3UXYA

The crystal structure of short chain dehydrogenase from rhodobacter sphaeroides
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
b'FEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFAKRGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title The crystal structure of short chain dehydrogenase from Rhodobacter sphaeroides
rcsb
total genus 81
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uxyA00
3G0OA 1YE3A 3GLQA 2IRWA 4ALKA 5JDCA 4BNKA 4LCEA 4AJ2A 2VZ8A 4BNZA 3N58A 2X23A 3NRCA 4R3WA 4L4RA 1B15A 4O0LA 5LDGA 1WAMA 1UXIA 3BTSA 6ADHA 4W4TA 3D0OA 1EQ2A 1T24A 2IDZA 4N5MA 3CTMA 4GI2A 4YJDA 5IZCA 3VDRA 4CR7A 3JYLA 2NU9A 3PHGA 4BO6A 4RCVA 2VHXA 3ONDA 5AXBA 3K6JA 3RFXA 2HSDA 3LLSA 3B1FA 2DU8A 1BSVA 4I5FA 5A5FA 3T7CA 4UUPA 5I7VA 4YA6A 3GA0A 5T5QA 3WFJA 2O3RA 3LT0A 3OJ0A 1DJNA 3E6AA 3ZHXA 1D7OA 1GV1A 2O3UA 2JCYA 3L4BA 1CIVA 4ZVVA 4RPGA 3ZWYA 2OZPA 1WXDA 1D4FA 4J0FA 2WM3A 1M75A 2Q99A 1E1KA 4NBRA 1LLCA 4YT2A 4KWIA 3KOUA 3RC2A 4BO0A 3JQ8A 5L7WA 1ZFNA 5A9TA 1U1IA 2H63A 5G4KA 4HADA 3PRJA 3WFIA 2VYND 3OETA 1QRRA 1EFKA 3E82A 3GGOA 3HJAA 3OFSA 3OQBA 3PI7A 3DHEA 3QV1A 4QX6A 3I3OA 4QQRA 3RFVA 1KYQA 3WICA 2JCVA 4AJNA 1YVEI 3BMOA 4Z9FA 4J3FA 1GCUA 3DMTC 3JQ9C 1ZW1A 2GN4A 2HMWA 2F1KA 1PTJA 2YJZA 5U9CA 3ZWCA 2VTEA 2AE1A 3D4PA 1BXKA 3HE3A 3WGGA 2EERA 1M66A 3GPDG 5BSHA 3H9GA 4KOAA 3TN7A 2P2SA 3G1TA 1VE9A 2OBYA 4XQCA 3BMCB 2HRZA 3OHSX 4FDAA 3DFUA 2O3TA 4QTZA 1H6BA 3LK7A 4BNIA 4ZQBA 2E6UX 4BO3A 1O6ZA 3WB9A 2J3KA 5C37A 4QUKA 1F8FA 1HDXA 5ILOA 1IZ9A 2IZ1A 3GFBA 4CMKA 3SLGA 2R2GA 4P8RA 2Z1NA 3OF2A 4LVUA 4OKIA 3W8FA 1QV6A 2H5LA 5JAMA 2VWPA 3FBGA 3RROA 1UH5A 5C5IA 4CV2A 4PRLA 5AVOA 3QHAA 3PFFA 3WR5A 4BMVA 1HSOA 4BOYA 3HDQA 1DFGA 3UCEA 4CLRB 3RUAA 2FP4A 2ZYAA 1GTMA 2I99A 3F9IA 5EIOA 4FFOA 4XR4A 4CL3A 4FQ8A 4WECA 5CG2A 2NNLD 4U0KA 5DBGA 4K1LA 2PA3A 4B79A 3N7UA 4BKUA 5JO0A 4JNKA 4PG4A 3NUGA 2PV7A 2Y67A 4GX2A 1ZK3A 5G4KB 4N7RA 1HF3A 1ZK2A 3A28A 1R4MA 1A5ZA 1K89A 4MVJP 4RF2A 4EYEA 3HWRA 4NHEA 2I67A 3DBRB 1PS8A 3EVNA 4JQCA 1YB4A 4PZEA 4JROA 5IJZA 2D5CA 4GX1A 3OH8A 1N9GB 3JQ7B 3CH6A 2X5KO 4J4TA 3H65A 4MVJM 3TDKA 5JAZA 3TFQA 1OAAA 3JQGB 1YL5A 4IDDA 4J90A 4L0QA 3QVWA 4DRYA 1RYEA 3BMQA 3DHYA 1Z73A 4RVSA 4M1QA 1E1LA 2EP5A 1PR3A 2CVOA 4W9NC 1UP4A 5TS3A 5F5LA 1CETA 4N54A 4RL6A 4DIBA 4XCVA 1EDZA 2Q50A 5KKAA 4BO4A 1X15A 3IQDB 3MWDB 1V3UA 3DAFA 3KSUA 3CMMA 3L4SO 3PYMA 5CDUA 3L6OO 3QJ5A 4GKBA 1E77A 1ZKMA 3BMNB 3MJVA 5A05A 4JGBA 5I7FA 4RZIA 4MP8A 4B3JA 4OSPA 2PZJA 3NDIA 3DMTA 3H3JA 4A5OA 1U7HA 1ZJYA 1IOLA 3GK3A 3AI3A 3K5PA 4NBVA 4IS3A 3FD8A 4CR6A 3I83A 1E3WA 2HDHA 3RASA 1XIVA 1YOVB 4CQMB 5L7YA 3GQVA 1U8FO 2FOIA 5DCYA 5KJEA 1JTVA 3JD2A 3W6ZA 1Y8RA 4E4YA 2AQKA 1JVBA 3PEFA 2ZYDA 5CEJA 3K30A 4ZICA 2VRCA 2GPTA 2NUAA 3DEYX 2NV6A 4KZPA 4CLHA 4D44A 4DLAA 3FR7A 2Y1EA 4FFNA 3TL3A 5J23A 4KTVE 3EK2A 2IZ0A 1A7KA 3SXPA 5CDTA 5THKA 5C7OO 2RH8A 1E3EA 3MTJA 4J49A 2BFOA 3Q2IA 4EEXA 4NIMA 3ZNQA 2QIOA 1Q0LA 4W7IA 4FFPA 4I5GA 3PQFA 3WOHA 1T1RA 2QZZA 3H9UA 5GMOA 3PK0A 2QZ9A 2VHYA 3LC7O 1Y9AA 1IY8A 1SPXA 1G0OA 3D5QA 3LF1A 3ZGYA 2RAFA 1P1IA 3VZSA 2QG4A 3ULKA 4AJOA 3INRA 4A73A 4YACA 7MDHA 2IEBA 1P3DA 3U4DA 3TOXA 3IMFA 4BNLA 2IZZA 2I3GA 2GN8A 4Q9NA 1BMDA 2CFCA 4BVAA 4AICA 3MJSA 1KEPA 3SLKA 3HDJA 4ZRNA 2JJYA 3ZHZA 5IXYA 3ENKA 2X9VA 4Y8VA 4YTEA 1MFPA 5A4DA 2NU6A 1N7HA 1DJQA 1PGPA 3IIEA 2O48X 2FR8A 3VKVA 1ENZA 3GN2A 3PYXA 3QQPA 4JBHA 3SJ7A 3AK4A 5I9NA 4M89A 5JCJA 3IOYA 4RZHA 3GEDA 4H16A 4PCVA 3WG9A 4BGEA 1E3WB 1H2BA 4OYRA 2IE0A 1E5LA 3QWIA 3JD4A 4D7AA 4AL4A 4ZQHA 2PKQO 2HAEA 2WYVA 2ZQZA 2NU7A 1W73A 2BFPA 3ITDA 4DMMA 2J3JA 1T2EA 3P19A 1E6EA 5ENVA 1RKXA 3H2SA 4R1NA 3B70A 3GAFA 1SEPA 2Q2VA 4Q3AA 1XYGA 1YWGO 5JYEA 4CLOB 4CMIB 3MWEB 1ZIDA 2O3SA 4N18A 4DLBA 1B14A 1DRVA 3JYOA 3VVBA 1NNUA 3GRPA 4J16A 1PJSA 3RWBA 3ZWPA 3F1LA 1PQUA 1CEQA 4FPXA 1A4IA 4UULA 3JD0A 3I6QA 5T67A 1HEUA 1HYEA 1Q0HA 3A4VA 2WDZA 3OQ1A 4FW8A 1NR7A 3L9WA 3E48A 2JCXA 1CDOA 1CF2O 4R54A 3CUKA 3OICA 3LDHA 4BGVA 3CZRA 3RU7A 2FHSA 4GSLA 3ZWAA 4CLRA 3W6UA 4ZGWA 5LCXA 3RQSA 1VLLA 2LDXA 3MCVA 4CUZA 3HDYA 3PWSA 3ROKA 3TL2A 1F12A 2CDCA 2NSDA 2Q1SA 4UREA 3PHIA 4TRMA 4Q3EA 3RKRA 3LT1A 2VYVD 1WMAA 2AEMA 1E7MA 4GGOA 1E1MA 4FSHA 1HLDA 3PPIA 2C5AA 1E7RA 5JMPA 4CJXA 3R3SA 3UOGA 2HMTA 1QYCA 1ZO8A 1BXGB 2DBQA 4IXWA 1R12A 1OC2A 1U5CA 4GAEA 1I24A 3GVCA 3INTA 3P2OA 3IKVA 2YYYA 2QX7A 4J1TA 1QYXA 1A27A 1NQ5A 1OFGA 2JL1A 3DBRA 4RQUA 1KEVA 1XELA 4CMHA 1KY5A 1IHXA 4XB2A 3VZPA 1O94A 1WW8A 2C7GA 4RPHA 2CVQA 3QE3A 4LRSB 1UDAA 5EJ2A 3C7DB 1UZLA 4YJGA 3C3XA 2D1YA 3WBFA 1QLHA 1JAYA 4A27A 5K6AA 1Y5MA 2YFQA 1ISMA 4IZHA 2OOSA 3WTCA 3V1TC 2DAPA 2X9NA 3X2EA 4QXMA 1JQBA 3AY7A 4MJLA 1V35A 1X0XA 1I2BA 3G3EA 4HKTA 3QIVA 4MP6A 3WJ7A 3JQCA 4E31A 4RPLA 2O23A 5ILGA 3MJTA 1G0NA 1PGJA 3V8BA 5L40A 1EVYA 3PWKA 5DP1A 2WWRA 1LBEA 1PSDA 2Y1FA 1H0KA 1LDMA 3UFXA 1ZK4A 3PVZA 4Z6KA 1QG6A 2G82A 2JHGA 2ZB4A 5DBIA 2ZYGA 4PN3A 1NQTA 1DDOA 3QVXA 1N1EA 1ADBA 3C1TA 3PLRA 1GCOA 5TLSA 4CQMA 2HMVA 2EJWA 2EG9A 1PL7A 1EZ4A 1X7DA 2BGKA 3ZWVA 1PGNA 1PJ2A 3L77A 1HDOA 4JK3A 1U2DA 3GHYA 2VNAA 1ZZEA 2HJRA 5DNAA 4D41A 1H6CA 2HRBA 4CV0A 1ISFA 3I9MA 2WD7A 3VHRA 1DRUA 4DUPA 3I9LA 1TLTA 3PZBA 3FSRA 5BSFA 3S2IA 4YYZA 1N92A 1Z6ZA 3FWNA 2Z1MA 3M6IA 2PKRA 1R0SA 1YJ8A 1P31A 5MGBA 4JIGA 4PZDA 3O26A 2TMGA 4IDBA 4TZKA 3D4NA 5ER6A 1QORA 2JAHA 3FTNA 3GDGA 3VZRA 5JNLA 3KETA 2O4CA 3GNTA 2XF8A 4Z0HO 4GMGA 4DMLA 3H4VA 3I4CA 5EN4A 2EKLA 4DQXA 4CMBA 1FDVA 4U5QA 3VOSA 1VL6A 4NQZA 4B3HA 3WGIA 4XIYA 2D5AA 4F46A 4Q3CA 5KVSA 2WSBA 2ZKLA 2HU2A 4HUJA 8ADHA 4QSMA 5CHEA 1OBFO 1X0VA 2GD1O 4UUMA 5JDIA 1P74A 4NU6A 5DCUA 2PY6A 1IUKA 5JCJD 3CEAA 1Y7TA 3EGOA 4O6VA 5TX7A 3W4KA 2B4QA 5BSEA 3V2HA 1BW9A 3O9ZA 2HK9A 4PLTA 4R51A 4BHTA 4YRBA 5DDIP 1ENOA 1HKUA 4NJMA 2C20A 4AG3A 5LC1A 1KETA 5EQFA 2NACA 5A1TA 2AXQA 3QVTA 4ZQGA 4CR8A 3KV3O 1MV8A 1KIFA 4Z0PA 3VAZA 1HDYA 4J91A 1I0ZA 2NQ8A 2V6MA 2X0JA 3P5SA 4DC0A 3A1NA 3GUYA 4NFHA 4D46A 5JS6A 2UAGA 4S1VA 4NK4A 1SMKA 5AOVA 1PL8A 4XQGA 4MVJI 1J6UA 1PWZA 4J1SA 3CINA 3KZVA 4YAJA 1BHSA 3WGZA 1HWYA 5KVQA 4CQLB 3AJRA 1TEHA 4CMGA 1EDOA 4RGBA 3UCXA 4BMNA 1BDMA 2CMDA 4ZRMA 3X2FA 1NR1A 3GH3A 1MC5A 3DXFA 3PJGA 4OIMA 4ALJA 3F4BA 3AM3A 2B5VA 2HLPA 3DBHB 5EL0A 1ULSA 1EBUA 1KERA 4ND3A 4YJFB 4Z9YA 3TJRA 2ILTA 2NU8A 5CEFA 2WYUA 4ZQEA 4AJJA 4BO5A 4CMEA 2AEFA 4E21A 3S8MA 4A2CA 4NFSA 1K0UA 3KBOA 1DHTA 3HADA 1T2AA 3U49A 2QYTA 3TZHA 1YH3A 3GDFA 4UVEA 3EZYA 1GUZA 2AE2A 1ADFA 2GNAA 9LDBA 4CM6A 4NI5A 4D45A 3GNQA 5FI3A 4U7WA 3S2GA 1J4AA 5KCZA 1D1TA 4MKRA 3JQ9A 1KY4A 4YQZA 1U3TA 3G49A 3H9QA 2H6EA 3ZV4A 3DBLA 3TZCA 3ZV6A 4JLWA 3EVTA 1PJTA 2EGGA 4EJMA 3VH4A 1YB1A 2AEJA 1LSOA 1ZBQA 5C7IO 3GG9A 1E3LA 2D4AA 1NQAO 4JP2A 4XYGA 4WASA 4Q39A 3ZDFA 3V2UA 1VJ0A 1T26A 4R68A 4YT4A 1H9AA 3O4RA 2PZMA 3GT0A 3OJEA 4J4HA 4XQ9A 3WNVA 5CAEA 4QO8A 1C14A 1U3WA 1PEDA 1LJ8A 2I6TA 1X14A 2Q49A 2YDYA 3GMSA 3RBVA 1TI7A 3L4BC 2JKVA 4PLVA 5GZ3A 4EBFA 3B1KA 3FNEA 3AOEA 3PDJA 1R0KA 3N74A 1XDWA 3WJAA 1DSSG 3EC7A 4R1TA 4L75A 3BMCA 4M55A 4DGSA 1HE4A 2B4RO 4NU5A 1U3UA 4LMRA 3WWYA 2F00A 1H94A 1W6UA 4IIUA 5AXDA 1OC4A 2DFVA 4RDHA 1VSUA 3F3SA 3QWHA 4TKLA 3TZKA 1F8GA 4H3VA 5HM8A 1UZNA 3W8EA 4WNCA 3IP3A 4ZQFA 4OL9A 3D64A 2Q45A 2PWZA 5IZCC 1PL6A 3ZNNA 4FN4A 4TZTA 1RYDA 1YQXA 1JWBB 1E3IA 3KTDA 1B26A 5EQDA 2OHXA 3GZNA 4RVUA 3K9QO 3GPIA 3QRWA 4AJ1A 4R4JA 1SCUA 4ID9A 1KOLA 4LW8A 3H9EO 3AM4A 5A02A 1DLJA 1O95A 4BV8A 3DO5A 5JDCC 2X0RA 4DXHA 1HETA 4IBOA 4DVJA 1ZEJA 1C1DB 2Q1WA 1AN9A 3KSZO 1V6AA 5DT9A 4FJ1A 1SEVA 4PLYA 4A26A 4ALNA 3KYBA 1ZMTA 3ZHYA 4GKVA 5ITVA 4FS3A 5IZ4A 1EQUA 1XQ6A 4L76A 2QW8A 4YRAA 1YGYA 1DFIA 5F3RA 2GYYA 1XCBA 3F5SA 4XKJA 1F17A 5COBA 3Q2KA 1D3AA 4KQWA 3WQSB 1V3TA 4R1SA 3R6DA 3UAGA 4PG7A 4BUCA 1U7TA 1P9LA 1N8KA 4DREA 2J5QA 5L4SA 4BGUA 4AJKA 1IHYA 3NJ4A 3WQQA 1X7HA 3JQGA 3OMLA 2QHXA 3GEGA 1H6DA 1M76A 3KLPX 1PQPA 4U6QA 2J8ZA 4OMUA 2X5JO 1Z74A 1L7DA 2PH5A 2FY8A 4LSMA 1Y6JA 3VPFA 1PZEA 2CF6A 2C59A 1AHIA 2XOXA 1O9BA 4BO1A 1JLLA 4WCFC 3K2BA 3PZRA 1YKFA 1U28A 1MA0A 2YV3A 1EUCA 4U0JA 4R69A 2OO5A 3DR3A 1DXYA 4IQGA 1VC2A 3VZQA 2D2IA 2FZEA 4WCFB 5G4LA 2ZIZA 4KDFA 1HZZA 5JC1A 5CPBA 4O63O 3E5MA 1P45A 4MVJH 4D3SA 1DB3A 1I2CA 2YHIA 4NH4A 4O59O 6LDHA 1XLTA 2DM6A 3D4OA 2NQTA 1YXMA 4ALMA 3DZBA 4AFNA 3RSHA 2FR0A 3FN4A 5IF3A 3H9JA 2VRBA 4ITUA 1R15A 4D3FA 3QVOA 3VH1A 5BSGA 2V6FA 1XG5A 1QP8A 4EJ6A 5GY7A 4FB5A 3V5NA 3TPCA 2OGUA 4GMFA 5K9ZA 3HFSA 1FDWA 1R6DA 1XEAA 3GC6A 1EVJA 3PJEA 4ZD6A 4DYDA 3V1UA 2IXBA 3LLVA 3LVFO 5BR7A 9LDTA 1PQWA 3U62A 2FPGA 4FJ0A 3GG2A 3C1OA 4AJEA 1B8UA 3C7AA 2V65A 5T8KC 4Y6PA 3M2TA 1R4NB 2ZB7A 1ML3A 2CDAA 2JFGA 3ENNA 2YUTA 1T25A 4G81A 5L7TA 4PLGA 4E0BA 1E0DA 2R00C 1Z45A 1O89A 5ICMA 2B69A 1T2DA 3BMOB 2VZ0A 3KYCB 3ZW9A 4F6CA 1NXQA 3DOCA 3GMDA 5DULA 1ARZA 4YJFA 3JQFC 3F6YA 2RHRA 4IQ0A 4R5MA 1YS4A 4B7UA 5JY1A 3OECA 1G6KA 3ZWXA 2BF7A 4XR9A 2NM0A 5L4LA 3MTGA 1BG6A 1DAOA 2J3IA 4BIIA 4FR5A 2POQX 4I8XA 3S2FA 1DC4A 4II3A 1MUUA 4J2HA 4AVYA 4I1IA 1NVTA 1YQDA 1DIAA 1X13A 4IJUA 3JYPA 4D3DA 4WEOA 1ONNA 1XGKA 5EINA 1BWSA 4O1MA 2Q4EA 1LU9A 2QRJA 2VNSA 3BXXA 1Q1NA 1C0IA 2VYVA 4Z0TA 5B1YA 5C7LO 1AXEA 4IIVA 1XHLA 1SC6A 4B8ZA 3IUPA 3ZCXA 4IJKA 4EEZA 4XWYA 1IYZA 1RM3A 2OMEA 3VPXA 5FEUA 3UICA 3WGHA 1E7YA 4M49A 3PTZA 1RJWA 1VL0A 1I32A 4PLHA 3U3XA 3L0DA 1K6JA 4NDNE 3D3EA 1PS9A 4DPKA 3WIDA 2X7HA 5KJCA 3UF0A 5ER9A 2C54A 3IJRA 1ISJA 1Z7BA 1WZEA 4W82A 1KC3A 3ZH2A 3AI1A 3R0IA 4YWJA 4G5HA 4BQRA 2PZLA 4WNIA 4J6FA 4LMPA 2A4KA 1JDJA 4WK6A 4HFRA 4BQPA 1H9BA 2Q4BA 5B4VA 2CSUA 4GL4A 3PJFA 4TVOA 1LEHA 2B0JA 3ONFA 3WLFA 1CERA 3I9KA 3WGTA 1YO6A 3H7AA 4IDFA 2P68A 2Q2QA 4EUEA 4QFDA 5L53A 4DL9A 2VRCD 2W8ZA 3ADOA 3M1AA 2YY7A 5JPIA 3FPCA 2O7SA 1QKIA 4G2NA 4HFJA 3IAHA 3KSDO 1UXHA 3WIEA 4B3IA 2NTJA 5G2OA 2IXAA 4H7PA 1AUPA 4RPJA 3JQAD 2I3AA 4PLPA 4Y9DA 1YDWA 4FBGA 5L45A 4QEDA 3ABIA 1UDCA 2E48A 2Q46A 2AA3A 1EK6A 1QSGA 4B4OA 2C82A 2ZTUA 4NK5A 2NVBA 4O5OA 4KUHA 5TT1A 4KTTE 3CIFA 3NDRA 1B16A 2BFMA 4Y6SA 4EZBA 4YXFA 3ETGA 3ROMA 5HS4A 2EV9A 3PJDA 1UP7A 1IPEA 4RLHA 3TRIA 1WNTA 4FGSA 3TNLA 4B7XA 2EW8A 2H1SA 1ONOA 1U9JA 1YJQA 1UZMA 2DBRA 3EAGA 1KEWA 2GZ1A 1LQTA 4XJTA 1TA4A 2G1UA 1DPGA 4CPDA 3HUDA 1PR9A 2JAPA 4U8GA 4DIFA 4CM4B 4R16A 4RVFA 3BTVA 3OIGA 4DPLA 2V7PA 4QECA 1PGQA 4BS9A 4L4XA 2OORA 4OO3A 3NT4A 4HNHA 2J5KA 1YL7A 3T4EA 3AFMA 2C5EA 1DIHA 5F1PA 4A0SA 1P1KA 2B5WA 3I4FA 4WPGA 3MZ0A 4YJGB 2ZTLA 3MJ4A 4XGNA 3D7LA 2GDZA 2CNBA 1SAYA 1QMGA 3I23A 4WGGA 2X0IA 5F1KA 5CDGA 1D8AA 1XWFA 3H6KA 4CV1A 1XKQA 5EMHA 1C1XB 1IZ0A 5CP8A 4PLCA 4FCCA 1NX6A 3Q3CA 3L07A 2BI7A 2C7VA 1LRJA 2Y0DA 4KUEA 4WCDA 1P0CA 1MFZA 2X0NA 1EE9A 2EWMA 1I01A 4Q3BA 1WWKA 2E37A 3ZU5A 3BIOA 3FI9A 4B4UA 3ZWMA 5G0WA 4MIEA 3QY9A 4UVDA 3WMWA 3NTOA 3PIDA 1LDGA 1J5PA 4IGFA 4Z3KA 1A72A 2YQ5A 3CPSA 1IL0A 2RH4A 5CPFA 4K9DA 4MINA 1WDKA 1GY8A 5BQFA 5ICSA 2FMUA 2D3TA 2RHCA 4CL8A 2GGSA 1KVRA 1AE1A 1M67A 3SC4A 4CUJA 4B4VA 4NZ9A 5G0VA 4BNUA 1UXGA 4NBUA 2PD4A 2BGMA 3WX0A 4II2A 4TRNA 1H2HA 1E6WA 1MGOA 3WSWA 1PJ3A 1ZSNA 4AJPA 4DBZA 3U4IA 1LLDA 1A7AA 3KB6A 4KMSA 4Q3DA 3K31A 3E1KA 1SOWA 4AJIA 2GN9A 4R01A 3FNFA 5H82A 1DIBA 1GFSA 4E13A 4IS2A 4OSOA 2DT5A 3JQBA 2V6BA 4AJHA 1TT5A 4TRRA 2QQ5A 3I52A 3SEFA 3OJOA 4BNNA 4OXNA 2PKQP 3EW7A 1GADO 4OHUA 4YDRA 3WGYA 4YR9A 3FHLA 5KWEA 1PGOA 5F5NA 1DAPA 4TVBA 1FK8A 2OP1A 2DC1A 3BMQB 3B20A 3DOJA 3NT2A 1Q0QA 1W0CA 2NTVA 2CZCA 3SJUA 2W2KA 1DEHA 1ZK1A 3E9QA 3WS7A 5A9RA 4IUYA 1HDRA 2FN7A 3GEMA 4GVXA 1E6UA 5CFZA 5ES3A 3KEOA 2XPCA 4RDIA 4UUNA 5CG1A 1VSVA 3H3FA 3H5RA 3HZZA 1NFRA 3TWOA 1LSJA 1ZXBA 3RUDA 1FMCA 4D0RA 2UV8A 3A06A 4Z3DA 4XDYA 4CMCA 3GVPA 3QSGA 1UR5A 2RIRA 3NTQA 1CWUA 5L4NA 4C7KA 2A92A 4HNGA 4J0EA 5DP2A 3UH1A 3W4IA 2CY0A 3QW2A 2VUUA 2G17A 3RUFA 1H6AA 4XYMA 1B3BA 1GU7A 3U0BA 1P77A 4FOSA 1JAXA 1P0FA 4AJ4A 3WYBA 1HT0A 4EUHA 1SBYA 4ND2A 1A4UA 1GR0A 2QRLA 4FJ2A 1TT7A 5TT0A 4EITA 2HUNA 3DAGA 3BTUA 4J1QA 1QR6A 3AU8A 4E2ZA 5DBFA 2I5PO 3ZWBA 5CDYA 3U09A 4W99A 5I9MA 4YAGA 3GY0A 3ZN2A 2IYOA 2HCTA 4B7CA 3HB4X 1ZEMA 3RJ9A 2AG5A 2BELA 3OEWA 2NVWA 1NBOA 3RFTA 3DTTA 4MVJF 5HA5A 3DZIA 4RLSA 3DTYA 3Q9UA 1EUZA 1GUFA 4JXKA 3ZHBA 5JMWA 1LNQA 4MOWA 3WTBA 2WD8A 4ND1A 2CD9A 3JQEA 5JAIA 2CUKA 3AM5A 1BVUA 4BMSA 4XDZA 3AY3A 2HMUA 2TMDA 2Y0CA 2ZB8A 1Z82A 3GRKA 4JBIA 4IINA 3AU9A 1M6HA 3BTOA 3VTZA 4RVDA 1LSSA 3JYNA 4ALIA 1FJHA 3D1LA 4ESOA 1KC1A 3ROPA 1BTOA 2E4AA 5DOVA 4PRKA 3ORFA 1DIGA 4PLFA 3OA2A 3MOIA 4YAIA 2IYPA 3AUTA 1JVSA 1GZ3A 2PR2A 4JX8A 1I5RA 4BKOA 1GYPA 2D59A 3T7EA 4Y67A 4D43A 1PU2A 3UCFA 3SX2A 4QT0A 2ZCVA 3MJEA 3R3JA 4OOFA 2Y1CA 5DZSA 5KJFA 2PFGA 3LQFA 1YQGA 4FFRA 5IXSA 2ZATA 3E5RA 3Q11A 5I9LA 1V9LA 3P7MA 2O50A 2VHVA 4DQVA 1EEHA 1DBVO 3RBZA 4RVGA 3AOGA 4YPOA 5I7SA 5L95A 2EKPA 1I33A 2DUUA 5JE8A 1IPFA 2Y66A 4GSKA 1EBFA 2FSSA 1SOVA 4FC7A 3KYDA 2P5UA 3ZU3A 3HQ4O 3R1IA 5BT9A 1HDGO 3K73O 4PLWA 2X4GA 3GAZA 1GQQA 4PGFA 4ZN6A 1ADGA 4OH1A 4CLOA 1L7EA 4XRRA 1M6WA 3I5MA 4JBGA 2HQ1A 1LXCA 1I36A 1Y1PA 4BKQA 3WBBA 5IDXA 3B6ZA 3FNGA 3JD3A 5KNLA 2DVMA 4IQ8A 1ZVMA 4XGKA 3UUWA 3ZU2A 2Q3EA 1U4OA 5T64A 3LT2A 4J9VA 4GBJA 2E49A 4WKGA 1GEGA 4DA9A 4DLLA 5ITWA 4GWKA 4CM8A 4NBTA 3RBXA 4DIOA 2OL4A 4E30A 1PZFA 1TB4A 3H5AA 3JQFA 3PXXA 3EHEA 3JQAA 4LVCA 5HS6A 3AI2A 1LX6A 2AMFA 1T2FA 1OZAA 4I5DA 1HDZA 3V1YA 3ZV5A 3WNQA 1Z75A 5FYDA 1JWAB 2J3HA 1YBMA 2O4UX 2O7QA 4NMHA 2DTXA 1SO8A 3FBTA 4C7JA 2VTDA 5T8KA 1NVGA 4OM8A 4JJIA 5A03A 4URFA 2BRUA 3KVOA 3TQHA 5K0ZA 1VPDA 3NX4A 2Y68A 1O8CA 1Y81A 2BKAA 4B8WA 4RO0A 1O5IA 1UJMA 3ICPA 2ZK7A 3C1AA 3PGXA 1X7GA 3O03A 1XU7A 2BD0A 5HBRA 1M2WA 4F3YA 4CM1A 3HFGA 3E9MA 2WE8A 1P33A 3ZV3A 4QFCA 4I9NA 3DBHA 3RUIA 2VN8A 1HE3A 2OBNA 5ADHA 4IDCA 3DAPA 2C0CA 3S55A 5C3MA 3WLEA 2W2LA 3DMYA 1CJCA 1Q7CA 3G79A 3JV7A 5JLAA 2JD0A 3RD5A 3WGOA 5KOIA 3F46A 1B0AA 2V6GA 3AFNA 3JQBC 5IDYA 1NTOA 1IE3A 3K96A 3PFWO 1B7GO 1ADCA 1SZJG 2P9GA 3HN2A 4WCFA 3DL2A 3ST7A 5COAA 2JFHA 5T6BA 1WDLA 3KM0A 1F0YA 1MG0A 3GVIA 1ULUA 1R66A 1NPDA 5H83A 5TGDA 2YHIB 2FWMX 3QWBA 5AXCA 4CM8B 3EZLA 4BNFA 4E5NA 4WEQA 1A71A 3H8VA 4RORA 4PG8A 4KWHA 3VPSA 2VHZA 3JQAB 4FD3A 3DOOA 1YRLA 4E6PA 3W1VA 1HL3A 3WXBA 4E32A 5HWSA 1R4MB 1Q7GA 3ASUA 8LDHA 2GN6A 3ASVA 1D1SA 3U4CA 3NAQA 1EVZA 2P9EA 4IM7A 2VHWA 3TZQA 3Q0EA 2CF5A 2D0IA 3QP9A 1B8VA 4DPMA 1P1JA 1Q2XA 3DC2A 3OA0A 3VDQA 2EEZA 2X5OA 3DDNA 2CDBA 2XAAA 1HSZA 3S1LA 4CM5A 3JTMA 4YRDA 4BKRA 1ISGA 3BHIA 4GX5A 1R0LA 2Y05A 4GVLA 3EMKA 5IAAA 2P5YA 2P4HX 3M2PA 4JN6B 1U8XX 5FI5A 3STHA 4WLOA 4NNJA 4FFLA 3EUWA 1R37A 4MVJA 4M8SA 3AWDA 1LC3A 3KO8A 5JXWA 1GQ2A 1PZGA 4CMAA 4OXKA 1LTHR 1RM5A 3BHJA 4BNMA 3KXDA 3CZMA 4RV9A 1HXHA 2RCYA 4XIJA 4LGVA 3TF5A 2GLXA 1N5DA 2ZB3A 3EDMA 4RF3A 3D3WA 1KS9A 1WVGA 2I76A 4IJVA 4N5NA 1YL6A 4BO7A 1GEEA 1PX0A 1YOVA 4MP3A 3WSVA 2BGLA 1DHRA 2D8AA 4MIYA 5H81A 2YW9A 5GZ1A 4WLEA 4ND5A 4YT5A 1E1NA 1WLYA 2P91A 4UEJA 3VH2A 4PVCA 3UW3A 4GGPA 4LISA 1H5QA 2P4QA 4E12A 1LUAA 2A94A 1PJCA 5HRUA 3NGLA 3PHLA 2EXXA 4MPDA 5JW6A 2X86A 1E5QA 4CLDA 5F1OA 3F5QA 5IDQA 3OJFA 4Q3NA 4CQLA 3ON5A 3GUCA 4BNHA 1LLUA 3WYCA 5AYVA 4EDFA 4YAEA 2X6TA 3O38A 3O8QA 1NPYA 3GR6A 3IP1A 4E3ZA 4EW6A 3TFOA 2PD6A 2EP7A 5CDSA 4WOJA 1DC3A 2HK8A 3OIDA 4JJFA 1N2SA 5KVCA 1C0LA 1UXKA 4TSKA 4R1UA 1ONPA 4UAGA 4L4SA 1VKNA 3HHPA 1K5HA 2BHLA 1BGVA 1NQOA 4Y98A 5U1PA 4R9RA 4UVGA 2VT3A 4TROA 2I66A 1PIWA 1RWBA 3E8XA 4CM9A 4CM7A 2A9FA 4PIVA 2EIHA 4MIOA 4S3MA 4HFMA 3I1JA 2OFPA 3L6DA 5B12A 4IZIA 2GCGA 2IODA 3WYEA 2LDBA 1JA9A 5IDWA 5B4TA 4J7UA 1BDBA 3OIFA 4XJSA 3ZWNA 2RBEA 3OBBA 2DPGA 1ID1A 2B36A 3MEQA 4OGWA 3EYWA 3DBLB 1HLPA 2DQ4A 1YDEA 5TSDA 1K6IA 5AXAA 3DONA 1OMOA 2C07A 2DPHA 2AQHA 1XA0A 1ZSYA 5HTOA 2BMAA 5A5EA 2YHUA 4IXTA 1X1EA 1XQ1A 5L9AA 1LQUA 4I5EA 1NM5A 3VVCA 4NFYA 1NASA 4FIZA 3P2YA 1W4ZA 3FWZA 5G0SA 1KEUA 2OP0A 1FF9A 1K2WA 2X8LA 3DQPA 3JCZA 4BO2A 5GZ6A 2PD3A 2YQ4A 1QYWA 4MKXA 4XX0A 4M54A 1WZIA 2DBZA 2Z5LA 5JY6A 1HE2A 2O2YA 3RAJA 2HK7A 2QYSA 4KDEA 4XEHA 1XSEA 1JKJA 2DUWA 1Y9EA 4GLOA 3NEPX 1MXFA 3DHNA 4ZHSA 1YB5A 2E82A 5KIAA 5KVVA 3S2EA 2EJVA 5U4QA 5A3JA 3U5TA 3PIIA 3L9XA 1XU9A 4BB6A 3QVSA 5TJHA 4CM4A 2YDXA 2YV1A 4XB1A 3ETEA 2WJPA 3UHAA 1PZHA 2W90A 3HG7A 1NHGA 4LRTB 4RF5A 1G1AA 3VPGA 4CQMD 2OXIA 1ENYA 1E3JA 4D0SA 1SNYA 1Z7EA 3ICCA 3GGGA 3TOZA 4BGIA 1VJTA 2ET6A 4PG6A 3D5TA 3NKLA 2DBVO 4BNTA 3ETDA 3DB2A 4E5MA 3FPLA 2YFHA 1EUDA 3LF2A 3A9WA 3ANLA 4BNVA 2VZ9A 1O0SA 1NFQA 1GV0A 4GPD1 4XGIA 3RJ5A 3RUEA 4L8VA 3RKUA 3IKTA 2UUPA 3NT5A 3V2GA 4AJLA 4CODB 2ZJ0A 3OP4A 3GFGA 4W6ZA 3ZNPA 2PZKA 2J6IA 3ZZNA 2A35A 4YJHB 1JKIA 2G5CA 2NADA 3UN1A 5JYDA 1Q7BA 4WLFA 1A9YA 1LI4A 4DWVA 1RM0A 3GZNB 3IDSA 1BXGA 4XZ3A 2JD1A 1K3TA 1QXSA 1ZJZA 3CKYA 4MVJD 2R00A 1AXGA 3NTRA 1EK5A 4HWKA 5JFOA 3GN1A 3UGKA 4M86A 3GVXA 1FDUA 1DC6A 1C0PA 1GDHA 3VC7A 1T4DA 3Q1LA 1IB6A 4CM9D 2PGDA 4ILKA 3U4HA 2GSDA 5THQA 1PJQA 5A9SB 3VTFA 2VWQA 1NAHA 4WLNA 3FCOA 1I10A 4QO7A 2GRAA 3WGQA 1GZ6A 4L73A 4ZJUA 2C29D 2EF1A 2NWQA 2FZWA 5IG2A 2YV2A 3E9NA 2Y0EA 3PLNA 4I9HA 1ZH8A 5EPOA 4OOEA 1V0JA 1V8BA 3I6IA 1T1SA 2PGLA 4XD2A 4UUOA 4LN1A 4BNYA 1LA2A 3BA1A 5G0UA 1BXZA 4WLVA 4NG5A 4J43A 3FR8A 3UKOA 4R9SA 3W8DA 1ZMOA 3SVTA 3K92A 1Y5RA 4DBVO 2X1HA 1JU9A 2UVDA 1J49A 1QYDA 3QWAA 4BNXA 1DFHA 1TXGA 3RC7A 2GERA 1HYGA 1N1GA 4HFNA 3U9LA 3LYLA 4G65A 4WLUA 4E2WA 3ITKA 1MLDA 5G0TA 1MP0A 2C2XA 3JQDA 4UVIA 5LDHA 1WPQA 1VKOA 3ZW8A 2GF2A 1HTBA 4CMJA 1SB8A 2X58A 1U4SA 2XXBA 1EVIA 1ENPA 2FPIA 4LK3A 1LC0A 1EMDA 3ADPA 4E2XA 1S6YA 3H2ZA 4GWGA 3ZWWA 5KJ1A 2WTBA 1VJ1A 1JN0A 1B8PA 3UVEA 1E7SA 5L3ZA 1GAEO 5TF4A 1K6XA 2QRKA 4A03A 3KYCA 1E7QA 1I30A 1KBZA 3VPHA 4BV9A 3B1JA 4K26A 4OXYA 5B37A 4BNJA 5A9SA 1GL3A 1PS0A 3GF4A 2AHRA 3G17A 4ALLA 4IPTA 4KQXA 5TIIA 4WOKA 1JKFA 4R3NA 4EI2A 3KLMX 3OJLA 4YT8A 2PTGA 3NDJA 2O2SA 1MXHA 2H9IA 3RUHA 1NAIA 3BHMA 4D79A 4GX0A 1YONA 1NWCA 1HDCA 3PP8A 1UXJA 1LRKA 1ZSVA 1AGNA 4RVHA 2ZTMA 2Y1DA 3FRJA 4IDEA 1LDEA 2GASA 4E2YA 4OAQA 3WWZA 5DF1A 1NPTO 2G0TA 3TZ6A 1ZXLA 2W98A 2DFDA 1GYQA 5A3VA 3EY4A 1NWHA 4KUGA 3RVDA 3COSA 1V3VA 4OQZA 1UAGA 4I08A 1R16A 4BL5A 2EKQA 3RC1A 5COQA 5TQVA 4EJ0A 1C3VA 5B4UA 1T4BA 4DQUA 1N7GA 3AOEC 3GZ4A 4TQGA 4D42A 1XR3A 1Y8RB 1LDYA 1CQJA 1I3LA 3E18A 3JQ8B 3NV9A 4J7CA 4OKNA 3PHJA 1WMBA 1RM4A 3BMNA 4BNGA 3VH3A 4I9UA 3GHHA 3ZNOA 5KJ6A 2BI8A 4CLEA 4U6SA 4DC1A 2HKIA 2Q2WA 3AW9A 1EE2A 5TNXA 3HN7A 1HZJA 4J1NA 3PQDA 4E5YA 1ORRA 3DFZA 4B4WA 3ANNA 2G76A 5AQ1A 3FNHA 1DIRA 5ENDA 3KRTA 4PFJA 4Y6RA 3DWFA 1P1HA 2WMDA 3IS3A 3Q6IA 3LC2O 2VUTA 5FWNA 2IEDA 3IL2A 4J2OA 3ZU4A 4LSWA 2FR1A 3KEQA 3BAZA 1U3VA 1LDNA 1DLIA 4JJGA 3A14A 3CE6A 2DKNA 4MKZA 3I9JA 1DOHA 4IDAA 1YBVA 3ONEA 4NBWA 4HXYA 4BO8A 3AUUA 1VL8A 1GUYA 1UUFA 1ZNQO 3F4LA 4MDHA 2PNFA 3AUAA 1DC5A 1VM6A 1LLQA 4YJHA 2VT2A 1LRLA 1MX3A 5JSFA 1E3SA 3RU9A 4IGEA 5BNFA 3AY6A 3ZWOA 3C8MA 1P44A 2W2KB 3LU1A 3KHUA 2WYWA 3ZI0A 4ROSA 4NR0A 5DN9A 5IN4A 1AHHA 3DBVO 2EGHA 1NFFA 3L6EA 2FSVA 3JQ6A 4P38A 3OEYA 2P9CA 2BFAA 1JW9B 4YQYA 5L51A 2WD7B 2UYYA 2VQ3A 2VOEA 1S7CA 2GZ2A 4JCOA 1FXSA 4XYLA 4XRGA 2UDPA 4M87A 4ONEA 3LT4A 1QYVA 4IDGA 3PYLA 3CSDA 1VRWA 4E5PA 2HJSA 1H93A 1KVQA 3WDSA 4YAKA 4FFMA 4A10A 1N9GA 1I3KA 1NHWA 4K6FA 1KVSA 5MDHA 4MVJG 3IC5A 2NTNA 3M1LA 1QLJA 5JO9A 2PLAA 2GUGA 3INGA 4UEKA 4HV4A 1FDTA 3PDUA 1GPJA 4CLXA 5DCWA 2J5RA 5BNIA 5I8WA 4UVHA 1I8TA 2AQIA 3RC9A 2VYNA 1VI2A 1CYDA 1PJLA 2ZJ1A 2Z95A 3CXRA 4CMIA 4W7HA 3DZJA 1BVRA 2BLLA 2EW2A 2VWGA 3RCBA 4CMEC 1L1FA 2B37A 4P4NA 4UEOA 2UUOA 4R5HA 2XXJA 4WUVA 4W9NA 4GLLA 2Y1OA 4EUFA 4NJOA 4FOOA 1HYHA 1KVUA 3GDOA 1ISHA 2B4TO 3TSCA 4PG5A 1SB9A 1RPNA 4C4OA 5A04A 1Y8QB 4E33A 5KKCA 5IFLA 4E5KA 1C1DA 1ZUD1 3GVHA 3HDHA 3F47A 2Y99A 2VOJA 1C1XA 1CRWG 3T4XA 5JAQA 3HNPA 2NVUA 4J4BA 4OJNA 2HMSA 2PK3A 4MVJE 4ND4A 4HBGA 4WE3A 3ROQA 1TVEA 3JSAA 2W2LD 4HX5A 1ZCJA 4X54A 4CM3A 2JD2A 3JD1A 3PGJA 4BNWA 4CUKA 2B83A 4F45A 4R41A 4YBZA 3NJ8A 4F6LA 5JBIA 1CQIA 1HE5A 2EHDA 3QA9A 1YBAA 3MOGA 3GOHA 5TJ9A 4TWRA 3GGPA 4BKPA 3MJCA 5TC4A 3PWZA 4Z9XA 2Y93A 2Q1TA 4OQYA 1BRMA 2SCUA 1NVMB 1UP6A 5EERA 1PJBA 4ZA2A 5I8ZA 3RIHA 2YZ7A 3IJPA 4IMRA 1TT5B 2OUIA 3QLJA 5JDIC 1A9ZA 1WP4A 2WEKA 4RQTA 3KYDB 3FTPA 1B3RA 4YCAA 3F1KA 2O3JA 4CV3A 4P4LA 3DZHA 4BB5A 1GQYA 5F21A 5CEEA 4TMFA 4DYVA 2HO5A 3QWFA 5A06A 2AG8A 4WJZA 4RJTA 3PQEA 2I65A 3OQ6A 1WDMA 2O3QA 3OSUA 4IY1A 1ZK0A 2WE7A 1E92A 1EFLA 3D3WB 3WQRA 3G1UA 3UXYA 1IULA 4BO9A 1B2LA 2DTEA 5JCXA 5KTKA 1GD1O 3DZFA 4EGFA 3SC6A 3JYQA 2ZTVA 1Y8QA 2GR9A 2JFFA 1MB4A 1T2CA 5K6AC 2FRDA 2ZCUA 4H15A 4J9UE 1NYTA 1I3NA 1FDSA 4GH5A 4K6CA 1DO8A 1U5AA 3LC1O 1U2GA 3FF4A 4TKMA 1R4NA 5FF9A 2NVUB 3RUCA 1I2ZA 4LCJA 2AW5A 2JHFA 3O8QB 2X9GA 3LZ6A 1GZ4A 4HY3A 3NGXA 2Q1UA 2W4QA 1X1TA 2R6JA 4HP8A 3ANMA 4P22A 3OM9A 3PHHA 4YEDA 5JC8A 3DZKA 1I3MA 5BNTA 4N5LA 2X22A 3I9NA 4IJWA 1LSUA 1OI7A 3H5NA 3RI3A 2GO1A 2PGJA 2PH3A 5T57A 3KUXA 4RPKA 5DOZA 4IMPA 1DRWA 1F14A 2BH9A 3SBOA 1P1RA 1UAYA 5TRTA 4FC6A 4A7PA 2AQ8A 1J0XO 7ADHA 2I9PA 3C7CB 4PZCA 3JQ7A 4RF4A 1W8DA 4P4GA 1NP3A 3VKUA 3C24A 5EESA 3Q9NA 4ZU3A 3K8ZA 4YVFA 2VWHA 1KVTA 4K28A 4JP3A 3IUSA 4J7XA 4XYBA 1HRDA 1ISIA 2ZQYA 3HSKA 3I9OA 2NLOA 3C85A 4YB8A 4MO2A 4XQEA 1E7WA 1PJ4A 3WMXA 1GPDG 2CVZA 2VUSA 5FFFA 4NPCA 4PLZA 3BYZA 2B35A 3AUSA 3DZGA 4L74A 3K2EA 3CMCO 3BZUA 1PWXA 1C0KA 4INAA 1BW9B 1LDBA 1F06A 3GNSA 3NYWA 1MG5A 2VCYA 5I7EA 2DTDA 1QV7A 4GQAA 4TRJA 1OOEA 4NJMB 1P1FA 2C2YA 2Y1GA 4DTIA 4L9RA 4PVDA 3LSYA 4KP7A 2DLDA 3E03A 5IN5A 3W4JA 4XA8A 1GYRA 3HB5X 1UDBA 2GZ3A 4FGWA 4XYEA 1MC4A 2FPPA
chains in the Genus database with same CATH superfamily
1D07A 1TEXA 3G0OA 4OQDA 1Y9JA 3P0HA 4BTVA 4YMGA 1J5XA 2WZBA 4RE5A 2IRWA 1OLOA 3BB1A 4ALKA 4EGCB 5JDCA 3EGIA 4LCEA 4AJ2A 4MR7B 2D5LA 3EWIA 4DUYB 1UJ4A 3W3AA 1FFAA 1JR4A 1RAGA 2UYQA 1Y0BA 2X5XA 3GDHA 3GJSA 3O93A 3L1IA 2CB0A 1NVKA 2AH5A 2NUPB 2C77A 2E4ZA 2FW9A 2K2QB 4K8RB 1Q50A 4O0LA 1EQ2A 3FG9A 3IOMA 4BIMA 5CFPA 2IDZA 2JLAA 1NMXA 5EWJB 5DJ5A 1Q19A 2D0PB 4C08A 4LOLA 3VDRA 3JYLA 4BFCA 3QVJA 2QXTA 1R6XA 3B3GA 2CXHA 5JD4A 3EULA 1NW5A 5AHXA 4BO6A 1WQ1R 2FLVA 3B6MA 5LZ9A 1PNRA 2WFMA 5IJXA 5SY6A 3Q7EA 2ZJ3A 2PM8A 3PPXA 4GMKA 2X42A 1EHYA 5K1ZA 1NVDA 2H65A 3JWGA 1IHOA 2SNIE 4I5FA 5A5FA 4TXNA 1IN1A 3HWX1 2DQZA 2SICE 1TVKB 3QFRA 1A5TA 1YFZA 3LT0A 5T5QA 5TEWA 3OPNA 1U7WA 3T5GA 3T54A 2GB4A 3ZHXA 2VDWA 1GUBA 2VK1A 3AHCA 4OYHA 3T3NA 1XP5A 1CF4A 2IK8A 1GA4A 4ISBA 3OM1A 3IRUA 1RQNA 1YIOA 2Q0QA 2GXAA 1UKBA 5INTA 3ADCA 3FB4A 1X8XA 2EQ5A 1OAKA 3OPQA 3R3UA 4AYTA 1WXDA 5HZMA 1OVGA 1YI0A 2JLBA 2QI9F 3LPAA 4CIDA 1LS6A 4M9RA 1JYFA 3NOXA 5ALZA 4MQBA 4ZV4A 1E1KA 3DVAA 1NRWA 2V03A 4W8OA 4NBRA 1L7VC 2XNKA 4F1WA 4KWIA 4AY5A 2DETA 3NC4A 1MRZA 1NJ5A 4IG4A 3IAAA 1DOZA 5A9TA 3TEJA 5AWFC 3L0BA 4HADA 3WFIA 1HMYA 2FZKA 3HJTA 3PL1A 1WABA 3TYXA 4Z51A 1ZVVA 4LK2A 4LF4B 5F98A 3GGOA 3HJAA 3OQBA 3CZAA 5K8TA 1GSOA 2AC7A 1NBHA 3I3OA 4MGKR 5DX1A 2BE7A 1K4MA 4I46A 4JYAB 1KYQA 3Q3IA 4DR4B 1GCUA 3VU9B 4RTKA 3DMTC 1UWCA 1Z6QA 1Z25A 1ZH6A 4GM0A 1V37A 1J09A 4P33A 3WWOA 3FNRA 2VTEA 5JQWA 3P4XA 4ZYLA 4Y2QA 2NN3C 4JC8A 2EERA 3GPDG 4HT3B 3OZBA 3V6MA 3GLKA 2YWCA 3MFQA 2I8CA 3G88A 4RFSB 5BSHA 3H9GA 4F6RB 2XMGA 3HXQA 4H2DA 1RIFA 3H97A 4G25A 5FTJA 2HRZA 3OHSX 1SK8A 1F38A 3I34X 2J46A 4FYHA 2GH1A 4C6HA 1E9SA 3NHBA 1H6BA 1R8JA 2AWOA 2OZVA 2E6UX 3LK7A 4WFIA 4D9GA 1F6BA 2I4TA 3NI2A 2J3KA 2VJAA 4N7JA 5HK9A 4BMYA 3MINA 5A6SB 4PFKA 4CMKA 3SLGA 3O4JA 4HATA 2R2GA 4BDSA 1BMFA 2WZQA 4P35A 4LVUA 4OKIA 1E79A 5DX0A 3W8FA 3D6JA 2H5LA 3R3WA 3RROA 2FEKA 5KYWA 2VCHA 3E8MA 4Z1MA 4FSDA 1G6Q1 4AYWA 4EFNA 2V7TA 3DCNA 3WR5A 3LBAA 3QHAA 4GI5A 4A9AA 1HSOA 4AC9A 4CLRB 1DFGA 2ACVA 3ZBTA 2FWIA 2M1ZA 4HB4A 4QOGA 2A59A 2LUOA 3IVRA 3AWIA 2G77B 3DS8A 3P20A 3F9IA 3UJNA 1KJYA 4GNRA 2B5OA 4J03A 3M6MD 4FQ8A 1Q95A 4CL3A 3ZVKA 2OZLB 1B74A 5DK6A 2GBLC 4B79A 3DVAB 4J29A 3EUEA 1T3GA 1UMCB 5JO0A 4URWR 4ZVUA 1OHHD 1SOAA 5H5JA 4RHYA 3L7MA 4JEIA 3K9NA 2HFKA 2GBLA 2ZTSA 1KS2A 2C99A 2C3UA 3QVKA 4IQ4A 3USZA 4EF5A 1M2VA 2YS6A 4JT2A 1HF3A 2DFPA 1ZK2A 2LZ0A 1KJWA 1G3IA 4GEGA 3SM9A 3WV5A 2GILA 3PV0A 5IDVA 3P9QA 4AZSA 3IT0A 1NJ1A 4JQZA 1G5HA 1D2NA 3UAZA 1CJMA 1JSRA 4GX1A 5EJFA 1RJ9B 4DJEC 2C2HA 2JGDB 2ERXA 1U31A 2P2GA 2V45A 3QXCA 4J4TA 2W6OA 3WYNA 4HOYA 1L2TA 3E5NA 3DKIA 1J1IA 1OAAA 1Q91A 1KYVA 1QG0A 2J41A 4HB3A 3RVRA 3UY4A 1T5OA 1WW3A 3GJ3A 5E6UA 4L0QA 4Q7JB 2DPMA 4S1NA 1AZTA 2C4NA 3RLIA 1SKMA 5CDFE 4L08A 3CUWA 1E1LA 1PL0A 2EP5A 3LQKA 1J2JA 4Y7DA 1ZNZA 9MHTA 1TQ2A 4BNTA 1CHDA 3Q8KA 1ZM4A 2FWJA 2WT8A 1CETA 4S1OA 4MRAA 3LTNC 1Y3FE 5H70A 1EDZA 1XEXA 4K9QA 5KKAA 2CL6X 1H05A 2I4RA 3IQDB 4C4PA 2ZP1A 3MWDB 4HHEA 1UBHS 3CMMA 1M6VB 1OGJA 1RBYA 3GROA 2H54A 3SHTA 1ZKMA 1SH7A 4PO8A 4M8NE 3G2PA 5FQNA 5A05A 1PI3A 5DCLA 1XMVA 3V1KA 5IP5A 1KR2A 2PZJA 3FPJA 4I1YA 1UOOA 2GLTA 3DMTA 5F2EA 1HQDA 1U7HA 1ZJYA 1JJIA 2VA8A 3K5PA 2GEKA 3I2YX 2ZIGA 3FD8A 1BFKA 3OZEA 4IICA 4YROA 3R3ZA 2HDHA 2JI4A 3RARA 4D9KA 1XIVA 4CIWA 5EKSA 1Z4KA 4RS4A 4UE2A 5L7YA 1U8FO 4CF4A 4MVWA 3AERB 1JTVA 3JD2A 3K9WA 1YOBA 2QMQA 3DOFA 1H9CA 3I05A 4R7TA 5TPZD 2AQKA 1G3QA 4XDGA 4C29A 1MMFB 3JX9A 3AL0C 3CPJB 1R0CA 1AKMA 2ZYDA 1EP9A 4ACBA 3CNQS 2VRCA 2NUAA 3N5KA 4V1CA 3OPVA 2NV6A 3L6CA 4KZPA 5JVDF 4KZKA 4LRUA 3FR7A 3TL3A 1WTAA 1UKEA 3CH5A 4QQFA 4E1VA 3MTJA 3T8YA 4EEXA 1WY5A 1YZUA 3L40A 2QIOA 2QTMA 3ZLUA 3HCNA 4PHFA 3KQYA 4FFPA 3O4IA 1QRAA 3WOHA 5KU1A 4PYNA 2N1MA 4RGYA 2WABA 4UJ3A 3ER8A 1WZ2A 4J0GA 1BXRB 3PK0A 1ZIPA 5AIBA 5EUQB 2WC1A 2Q1YA 5H7XA 2BFCA 4RHEA 3WAKA 1RWKA 3LC7O 4MYDA 2J6BA 2PLRA 3IB6A 4TWZA 3ZEAA 4AD8A 3B3FA 1VZ2A 3D8UA 2BGIA 4A73A 2KX7A 2WOOA 3ZJUA 2IEBA 4ZYWA 1E1YA 3STVA 5LUBA 3QOFA 4G1EB 4PC2A 3QXSA 4BVAA 3MJSA 1Y3HA 1N3BA 3DGEC 3ONVA 4CKCB 2XMZA 1W2HA 2JJYA 3SOZA 5GJBA 1ULBA 1ZGHA 2H07A 4M9ZA 1QANA 3A6EA 3MLAA 4PZYA 5EY5B 3OPYI 4HAUA 2QTVB 1C9MA 1DJQA 1N7HA 1H3NA 1PGPA 1W5BA 1XZPA 2R11A 3JZAA 4LXXA 5TGTA 4WXPA 3VKVA 1ENZA 3EIEA 2PDAA 3BT7A 1UM9A 3E3OA 3Q8MA 4IDPA 3U9SA 5I9NA 1WB5A 1C4WA 3DL4A 2BC9A 4ZI2A 3T4PA 3O4GA 1SWWA 3AQIA 1E3WB 1Z7WA 3BVPA 3K9GA 4NZOA 1E5LA 2O1SA 5JCOA 4D7AA 4U4AA 1OLSA 2FI1A 4CKZA 4DV3B 3ZPXA 4P5EA 2HAEA 2JAQA 5DNYB 1QGAA 2NU7A 3BXHA 3NASA 1FIUA 4I2VA 3QMWA 1MAUA 4JEHA 5J5CA 2QRUA 3LCRA 3ROTA 3UG7A 1THMA 5J1TB 3E05A 3DDHA 3DVSX 3HCAA 1Z8DA 1Z6XA 2CNDA 2R25B 3B2NA 4GYJA 4MV3A 3AHGA 4O2AB 4GEKA 2ZUFA 4CLOB 1JH8A 1Z13A 1ZIDA 1TOAA 3PFHA 1I7LA 1A5BB 4C0WA 3B82A 5ES4B 5FTLA 3FYTA 3JWJA 3N2LA 3VVBA 2NX2A 5ALMA 3W5HA 4OQLA 3GT3A 1EG2A 3PNPA 1ESNA 5AK3A 1NNUA 4ZZ2A 4C5BA 3HABA 3GFRA 4MV9A 3F1LA 4UTOA 3RWBA 3ZWPA 3R9XB 1PQUA 3BJZA 1A4IA 3FUUA 2NP7A 1E8NA 3JD0A 1ZJJA 2HGZA 2PN1A 3OZXA 5LQMA 2C5BA 4E07A 2A9KA 3OQ1A 2CXXA 3IJ5A 2CEAA 3MERA 4FW8A 4V24A 4B1FA 2V97A 1KQFA 4QVIA 1D2MA 1HG1A 1CDOA 5LP6A 4R54A 1SELA 2VBCA 1QLWA 4HYTA 3FZQA 4J0QA 2YN2A 4LTMA 3Q72A 4IKPA 5HPYB 3RU7A 3FHJA 3L8DA 4MV8A 2DHQA 4U7PB 3TW8B 3V8NA 5LQSA 5E8RA 3B5IA 4ZGWA 2PWPA 2C9OA 2IY9A 2UZIR 2QX8A 3JATA 3OBIA 4EECA 1RWNA 4GICA 1J5EB 3E35A 5JASA 3B2EA 3HDYA 4CUZA 2C2GA 2X2EA 2X6RA 1N7JA 3TL2A 4R7GA 3V55A 2EL9A 1F12A 1TZJA 2CDCA 3D4BA 4FMBB 3PHIA 4OAOA 5G53C 4EPYA 3M33A 4K86A 2EFHB 2VYVD 4M0FA 1WMAA 3JAWB 3MT7A 4E6EA 1CJTC 1E1CB 1TM7E 2QZJA 1W7AA 3EJ6A 3H1BA 3OT1B 4L6AA 2NZ8A 3OZWA 1ZO8A 3HH8A 2NO5A 4KMRA 1OV4A 1R12A 4C1NA 5KHOC 3L04A 1A2BA 2XA9A 3GVCA 2PRYA 3W90A 5K7SA 2YYYA 3G13A 3HN6A 2I0FA 3DLCA 2MSLA 4MCHA 2JVJA 3P9KA 1NQ5A 1OFGA 2JL1A 1KEVA 3DFMA 1KY5A 3T1QA 1JJAA 3H1FA 2WJYA 4M0EA 3ECAA 3H17A 5B6PA 5B1YA 1CR4A 1S3SA 3ER6A 5EJ2A 3FCSB 2IU0A 2IPXA 1WXWA 1XMXA 3CA8A 3KCQA 3WA6A 4LHZA 1JAYA 1Y5MA 1Z68A 2Z9BA 4OMFG 3KQKA 2OOSA 1MOZA 5DH9A 3FGPA 3SX0A 3WTCA 3VV2A 2DAPA 2QWXA 1KJIA 2I4MA 2IS1A 1II8A 1SKBA 1WX1A 4HYQA 1IN5A 4RZQA 1DDIA 2EJBA 4H27A 3AY0A 2SECE 1UF9A 3ISJA 4JELA 5C1DA 3AVQA 2A5GA 5L3QA 2CLHB 4LJYA 3WJ7A 1Y8ZA 1VHJA 2C5HA 5KOJA 2NZXA 3HUEA 3KPUA 4JOSA 5I4CA 4DQLA 5J9FA 3A26A 5L40A 1EVYA 5EYPB 2JFXA 3U3MA 3GIWA 3U1BA 1LBEA 2RJOA 3PGMA 3TQIA 4Z2AA 3C5VA 3C7KA 3RWMB 1FUUA 1U0FA 1V48A 4EY6A 4IOLA 1TZMA 4JMPA 2YOFA 1RBQA 2AXNA 3CLTC 3UFXA 3DKPA 1G9TA 3DLBA 1QG6A 3G89A 2G82A 2ZB4A 5DBIA 2VXCA 2V1XA 1VMAA 2HTEA 3G0IA 1NQTA 5FWXB 4BRUA 3KQLA 3PLRA 2VF7A 1DQYA 1ESCA 3C87A 2DR3A 5T41A 2RGUA 1PL7A 2BGKA 1EZ4A 2OV2A 1PGNA 1PJ2A 1TO2E 2QPLA 2B25A 2Z83A 2V0GA 1LWOA 1JU4A 4IYJA 2HRBA 4CV0A 4DIEA 1ORVA 1WY7A 2DUNA 1I13A 2FFJA 3I9LA 3OOSA 1HG0A 3CURA 4IEEA 4LZWA 2IUTA 4MPJA 4QBKA 1E32A 4RELA 5FO0A 4ZYYA 5ISMA 3FSRA 1YB6A 4GOKA 5KDLA 5BSFA 1TKRA 5AW4A 1HE1C 4V0LA 4RPIA 4YYZA 3FZGA 1XQ9A 3LW8A 4HRVA 2PKWA 3E7DA 2Z1MA 2FRDC 1IZ7A 1L5QA 1Q6YA 2ZROA 3L5KA 1R0SA 2J9GA 1P31A 3IXQA 2QSZA 4HNSA 3T3GA 3OTOB 3P2JA 1Y4ZA 2X8WA 1GU0A 4NV3A 1D2HA 3OOWA 1N5KA 4IDBA 1UPXA 4RVNA 4TZKA 5DN6A 1G7CA 4IZOA 3N8IA 2BCEA 2JAHA 3GDGA 4KVAA 5IPFA 1Y4DE 4F7DA 5REQA 1BH6A 4I4IA 5F2KA 2AZ4A 4I55B 4GMGA 5KTOA 3RREA 1MJNA 5DM0A 4XFKA 4NAHA 5EN4A 2EKLA 5IUNC 2H5IA 4EHHA 2WIBA 2BDTA 3NO4A 4A6XA 4L22A 1IY9A 1T4CA 3OKPA 4PQEA 5JSZB 1FDVA 5EI5A 3SYLA 1DWQA 1DXQA 3QE0A 1DXOA 3WIUA 5KVSA 2R47A 2HU2A 1N4AA 3FHTA 3FCEA 2GJKA 3ZVMA 3ZV7A 3CN7A 1TC1A 4UUMA 1P74A 1KWKA 4JLVA 1JMVA 4HRXA 2IQIA 3FKSA 4Q3LA 1IUKA 1T34A 5TMBA 1HQYE 1Y7TA 3EGOA 1MA3A 4UU0A 1XZQA 3DW3X 2QE7D 4G0MA 4EEKA 2NV0A 1BW9A 3O9ZA 4WXEA 2HK9A 1CEYA 3H6GA 1WVMA 4QOSA 1MF7A 4BHTA 4RU1A 2XGMA 3RYFA 1BRTA 1PF7E 5T4FA 1AH2A 1JEQA 4NJMA 2CUNA 2C20A 3F7NA 4AG3A 4BCDA 4JYBA 2VUIB 1CZNA 1I3OA 2VDMB 2VS1A 3RNLA 2AXQA 2R8XA 4N0PA 5HZHA 2HQOA 4KFTA 3E3AA 1Z7GA 2FZGA 2ZRIA 3G1WA 3KV3O 1FDRA 4G24A 5A1JA 2FPUA 3AM1A 1DO2A 1HDYA 2O1WA 3GLUA 2V6MA 2IF2A 3P5SA 3NANA 4DC0A 3DE4X 1JH9A 3VJRA 4FKZA 4P92A 3KLBA 1W94A 1BHJA 5FD8A 4D46A 3OHPA 1O3YA 1HKHA 2UAGA 1OREA 1H65A 5AJUA 3B3AA 1SMKA 3UGTA 1SXHA 4W5JA 3W7BA 1J6UA 4QLOA 1VKRA 2OM6A 1XEWY 4YAJA 3UW1A 3IEUA 1T0HB 5KVQA 1UWVA 3TTVA 1TEHA 2VBFA 2W11A 3A10A 4UDNA 4WESB 4WWHA 4G0VA 1KYXA 3KZOA 3QQ5A 5EIBC 5LN1A 2Z43A 4D98A 3DP7A 4LYFA 1C2YA 2Q9AA 5E3JA 1LFAA 1U0TA 1YDMA 1ULZA 3D0KA 1QK4A 2VNKA 2HLPA 3DBHB 3E70C 4U9UA 4B87A 2ECQA 1QUEA 4ND3A 3NEAA 4Z9YA 1ZGAA 2NU8A 2OFWA 5HF5A 3TTWA 4BMXA 3HM9A 4KR2A 2OGWA 4BO5A 1BJTA 1JA1A 3VO9A 1GTZA 4H9GA 3IMCA 4RJ2A 4A2CA 4NFSA 4WBNA 2ZSEA 1UDRA 2QUZA 5DXJA 4CT5A 1XJWA 2RFLA 1IJFA 1BJRE 1TECE 2FFAA 5JISA 1LNZA 2GBIA 1YH3A 5LMCA 1FY2A 2MSEB 3EZYA 4BUJA 1G2QA 1ADFA 3LUGA 1E1DA 1E61A 4D45A 4U7WA 4BZXA 1VZ3A 1Z6AA 5KCZA 1FRFS 1H23A 2VJYA 1KY4A 3HUTA 4EELA 5KEIA 5LWQA 1TGYA 1IVSA 4L6IA 4OQFA 5KTTA 2IZ5A 4LFAB 1J00A 2Q6KA 1X7YB 3TZCA 3PNYA 3PLAE 3EVTA 4L8GA 1KO8A 2O05A 2XLBA 4KVGA 2JLUA 2AN4A 2EGGA 4EJMA 5HOEA 4FNOA 1XZ8A 1YQQA 4LXYA 1LSOA 4TWBA 4FMPA 3GG9A 1SQ5A 3H5WA 4Q7MB 1FJ2A 4G8BA 1B00A 1TYDE 2I78A 4Q39A 1KGDA 2CK3D 2P0AA 2XVZA 3OUZA 4MEJA 4MJXA 4QBGB 5IARA 3VHXA 1OBVA 4R68A 2O19A 1H9AA 4EY7A 1RWVA 1C29B 1ODFA 4FGKA 3CONA 3B1YA 5CAEA 1G5RA 1B1CA 1FS6A 3ZD6A 3OVMA 1LJ8A 2JGFA 2I6TA 1KI1A 1X14A 2WFLA 3CUTA 1NBMD 4HL6A 1UBRS 2GF9A 4R1MA 3RVBA 1FLAA 1QE3A 1SVOA 3DD5A 5GZ3A 4EBFA 5GGXA 5TEVA 1E8MA 1L5VA 2GA8A 4I50F 3DVLA 3CZCA 3C43A 3PDJA 1XOIA 4JENA 5KTYA 3HKCB 4EY4A 2AT1A 4TQ9A 1GLGA 5C32A 4R1TA 2EZ8A 4L75A 5IM4A 2Q5EA 4TT3A 3WK8A 1HE4A 2B4RO 4LJ6A 4DGSA 3KJIA 1VYTA 4LMRA 3VAAA 4OHMA 3WWYA 3NHZA 5EMNA 5IBRA 4MWDA 3WHIA 5SYNA 1E2IA 1OC4A 4QTYA 5CA0B 1ZOLA 3HCDA 2PUWA 3LOUA 4HXGA 2Z6UA 1A9QA 3TZKA 5HM8A 3N2ZB 3EXIA 1UZNA 1YR2A 3CLRC 3G2LA 3Q3GE 4I4NA 4NHOA 4WNCA 2BW0A 2OAP1 3B8HA 3CVOA 4ZTBA 4EZEA 4ZQFA 2R751 3D64A 2Q45A 3DQQA 2MDTA 1L8AA 1PL6A 2DB3A 4ZAGA 1SVUA 3GIDA 2RGNC 4OB6A 3WO0A 2WSIA 1KZ4A 4MMYB 3NBFA 5EQDA 1B26A 3WBKA 2OHXA 3DMPA 2E7ZA 4RVUA 1RXWA 3K9QO 1EDBA 1SUCA 3GPIA 4JI6B 3HKBA 4AJ1A 4BFYA 5HIKA 3TM5A 1A8PA 1GPNA 2AI2A 4B76A 1A04A 3AM4A 1O96B 3IQHX 2QUKA 3LG2A 1DLJA 5IKXA 3C14C 4V2UA 1O95A 2HA2A 3PB3A 4OHKA 3THRA 5JDCC 5A6SA 3PL5A 5M3BA 1BMTA 1YDHA 4IBOA 1ZEJA 3CSSA 3U44A 3HO8A 2WFZA 1EFCA 2HPZA 4B3FX 5FFMA 2Y9PB 2CXTA 1P4AA 3AHEA 3ZE9A 5KINB 1JTFA 2X1VA 3O2SB 4FXOA 4RK7A 5LKRA 4YR7A 2CV0A 2QW8A 1OJ7A 1XZNA 2L2QA 2OBFA 2QL6A 1DFIA 3FKSD 1OI3A 1T5IA 1PLLA 1X1BA 2ZIUB 4X3OA 4XKJA 5COBA 5F3RA 4EK9A 4OCZA 4O4JF 4V0SA 1MW8X 4I4CA 3MGAA 4R1SA 3WK4A 1ZUNA 3BERA 4X8MA 1J22A 5AI4A 3DGFC 4RJJA 4PG7A 1P9LA 2GJ4A 1QQ5A 4P7KA 2J5QA 2Y3IA 3C4JA 1QOPB 3KXKA 3LRTA 3Q7TA 3CG0A 1SRQA 1U0JA 3WRYA 4A82A 3WQQA 1EFVB 2ALJA 3OMLA 1BWPA 4GZMA 1H6DA 1M76A 4QGBA 1PQPA 1PFKA 1BX3A 4NV1A 4G56A 3IE2A 3COVA 4H7EA 4HJRA 3VPFA 4RHUA 2H1CA 2VZEA 3FJOA 4BS9A 1M1UA 2DWQA 1GGMA 1UJ6A 4UZFA 4WCFC 1O54A 3FM9A 1OBCA 4FYKA 3M6XA 5ITSA 2XECA 4DV4B 2BFNA 2EDCA 1JEEA 2BT4A 4QPJC 2PGOA 2ZJ2A 2F6RA 1O6GA 2VAMA 4LWOA 1EUCA 4LJ4A 2ZIEA 3S1AB 2BEWA 2FN4A 3PUWA 4XVQA 2BPOA 3SJAA 3VPAA 3VZQA 4PZLA 3H0CA 2ZIZA 1RVV1 3GFTA 1HZZA 3QI7A 4OUKX 4YJ2F 2HDNB 1Q7EA 1QZTA 4GPEA 4UEQA 1MCZA 3OEHA 1W0KA 4WN9A 4PXAA 3VR4A 4AAYA 6LDHA 5LZ5A 3ZY3A 1XYVA 2CL7X 2NQTA 1YXMA 1DCKA 3CRW1 4PGAA 2ZPTX 5KNBH 4ALMA 4UCFA 3WKEA 2WM2A 2YZKA 3TIGA 4AFNA 1Y8AA 1QGOA 4HBZA 4Y18A 3FGNA 1SXPA 2BBOA 4ITUA 3W78A 3H4MA 3I0MA 1QRDA 4OLHA 4D8VA 3BDVA 1WXIA 4IDNA 4MZXA 3GH1A 1E59A 1FVXA 2OGUA 3QLTA 4ON9A 2HT6A 3FA2A 3HFSA 4CKEA 5JUWA 1JWLA 1EVJA 2AOXA 4O5AA 2O0JA 2O2ZA 2L42A 3TPZA 2FSHA 2HF8A 3LLVA 3UMCA 3V1UA 3KUUA 1PQWA 3KJQA 4MW2A 9LDTA 2WSSD 1WKCA 3GG2A 5IJ9B 3AT1A 1XTQA 1U9IA 3C7AA 3QX8A 1JL3A 5T8KC 3RFUA 1O08A 5IYZA 1R4NB 1ML3A 2ZB7A 4KNYA 4KOEC 2YIJA 2YUTA 3F5MA 3OZTA 1E5TA 4DR1B 1FRQA 3M3PA 4OB7A 4PLGA 1JVNA 1C5KA 2GVNA 3DOHA 4YAOA 5T6MA 3T7IA 1T2DA 4HEQA 5FL3A 3BMOB 4LHWA 4F6CA 4FEGA 1NXQA 5BVHB 3JQFC 2VTKA 3F6YA 3H3XA 5DGDA 4AU1A 4CQNA 4FUTA 4YGYA 2H1FA 4KCGA 3N1UA 4ID3A 4R5MA 3GUZA 1G17A 4UHHA 4B09A 2G71A 3M81A 1YS4A 4HNRA 3VR5A 4RVCA 1G6KA 1N5JA 4XR9A 4AW9A 3MTGA 1BG6A 2J3IA 2B1QA 1YC2A 2IZ6A 4FR5A 4LPSA 4YK7A 1UMDB 3CO0S 4MWEA 3CX6A 5AJZA 1N1DA 3TKLA 2ZIXA 1MUUA 1A1SA 1FRZA 3HP1A 1TUEA 1J2YA 3R09A 3C3CA 4FZJA 1FYEA 1AG9A 4WBNF 1WOYA 1DIAA 1Z0JA 4U2DA 1CUZA 4IJUA 2XOEA 3FCYA 3R5TA 3KX2A 4ME6A 2IBTA 2PS1A 2DPLA 3KJEA 4P82A 5D3ZA 2XUIA 5ALXA 1ONNA 4JOCA 2WHRA 1XGKA 4C4AA 2I2DA 1CEEA 3U61B 4ZYZA 4O1MA 4OXIA 1ZCFA 4W8HA 2QL9A 3GEPA 2C5SA 2Q4EA 1W4RA 4EI7A 2QRJA 2IEZA 3PQCA 1Z17A 2VNSA 1KI4A 4E51A 1Q1NA 3AEQA 2VYVA 2WTEA 3U7QB 1F2TB 1TC2A 2CHQA 1NN3A 2D1FA 2GTHA 4H0FA 2HL6A 1I6WA 1FFXA 1GGFA 3TSZA 2WTNA 3MELA 4KXWA 4PAMA 3CHYA 5ALWA 1HNNA 4B8ZA 3IUPA 2H7VA 3KT0A 4FGZA 4F2PA 1RM3A 3SNHA 3ZJTA 2J4CA 3DZ8A 1WZNA 5E7QA 1E7YA 3OKCA 1RJWA 1VL0A 4K9LA 2OGTA 3PX3A 3MUNA 3ICEA 4LRYA 3LUDA 4RWZA 2E18A 5JNUA 3D3EA 3HB7A 2GDJA 3MS2A 2GI4A 2YOGA 3A9CA 2ZZNA 2ZRCA 3CYFA 1Y1SA 1CUEA 2C54A 2YUIA 2JIPA 1BQEA 4M7PA 1XTVA 3HY3A 4TTSA 1Z7BA 2W00A 1GKUB 3TX2A 2PTHA 1IN8A 2IW1A 3ZH2A 3K9BA 5BWNA 1WPRA 4YWJA 3RKSA 3CNNA 4UXJA 4BQRA 5A6VA 2OV3A 1ECJA 1HYQA 1OU4A 4J6FA 2A4KA 1JDJA 4P31A 3HU5A 3HXLA 4A6DA 4BQPA 3JZDA 1C9NA 2IBSA 1BE6A 3NBAA 4WT7A 2QTGA 3LC0A 4B71A 1PG5A 4DDMA 5B4VA 2XBUA 1LEHA 5EJMA 2B0JA 1CERA 4ZZ1A 1QQ6A 3QEBZ 1TM3E 2KM1A 3I9KA 2RK4A 1RT9A 5CBKA 1F48A 1WD7A 4OP1A 5TPZA 2I6QA 2HO4A 4HPWA 4NBSA 4EUEA 3AZOA 4QFDA 3IHWA 1VBKA 3ZQUA 4B6SA 4MW4A 2YY7A 4Y2PA 5JPIA 4JKOA 5EGNA 2AOTB 2Q07A 3IT1A 4DR6B 3IAHA 1UXHA 4PN7A 1MC1A 2RCNA 3SR0A 2BEUB 5DSZA 5LA6B 2NTJA 4P3OA 3ZCQA 3B38A 4M98A 4CQJA 5JJIA 2I3AA 2OHHA 4Y9DA 3TRKA 4Z7NB 2BISA 3ABIA 1UDCA 4Y3UA 2E48A 1TVKA 1G2OA 1C8KA 2HNBA 2WUVA 3CIFA 1A7JA 3NAGA 1L7PA 5JYCA 3JU3A 1D1PA 5PGMA 3TZBA 1RPAA 5T4HA 3GXOA 1M1NA 4LOIA 1RHMA 4U02A 2A6PA 4X94A 3OE7A 4RXMA 4YXFA 4NYJQ 4ICIA 2R2AA 2EV9A 3AUJB 2JLXA 3DTVA 2A9RA 4KFSA 3UV6A 3E22A 3NM5A 2IUSA 4RLHA 3V34A 4FGSA 1Z0UA 1KY2A 2F3UA 2EW8A 2XUPA 3O3CA 4AMZA 3VU9A 1H4TA 1YJQA 1NM5C 3QH4A 4P3NA 1G18A 2GZ1A 3G2NA 4UMFA 2G1UA 4JBLA 1OV6A 1DPGA 2QD4A 5HRCA 1R6UA 3UJBA 1US8A 1SOUA 1UEXC 2JAPA 4CM4B 4D9HA 1XDSA 1ABEA 1EP3B 3PT9A 4NBKA 5K3CA 2JB9A 3SZGA 4DSAA 2G9VA 4YCMA 5DIZA 4B4DA 1FP7A 4DPLA 1Z5NA 4QECA 1PVVA 1RBMA 1V43A 2P3QA 1U7XA 3DHVA 3QKUA 4H7KA 1GAQA 4L4XA 2A0WA 1E2MA 1SQGA 1UIRA 2OM2A 3OQIA 2X41A 4OO3A 3HPRA 2XUOA 4MA4A 5DWVA 1KHTA 1YL7A 3T4EA 3LY8A 3LFUA 3LECA 3AFMA 2C5EA 1YJ5A 3I2KA 5F1PA 5GAJA 2P6MA 3AVVA 1P1KA 1ZGJA 3FSGA 5EWLB 4WPGA 2RGBA 5IT0A 1XDUA 1GSIA 1QJCA 1VP3A 4HN9A 2ZTLA 3SSOA 3D3QA 1PR6A 3MINB 3MJ4A 2G5TA 4N5DA 3C6YA 3UMBA 3OPYB 4Z4HA 1TKAA 1QMGA 3CVYA 5GJWC 5K2MA 3AVTA 1W1IA 5CDGA 4NL4H 4BQQA 1L5NA 2GEUA 1K8ZB 5KCMA 1E98A 3QITA 2PZGA 5BQ3A 2ZJZA 1BJKA 3Q3CA 2HMAA 3A4MA 4N8EA 2HT1A 3TSWA 1QU3A 2B1IA 4BVLA 4WCDA 2QM0A 3H5LA 1BNCA 1MFZA 3DH0A 3NAZA 3OJWA 1OXMA 3L8FA 1QOQB 1I01A 3R8CA 5IJ0A 1I7QB 4M9UA 4B4UA 1EAYA 1QS0A 3P0EA 4HGYA 5G0WA 1C3OA 3QY9A 5CA1A 5FI0B 4FHGA 3DEJA 3NTOA 3QFCA 1Z62A 5JU6A 3UXEA 3IAS1 3QTLA 1JQDA 3R3YA 5FWXA 1A72A 2ZIFA 4ER6A 4YV0A 1NOKA 2PZ8A 1NUTA 4DSTA 4MINA 1V11B 1GY8A 1WDKA 4KO8A 4QQNA 3VV3A 4YCDA 2QE6A 2X0EA 1AE1A 1ADJA 1E5XA 3SC4A 4B4VA 5HRAA 3UOWA 2WIGA 1TCAA 5BWMA 3AV0B 3MWGA 4BNUA 4ZV7A 4DAEA 4TRNA 1T0UA 2PT6A 1H2HA 2RHHA 3GU3A 4X20B 4ZWNA 3K6SB 3TLZA 4AJPA 1OX4B 2XLCA 3UAYA 1Q0TA 2JZNA 4X1YB 4Z2YA 5LU8A 1LLDA 1R9JA 2PX2A 1A7AA 1ZITA 3ERCA 3T9FA 2GAAA 2VHTA 2VP4A 2XV1A 1S4MA 2UZ0A 2X2OA 4ZVQA 3K8YA 3R76A 3U80A 1NIJA 1SOWA 4LBWA 3G7SA 5CM2Z 2QVZX 4KN9S 4TM8A 4R01A 3FNFA 5H82A 1GFSA 1K27A 4C2AA 4Z49A 1NMYA 1Q21A 3JQBA 2X2FA 1FZQA 4PCAA 4TRRA 5C1IA 2XSZD 1KKLA 3AR3A 2FEOA 3I1YA 4S2EA 2JFOA 3EW7A 5KWEA 4TV8A 1KZ7B 3PKZA 4YR9A 2IYRA 3PQ3A 1DAPA 2V54A 3HKEB 5EIXA 10MHA 2R4TA 3B20A 4AXBA 1OXVA 2QSYA 2XE8A 3VOSA 2E55A 4C7XA 4M1ZA 4IHKA 4MUEA 2CZCA 3SJUA 2W2KA 3WS7A 3E9QA 1ZRSA 5A9RA 4OX9Y 3HA3A 1HDRA 4IUYA 3TK1A 1E6UA 4LHVA 1F7VA 1ONSA 1Y82A 3KEOA 2VDNB 1S2IA 2PXCA 3A6LA 1GL9B 5HGXA 4LZOA 4RDIA 3STUA 2QAJA 4KQ6A 1OT5A 1J42A 5HKLA 3F7TA 3H3FA 3H5RA 5FL7A 5MN5A 2A5FA 3IQXA 1NFRA 2JI9A 1ZJWA 4UDXX 4LOHA 1DP4A 1FMCA 3BH7A 3P27A 4D0RA 4Q4JA 4Z3DA 1G38A 1ZS9A 4LNUA 1L9XA 4XDYA 2JH9A 4A0HA 4CMCA 1UR5A 1L5FA 3P45A 1DKUA 3MHTA 2YY6A 1FP4A 1R0XA 4M0LA 4OSEA 4HNGA 5DP2A 2WM8A 5MDHA 5HP4A 2CJWA 2EBFX 4C2TA 2BKEA 2VUUA 1U8TA 2N0SA 4LFBB 4BFWA 1GU7A 1N6PA 1S01A 1XZMA 2J32A 2ZVQX 3KDAA 3UEOA 1P61B 1Q3TA 2Q7OE 4X44A 4AJ4A 3H86A 3WYBA 1YMVA 4EUHA 5LYJF 2IDKA 5CK5A 4B82A 2QRLA 3K09A 3K1ZA 1MQ9A 3N3BC 4FJ2A 5TT0A 4EITA 2LRHA 4X8LA 3DAGA 1I9CA 5HCUA 4J1QA 1QR6A 4E2ZA 2AVNA 2I5PO 5DBFA 1V25A 3F98A 4W99A 5I9MA 5CXQA 2RK3A 5E7MA 2XYPA 2IUFA 2HPHA 1O94D 3AP2A 4QU9A 3WLSA 9ATCA 4OLJA 2FUG6 3ZVNA 4MGZR 1ZEMA 2XYVA 3RJ9A 1SQ0A 3ZW7A 2BELA 5GTDA 1MOQA 3FHCB 3RFTA 3R5FA 3LPMA 4MVJF 5HA5A 1QQBA 3LCCA 2G1JA 1NONA 1EUZA 2FMIA 2WBLC 1IBSA 4JXKA 4TS4A 5BQPA 3BQ9A 3TQFA 4MOWA 3ZHUA 2FDRA 3LCMA 3R74A 2HA4A 5L6LB 3N8DA 2VTVA 2EVWX 3W3AH 1EH5A 1G7RA 3JQEA 3WKCA 4X7RA 2CUKA 1WV0A 1MEEA 3T52A 3A11A 4Y9RA 3OX2A 2KLBA 5FT9A 1J8DA 1VHQA 2TMDA 3U7JA 1ADYA 1CR6A 2ZRGA 1DBIA 3H2IA 3TQRA 2WG2A 3KR1A 4TTAA 1B1AA 1GTVA 2WSYB 4JBIA 4MGIR 1M6HA 1UBSB 2DZDA 2GN1A 1I1HA 3VTZA 5B7NA 1BYIA 3JYNA 1FJHA 1XTUA 2QX4A 1KC1A 3BD7A 4JQSA 4ALIA 5DOVA 2WV9A 4ESOA 4YRIA 3NDBB 5E7IA 3ORFA 4EG3A 5B7GA 1K75A 2IYWA 3OA2A 5AVZA 4YAIA 1JQEA 2WVHA 3W9UA 4D6YA 2IYPA 1EYZA 5CJJA 1NW8A 3UJHA 5L3SB 3Q3EA 4NOMA 4K9PA 4BKOA 3L0YA 1MC8A 4D43A 1E1QD 1PU2A 2DKFA 2ACEA 3P96A 3MJEA 2ZSDA 4QT0A 1G8MA 1H5UA 3EVEA 3PTAA 1NF9A 5E6UB 1YQGA 2QR2A 4X84A 5KVAA 2HF2A 2JCBA 2V5UA 2O50A 2RBGA 3NHKA 2C9ZA 1QAQA 1XZBA 3NRJA 3UMRA 2H2GA 2VVTA 3KOWA 3PFKA 3AZPA 5GINE 4TQGA 3AF2A 3GJZA 2XIQA 4QJIA 1ZD2P 5IVPA 4LE2A 2HFJA 4LNAA 1UBMS 2DECA 2K7ZA 2A4MA 3NP7A 1MO4A 3GCWA 3HQ4O 2CLEB 5C9ZA 1UBTS 2P6UA 1HDGO 2C1XA 2XB8A 4O4LA 3GAZA 5AO9A 4PGFA 3PDIB 2O52A 4ZN6A 3S5JA 3MWEA 1NJGA 1INLA 1N0UA 2GS9A 2XDWA 4PWYA 4D3ZA 5KYUB 1X94A 1VL1A 1BN7A 1TPYA 1LXCA 1VSQA 3TGPA 3HCCA 3FNGA 3OLQA 4AWBA 3F3MA 1XWWA 4F9TA 1U6KA 4XGKA 2Q3EA 1P39A 3NHUA 1MVLA 3LT2A 4DA0A 1GNPA 1KTIA 5KVCA 4DA9A 3PC8A 2ASEA 1XKXA 1BD4A 2EBHX 4DLKA 3FWPA 4CM8A 4DF3A 5BW6B 3Q4GA 4CTNA 4QELA 1J07A 2FGJA 2OL4A 3RC3A 3ZIUA 2QGFA 4M9CA 3H5AA 3OT1A 2DR0A 5EHGA 5K3DA 1RRKA 3JQAA 3ZK7A 1W5TA 4YFYA 5HS6A 3U6KA 4EMSA 2AMFA 4GOXA 4KVFA 4WZBA 1OZAA 3TLEA 1HDZA 4F2GA 3ZV5A 5B6JA 5BT8A 2HV8A 1P62B 3PCXA 4HLCA 1VHLA 3WNQA 1W5EA 3TAHA 1Z75A 2W71A 1JWAB 8ATCA 1LPBB 1VI5A 3KVVA 2J3HA 4L0CA 5HFNA 1WCXA 2O7QA 4YLYA 1J2UA 4LI3X 1VYVA 4M8KA 1SO8A 4Q37A 5B53A 4BC0A 5JNVA 2VTDA 3FVWA 3NP9A 5F76A 5T8KA 3KOYA 4P53A 4OM8A 3AF6A 2F7SA 5EKDA 5A03A 4NKRA 2WIAA 2GARA 2ZIVB 1GTG1 4L02A 2YWJA 3DYIA 3GLHE 3JYHA 5LZ7A 5LXTB 5EMMA 5K0ZA 4QUAA 5LDDC 4NYMQ 1VPDA 1XPOA 1QPZA 2Y68A 1O8CA 2FYTA 3EWAA 3CBQA 4UD2A 2VSNA 1DG1G 3N6XA 1O5IA 1UJMA 1QWOA 2YRWA 1OB5A 1GRVA 3ILXA 2X7XA 3PGXA 1Y89A 2HEIA 2I1VB 4CFZA 2JGNA 1MPXA 1W1UA 1JFFA 2AKYA 3D7NA 4HN4B 1YVUA 2J09A 2Z3WA 5HBRA 3GLIA 2Q3JA 4F4FA 1M2WA 2AF3C 2OZKA 4PZUA 1KBQA 3N9IA 1OKKD 2VNJA 5EJ6A 5LQAA 1JR2A 4QFCA 4XB6B 4I9NA 5TE9A 1WB9A 4KN6A 4MTLA 1XV5A 2VN8A 4HI0E 2A1UB 4JODA 4QWMA 2BFWA 4YWHA 5LXTF 3ZS9A 4C3UA 4IDCA 3VPCA 2QLLA 5AKJA 3T9BA 3NHRA 5TIIA 2GYUA 2OG2A 1CSEE 2PFSA 4Z7JA