1YEHL 2VLRE 4HGWA 3GNMH 4HWBA 2HN7B 1VEOA 4ZAKC 5ESAB 1NQBA 5KOMC 3GSRA 4U6HB 4HKJB 4MVBD 4RAUA 4AQ1B 3I75A 1QRNB 3QBTB 4YWGH 3VXNB 4AM0A 3NZHL 5I71C 2Q6WB 1F90H 3RGVA 2N7AA 2C3VB 4PV9A 5FAAA 4PJBB 2DQEL 3TBVA 4ZAKA 4M6ML 1L9NA 4Y5VB 5INDB 4FQCH 4YHLL 1A7NH 3O4LA 1RZKC 4JFZH 2DBJA 4P0DA 4F80A 3LMJH 1RUMH 4POZC 5DD3H 3CC5A 3KHOA 2ID5A 4JM4L 5F9OL 4YEFA 1C5CH 2DJSA 4IIQB 1UM6L 4GT7A 4MLSA 4X6CB 4ZPTB 3ME0A 4PJXA 1I75A 5I30L 5L2KE 4C56E 1RJLA 1AGDB 2J8UB 2FCBA 3HC4H 3I6KB 3AMLA 2ORBH 4WGWB 4L8CA 3MO1B 5F6HJ 4FQPA 1E6JH 1W0VB 1JYXA 1U8QA 3AU1B 1KFAL 5M7QA 4L4TB 1OP5H 4ZDHA 5TDPB 5E2WL 5I1HL 4ODUA 1AD0A 2QSCL 2AJXL 4OLWH 3MNZB 3PF2A 1K85A 1OTUD 2XPGB 3W82A 3FRUB 1I85C 1T21A 3RWHA 4QNPF 4KJQC 4EEEA 3BSZH 1PAMA 3C60A 2WV3A 4M48H 3CK0L 3U30C 1MCRA 3RTQD 1MRCH 4XP6H 3BJ91 2VDQH 4QNPE 3VD4A 4XCNA 2YC1A 4GW4A 4Y7MA 2E7LC 1ZHNA 3GMOA 1CGVA 5F9JB 4J3WA 4KY1H 3K2UL 1PD6A 1RI8A 3KXFE 4NBZB 4OGXH 4S1QL 2K7QA 2CXGA 4RFNB 5E4EB 4NO0A 1C1EH 4RGNC 4B7LA 1MUJA 3QG6B 1WWBX 4PUBL 4JHWH 3P3YA 3TVMD 3L9RA 1WBZB 5E5UB 3NAAL 3ULUF 1Y18A 3C6SA 1QSFA 5I17A 1JUFA 3K4ZA 4F37K 4DEPC 2E7LA 3BEWA 3NFSL 4HV8B 2EYTB 3QIUB 1ZLUK 3TJHD 2CDFB 4NNPH 4RNRB 5K9JH 3U36B 3QXTA 3JV6A 1OAUH 1CICD 4KK9D 3OPZH 1VACA 5DMGD 4Y4HA 3C5JA 3BFOA 1MHEA 3SDYL 2X4PA 3ARXA 5FO7B 4YFLI 4UU9B 5EU7E 3ZDZF 1CDUA 2VLJA 3HFMH 4U6VH 5ICYB 3GSOA 3QQNA 5FYJH 4G8EB 4ELKB 5C07D 3P73B 1HH9A 1IGIL 4FQQB 1DUYB 5I19H 3ZDZE 4LBEA 3WIHH 4B5EA 1BPVA 3S37L 1IGML 4S11A 2NNAA 4I2XE 3EO9H 2D0HA 3GBML 3JWDL 4UIMB 4E0RA 2OZ4H 3QWOA 4MGXA 2LQRA 3U82B 1U41A 2PYEB 2WWMD 4GKSB 5EOTA 4LU5H 4NZUH 3B83A 3BAEH 1RZ8A 4JM2F 3WO3B 3DX7A 5DR5L 4B7IA 5JDSB 5DD5L 1TQBB 1KENL 4QTHA 3GMRB 3T09A 3V4UL 1MHCB 4LSRL 3GK8H 3MRJB 2H9GB 5CGYC 1KNOA 1NBYB 3OGCB 4MAYD 3BN3B 4PJGA 1CU4L 2AXFA 4MD4A 2BOBB 4JPIA 2CLZB 4JO3H 1J12A 4K3HA 3EJYD 3U4AA 4RMQA 3L3OB 2Q86B 2ZUQB 3BE1L 3PE9A 4FMKA 4LCUA 4JKMA 1GC1H 3NOIA 2B1AL 3WHXA 1SJHB 5KSBA 3WXWH 5C0CE 1IQDB 1YY8A 2H32H 5HYFA 1AQDB 2WAHA 4CJ0A 4NRXB 4ZS6D 4Y2DB 3I6GB 4FTVD 3UTSE 2GJ6B 1N3NB 3LKQB 5CJQL 5DJAA 3QH3B 5DWUL 4GRWH 4U31A 1CDBA 3VFWB 5KN5A 3G6JF 3VXMB 4KMQA 1MOEA 1GGIH 3ARFB 4WHYH 4B50A 3IJYB 5E4EC 3FL7A 4Y19D 5TH2B 2OYPA 1NMAH 4OGYL 5T3XD 3G6JE 2MTPA 1HHKA 4FG6C 4XXDB 2GAZB 5EORL 5IVZA 5ITBH 1A64A 4L9DA 4JFFD 3NABH 5TPWH 4QOKD 4XCEB 2VC2L 5DFTA 3GB7A 1NUGA 5A43C 1A6TB 4LNRB 2P24B 5DMKB 3HZVB 1XGTA 2VZTA 4KK8D 5JIIA 1RIUH 3C8HA 1U36A 5AZEH 4UDTA 4YHKL 1IVLA 1I8MB 3PWNB 4YUEH 3HZMB 3CFJA 4RMRA 3LKSB 2EYSA 3VFTB 4BFIA 3THMH 1LO0L 3GSNL 5BOPA 4LIQE 4Z0XA 5H37H 1UWEL 3BI9X 3W11C 7FABH 1KN4H 1CE6A 3D6GA 5BJTA 2X89D 3WJLC 5HGAB 2R1YA 2IG2H 4OCXL 3QA3A 4XBEH 3VRLE 1GCFA 3KPOA 2B4CH 3PHOA 4X6BA 3FB5B 3IDIA 5EH1A 2GK2A 3Q6FB 3QUYD 3UXFA 1U8HA 1TQBC 4X99B 4P9HC 3PNWA 3GFUA 3G04B 1VHPA 3OXSB 1OSZB 1TTFA 4KHTL 4OFYD 3Q6GH 4D0CB 1QLRA 2W9DH 3B2VH 1T22B 4FQ2H 4LPYA 4GKSA 3D5OF 1YEHH 1X5YA 4L29A 1NANH 3EHBD 2VB5A 4FZEL 4K8RC 5BMFH 3I85A 2ZUQC 5T3ZL 1YN6B 3O2DH 2Y9RT 1HHIA 3N1MC 5IMKB 1H0DB 1MCPH 2GHWB 1JK8B 4LGRB 1AO7E 2HG5B 5IG7B 1GXEA 2Q76A 1GGBH 2NY5H 2H1PH 5CIPA 4Z0BL 3T8XA 5INCA 4XAKE 5I1GL 1FGNL 3C5SA 5D1QB 4G3YL 4WENB 4M6MH 1K2DB 4X6DA 2XG5A 4PRNA 4Y2DC 5C7XH 1XIWB 2APVA 4LLDB 4KKBD 1CGYA 5C0JB 1A6UL 5HPOA 5EG6C 2R2BA 4KAQH 5IWLC 2CKBH 3NZ8A 2EKJA 5EU3A 5J8OA 4JM4H 4TTDC 4TSBH 1J0HA 4XX1G 2X1PA 4LEOB 1IQDA 5I30H 4RAHA 1EVUA 4NQEE 4P2QE 3EOAA 3I6GA 3FONA 1LO4H 2JB6B 3IDGB 3UTTB 3WDJA 4U1LB 5IWLA 1F4WH 1PDKA 4X7FC 3A67L 1KFAH 4YHZL 1KCRL 4PJFA 3VFOB 1S5IL 3AC0A 5DVKA 2QSCH 4IS6A 4WI6A 2VR9A 1A6VL 3V6FB 5C71A 4MXWL 4WFHE 4ZUVA 4J8RB 1NAMA 1JE6A 1G7LA 2JIXA 3ES6B 1Z9SA 5CJ8A 2X05A 1ZV5A 2ZCLL 3L3HB 4WHTA 3IDNB 1NUDA 3MLRL 2GEEA 2VQ1B 2BZDA 4AIZB 5JW4M 2LV4A 1HHHB 2VLRB 2FIKA 1IMHC 4GG8B 4OD3L 3TJEH 3T0AA 3S36X 2FSEA 5KTEL 4TNVF 3HMXH 5HDLA 2CIKB 2Q20A 4S1QH 1CR9H 4HFWA 1GPOL 2PTUA 4PGDA 1JTTA 4NZTH 4CW1A 5DJ6A 2R0KH 3DNKA 3NAAH 1A6ZA 1G7QB 3PQYB 4UIKH 3LRHA 5CEZL 2NY0C 3D3VA 5HHOD 5J6HB 1IKNA 4P5TB 2JJUA 3MV11 1Z5LB 1IGFH 1RK1B 1ETZA 3L95A 3OKOB 2H6PB 3PP4H 5IJVA 1AC6A 4Y4FD 2OSLB 3JV0A 1ZKAA 1JPFB 1DQMH 3QQ9C 4OLXH 1AFVL 1EGJL 4Y5XB 1AQKH 3KWWB 1ES0B 4YBLB 2R2HA 4HPOL 1Q72L 4HUXB 5L2KB 1FFNA 2LAGB 4FRWA 4C56B 5IMLB 1HXMB 4WFEE 2FX7L 3B8SA 5E94B 3ARGD 5FOJA 3K74B 3CMOL 4RAVB 2BVQA 1IGIH 3CH1A 3O6KL 1RPQA 3DURA 3ARUA 1I9IL 3BZEA 5I2IB 3SDXA 1MRDL 1MJ8L 4K7FA 5SWQB 3C5ZB 3RKDD 1C08A 3T04D 3GBMH 3JWDH 4WU5A 2XWTA 3OHXB 2O61A 5BZDA 5GHWH 1XIWC 4QHKI 1QBML 5CGTA 1NGWB 3QULA 4L8BB 1FPTL 5C08A 2I24N 1IKFL 1N0LA 4G8GA 2HG5A 4QHLA 1KENH 2AJZB 4N8CH 3O3EB 4KH2A 4BYHA 5MEQB 2X4QA 3D85B 3UTPE 1NFKA 2NW2A 4KTDL 1UJ3B 3WDIA 1MVUB 3TBYB 4OZIB 2DM2A 5F1NB 1CU4H 1WWCA 1DVFA 5IROA 3KXFB 4Y2OA 4JQXC 4WRLA 4PRPD 3CSYB 1WZ1H 1OF2B 4PLKC 1AGFB 1SJEA 3QCVL 4WI7A 4JLRB 4Z7WA 3ZZ1A 3IDGA 1NCDH 5LGKA 4OZHA 1NLDL 4TUKL 5HGGS 2PTTB 4JQXA 4KI5C 2YOCA 2QQLL 5CILL 1WLHA 5JIPA 2Z4QB 1S7WB 4HIHA 5IBLC 1F97A 5CJQH 5DWUH 3NCYP 4ZSOA 3EDJA 5F89A 2C1PA 1XZ0B 1EXUA 2I60L 3MLPA 2UY7A 1IBGH 3L3HA 4PRBB 1JP5A 3AB0C 2ADGB 1AR1C 4U6YB 4FQXA 4OLZL 2BY1A 2MQ3A 4N5EC 4I2XB 3VMOA 5D4QA 1IGTB 4HJJH 1IARB 1ZVSA 4W70A 3SQOL 3T77B 4P5TC 5JORA 2W60B 4X6EB 3CZJA 5AG8A 3DROB 4O51B 5JIHA 3PABA 2BCKA 4HXBL 2OJEA 1EFXD 1U58A 5B39B 3TA3C 1MIMH 5GJTH 3GSVA 3HI5H 1TJGL 2IJ0C 4YBLC 5DQJA 2WBJD 3KLSA 2YRLA 5JPNB 4JM2B 4RA0C 1KIRA 4YHKH 4YDKH 5HXMA 2MPAL 1OOAA 3TA3A 2FZ3B 1FL5B 3GSUA 4Z77A 5KBNC 4TVPL 1LE5A 3WMSA 5EBWB 1YMMB 3M17A 1ES0A 3PDGA 1J8HB 1CWVA 4ODWA 3U6RA 4OJFL 2QR0B 5E8PA 5C8JB 1F11B 2YSSB 5D8JL 1FGVH 4OCXH 4X80L 5B39G 3SHSA 3O8XD 4HS3A 4GG6A 3UJTH 1Q1JH 12E8L 1N2RA 1MFAL 4I18B 1CFBA 4PGBB 1PJ9A 2ZSWB 5IIEB 4F8QA 4ORGB 2NX5E 1NUNB 3OR7B 4Q74A 3UTSB 1FFRA 1YEDB 2QKIB 1Q9WA 2YK1H 1RIVL 3S36L 4OF7A 4KVNH 1OGTB 4OBRA 3ESUF 1UJ3C 4Z7UB 5F9AC 4YZFF 1JN6A 2D31B 1EO5A 4FZEH 1AIFA 4OZFH 5CJOL 5T3ZH 4YZFE 1CLOH 3G6JB 3UBXB 1OD7A 3QDGE 1KB9J 1K4DA 1NCNA 2G60L 4TRPH 4RMUA 4XVSL 3DRTB 2XN9E 2XTJE 5KVGL 3BO8A 1S5HA 3DV4B 3I2CH 2P5WE 5I1GH 3H9HA 4XC1L 2ICWI 3V6OA 2QLVB 3ULUC 2EH8L 4UT9L 1UM4L 4U1NB 1QFPA 3L3JB 3R8BB 1H15B 4HS8L 2YA2A 2ADIA 3MUY1 1OF2A 5ID0A 7CGTA 1AGBB 3MTRA 4BM7A 5EU7C 1AGFA 2AK4D 4APQD 2C3XA 3LPWA 4QRQB 3RX8A 3D1MC 5F88A 5J6GA 3MUZ1 3MRDA 3IETA 4XBPA 4HAFA 1JPGB 1N59B 3PDDA 4LSQH 3EDFA 1RJCA 1TZHB 4HLZG 4MWFA 5SX5K 1FYHB 5EN2B 2J3SA 3QIWB 3KNBA 4LDLB 2F53E 4O2FA 2OTWA 5I9QB 3S3JA 5I1CH 1ZHKA 2YPLD 3WFEL 3QIBB 4G6ML 1EEYB 1A6VH 3QEQE 3L5WA 4MXWH 5C0DB 1IAKA 3QDMA 5CEYA 2VDOL 4IOIA 2BVYA 4NUGL 1X5HA 4ODHL 3RPKA 4U4BA 4OAWA 1OB1A 4JM2C 5AUMB 2G75A 2X4UB 1NAKH 4PFEA 1B0GA 2PO6C 3QG7L 4JRYE 3V5HA 4PLNC 43C9A 4CVXA 1PX4A 3O4OC 2FL5B 3UJIL 3ULSB 4OD3H 3EFFA 3P0YH 1IM9A 3GKWL 4W4NA 1M1SA 5KTEH 2FYYA 2APWA 3RU8H 3QFJD 5GS2H 1AO7B 2R9HD 1X5ZA 1CFNA 2PO6A 2I27N 1I1CA 4HS6A 4LMQI 4KTYA 4J3VA 4WEBL 3VWKD 4QYOA 2X40A 3VJ6B 4I18C 1AXSA 1GGCL 4TN9A 3LEYH 3O41B 4ODTH 1T1XB 5K9KA 3ZKSD 4WWKD 2C3HA 4YXKL 2R69H 5I1EH 1CFQA 4PRDA 1EGJH 4JFHE 5TDOA 4HPOH 1Q72H 4GAJL 5C0CA 3C6LD 2H41A 4I0PC 4NQEB 2ZSWA 1A1MB 1QR4A 3CVIH 2UZYB 2CDEA 3UO1L 3RZCB 1N64H 1RJYA 3R1GH 3FOMB 1HZHH 1I3RA 3O9WA 4ZOEA 4MHHI 4P3CH 1K4CB 2EIEA 2IF7A 4P2RA 3S96B 4D0DA 1CDIA 1I9IH 1P9MA 3IDXL 5T3ZD 5GS3A 1NLBL 4KKLC 3PGCB 1A9BB 4PRHB 1PLGL 2ICWJ 3KPNB 1NMBL 4I0PA 4YGVA 5IBUB 2DQDH 5GSVA 4JVUA 2A6DB 1DUZA 1IKFH 1QHPA 1CDHA 2IH3B 3MRCB 3B8YA 1KG0B 1FL3A 1F3JA 2GJZA 3PWPE 3ZSSA 1R5WA 3DVNB 2WK2A 1UVQB 1FYTA 5DRWA 1UKTA 5IEKA 1VFAA 1U0QA 3Q5YA 4HAGA 2FH8A 3QIWC 5I0ZA 4BSJA 2GTZA 3KLHD 1G7IB 4U1SB 4WUUE 1KPUA 4F2MA 1EV2E 4WIQA 4ZS7L 5DHVB 2MCPH 5ESVB 1L0QA 1JPGA 1T0PB 5IBUG 3L5IA 1KLUB 1X5JA 3DRQB 5GRVL 5TE4H 4IOFD 1SYSB 1ROWA 4KV5F 3MFGB 3FOLB 4JQIH 1VFBA 2J88H 3QHZL 4JKPL 5BOZG 4F3FB 2HRPH 1MH5B 3AVEA 3ZT6A 5M95B 4O02H 4MDJB 1KCKA 4L4VE 5I1LB 2Q3ZA 1UZ6F 2IGFL 4KV5E 5KW9L 4JAMA 3ARRA 4A2LA 5FDYA 2I60H 5LCVL 3WYRA 3X12B 1KGCE 3UYRL 3OKLB 3HAEH 4MNHA 3Q0HA 1UZ6E 3P77B 4NKDB 2GFBB 4H8WC 2H45A 4I5BA 2G2RB 4QRUB 4I48B 2HTKD 4DFIA 1G9NL 1F8TH 1WICA 4U7MA 2AW2A 2ESVB 5CEZD 4GKZB 4TNVK 1T7WA 1BWWA 2EE6A 4WGVB 2PCPB 2EXYD 3MUGB 2A6JA 3QEHB 5CEXB 2HFFB 2QHLA 4YHIB 4AEHL 5B4MD 2BVPB 5DLMH 1ZLSL 3SJVD 2FO1A 2HT3C 4Z7OF 1FVDA 4HH9A 2IEPA 4NRYA 4QHUB 4S1DD 5JO5A 3OF6A 4MJ5A 2BVTA 3RZCC 3DV6B 3FQTA 2EICA 3CZFA 4DZ8B 5JNYB 1GZPB 3QI9D 5CBEA 3V5KA 4Z7OE 4XP5L 3V0WL 2F19L 4P3DA 4A6YL 5BRZA 4XVTH 4NO3B 1A0QH 5IBTL 4YXHL 3W39B 3VWJD 5IFJA 4H25A 4MCZB 4P2QA 5FDWA 2UVFA 2FJFB 5D8JH 1S9KC 5D7JB 3OQ3B 4LSVH 4GRMA 3QB7C 1YNKL 4QY8B 4X7TA 5DMIL 4NYLB 2W0KA 1MFAH 1RVFL 5KJRL 2NXYD 3OKDB 5EO0A 4OD2B 5DT1H 1LEKB 2BX5A 2QHRL 1J1OL 1NJ9A 2A77L 4K3EL 4U7SA 1G6VK 4LCWA 4ORZC 5C0FB 4N1CA 4HWZA 3LQAH 5FHAH 5FK9B 2GITB 4KZEL 2BDNH 3RWJA 3VD7A 4HC1A 4GRLB 3CFCL 2BFVH 1G7JA 3LZFH 3MZTA 5F7DB 2R2EB 4JHAH 2RHEA 2AV1B 1LD9B 3CFEA 3PWLB 4X4ZA 5MENE 2C7UB 4G9FE 4HUVA 4JFYA 1WBYB 2IBZY 3VDAA 4FFVD 4ZPVA 5IP4A 3VXOA 3BPNC 4RRPG 5HD8C 5KVGH 5C0BE 1X44A 4XC1H 1LO2H 2HJKB 2EDXA 3RPIA 3P4NB 4WW2F 1U8IA 3V6BR 5LJYH 1NSNL 4HS8H 4HWEL 3ULVF 1UB5B 5T1DL 1D5XB 5DUPH 1AXTH 5J56B 1OTSC 2PXYD 2VLKE 4LARL 2NR6C 1YEIL 4M02A 1E4XI 4ALAH 4OT1H 5DURD 3IFLH 3ULVE 2OL3A 2CDGB 3HUJA 4P9MH 3FJTA 5EA0L 3VXPB 2X41A 4TQEH 1ORQB 1JYNA 4EI5D 3NA9L 4M1CD 2DD8H 1J8KA 2GI7A 1F5WA 3IKCA 4EXPX 2IANA 3MBEB 5MEOB 3WFEH 2HRLA 4LHQB 4HD9A 4G6MH 3X12A 3O3BA 2UV3A 1F6AB 5D2NE 4OCYH 3LN4A 4L8DB 1U8JB 4H26A 1G0XA 4FMFA 3MRIA 2NX5B 4ODHH 4J4PD 2OP4L 4XNMB 1T2QL 1BIIA 4PJDA 4QRPD 1H3UA 3VG0L 5DJYA 1IRAY 3W0WE 3DX9B 4UB0H 5GRUL 3F7QA 2VXUL 3UJIH 2IPTL 3GKWH 4PGCB 2ZWLT 1A4JB 3E1F1 4TVPD 4KTEH 3QQ4B 4Y5YA 1E4XL 1F4YH 3F7VB 1YDPA 3RWDA 1H3WM 3GMPA 3PJSB 2XTJB 2XN9B 2IALA 3FQXA 3SPVB 4XWOD 2WSKA 3L7FA 1DLHA 1GRWA 2XQBH 4ZFFA 4FQJL 4L3AA 3V0VB 1KTLA 5DJ8B 5D7LD 2ZCKL 3T0EE 3OJMB 4MJIE 2GQHA 3IDJB 4Q9QH 2G5RA 4IHOB 4XP1H 4GRLC 2NYYD 5DF0A 1LGVA 4PY8J 3RWCB 5F3BA 3HG1D 3V95A 2OQJB 2J4WL 5EC2B 1L0YA 3JTTA 5TE7L 2DMKA 2F5BH 1YUHB 2BJML 5ENWB 5T5FL 4MCYA 5C0NC 4HCRA 4PB0H 2F53B 4P4RB 3TCLB 4MZ3A 5ACMA 1X4YA 2FH6A 3QT2A 2PR4L 2CUHA 2O5XL 4ZUUA 3FFCE 1D5MB 4YK4B 4X9IA 2FO4B 2C1OA 3QEQB 3CVHL 1IILE 1NC4B 5H35A 2WLYA 2K7PA 1T66C 1KJ2L 3TFKC 3U7WL 1MWAB 1D3CA 4HKZB 3RVUC 5IW6B 4ONGL 4CKVX 2ADJB 3R06B 3NCJL 3TZVD 3S97C 5IW1B 5GGRA 3QNYA 4JRYB 1M7IB 4TVSa 1CGSL 1Z9MA 2VTFA 1A2YA 3LN5A 4QHNA 1JL8A 2Y4SA 1PFCA 4F57L 5FOBB 4YPJA 5EC1B 3DBXA 1RV6X 2JCCF 1RU9L 1UGNA 3H0TB 3LQZB 4ZS7H 3SY0B 1PVHA 2BNUA 2XWJA 2ZUWA 1EFQA 3I3EA 3CXHK 1CICA 4FZ8L 2JCCE 4O2EB 4PREB 1BZ7B 3LHPL 1MLBB 3F7YB 4XWGL 4F7CB 2ZOKB 3BP4B 4S1RL 1S7UB 3ORJA 1CI5A 3MXWH 3MODL 1W8NA 4KK6C 1KJMB 5C07A 3L3DA 4U6XA 4Z7NF 3EYFA 4CVZB 5LCVH 1U8NB 4OKVB 1FZOA 3E3QE 2I07A 4XP4H 1CFTB 5JPMA 5DK0B 1I1AB 3DETD 4I4WB 3QUZB 4Z76B 2XTJC 4Z7NE 2DM4A 2F74A 4HWBL 1PZ5B 1MF2L 4M00A 4TUJB 4G43A 4JB9L 4UTAL 5C9KA 1G9NH 2YD3A 1BX2A 4MX7B 1NC2A 2GT9B 5D1XA 4U33A 4GS7B 4PJ5D 3V9FA 4LASL 4KJWD 1U3YA 2A83B 2MHAB 3QDGA 1ZSDB 3QQ4A 4D9QD 3QAZB 4H20H 1FZJA 3F7VA 4DTGH 5EFIA 4PJAE 1GZQA 3PWPB 3E6FA 4MAYA 2YWZA 3CX5K 4JO1H 3CH8A 1ZLSH 5I18H 2P5WA 1KN2H 2HVKA 2Q7YA 5CSZB 4DQOH 3W9DB 2EH7L 1ZGLB 5DEGA 5EUOE 3SCMB 5SWZE 4CMHB 2ITCA 1AY1L 4EN3B 1FV1A 3T1WA 1V7ML 3X14A 2VZ1A 2CO7B 1ZTXL 3AS0A 3RUGF 4RX4D 4R0LC 1CQKA 2ZSVB 4Q6IB 3GSQB 4A6YH 4WUUB 4M7LH 3U4EB 2HT4D 4IDJL 5HGBB 4YXHH 4XPHH 5IQ9B 2GK0A 5J57B 4X4YA 5T1LD 4XGZA 5CINL 2ATKB 2BVOB 2CMRH 5DMIH 5IK3A 5EZOH 1LK2B 5SX4I 5KJRH 3M8OL 2QSTA 4XBGA 5JW5A 4R0LA 5TE6L 1J1OH 2ED9A 2A77H 5E8NA 4MXVE 1DE4A 4G6FB 4N90D 1DSFL 1KIPB 5GRJL 3B6SA 4L4VB 4LQFL 2NZIA 1N7ML 3VH8B 2HLFD 3IAGC 3VFRA 1J0YA 3CFCH 4MZ2A 1J1PL 4LAJH 5ICZA 2GSIB 3REVA 1D6VL 3D0LB 1IZKA 3IXAB 3T2QA 3KR3L 1K3IA 4LLMB 2P49B 3TM6A 4W6YB 2YPVL 4BZ2L 5F7EL 4KGJA 3B43A 5E9DE 2VR5A 1QZ1A 3RNQB 2AQ2A 3KJ6L 4N0YL 1BFVL 3EJJX 4Q58C 3ET9F 2HVJB 5AD0A 1KCVH 5DRZB 3QJFA 4HHAA 1JF1B 4XNUL 4HWEH 3VH8G 5T1DH 2A9ML 3EDEA 3KPLB 2H2SD 4G9DA 2Y06H 3BPCA 3H7BB 4PJHF 1RK0B 5DJ0B 1F45A 2GUOB 3BGMB 1I1AC 1JHTA 1EHLL 3QUZC 4PJHE 4GBXD 1IGCH 4JZOA 3DO7A 4J1UA 3U9PL 3BDYL 3QNZA 5IMOA 3MGTB 1FVCB 2GTWB 4UI2A 1JGDB 4PRIE 4GS7C 3ILQD 4TSCL 1SMOA 2NTFA 2ZKHL 5GS0H 3QAZC 1NL0L 3D39A 2JK5B 4PTUA 4M8QB 4ETQA 2DTMH 3GHEH 4NFBA 1CGTA 1PZ5A 3TWCH 3LDBC 4P46B 1M71A 4TULH 3SCMC 2PETA 2HKHH 4JR9L 4F33A 1T7VA 4MX7A 4U1JB 3L3KB 2P4AB 2VXUH 2IPTH 3WFDH 1F13A 1PQZB 1AGCB 2Y07L 1ZANH 5CBAB 5MENB 3NCYS 1A21A 4G9FB 4LRNL 1YY9C 3I02A 5I8EB 2NY2D 2Z8VC 4N1EA 2DLTA 5KVDL 3G6AA 1KLGB 1H3TA 2NY6D 1XGYL 1ND0B 1UQSB 4ZUSA 4Y16B 3ZKMC 3NFNA 2F5AH 5IVXA 4WFFE 5JW3L 3O11A 4FQJH 35C8H 1PG7W 5HYQB 1SY6A 4LQ1A 3NIDF 8FABB 3AS2A 2F8OA 3RVXC 3VGFA 4ACPA 4GMSH 1ITBB 4M1GL 3ZKXB 4BA8A 3BUYA 2M8XA 5D5MB 3ZKQD 4UZGA 3SE8L 1V8HA 2XKNB 3NIDE 4PGJA 2NLJA 1NDMA 1W72A 3Q5TA 1NGZA 2YA0A 1JGVL 5DUML 1LO5B 1FLRL 4UQ2B 4KU1A 3TLRA 5ECJE 4U1MA 1C7TA 4AEIL 4JFXA 1RJZB 5ESQB 3HZYB 4KZDL 2H8PB 1ZA3A 1FFPA 2IMNA 4XCYB 3GRWH 5ANMB 4LSSL 1B0RB 4AENB 3TNMB 3OB0H 4LLYA 4M5ZL 1CVRA 3ZL4H 3HC3H 1KCSL 4ONGH 4KRPD 1TCRB 1LDSA 3LKRB 3NCJH 5DO2D 4Y8DC 2EXWD 5DFVC 1QO3A 5D9SA 1CGSH 5E1AB 1FG2B 4MNQB 4R4FL 3MJ7B 4EKXA 4X7SL 1X6NA 2NZ9D 3WJJA 5GGSB 4CU7A 4XTRC 4F57H 1NGYA 5HHOA 2R29L 4NKMB 5EULV 3FO0L 4DCQA 1IAMA 3EFDL 4ZNCD 4DWHA 3PWUB 2K1MA 4OZGF 4GH7B 2RB8A 3FMGL 2GUOA 4DAGH 1F2XK 5BZWB 3RAJL 5MEPA 2V9QA 4IRJB 2V5MA 4R7DA 1I3GH 1WFOA 1M05B 3SDAC 2R0WL 1PKQA 5LGJA 4L8SB 4LLUA 4NGHH 3K46A 2H26B 3RWGB 1P4IL 4JZNA 4OZGE 4P46C 4S1RH 2VLLB 3MUJA 3T0EB 1I7TA 4LHJB 1BQHB 4G8FA 4DJMA 2YD9A 1D7FA 2CRZA 3GMNB 3K8LA 4HDIB 1WF5A 5C09D 3FO1A 3OKKA 1QBLH 5JW4Q 4GO6B 2P42B 5C0GB 2AEWA 3RX7A 3SDAA 1RUKH 3IFPB 3VFMB 1ZT7A 4P46A 1J7VR 4H1LB 3DX8A 1BVZA 1I9JH 5C0AE 4Q97A 3P0VL 4HKBB 1QQDA 4DW2L 2Z93A 3FFCB 4D94A 3D25B 4Y16C 4OM0L 2DKUA 4P9HL 2GCYB 2Y36L 3QZWG 3AREC 4Y4KB 4LNVA 2X42A 5EU5A 2WIIA 4K2UL 1BQHG 3QP3A 2MOVA 1MLCB 3QR2A 4EI6A 2XFXB 2Z35B 5C0BA 4Y0GA 3DUUA 4DFHA 4X9FA 4K8RL 1G7MA 3VRJB 1UWGH 3ULVC 4I13B 1U8OB 3ZKXC 5FYKE 5D7KE 4R2GD 1NCAH 3AREA 4LCIL 1NMCC 4LFHG 5D71L 4PRPA 4H1LG 1FO0B 1V7MH 2M26A 3LEVL 5E8DL 3ARDA 3RHWF 1T1ZB 1R24A 2VLKA 3BZ4A 3JV4A 4PG2C 2VXSL 1JV5B 4IDJH 4WW2A 4DN3L 1N5YL 3BW9A 1MFBH 5D2NC 5IQ7H 3VW3L 4K07A 3ZT5A 5CINH 2X1WL 4AMKL 4R3SB 3BKYH 3NH7L 3MNVA 5IM7A 3JTSB 3H3PL 1I8LC 3I3BA 2BNQB 3DI2B 4PJ8D 4X0KA 4PG2A 1DSFH 5C0IB 1UM5L 3EO0A 4IBLT 4LQFH 3BP5A 4WTWA 1RJZA 5D2NA 3H9YA 3VXSD 3LV3A 4OQ1A 1XEDA 1BF8A 1FSKB 1J1PH 1UXWA 5IMMB 3CU7A 2YXMA 1P4LB 5CD5C 5FB8A 5CGMA 3WFHA 1MJ7L 5KS9A 1S7SA 3G9VA 4BZ2H 3W0WA 1OT2A 3V7MA 1ERNA 5C86A 1HNGA 3TBWB 2X4TA 1TMCB 4JREC 3K80A 3T0DA 1L7IL 2AK1L 4N0YH 4L8SC 3UJJL 3MJ8A 1AP2A 1EAPA 3T0EC 1BJ1H 4FQ1L 4PJAB 4KKAD 3VXUA 3FFDA 3S6CA 2PYFB 3O45B 2A9MH 3F5WB 3F62A 3JWOC 3UZQA 1BD2D 1RULL 4U0QB 1KEGH 5EUOB 5SWZB 1WIUA 1M05A 4CU8A 3TBSA 5HI4D 3QZWA 2AXHA 5JZ7C 1FCGA 1TVDA 3STLB 3MLVL 4PYHA 2WUBH 1S7RB 3PWVB 2I9TB 3T0EA 3RQ3A 1TVBB 1MCOH 4MJIA 4OV6F 3SDCD 4X5WA 3GMNA 2F54D 2QADD 3IFNH 4F7MB 3O8XA 4FABH 3UEZA 2WZPD 1TLKA 2I9LA 4NKIL 4PJ9B 2XA8H 1WC7B 4Y4KC 1MJUH 1R3KA 1OSPH 5EWIL 3DYMA 2X70B 2O5ZL 4BH7B 3WXVH 3EYOB 3OJDA 4LCYA 4LHUD 4R26H 5CKGA 1C5DA 4ZAKD 3TO4B 4PBVC 1S8DA 1KSRA 3MV9E 1SBBA 4JEGB 1GYAA 4H5SB 3CGTA 4G80B 4WI4A 5E6IB 3VMPA 1S9WA 3GO1H 1IQWL 1TVHA 2V5RA 3HHRB 4WJ5B 1R3IH 1YQVH 4LRNH 1MRFH 1BQUA 4KHXH 2YUXA 2ATPA 3KYKL 3VFSB 3GBNL 5EU6B 1JWSB 1YNTA 1K8DB 1UXSA 1AHWA 4POZD 2X10A 3WO4B 1SJXA 5HY9B 4APQA 4NZJA 1IL1A 4YLQT 3TN0B 2H3NB 1CZ8L 4NJAL 1KB5B 1A6PA 2G9HA 1U95A 1KIQA 3V4VL 1U3HC 1U8MB 2JCCA 5BW7A 4PJEF 1FSKC 3E3QC 4FA8A 3V7AE 4M1GH 3U46A 2W65B 3C60D 1G9MH 5D96B 4MNGA 3F7PC 3MCKA 2YPLA 3SE8H 4O58H 4P2OB 1D9KA 1RHHA 1ZLUH 4PJEE 4MQ7B 5JOFA 1CLYL 1GIGL 1RIHL 1NDGA 3MV8D 5DUMH 1U3HA 1FLRH 3MXVL 4DGIL 4PRIB 2CLRA 4AEIH 4KJQD 4KK5C 4KJYB 5ACLA 1WCBB 1WK0A 4V1DE 5I1JH 1T6VN 4LSSH 4NO0D 3NA4A 5IEHB 4Z7QF 5BXFA 3OB8A 3SGEH 5HYSA 5L8KB 3LKOA 3LVEA 4Y1AE 3Q3GB 1QEWA 1KCSH 3D69B 4E42B 3MV7B 5CSBA 4K94H 5AEAA 1A6AB 3B9AA 4UOW0 5CUSL 3MGOA 3OKNB 1QSEB 3FB7A 4OTXL 2IFGA 4NIKB 4X8XA 1JFQL 4FQHA 3RI5K 4RGND 2NW3B 4R4FH 4YIQB 5MI0B 1IAIL 3BHBB 3S88H 2UYLA 2R29H 3ZDXF 1I7RA 1MVFA 2ZOLB 5CCKL 1BZ9B 1GHFH 2FX8L 1INEL 3X3GL 2XY2A 3BRDA 1ED3A 5GGVY 4BFBD 1MNUL 2VE6B 4MDIA 4WWKA 3RAJH 3S4SA 2N7BA 1CFSB 1KEMH 2LU7A 1HH6A 3ZDXE 1M6OB 2R0WH 3KPRD 2HLAA 1ZT1B 3FO9A 1FJ1B 1T4KB 4OIIL 3RRQA 1JGLL 3C6LA 1XMWA 4JFDE 3DTXB 3MRLA 5FYJE 3TO4C 2IBGA 2V5TA 3RUGA 3I3DA 4ZFOB 2C3GA 3LPFA 4Z5RA 2A9NL 5E6IC 5JR1H 1Z3GL 1QRND 1D5BA 3J7HA 3ZTNH 3PV7A 1I8IB 4EDWL 3MOAL 4PJ7F 4O5LL 3HTLX 4TUOA 1MSPA 4JZJC 4DZBB 5EO9A 4ZXBB 1U42A 4UOJA 2XRAL 3FT2A 4LKXB 3MNWA 4KDTC 3VXRE 5ITFA 2VDNL 1N4XL 5EBLB 5FYJU 3DYOA 3WO4C 1J0KA 4ODVL 4ZD3L 1KV3A 4U1HA 5E2JA 3U9UA 3TN0C 3N1FC 5EIQA 4QXUH 4PJCA 4MA7L 1S9XA 4Z7VA 4XPAL 4NHCH 4XMPL 1T3FA 4JZJA 1CK0H 5CIPH 5E9DA 5CGYD 5ACZB 4OFKA 3G5ZA 5I66A 2OM5A 1PG7L 5DJXA 4N8VA 4OCNC 1IT9H 1YEGL 2E7BA 1M4KA 2OR7A 1CFVL 4UUJA 4LCIH 5EUKB 3WFCL 4JVWA 5D71H 1SMAA 1EHXA 4L4TD 3BEVA 4BKLB 3D2UB 4P2OC 3FQUA 4IEFB 3LEVH 5E8DH 5FO9A 2DQUL 4L3EE 4JJ5A 5D2LF 3B2UC 5ADPH 4XZUA 1I1FA 3HI6H 1FNAA 2VXSH 4ODXA 5CD3B 4GRWF 3P0GB 1NEZB 3ULUL 3UC0L 1N5YH 2DICA 2R1XB 3GMLB 2C4XA 4JPVL 4WTXA 4E5XA 3SKMA 2KQNA 1ZS8A 4PJHA 4NWTL 1SHMA 3DLQR 3C8KB 1BQLL 3H3PH 4GRWE 1MQKL 3RGHA 4OF6A 2P8LB 3DHJA 3WKML 1SYVA 4YBHA 1QA9A 2E6PA 3HB3C 1DQLL 2HMIC 3TO2A 4KJYA 2RFXB 4M7JL 5FGCB 4QT5B 3JVGC 2APTA 1NAMH 3ARBC 1DDHA 1B90A 5HJ3B 4YBQC 3VGAB 1S3KH 4XCFL 2X6MA 2PW1B 2A1WH 3ZTJH 2C5DC 4FG6D 3WFBL 3LKPA 4DGVL 5F1IB 1HQRB 3ZE2F 1BVKB 5H2BA 2DQCL 3FO2A 3OKNA 5EOCL 1MFCH 1VGKA 1XR8B 5GGRY 1Z9OA 1T1YA 5A2JH 1U91B 3ARBA 1L7IH 3BMWA 3C2AL 3H9SE 3ZE2E 4KMTL 3ZYIA 4W4OC 4PV8A 1DR9A 5IJKC 4R90L 3D18B 3OX8A 2DQFB 2BSSB 4LSPH 1ITCA 4JRXE 3QI9A 1RULH 1FNEA 4G7YL 2HFEB 5DC4B 4RFOL 2EDYA 3MA7A 4U1IA 3STZA 4ZYKB 2A74B 1N0XH 1JJUA 4W4OA 2J1KA 4O2CB 3DVIA 3W11D 3GSWA 5FM5M 4ZXBC 4I3RL 4C58B 3REWB 4F58H 1OAKL 3SQBA 2BERA 2PYED 4LLVB 5GZOD 2W0FB 3CLFH 4JN1L 4WI3A 2B0SL 2EIZB 2ARWA 5DJDB 3D48R 3WIFB 2IQ9L 1KELL 3OXRA 2VO5A 1P69B 2X1QA 5KSAC 3UTQA 2Z92A 5EWIH 2UZIL 2O5ZH 2B20A 3GI9H 4HT1L 3GJFB 4MA3A 4ZFZA 3KJ4B 4YHMH 1WAAF 1B2WL 3NCEB 4PY7B 2ZUTA 4UV7L 1WZKA 2EEDA 1R5IB 1F3DJ 4K8RD 2X4RA 1KCLA 3WUZA 1RZ7L 4NNXA 5KSAA 3MLSL 1WAAE 2Y7QB 4R8WH 3HCVB 3F6IA 3P9LB 5JW4N 3GMQA 3FN9A 4RSVA 2YKLL 5I1IL 4MJ6A 1KF9B 3ARPA 1I7UB 5DD0L 3RVWC 4QRTA 4X4XA 5HHME 3F6LA 4ISVA 1FNSL 1RUQL 4Y2DD 5FGRA 4ODSL 3RTQB 2M1KA 5BS0E 3RHWK 3T0VA 3C9NA 3N85H 3QNXB 1RZFH 2R56L 4NM8L 4K3JL 4TTDD 4UQ3B 2YUWA 3VXMD 1EBPA 1OTTC 3BKJL 5ALCH 1ZVHA 3W2DL 4NJAH 1MAJA 1U6AL 3T65B 3LSOA 1E4WH 1EO8L 1S7QA 2BNRE 2R1WA 2AV7B 4P59L 4AL8L 5I6XB 1BFOA 4LIQL 3VGAC 4EI5A 4M7KL 5D6CA 3BYTA 4OZGA 2JIXD 4JKKA 3TVMB 4YR6B 2NPLX 4NHUB 1MCSA 1DBBL 2BVEA 3P9MA 1IGYA 1DEEA 5SWSE 1CG9B 3BZFB 1HQ4B 1N8ZB 1X4XA 1CLYH 4NQDA 4KXZH 1RIHH 2N4IA 4S2SA 1HSBB 1FG9C 1RQ5A 4PR5A 2X7LB 1HHGA 1WIOA 3VA2C 5HHXL 3MXVH 5DD6A 5TQ0L 1CF8L 4J4PA 3P4LA 5E5MB 5JIKA 2V2XB 2WUCL 4KVCH 5MHSE 3UTZB 1HQRA 1G7HA 1NCBL 1T5WA 3MRRB 5GPRA 5C0AA 3IF1A 3U0PB 5IUSA 3WL9B 1REIA 3HNVL 1WV7T 1LNUB 1TITA 1DBJH 1NH6A 4JHBA 5TDNB 1GGUA 4OSUL 4MD5A 5KANG 5EPMB 1BGXH 5CUSH 1KTRL 3RIFK 3BKCL 1SVCP 2YBRB 2QQKL 4XRCB 3EYSH 5HYJE 3BWUC 4OTXH 4H8WL 1XF3B 3TH4T 2ZP0T 1VADB 2DLHA 4UILH 5ETUB 4PG9A 5ID1B 1QLFA 2NY0D 5IESH 3LH2L 1U8LB 2K3TA 3MLZL 3WEXA 3O3DB 1BVLA 3EO1B 1MNUH 3BD3A 3KLAB 1NBZB 3G6DH 4XNXH 5D7LA 3SKJL 1JGEA 4L9LB 4ERSL 1IAIM 2VH5L 5DRNA 4BSVA 4OIIH 1INQA 4LEXH 1G6RB 3HG1A 3C08H 4HIJA 3OJVC 2LU3A 1J0JA 5I1AA 1L0XA 5C08D 1Z3GH 5IHUL 3JUYA 3T4YA 4G8GD 5E08L 2F58L 4EDWH 3EKCA 5CZXC 1T1WB 1A7PL 3PDOA 1EMTH 4HLJA 1JWMB 4PJEB 1UZ8A 3LEXA 1IEBB 1SM3L 4G6AC 1QTYT 1U92A 3S8WA 3WS6A 2VDNH 1N4XH 3NN8A 4LPXA 4QRSB 4FNLH 4K7PH 2NY1B 5DYOB 4FTVB 1YN7B 3WD5H 2J12B 1IZJA 4EVNA 4UNTA 4ODVH 4ZD3H 4PGZA 4V1DB 1T5XB 1ZEAL 3SKOA 2YUVA 3K8MA 3TZVA 1WIPA 2V7HB 4MA7H 4P5MB 1IM3A 3LN9A 4XPAH 5DDHB 1QVOB 2AEQL 4XMPH 5I16B 1YYML 4Y1AB 2O5YL 5EZIH 3QXWA 5FA3A 2DYPA 4HUWB 3K3QA 4Y19B 3V7AG 3Q1SH 1PG7H 3GJEB 2PUQT 3I50L 2AXJA 15C8L 4JDZA 2BOCB 3E8UH 3HS0A 1V3LA 5A2LH 1CFVH 2BC4A 4RFEA 3WFCH 5BVPL 3B9DA 4JFFB 3G08A 4QOKB 4FFYH 3QCUL 5GGVL 4I77H 4PLKD 4U1KB 5F1SA 1H5BB 2OJZH 3MRFA 5D7SH 2CR6A 5HVFB 5JHLL 2BSED 2OL3L 3UC0H 3ULUH 1IE5A 2CLVB 3I9GH 3DJ9A 4JPVH 1WFUA 5E2UL 2AQ1A 5L2JA 3HC0A 4E9LA 4JO2H 3SE3C 4TSAH 5CJBA 4HK3J 4KI5D 4KRNA 3N1QC 4FQXD 1ORSB 1QFOA 1BQLH 2DM7A 1MQKH 1A3LL 3AFLA 2ICWA 1K3ZA 2B39A 4MSWB 4JFDB 2QEJA 5IBLD 2WIMA 2EDJA 1XF4B 3VFVB 5DQ9B 4MHHG 1T20A 3RWEB 3F12A 1GAFL 4M7JH 4NQSB 1K6QL 5FYLL 1VKXB 4M7ZB 5EBMB 1PX3A 1IGJA 3SE3A 4IMLB 1AR1D 3V2AR 3ZKNC 3FRPG 4PB9L 4DK6A 4N5ED 3H3BC 2YR3A 4C83A 3WFBH 1AJ7L 4DGVH 4XPGL 4JN2A 3TT3H 4N0RA 3IDMA 4P5TD 2DQCH 3MV9A 4PJ5A 4S1SH 4WO4C 2W59A 2X9XA 1WTGT 3VXRB 3WHE0 4JQVC 1XFPA 4UTBH 4L9LC 4DKAA 3TA3D 4AJ0A 3C2AH 4OFIA 3BQUC 4U3XA 2FD6L 1NCCH 3VCLB 4OLVH 2DQHL 3LKNA 1OQOA 4K3DL 1B6UA 5L2KD 4C56D 5IR1A 4FS0A 4FQIH 5BCAA 2WANA 4WO4A 3L3GB 4G7YH 3KHQA 4HJGB 3OMZA 4JQVA 1MI5E 4OV5B 2Q8BH 5E1HB 3WE6A 1XF2A 1Y6KR 4GW5A 3DSFL 3BQUA 2VITB 4NC0B 1JNLH 4HXAL 2YMXL 4NDMB 3VFPB 5FUZL 5D93B 4NFDA 4L3EB 5JQ6L 3TPUA 2X1XR 1YEFH 4Q2ZA 5T1LA 2AKRA 2L0DA 4LP5A 4I3RH 4ENEC 5J4MA 5KG9A 1M7DA 1QR1A 4ZS6C 1PBYA 4Y8AA 3HE7C 2NY1C 3CLEH 2XZCL 4PJBF 2FB4L 5IB2B 1CL7I 1SEQH 3T1FA 5DRXA 3QUMB 3IKKA 1DFBH 3MRQB 1F2QA 2R8SL 3QFDB 2A6IB 4ZUTB 1KELH 1E6OL 2DWDA 4IJ3B 2CRIA 4HCRL 1TNNA 4PJEA 4GRWB 4PJBE 4AT6B 1JZ7A 4GAFB 1TZIA 4R4BA 5I0DA 3QUXB 3HE7A 1B2WH 3V8OA 4MYWB 4UV7H 2ZG1A 5SX5H 1Q38A 2J8UF 3FZUC 3KXFD 4IRSB 2AJYL 1JBJA 4OFDA 5T3ZE 1T5XA 4DOHB 5D1ZC 4XB8A 5JHDE 1RUPL 1RZ7H 1JPSL 5HGDA 4XC3H 5DHYB 1MELA 3MLSH 2AI0L 1A4KB 1ADQA 2P7TB 2AJUL 4KROC 1L6ZA 1FZMB 2J8UE 3FQNB 1KB5H 2FDBP 1FVEA 1H5BC 2YKLH 5I1IH 4OF8A 1MREL 5A40E 1MCWW 2DOCA 1OPGL 4JG1L 4NM4L 3GUTB 5IB1A 3ULUD 5D1ZA 1FNSH 4CMMA 1RUQH 3U2SA 3OKMB 4R97B 3KPPA 1FL6B 1TENA 2KBGA 3OZ9L 2BP3A 4QRRE 5DSCA 1CD1A 3MREB 4WHYG 4K3JH 3IDUA 3BKJH 1S9VB 4JRXB 1CLZH 2YZ1A 4NN6C 1EO8H 1ZA6B 5B22A 4M7ZC 5AZ2L 1HEZB 3TC9A 4M7KH 1F4XH 1UEMA 2DBLL 3HLAA 3P30L 2P8MB 4ETYA 1D6EB 4WCYL 4MSWA 1DBBH 1CDJA 5ALBL 3LS5L 1LP9B 1KCUL 2DRUA 1XR9A 2JJSC 1C5BL 4HZLA 4ZO6A 5I15L 2ENYA 2SEBB 5B38B 2WLZA 4Y4FB 3V8CA 1H3PH 5HHXH 1IM9D 5HGHB 3QRFM 5IHZA 1XCTA 5BV7B 2WINB 2F8VA 1OAYL 4HIEA 3MJ9A 1NCBH 2X4OA 4RISH 3RVVD 1VPOH 2HAZA 3HNVH 1T7ZA 4JM2D 3BH9B 3FQRB 1P7QA 3P4MB 2PO6D 3KYMA 3QJHA 1HXYA 3ARGB 4PJ7A 5H37G 5T1KA 4KMLB 1WWWX 3LIZL 3RIAF 2CJUL 4P5KA 4GMTL 3WUWB 1DP0A 5GIRA 3Q2CA 3MACL 4GSDH 1QG3A 1LE9A 4GAGH 5LG1A 2OXHA 4JFPB 5DA0B 1GC1C 1JZ5A 4K9EL 1A7RH 5E8OA 4XVJH 3GM0A 4GW1A 2RCSL 4KWUA 3DXAA 1T03L 1HSAA 2FBJL 1EZVY 5B38G 4HJGA 1R3JA 5C0CD 2PW2B 3L1OH 3DWTA 4QXTB 1W0WA 5HHMB 3FT4A 1ZHBB 2UY6A 4IJ3C 1V7NH 4E41A 3EYUH 3SKJH 1BJ1J 2VSDA 1J87A 3B5HA 1MCFA 3CPLA 3QRGH 4HIXH 3DX6A 4P2RD 3QUXC 4L3CA 3MRPA 2H32A 4HK0A 1EJOL 4OKDA 3DPBA 3AAZB 4R96A 4WU7A 3WUWG 4IRSC 4XMLL 5FKPB 5D2LA 3TH3T 5B8CA 2BNRB 5HPMA 4I0PD 1K5NA 4NRZB 4KJPC 1JI2A 4YQXH 3CFKA 1LDPL 5GRXG 2A0LC 1Q9OB 2VIRB 3CUPA 5KSUA 2F58H 3DIFB 2DIBA 2D7MA 1A7PH 5IB4A 3P9WB 3H7LA 1T0MB 4EUPB 4H0HB 2HJLA 3RDTB 1F58H 1SM3H 4KKLD 1R5VB 2C4FT 4HC1H 1ZHLA 2V7NA 2DLIA 3UROR 3KAAA 3VFNB 1MWAL 4AH2B 3WSQL 2P7TA 3RJQB 1C16B 3O6ML 5GRYA 5GSRA 4PRAA 4NO5B 4BZ1H 4F9LC 4YNYA 3IJHB 2O5YH 2DI8A 1HILB 4X8JB 1JZ8A 1D5IH 3IVKB 4P2YA 3H9SA 5HHNA 5HYJB 2GJ6E 15C8H 1P7KB 3QIWD 3O3AA 1BJ8A 3MREA 1E28A 4HKXA 1JZ3A 1CBVL 5BVPH 3VRIB 1S9VA 2EE3A 2B4CC 1DQQB 1EFXB 2A73A 2Z91B 4Y4FC 5T1MB 2DQTL 3QO1A 3VMNA 3ARTA 5JHLH 2OL3H 3RL2B 5BO1L 2WBJB 1UEYA 5E2UH 3RNKA 3EGSB 2HT2D 1QFWH 1NGXB 1RFDH 2ICEA 4CVUA 5C09A 4JY4B 2XNAB 4ZNEE 1F4HA 5I74B 1R3LB 3C09B 3V6ZB 5ICXA 1GAFH 4LLWB 2IFFL 2ZPKH 5FYLH 5EIIA 3BP7A 2NY5C 4WV1B 5DGQA 5EU4A 4YC2B 1AO7D 4OUUA 3HR5B 2ZCHL 3MYJA 4XAKD 2AQ3A 4PP2B 4UT7L 4XPBH 3SKNA 3OF6D 2IADA 4YHOH 5EZLA 2DWEA 2XA3A 3FTGB 1TZGL 2VDLH 4ZQKA 4RMVA 4RQQA 2EKSB 1WAAA 1HOCA 3TBTB 4F7PA 4XMKL 3RFZC 3DGGB 3S5LB 3OKEA 5FGBA 1CXLA 3QXDB 2FJGB 1EAJA 4NO2A 1A47A 4YHPB 2HT3D 3CNKA 2MFNA 4XNQB 1PYWA 5CZVL 5K93A 1EK3A 4NQED 1A5FL 3JV5A 1CE1L 4P2QD 3O6FC 1J10A 3RZCD 1TETL 5BS0A 2CKBA 2KH2B 1RZGA 3QEGL 1AKJB 3DSFH 4NFCA 1KULA 4MQTB 3G5XA 4F7TB 1Q94A 4OZ4B 4CNIB 3SE9L 5ISZE 2FEEI 3MROA 4LCWD 3RDTC 32C2B 4ZTPL 3LQMA 4M8VA 3ETBF 4X6FB 3O6FA 2P44B 4LF3A 4LK4A 3IFOB 1EZVX 4WFHD 3VE0A 5LGHH 5F6HI 1XF5A 5IB5A 3KYNA 1EDQA 5I8KL 1N6QL 1A1OB 5SWSA 1KJ2A 5EO1B 4D9LH 1E6OH 4HCRH 4M4RA 1W72L 3UPCA 1P5UA 4HSQA 5J13B 1GJIA 2QSVA 3VXSA 4QXWA 4YO0B 5TFSH 1KPRB 3KDMB 3S34L 5CLTA 1JPSH 4DGYL 4D9RD 1YPZE 4MS8D 4MA8H 3SGDI 4DUWA 4R4ND 4YDVA 2AJUH 4BQ8A 1Q0XL 2VISB 3L6FA 1N5AB 3UTTE 4JG1H 3HE6C 3BT2L 1EJ6A 5E2TL 2CSPA 4NP4L 1IJ9A 1TJIL 3M1BA 4C59B 3OZ9H 1ACYL 5FF6B 5DUBB 3MRKB 2GW5A 2IAND 1OTSD 1FDLH 1U8KB 2NR6D 2VL5B 3PGDA 4WWID 4YPGA 2ADFL 4F7EA 5FGSA 1XGPB 3G5VB 4QF1A 1Q9LB 3HI1B 1C12B 3WDHA 3S35X 3HE6A 1MI5B 3QFJB 3FN0H 1A9EB 1OP3H 3BIKB 3DUSB 3GSNB 1X5LA 3SDCA 1I9RH 4NQCE 5JLZB 4YC2C 3IDYB 4LKCA 5FYLD 4UINH 5CMAB 1FP5A 4I3SH 3ZSTA 2HP4A 3JWDC 1TNMA 4WCYH 4YE4H 4R9HA 3VWKB 5HHQB 2P46B 1KCUH 5FO8B 1QP1A 1C5BH 3T3MF 2DL2A 1DQJB 2ZG3A 3HPLA 5LBSH 4H88L 3TIEA 3HRZA 3O2WL 4AIXA 4AG4H 3LRSA 5IFAH 3T3ME 4UV4H 4LHUA 3PQYE 4GLRH 1I4FB 1OAYH 1A14H 1OGAA 1MCDA 3FTGA 4JY6B 3GIZL 5DJCA 4ONFH 1LEIB 3LIZH 4OZFB 2CJUH 2OTUA 3G9AB 4GMTH 5E4IA 4P49A 3MACH 5TQ2L 5JHDB 2VXTL 2YPKB 5EBGA 1K8IA 4HEPG 3TYGH 2JELH 5SV3A 2G5BA 4K9EH 5IB3B 3INUH 1ZAGA 3DI3B 1G6RH 1F3RB 2FBJH 1VA9A 4HUKB 1BREA 3KYOA 2Y5TB 3TYFA 2OR9L 2AXGA 2D03H 1OD9A 2ZUUA 5H94B 4D3CL 4O9HH 4D9QE 3AXLA 2CK0H 1UB6A 2ZG2A 3PIQB 4QEGA 5DS8A 4JPWL 4UT6L 5J13C 1K9TA 4QRRB 1KT2B 2F8XC 3S9DB 2EDEA 1DN0A 1U8PB 4G42A 3CXDL 5CWSA 1EJOH 4OZFG 1HHJA 5J1SC 3ULVL 4GRLD 2E8YA 2L7JA 5GGTH 3HNSH 5MERB 2AJVL 4OZIF 5TGBA 5L8JB 3PV6A 4EIGB 3K4DA 5C0ND 5DC0A 1S7VA 1G1CA 1II4E 3MV8A 4TOYL 4MD0A 3KPMB 3ZDYF 4GUPB 2GY7B 2B1HH 5GGUB 4OZIE 3BN9D 1XGUA 1CN4A 3EYVA 4YO0A 1PSKL 1I85A 1V5JA 3PWJA 4WDIA 3X11A 2BHZA 2E8ZA 1EIBA 1OWRM 3GGWB 1I7ZA 2J6EL 3FT3B 5DZOA 5T3XH 3U48A 6FABL 2E9WA 3ZDYE 3BP6A 3IXTA 3ARQA 2OMNA 2X4NB 3DMMB 1OWWA 1U9KA 3QXAB 1T66D 4NT6B 3AGVA 3TFKD 1UH4A 5FHBL 3RVUD 3CMGA 2VAAA 5GRWA 3CDGA 3PL6B 1QBAA 2WP3O 4M4PA 1BAFH 1Y0LB 1LEGA 3ROOB 3V5DB 4X5XB 1ONQA 3EOTL 1XT5A 2EYRA 4UBDC 2OK0L 4WNQB 5BVJB 1YJDL 1I8KA 3QDJE 5A16A 1AE6L 1J1XL 3CFBA 2P8PB 3GIVA 1Q9KB 3MJ6A 1CBVH 3QDAA 4UDUB 3L3IB 4HPYL 3FHAA 1MI5A 2GSGB 2VERN 1QNZL 2UUDH 4JFOA 3KPRA 2DQTH 3SE4C 4GAYA 3D0VB 3LS4H 1OQXA 2NX5D 4QCIB 1ZVYA 1INDL 3SJVB 2JJTC 2HN7A 3RKPA 1JF6A 5ESAA 3U83A 4Y5VC 2V5YA 4PP1C 4U6HA 5GGQH 3T4AB 4HKJA 4A2MA 4KK6D 1QRNA 3VXNA 1JRHI 4N9GB 2R23B 4OCSL 5IV2B 3A6CH 4G5ZH 2Q6WA 3W5MA 3O2VL 4PBXA 4M62H 5D1XD 1LO3L 1NC2D 1NUFA 2R0ZH 3IU3B 4NQTA 2C3VA 4IIQC 3MLUL 4JFEE 2IFFH 2ZUXA 4PJBA 2HJFB 3QDGD 3VWJB 4Y5VA 5INDA 4G7VH 5DMYA 2AS5M 4FXKB 2XTJD 2XN9D 2DLGA 2ZCHH 2P5WD 1TJHL 1LEIA 1R3HB 5DC9B 1T04B 4UT7H 4QWWC 2NXYB 1YMHB 4V2BA 1JPST 3FQWB 3U0WL 2P43B 4N0UE 1P6AB 2BVUA 4CU6A 3MLYH 1YMME 4IIQA 2X4SB 4X6CA 4ZPTA 1J8HE 4XMKH 1JHKL 3WNPA 5IHBA 1AGDA 2J8UA 1BHGA 3I6KA 2BMKB 4OQTH 5I76B 3S35L 2P5EE 5GS1B 1HKFA 3MO1A 4WFGE 2UWEE 4C57C 4OF3A 1W0VA 1A5FH 3VU2A 4Z7UF 1FO0L 3AU1A 5JXEC 4L4TA 2CD0A 3OV6A 4YX2L 3QUMH 5TDPA 1AD9B 1IEHA 2X09A 1T0NB 3DVGB 3DGCR 3MNZA 2F53D 4Q6YA 4KQ4H 2I5YL 4NUJB 4Z7UE 2XPGA 2OMBA 3FRUA 1JRHL 3SE9H 1SY6H 4OCRH 3PHQB 1KTDB 2ZUSA 4GKNB 1OAXH 4RFNC 4GOSA 1DBAL 5JXEA 3VGBA 3DMMC 1NC4D 3RBGA 4N0FB 1BEYL 3ALXA 2VN7A 3GM8A 1LMKA 5GJSL 2PXYB 3QIUC 5F9JA 3PL6C 3NVQA 1KUMA 4LOUC 4PIRF 1WBXB 4JRYD 1DLFL 3MR9B 4XP9L 2D9QB 2DKMA 1AR2A 3WLBB 3QG6A 4DUVA 4OCMC 3HAEB 3P4OB 4HIIB 2Y25A 4U2YA 4Z78B 1WBZA 4AZ8A 3S34H 1Q0YH 3GI8L 1CD9B 1A3QA 3TF7C 4HZAA 4Y88A 4HV8A 4DGYH 2EYTA 3QIUA 4MB3A 4X7EC 2VDKL 4R7NB 2CDFA 4RNRA 4QHMB 2WWKT 3U36A 4XI5C 1TPXB 3BOVA 4D2NA 1NCTA 4HF5L 1UA6L 3DUHA 1L4IA 2NQCA 3VRLF 4OCWL 2RR3A 5FO7A 5AWNL 1CQYA 5KVFL 4QRPB 4UU9A 1OHQA 2WM0A 1NGPH 1TJIH 5ICYA 3B4NA 5AYUL 1KJVB 3STBA 1ACYH 2EECA 3UTOA 3LAFA 4G8EA 1TXKA 4ELKA 4IOSD 3MFFB 4HEME 1NFDF 3P73A 3HAEG 4FQQA 4S0TD 1DUYA 3D0VA 1WZMA 4M43L 1UJTA 3UYOD 4KQ3L 2WBKA 1I1AD 3D39D 4UIMA 5BV7H 3WJLA 1BBJB 1P2CB 1NFDE 5CJXC 3QUZD 5DEZA 2HFGH 2PYEA 4DVRL 1RZJH 1P1ZB 3AY4C 5ISZB 1HI6B 1OAZL 2XZAL 5JDSA 1DQDL 43CAB 3IU3A 4LCCB 3GMRA 4H88H 5DEFB 3NFPB 1MHCA 3SO3B 3MRJA 2H9GA 3NZHH 3UPRB 1JNNL 4KUZL 4JFQB 1NBYA 3OGCA 3U7YL 5CJXA 1U93B 5GS1C 1XCQB 1B88A 2QQNL 5D7IB 2BHUA 2BOBA 1VSCA 2DQEH 2CLZA 5DI8B 4N5UA 3SCMD 2COQA 3E6HB 2XXMB 4YHLH 3SDDB 2XTLA 3L3OA 3QPQC 2Q86A 1CXEA 3ARZA 5DZNA 2JJWA 2BRRL 5J3HC 4WUUD 5F9OH 1YPZB 1FAIL 1SJHA 1UM6H 5F8RC 1L7TL 2VRAA 3ARFC 5KZCD 3BH8B 1W2KT 1AQDA 1J0IA 4I9WE 4NRXA 2Z31B 3LB6C 4HUUB 4P23B 4Y2DA 4NC2B 4PJIE 5FM4A 5HTSA 2GJ6A 4L4JA 1N3NA 4D3CH 5JMRA 3LKQA 3ILPB 3QH3A 4NQVB 3ZKMD 1HYRC 2PXYC 4JKWA 3MCG1 3VFWA 3VXMA 3WS3B 4G6FD 4UT6H 5E2WH 5I1HH 3MX0A 1FBIL 3ARFA 1OM3L 4PRHE 2AJXH 4EUPH 3IJYA 1KYOJ 1OAQL 5TH2A 3CXDH 4WEUD 3DVFA 1AC0A 5DD1L 4RCAA 5I73B 2R15A 2D7TL 4M6NL 4XXDA 2AJVH 2GAZA 2XWBB 3CK0H 4NQCB 5GISL 4XCEA 4EQ2A 1TPXC 4TOYH 5EOQL 3QHFL 3R4DA 1A6TA 4ONHB 3U4BL 3WN5B 5C0EB 4LNRA 3RWIB 3K2UH 1LK3L 2P24A 4RGMB 5LQBL 2O93L 3QEUB 1YEEL 5DMKA 3HZVA 1MJJB 1CGWA 3IS1X 3S3SA 3NPZB 6FABH 3X13B 3R8QA 4PUBH 4HQQL 4R7NA 3S7GA 3LCYA 4FFZL 1I8MA 3PWNA 3OG6B 3SGKC 3HZMA 3LKSA 1XH3B 3WNNA 3NFSH 2DDQL 4IMKC 3VFTA 1MCWM 3OGOE 5FKAB 3L5XL 2D7OA 1ZXQA 5HGAA 5FFLA 3MRHB 5L9DL 1YJDH 3SDYH 2V2TB 4XTRD 1J1XH 3EOBB 3SGKA 3FB5A 4BFGA 3Q6FA 2APBA 3QCTL 3ZHLA 5T33L 4LCCC 4X99A 1QOKA 1NBVL 1W8OA 4XH2B 3G04A 3TIDB 3OXSA 1OSZA 2OI9B 1CT8B 3VXQB 3BWAB 4D0CA 4DKEL 2BSTB 3JSSA 1M7XA 1JWUB 1T22A 3SDAD 4ZFGL 1ZWIB 2KKQA 2QBWA 1INDH 2FHBA 1IGMH 3S37H 4BQBA 3LQAC 1IAOB 3BZDA 4WEMB 4P46D 5JQHC 5D1QC 4BK4A 5C2BL 2P48B 2E6JA 2Z8SA 3SDDC 2ESVE 1P84J 2IQAB 3LRGA 1YN6A 5IMKA 1H0DA 1PY9A 3K8KA 4JGJA 4M61B 2W07A 5DR5H 3O2VH 1JK8A 5IG7A 3QWRD 5E95B 1LO3H 3I84A 5DD5H 4CADB 3MBXL 3V4UH 3KG5A 5MEND 4PGEB 4LSRH 5D1QA 2IPKB 3VI4F 1B4JL 2XZQL 1K2DA 2PN5A 2Z31C 4P23C 4C55A 1XIWA 5C0BD 4LLDA 4FP8L 1TJHH 5C0JA 2B2XL 5TF0A 2AJ3B 3QUKB 3VI4E 3U0WH 5FECB 2ARJB 1HKLL 3ARED 4KI1A 2C26A 1NCUA 1R0AL 4LPCA 3MRNB 1KJ3L 3BE1H 3IJSB 4LEOA 1JHKH 3ARDD 3IB4A 1KLFA 5TF1L 2YRPA 2Z31A 1MPAL 4P23A 2VLKD 4HG4J 1YNLL 2B1AH 1BLNB 1CS6A 2HTLC 2JB6A 4G6KL 3UTTA 3O4LE 4U1LA 4G8IB 3ULVD 4WVRA 2NY7L 2WMPA 4U2ZA 2Q1EA 1S9YB 2N1KA 2V2WB 1EEZB 1QKZL 3E0GA 1AGEB 1FZKB 1NGQL 3VFOA 3QDJB 5K9OB 1GGTA 3TT1L 1DZBA 2I5YH 3V6FA 1H9VA 3WN5C 4J8RA 1CLCA 5T5NF 4EBQL 4XCCL 3ES6A 4NCC2 4RGMC 4J23A 4Q9CA 3VGHA 3IDNA 1DBAH 5C6PB 2Z8WC 2VQ1A 4AIZA 4OGYH 3B9KB 1JF5A 5C9JB 5HDOA 1HHHA 2VLRA 1T7X