3UXYA

The crystal structure of short chain dehydrogenase from rhodobacter sphaeroides
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
241
structure length
241
Chain Sequence
FEGKVALVTGAAGGIGGAVVTALRAAGARVAVADRAVAGIAADLHLPGDLREAAYADGLPGAVAAGLGRLDIVVNNAGVISRGRITETTDADWSLSLGVNVEAPFRICRAAIPLMAAAGGGAIVNVASCWGLRPGPGHALYCLTKAALASLTQCMGMDHAPQGIRINAVCPNEVNTPMLRTGFAKRGFDPDRAVAELGRTVPLGRIAEPEDIADVVLFLASDAARYLCGSLVEVNGGKAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase SDR
publication title The crystal structure of short chain dehydrogenase from Rhodobacter sphaeroides
rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 81
structure length 241
sequence length 241
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3uxyA00
5CDTA 4G5HA 5IDQA 3TFOA 4TSKA 4R68A 1HE2A 1IOLA 4NK5A 1B16A 4D45A 2FN7A 2EF1A 3R6DA 3DTTA 2LDBA 3D3WA 3WQSB 4URFA 2FP4A 3NGXA 4J4TA 4R4JA 4CODB 1E3WB 2HRBA 3DWFA 3PHLA 2B37A 3GUYA 2AEMA 4LCJA 1LX6A 5TS3A 1FJHA 5DBIA 4DPKA 5BSHA 1F8FA 3TOXA 4OIMA 2Q1TA 4C4OA 1G0OA 4J7XA 2EW2A 4TKLA 3HDQA 4XYGA 7ADHA 1Y6JA 3DAPA 1HDZA 3PHHA 4IDCA 4CM7A 5A04A 2R00C 3G0OA 1VL0A 1KYQA 1ENZA 1X14A 3OHSX 1GQ2A 2BD0A 2JL1A 5HS6A 2P2SA 1SB9A 4RO0A 4M54A 4AJLA 5JAIA 3LU1A 5A3VA 1BSVA 3TPCA 1TXGA 2FPPA 4IJKA 5A05A 1B3RA 1XYGA 2J5QA 1E1MA 4LSMA 4EJ6A 3A4VA 3GGPA 1HDYA 4BNNA 4BKUA 4MVJM 2ZYDA 4H15A 3MEQA 4J1SA 1PR3A 1CQIA 2GERA 4QECA 3I4CA 1PQPA 3E48A 2G82A 4ND5A 1E7RA 5EJ2A 3KV3O 2A94A 3ZH2A 2W98A 2JFHA 4IMPA 1ID1A 2J3KA 4PG7A 3C24A 4WECA 4W7IA 5DOZA 2O3RA 4E0BA 1R15A 1JN0A 4XGIA 1BW9A 2X1HA 1SB8A 2J3JA 4BMSA 4R3NA 3AI3A 2DPHA 1HYHA 4WNIA 4AJKA 9LDTA 4Y6PA 1PS0A 1XWFA 1MP0A 2WWRA 1PJSA 2C2XA 1QORA 3L4SO 3NTOA 4E3ZA 2QW8A 3WYEA 2HDHA 4U6QA 2I76A 2W2KA 4RVFA 3S2FA 1K6XA 3LT0A 4MOWA 1JKJA 5JCXA 4ZICA 2GUGA 4WGGA 5DBGA 4DRYA 4B4UA 4FCCA 4HV4A 2P9EA 5DZSA 3FPLA 3HDJA 1IULA 2UUPA 3RKRA 3QVOA 5I7SA 4N5LA 1ENYA 1AUPA 1UH5A 4Y6SA 5ILGA 4EEXA 4X54A 3U62A 2EXXA 5B4TA 3ZHXA 3PPIA 5A9SA 3F9IA 4ROSA 3LLSA 4B7UA 1A9YA 1VJ1A 4AFNA 2BFPA 1KY4A 3PDUA 4WCFB 3TNLA 2V6MA 2GGSA 4AJJA 4CMAA 1VKOA 5I7VA 2A92A 2WEKA 1T2DA 4NDNE 1SC6A 4DLAA 2PR2A 3RC9A 1HETA 4NMHA 5AXCA 5FFFA 4XQCA 3AW9A 1P1JA 4E30A 4Q3DA 2NVUB 5KVVA 1T4BA 2A9FA 3PHGA 3GMSA 1L7EA 4EZBA 4OKIA 4XYLA 4DREA 1M2WA 1RM4A 2C0CA 1B8VA 1ZVMA 3OA0A 1C1XA 1SPXA 1U28A 1ISJA 2JFFA 4DUPA 3I1JA 1H9BA 2H5LA 4F6LA 4YJFA 2FRDA 1HDXA 3KZVA 1I5RA 3Q11A 3GAFA 2Q4BA 3OEWA 3ENKA 4NZ9A 2CNBA 4ND3A 4R51A 2WD8A 3T4XA 1LLCA 5I7EA 1QKIA 3GR6A 1Z74A 4D0SA 5TGDA 2FPIA 3JQGA 1HYGA 1K6IA 1R12A 2HU2A 1Y8QA 2AA3A 1PGQA 4BKRA 2IEDA 4ALLA 1CF2O 1PL6A 4RLHA 1D7OA 2CZCA 5C7LO 4RVSA 4P8RA 4CUKA 2I3GA 3CMCO 2ZKLA 4JN6B 1K2WA 2HSDA 1FF9A 1RPNA 2BELA 4DPLA 4D3SA 4O59O 4XGKA 3BMNA 3WGHA 1SOVA 4OSOA 2VUUA 3JD3A 2GN4A 4I5DA 2F00A 5JFOA 5F1KA 2P4QA 3UW3A 2WYVA 3AWDA 1E3IA 3H2ZA 4KWHA 3QWAA 5F3RA 3UAGA 5EINA 4YR9A 1O94A 5F1OA 2CSUA 3LK7A 2ZB8A 1EDOA 1GPJA 3PK0A 1AN9A 4BNZA 3KEQA 3K2EA 3N58A 3HHPA 4TRRA 4Y98A 1LEHA 1PJQA 3QV1A 4XJTA 4Y8VA 3U4HA 4L4XA 4CR6A 3WDSA 4LVCA 4WCFC 5I9LA 1O95A 4K26A 1TEHA 2D8AA 5JYDA 4I9NA 1LU9A 4WKGA 1BG6A 4DQVA 3D64A 5L3ZA 3INTA 2FPGA 3OFSA 1NXQA 5IZCC 5JO9A 2ZTUA 3W4JA 1ULUA 3RU7A 4E13A 1EFLA 2C7VA 3D3EA 1YVEI 4WK6A 5B37A 2NQ8A 3LT1A 3EVNA 2OZPA 2IE0A 2YHIB 2QIOA 3F3SA 3WGYA 2YZ7A 2CUKA 3C8MA 1SNYA 2QRJA 3BIOA 3FPCA 1BVRA 3GGOA 3K73O 1KVQA 4XA8A 3S2EA 4CJXA 2O3QA 3I52A 4BV9A 1ZSVA 1V3TA 2ZB3A 4KUEA 1H6AA 3CSDA 2I66A 2OL4A 5DP1A 1XU7A 4BO7A 1W4ZA 3PJGA 2D0IA 1A72A 3WGTA 2VRCD 2DPGA 2BFOA 4XWYA 2BH9A 1RYEA 3D5QA 3GUCA 4IIVA 1NM5A 3QIVA 3I9LA 2D1YA 4XIYA 1H9AA 3JYPA 4GMGA 3Q9UA 1ZBQA 2AEFA 1MX3A 4CM4B 3HADA 2R6JA 1EZ4A 1N7GA 1R4MA 2OXIA 1PJ2A 2ZTLA 4E33A 5K0ZA 1PQWA 3S2IA 5T5QA 5BT9A 4GX0A 4TVOA 3RD5A 3MOGA 3AI1A 3A28A 4I5FA 4Z9YA 3FNEA 1NBOA 4JGBA 2VZ9A 5L53A 4IPTA 1C0KA 4YA6A 4PLVA 4R3WA 5CDYA 4PLPA 5CPBA 3GFBA 3WOHA 1YS4A 4CV1A 4RQTA 4EW6A 1AXGA 5TT1A 2I6TA 2VHVA 4FBGA 2EP5A 2V6FA 1PJLA 3STHA 2RH8A 4Z9XA 4CLOA 1WDMA 2DFVA 4GH5A 1GCUA 2IXAA 3UF0A 4DTIA 1ZMOA 4GVXA 2EW8A 1M67A 2I67A 2DFDA 4TROA 1Q0LA 3I5MA 4IY1A 3EY4A 3K30A 1Z75A 3PHJA 4OGWA 4E2YA 3C3XA 4BIIA 4IGFA 1E5LA 4MVJF 2JD2A 2DBRA 4B79A 3G49A 5HS4A 3C7AA 4YB8A 2ZCVA 2I3AA 1DBVO 2W2LD 2H9IA 3MWEB 3O26A 3KB6A 4UVGA 1Y81A 1JQBA 1WP4A 3AUAA 3GVXA 3L77A 2VHWA 1UJMA 3IKTA 2Y0CA 2DBVO 3GFGA 3IP3A 4YQZA 1Z7EA 1C0LA 1ADFA 4N18A 5KOIA 1D1TA 1F8GA 4I9UA 3PGXA 3W8DA 1Z7BA 4Z0PA 2P4HX 2O2SA 2C5EA 4MP6A 4GLLA 1HE4A 1KC3A 2CVOA 2X7HA 3DL2A 3KOUA 3GT0A 4YT4A 4BUCA 1JAYA 3S55A 1KETA 2QZZA 2NADA 5JE8A 4OQZA 3WGQA 1ADCA 2B5WA 5AXBA 3U3XA 3OJFA 4UEOA 3NJ4A 1NPYA 3KO8A 5BNTA 3L9WA 3LF2A 5B12A 4QSMA 4QFDA 5G4LA 4B8WA 4E12A 3ZWXA 2VCYA 1I3LA 3GDFA 5AQ1A 3RBVA 3KSZO 4DLBA 3QWBA 2HJRA 2B5VA 4HFNA 5H83A 1LA2A 1UAYA 1ZK3A 3JYOA 1UXGA 5ENVA 4IDFA 5F21A 1P1HA 3V8BA 4NBVA 1O5IA 4ILKA 4R1TA 3X2FA 2J5RA 2AQ8A 4WNCA 3UCXA 4JIGA 1P1FA 4XDYA 4FW8A 5A9TA 3P19A 2AMFA 4WPGA 2C54A 3I6IA 4KQWA 4GKBA 4MP8A 3TZQA 4RF3A 4BQPA 5ITWA 3RI3A 3ADPA 3BMCA 4HY3A 5TNXA 3PZRA 3DMTA 3ROPA 3EW7A 3ZNNA 5I8ZA 1YQDA 4EJMA 2RHCA 2GRAA 2NM0A 1GL3A 2FOIA 3JD4A 4DBVO 2O48X 1PGOA 1SOWA 3H8VA 1GAEO 1NPDA 4CM5A 3V1YA 2VYNA 4JP2A 5JNLA 2Q46A 1SMKA 4RCVA 1LNQA 1UAGA 3I3OA 2RCYA 5FWNA 2J3HA 1PX0A 1UDAA 4IS2A 1J6UA 3OJEA 1GDHA 3QJ5A 1ZUD1 1O0SA 4CMEC 1QXSA 3AU8A 4FFOA 3PWKA 2DBQA 3JTMA 1GCOA 4F45A 1YDWA 2IYOA 1L7DA 3KYCA 1ISFA 4IJWA 1MLDA 4IMRA 3WIEA 1IE3A 1P1KA 2VRBA 3K2BA 1Y5MA 2GLXA 4WUVA 1M75A 5JCJA 3AM5A 2IEBA 1ULSA 4J1TA 2ILTA 4XCVA 2VOEA 4ALMA 2YY7A 4IS3A 4U6SA 2O3JA 2PZLA 4MVJI 5K9ZA 2AXQA 4FFRA 5KNLA 1QYXA 1ZIDA 4TRJA 1BDBA 5EL0A 2VTEA 3ETDA 5AYVA 1I10A 2NVBA 1VPDA 4A2CA 2YDYA 3AM3A 1K5HA 1LUAA 1ZEJA 3DBHA 3OJ0A 3BHJA 5B1YA 2Q1WA 1DB3A 1E0DA 1WMBA 4E4YA 1KY5A 1ZFNA 4IM7A 4M87A 2J8ZA 5DF1A 1KEWA 1VI2A 2B0JA 1K3TA 1DDOA 1EUCA 2ZYGA 4QFCA 4ZU3A 4U8GA 3SBOA 4OXNA 5ENDA 5FEUA 4FDAA 4CQMA 3JYQA 3KYDA 2O7SA 4PZCA 2FR1A 1IZ0A 3ONEA 5JDIC 4UREA 2WD7A 3RASA 3UGKA 1R4NB 4YJGB 1BDMA 5HWSA 3DO5A 2Q2VA 3K6JA 4CR8A 4MVJE 2C59A 1ISGA 5A9RA 1I3MA 2ZTMA 4Q3NA 2YFQA 2NWQA 4QT0A 4YJHA 1B3BA 4WLOA 4IZHA 2P91A 1PJTA 3CKYA 3R3SA 4IQ0A 4K1LA 4MVJH 4UUNA 2ZTVA 4ZVVA 3VKVA 1U4SA 3DAGA 2ET6A 3FWNA 5LCXA 1B26A 1G6KA 3UCFA 4WEQA 3VH2A 5L4SA 4E21A 1YOVB 1Z73A 1P33A 2GF2A 3DTYA 4CMHA 3TJRA 1R37A 5BSFA 1XCBA 3SVTA 1GZ6A 1U7TA 4TQGA 2FZEA 3ZWCA 4BO6A 4UVEA 1YBAA 3BTUA 5CPFA 3OBBA 3FSRA 4KUHA 5FI5A 3PLNA 5JY6A 3V1TC 4JJFA 4KDFA 4MVJP 4CM9A 1NVMB 4TVBA 4Y67A 2JFGA 3RSHA 3W8EA 4JXKA 1LDBA 4MP3A 4YAJA 5K6AC 4EYEA 1NTOA 5TC4A 3G79A 4OMUA 5IN4A 4A10A 1DIGA 4L0QA 3DR3A 4J0FA 4OH1A 4IDEA 3CE6A 3IUSA 1CERA 1C0IA 1UDCA 4YAIA 2NV6A 3JQFC 1ORRA 1TT5B 3GN1A 3VZSA 3VZRA 1JA9A 2CVQA 1M76A 3CZRA 3I9JA 3DZJA 5I9MA 4J0EA 4AICA 1DRVA 1ONOA 2X9VA 1X0VA 2DBZA 2X4GA 3FN4A 4ZQGA 2NNLD 1A71A 3DBRB 2Y1OA 1GR0A 1GYRA 4BNLA 2EIHA 4ALIA 2YYYA 4YACA 4B4WA 2ZB7A 1Q7BA 2QG4A 4TMFA 3GVHA 3JQ8A 2HMUA 5JAQA 2C5AA 2H1SA 4FGSA 2Y1DA 4ALNA 4MJLA 2Y68A 3H9EO 2VZ8A 5G2OA 4OOEA 4MINA 4J3FA 2O7QA 2VT3A 1LSOA 2BGLA 4B3JA 3QQPA 1WLYA 4CLRA 5L4NA 1ZSNA 5TLSA 1C1DB 4OXKA 1Q1NA 3VPSA 4ALJA 4ZGWA 4AG3A 4F3YA 2HMSA 1BVUA 1DSSG 1KVRA 3GZ4A 3GF4A 3KXDA 3WYBA 3ZNOA 4YT5A 2PFGA 1NQAO 3AY3A 2GCGA 3FHLA 5ICSA 3F47A 3DHYA 3G17A 3IP1A 4B7XA 5KTKA 3DOJA 3ZGYA 4WLNA 3RUEA 1FDWA 2VUTA 3D1LA 3ASUA 3KLPX 2GN6A 1K6JA 1PIWA 2GSDA 3AY7A 4L4RA 3GZNA 3WLFA 3WJ7A 3BTOA 3JD1A 5FYDA 3TZ6A 1EK5A 4M8SA 3WGZA 4DC0A 3GEDA 5L45A 1U5CA 1C0PA 1PS8A 1SZJG 1TT7A 3HDHA 3PIDA 4OQYA 4Z0TA 4CLDA 3ZWBA 4B8ZA 5HA5A 1JW9B 4RF5A 1ZK0A 2W2LA 1Q7GA 1HTBA 3NDJA 4BO0A 4DPMA 4XR9A 3F1LA 3Q6IA 1KIFA 1HT0A 4ZQHA 2DQ4A 3GY0A 2B35A 2HK8A 1EBUA 4N7RA 2HLPA 4GWKA 3N74A 3QW2A 4ZD6A 2H63A 3JYLA 3SLGA 4CUJA 4QTZA 2P9GA 3DZBA 2NTVA 4FS3A 3WGIA 9LDBA 2EKLA 2GN9A 2X0IA 4GMFA 3GEGA 3GN2A 2EGGA 3GHHA 4BNVA 4JROA 1U8XX 4JNKA 1UP4A 1F0YA 3ZWNA 4CM8A 3A1NA 5HTOA 2D2IA 2VQ3A 3VPGA 5CEFA 3NUGA 1G1AA 2GZ2A 1BTOA 1VRWA 2WM3A 1DXYA 4MIYA 1QYVA 1GUZA 2HK7A 4R1SA 3FCOA 4BNYA 2WJPA 2HUNA 2Y0DA 1TI7A 4LSWA 1QYCA 5U4QA 1DIHA 3K8ZA 3QHAA 8LDHA 1CRWG 1XELA 3H4VA 3KUXA 5BNFA 1GTMA 1C3VA 4HNGA 3ETGA 2ZK7A 1ZMTA 4P4LA 4CMBA 3JQBC 2ZQZA 2CFCA 4PLHA 4NJOA 3RC7A 3UH1A 5B4VA 5ILOA 3T7CA 1HDRA 1X1TA 1E5QA 2EWMA 1XQ6A 4M55A 4XRGA 4LVUA 2YV3A 1I0ZA 3AM4A 5IDYA 3JD2A 5JC1A 1E3WA 1LSSA 3G1TA 1D1SA 1PGPA 1R0LA 2JKVA 3DEYX 3HE3A 4PLWA 4D3FA 2W2KB 3WNVA 4IUYA 3KYBA 4RGBA 1JWBB 2Z1NA 1JWAB 1W73A 2JD1A 2B4QA 1M6HA 3CUKA 3GH3A 3KM0A 2DUUA 1DIBA 3OH8A 3WBFA 1OC2A 4GBJA 2C2YA 3QVWA 1U1IA 3VH3A 4CMIB 3NDRA 4YRAA 1B2LA 2J6IA 3WQQA 3OETA 3LLVA 1HF3A 3FBGA 2H6EA 2XPCA 4LW8A 4BNUA 5LDHA 1DOHA 3GG2A 2Q1SA 2YW9A 3NT5A 5LC1A 5BSEA 5CG2A 4ZA2A 3MJEA 1KEPA 4MKXA 5THKA 2C7GA 1ML3A 4BB5A 4BO3A 2IYPA 4EGFA 2Q1UA 3DHNA 3JQAB 4R01A 1LQTA 4E32A 1E6EA 4O1MA 1A4UA 2FSVA 3EC7A 3BHIA 3FTNA 4EUFA 3U4IA 3H3JA 1A27A 1YQXA 2FR0A 3B1JA 4XQGA 4EITA 3H9QA 1HL3A 4DC1A 3VC7A 4XYMA 3I9NA 3D5TA 1OMOA 1G0NA 1IPFA 1UDBA 5TIIA 1GZ3A 3GK3A 4MIEA 4U0KA 1NHGA 3JCZA 4E2ZA 2CD9A 4BMNA 3RAJA 3AI2A 3O9ZA 4FC7A 4O5OA 1X7HA 2Y1GA 3DOOA 4AJ4A 2VUSA 1LDNA 4YJFB 4Z3DA 3TL3A 3ZU3A 3W8FA 4JQCA 1BGVA 1W8DA 1U8FO 1IL0A 4P4NA 3FRJA 4U7WA 3MOIA 1I33A 1W6UA 3E03A 3L0DA 4BVAA 4ZQFA 2Y1CA 4J7UA 3JQGB 1X15A 2OHXA 3MZ0A 4YYZA 1PWXA 4EUHA 4BL5A 2OP1A 1AE1A 1JKIA 2B69A 3RUHA 3VH4A 4Z0HO 2DAPA 2VYND 3NAQA 2O2YA 3VAZA 3RUIA 2HJSA 5EESA 5EMHA 2P9CA 1EK6A 2B36A 3TZHA 2WDZA 3C7DB 4OOFA 4AJEA 2P5UA 3K92A 3DBLB 4HXYA 4FFPA 4WCFA 1LJ8A 3OQ6A 1I24A 5JS6A 4NJMA 1DLJA 4G65A 3DXFA 3L9XA 5IZCA 3ROKA 5GY7A 4P4GA 1DJQA 3GVIA 3TDKA 5JCJD 3D4OA 2NVUA 3KETA 2CMDA 5DNAA 3HFGA 1U4OA 5KJCA 4FN4A 1GEEA 4IXTA 3KHUA 1V0JA 4JJIA 3W6UA 3FNHA 3NKLA 4R5HA 1Y8RB 3HB5X 3QWFA 4GWGA 3RC2A 3GDGA 1OAAA 3BA1A 4BMVA 2BLLA 4GPD1 3IIEA 2J5KA 5ICMA 3PWZA 1P0CA 4KOAA 5ADHA 1UXJA 3ITKA 4KWIA 2RH4A 1MUUA 3WG9A 4ND1A 3ZU2A 2OFPA 3IMFA 3HSKA 4I5GA 4IQ8A 1NNUA 1E7QA 4GX5A 1T25A 1P9LA 3WSWA 4CQMD 4IDBA 4JJGA 2D3TA 1E92A 4BNFA 3HB4X 3LSYA 1DFHA 1GD1O 1NQ5A 1U7HA 3PJDA 4XB1A 1UUFA 4DXHA 1T2EA 2D4AA 1QLHA 2PKRA 2VHZA 3UUWA 1LLQA 4R1NA 3AOEC 1YL7A 3WGGA 1V3UA 3DZGA 4I8XA 1YBVA 3ZV6A 4FIZA 2OBYA 2R2GA 3A9WA 3RUDA 1NFQA 1NWHA 4NHEA 2E37A 2X86A 4YQYA 2GZ1A 5KCZA 4J1QA 1SAYA 2O3UA 2AW5A 3UKOA 3VKUA 4YWJA 1N9GA 5ITVA 3GQVA 1U3UA 1JAXA 1VE9A 1JLLA 2C29D 1AHIA 1QG6A 4FB5A 5H82A 3NDIA 1QLJA 5HRUA 2A4KA 4CM9D 1MB4A 4JBHA 1NASA 3MJVA 4YDRA 3MJ4A 1IHXA 5L7TA 4OJNA 1NVGA 2W90A 1OFGA 1GFSA 4J16A 1KERA 2CY0A 2ZCUA 5G0VA 4HWKA 3L6EA 3PQEA 4HFJA 1J4AA 1R4MB 3PWSA 1KEVA 1Y9AA 1TB4A 3ST7A 4W4TA 3P2YA 4CMGA 1M6WA 4AJIA 2NQTA 2QX7A 2SCUA 1EEHA 3K5PA 3WQRA 4RDIA 2JCXA 1LDEA 1F12A 3KLMX 4RPLA 3BYZA 4RQUA 4BS9A 5G0UA 2EP7A 5KIAA 4RF2A 1HYEA 4NNJA 1P77A 2VHXA 4WOJA 3FWZA 4O0LA 2OOSA 1WWKA 2YHIA 4ZQEA 4BHTA 3P2OA 4PG4A 5DULA 4J43A 5TSDA 2D5CA 4E5YA 5BNIA 4CLOB 4HFMA 4PRKA 1HSOA 3GPDG 4NU5A 1K0UA 2Y0EA 3PYMA 4L73A 4BNTA 4RPKA 3ZWWA 2ZQYA 3AFMA 4NFYA 3NTRA 4F6CA 5U9CA 2HMWA 5IJZA 1ZH8A 4WASA 3F5QA 2DLDA 4LMRA 3KVOA 4IDGA 3HN2A 3PDJA 4YEDA 1VM6A 3H9GA 3VTZA 4FJ0A 1NR1A 4A73A 3QE3A 3H5AA 3W1VA 1HKUA 1O6ZA 5C3MA 3EYWA 2Q45A 3W4IA 5I8WA 5JLAA 2E4AA 2RAFA 1HZZA 1ZK1A 2E82A 3NTQA 4IDDA 3TN7A 5CG1A 3GOHA 4PZEA 5F5NA 1I30A 3GEMA 1MXFA 3Q0EA 4TZTA 4Z3KA 5KJEA 2HMVA 2G5CA 4J7CA 2CDBA 4RZIA 2PKQP 1T2FA 4E2XA 5IZ4A 5GZ1A 2NLOA 3Q9NA 4OXYA 4W9NC 2EEZA 2TMDA 3M1LA 1NR7A 1MG0A 2V6BA 3F4LA 2CDAA 3U4DA 4HFRA 3GVPA 3BMOA 4BNJA 2UYYA 1Y1PA 3QWHA 4E6PA 5JDCC 2RIRA 2AQHA 1SCUA 2GN8A 2EJWA 4I9HA 1HWYA 3FTPA 1HXHA 2Q4EA 4NI5A 2BMAA 5IF3A 1S7CA 4XJSA 1ZEMA 3LC2O 1AHHA 5JPIA 3OSUA 2BFMA 4J9UE 1BXZA 1BXGB 5FI3A 5G0WA 3E6AA 1X1EA 1LI4A 1ZK4A 1OBFO 3RUCA 1YBMA 1H94A 3VOSA 1KVSA 4BKQA 2OGUA 4AJPA 3NV9A 3I83A 4J90A 4UULA 1DLIA 4UAGA 1HSZA 1E3SA 3IQDB 1YH3A 4XQEA 3ZV5A 1GY8A 3GRKA 4YT2A 2JHGA 3BMQB 4DIBA 2DKNA 1PL8A 5AXAA 4LISA 1UXKA 4BGIA 5I9NA 5C37A 1WDKA 3WFJA 4DL9A 4B3IA 3GAZA 3DZKA 3BTVA 2VTDA 1ZZEA 3BMCB 3AK4A 4IXWA 5L9AA 4FJ1A 5CDUA 1DAPA 1CIVA 2YQ4A 3GNTA 1Y9EA 4KQXA 3ZNQA 1MC5A 5IN5A 2QYSA 4TRNA 2Y67A 3C1TA 1IY8A 4NFSA 4BO9A 4XKJA 1E7WA 5G4KB 2PWZA 4UVHA 3PHIA 2JD0A 2NUAA 2Y05A 1I32A 1L1FA 3TWOA 4KTTE 3PQDA 4A0SA 3H9UA 3GNQA 1JDJA 5CFZA 2V6GA 1UZMA 1LBEA 1S6YA 4PG8A 4ID9A 3SXPA 3PFWO 3VPFA 1SEVA 2JHFA 3QP9A 3LC1O 3SLKA 3EAGA 3HUDA 3DAFA 4YAKA 4ZHSA 4BNHA 1NVTA 2HCTA 3PXXA 4AJNA 4KDEA 1Q7CA 1P1RA 2CF5A 4LRSB 3H2SA 4ITUA 5L51A 3MJSA 2GASA 5G0SA 4INAA 3JQ9C 2O3SA 5JDIA 2O4UX 3ZWAA 3HZZA 4IGEA 4B4VA 1Q0HA 2IODA 3OP4A 3WS7A 4Y6RA 2QZ9A 1TA4A 3H7AA 3PYXA 5LDGA 3ITDA 2P5YA 2VN8A 4PLZA 3L07A 5JY1A 4GX2A 4TRMA 2IZ0A 2VNSA 3GPIA 3DBHB 4MKRA 3FR7A 4RV9A 4XD2A 1NQTA 4N5MA 3OIDA 4PRLA 4WEOA 3UOGA 3O8QA 3IS3A 5A5FA 1KVUA 5HM8A 3FI9A 4OYRA 2VWHA 4RL6A 4WLFA 5DDIP 1AXEA 5EPOA 4CQMB 1GEGA 4LGVA 3D4NA 3ICCA 3OIGA 4JBIA 2HK9A 4FFMA 5JSFA 1FDSA 1OOEA 4CLHA 1F06A 1T1RA 2PTGA 2G17A 5EN4A 1LXCA 1EBFA 1Z45A 3EUWA 4DMMA 2DVMA 2X9NA 2DTXA 1CDOA 3O38A 5C5IA 4A26A 1LSJA 4QUKA 4BNMA 3HN7A 2G0TA 3E18A 1JTVA 2GYYA 3DOCA 3WWYA 1A5ZA 3WSVA 4EI2A 1T1SA 4R9SA 2UVDA 4YT8A 1ZXBA 1WNTA 4ZN6A 1YDEA 1I01A 3ABIA 3TL2A 2VT2A 1YB1A 1CEQA 4AJHA 4QX6A 3U4CA 1N2SA 4HADA 4GKVA 4DBZA 5IFLA 3S8MA 4CM1A 1I8TA 1FDUA 1QYDA 2NU7A 3EZYA 3WTCA 2FMUA 3GG9A 3F1KA 1V3VA 3EDMA 4AJ2A 1CETA 3OMLA 1E3LA 2VYVA 1CQJA 4Q9NA 4A27A 4QQRA 5DBFA 2FSSA 1ISHA 2AQIA 4O6VA 1DHTA 3HJAA 4Q3AA 5JW6A 3JQ7B 2AE2A 4FSHA 4FQ8A 4U0JA 3PVZA 3C1OA 4J49A 5DT9A 4WE3A 4BB6A 4L76A 1VL8A 3I4FA 3TZKA 1U9JA 4IZIA 2GR9A 2OBNA 5T8KA 3EZLA 2G76A 5A3JA 2D5AA 3NX4A 4I5EA 2VHYA 1JVSA 3ZU5A 1IZ9A 2XXBA 4FJ2A 2G1UA 1GUYA 3JQ8B 3WGOA 1NFFA 4AJ1A 4CQLA 2OUIA 4Q39A 3TFQA 1XGKA 2ZJ1A 1AGNA 2E6UX 2PZMA 3TOZA 2QRLA 2Q3EA 3JYNA 1IB6A 4UEJA 1UXIA 3G1UA 3W4KA 1YOVA 4DYVA 3V5NA 2YHUA 5T6BA 5I7FA 4YVFA 3FF4A 1NQOA 1ZJZA 4FOSA 4M49A 4H7PA 1GQQA 3EVTA 1E3JA 1WVGA 4CMJA 3QVXA 1EVJA 1DC4A 3ZWPA 3C85A 1ADGA 4F46A 1OZAA 4W7HA 4ESOA 3GZNB 1LC3A 3R0IA 4XB2A 4EUEA 4KUGA 4PN3A 5CEEA 1P0FA 1YONA 2BI7A 3DFUA 4GQAA 4OSPA 1YO6A 2D59A 3RC1A 3COSA 3V1UA 3WMXA 4DGSA 5CAEA 3IAHA 4CPDA 1H0KA 2R00A 4KTVE 5H81A 2QHXA 5TJ9A 2O50A 3PZBA 5THQA 4GL4A 1N7HA 4RVHA 1N1EA 5U1PA 2YUTA 2PD3A 4J2HA 4MVJA 1OC4A 2JCYA 4TWRA 1PTJA 4R69A 1PZGA 3D3WB 3HWRA 3TRIA 1P44A 3SC6A 4YJDA 3LT4A 1X7DA 3UFXA 4BO2A 3PI7A 3WNQA 4J1NA 3JQBA 4XQ9A 4H3VA 1HE3A 4RDHA 2X5OA 4B7CA 1ISMA 1LSUA 1CWUA 3ZW9A 4CM3A 2IZZA 2JAHA 3LVFO 4IDAA 4EEZA 1NX6A 3QSGA 5J23A 2YQ5A 3E5MA 3PFFA 2FY8A 4CM8B 1P45A 3IC5A 4FGWA 3TF5A 1GPDG 1JKFA 4BKOA 1C1DA 2NU8A 1NPTO 3DB2A 3GHYA 4PFJA 4RLSA 1GYQA 3I9KA 3WB9A 2QRKA 4GSLA 5JC8A 1YE3A 2BHLA 5JYEA 5DN9A 4N54A 4TKMA 3Q1LA 4BO5A 4D43A 1VKNA 2PH5A 1T2AA 2EJVA 1GZ4A 4MO2A 1PZFA 1WW8A 1YB5A 4MVJG 1XDWA 4OAQA 5TJHA 4D0RA 5F1PA 3H5NA 3VTFA 3T7EA 4BGEA 1KEUA 2EKQA 4R54A 4WLEA 2WE7A 5AXDA 3HDYA 3B6ZA 3JQEA 4CMCA 2Y99A 3BAZA 1E7MA 4UEKA 4YCAA 4RVGA 4XRRA 8ADHA 4C7KA 1PZHA 3AUSA 1VLLA 3AY6A 1EE2A 1XLTA 1P31A 4QEDA 2HKIA 4NIMA 2E49A 2AEJA 1JU9A 1BW9B 1LLUA 3L4BC 3PEFA 2UAGA 1H2BA 4DQUA 2PZJA 2V65A 3S1LA 3CH6A 3GMDA 3AU9A 3WLEA 2POQX 3WYCA 3WFIA 3AOGA 3ENNA 2Y1EA 3VPXA 2XF8A 2PK3A 4Z6KA 1T26A 4WCDA 1YGYA 5ER9A 4AJOA 4LCEA 3ZV4A 5TRTA 1NAHA 4YXFA 4GX1A 4J6FA 4JX8A 1BXKA 1NAIA 7MDHA 1PQUA 5A03A 3QRWA 1PGJA 4GGPA 3ULKA 2PV7A 2RHRA 1J49A 3CXRA 1HZJA 1OI7A 5BR7A 2NACA 1GQYA 1PJCA 3F6YA 4FD3A 5A9SB 4ND2A 3NGLA 1KC1A 1Y7TA 3RUAA 3WBBA 3ON5A 2HMTA 3VVBA 3DC2A 4E5MA 5CEJA 2XAAA 2DM6A 3PP8A 4NPCA 5EQFA 3V2GA 1DRWA 2Q99A 2B4TO 4PG5A 5F5LA 3OF2A 1Y5RA 3WMWA 4JBGA 1HE5A 4PLFA 2Q2WA 4PIVA 1ZKMA 1PSDA 5KVQA 4RJTA 3VDQA 3KTDA 1HRDA 5EQDA 1D8AA 3HFSA 1MC4A 3DONA 4NBRA 3FNGA 1O9BA 2PGDA 1WAMA 4GSKA 4PLCA 4R9RA 1YB4A 1C1XB 3LDHA 1YWGO 4D42A 4HBGA 3RFVA 4AVYA 3ZWVA 3K31A 3PGJA 3RROA 4W6ZA 4CMIA 1ZSYA 4PCVA 3CTMA 4L4SA 3C7CB 3I9MA 4NQZA 1BWSA 1GADO 1DO8A 3JQDA 3B70A 1EFKA 1MV8A 5HBRA 5KJFA 3ORFA 1MGOA 1E1NA 1LTHR 1F17A 4PG6A 2ZB4A 4BO4A 5COAA 2ZJ0A 5IG2A 4NBTA 1HDCA 3I23A 2XXJA 1HEUA 1MA0A 1U3VA 2PH3A 3JQAA 4NJMB 2UUOA 1Y8QB 2VOJA 5GZ6A 3HQ4O 3WWZA 2X23A 2EGHA 1YKFA 1I3NA 2Q2QA 2FR8A 1YRLA 3BTSA 3CEAA 5TX7A 1V8BA 2IRWA 3PJEA 4A7PA 4CLEA 2PA3A 3E9QA 3OJLA 3OJOA 3RJ5A 2VNAA 2YFHA 3RU9A 4DMLA 2Y66A 3AOEA 3L6OO 3OQBA 4RPHA 5MDHA 5KKAA 2VWQA 3NEPX 3BMNB 3OM9A 3RKUA 3TQHA 3S2GA 1LRJA 1KOLA 3RCBA 3V2UA 1IUKA 5JBIA 6LDHA 3PLRA 4RF4A 1FK8A 3SEFA 1X7GA 5A4DA 4XEHA 2X5JO 3ZWMA 3QVSA 4XIJA 3H3FA 5CP8A 1RJWA 3E82A 4S1VA 2EG9A 4NG5A 4CLXA 5EIOA 3PQFA 1R0SA 4QO7A 4HP8A 3ZCXA 1K89A 3ZZNA 3WXBA 3GLQA 4KZPA 1HLDA 1DFGA 1ONPA 5T67A 6ADHA 2FHSA 1NWCA 2A35A 4HNHA 1R16A 3B1FA 1QYWA 1KBZA 5EERA 2GPTA 1E6WA 1WXDA 4EBFA 3A14A 3A06A 1H6DA 4JK3A 3UN1A 1B0AA 4ZJUA 5JXWA 5L95A 5GZ3A 1W0CA 2ZATA 1XG5A 3KSUA 2AE1A 3DBLA 3RUFA 1VJTA 1FXSA 3IDSA 4HX5A 1E77A 2HAEA 1XR3A 2YV2A 3MCVA 1MFPA 5BSGA 2X8LA 2YV1A 5FF9A 4C7JA 1DJNA 1N9GB 1IPEA 3ANMA 4MIOA 4XGNA 1CJCA 2EKPA 1O89A 4RORA 2WYWA 4D41A 1ZW1A 4A03A 3SJUA 3WIDA 4LMPA 3AFNA 1A7KA 1Y8RA 1PJ3A 3ZI0A 1EMDA 1X0XA 3ADOA 3VH1A 3CMMA 4CM6A 3OA2A 5A5EA 3R1IA 4UVDA 2VYVD 4CR7A 3X2EA 3V2HA 3JD0A 3CZMA 3E8XA 3RIHA 2GD1O 4MPDA 5AVOA 3DHEA 1EQ2A 1EUDA 1WPQA 4E31A 2B4RO 3ETEA 1R6DA 3CPSA 3QY9A 2VZ0A 3ZHYA 1QV6A 4IJUA 3EGOA 4K9DA 4XX0A 1CYDA 3IUPA 4NR0A 1Q0QA 1YL5A 3QWIA 3SJ7A 4CV0A 1DPGA 1I36A 1BRMA 1YXMA 2C82A 3WJAA 3DZFA 4RPJA 1D3AA 1ZXLA 1IYZA 3PIIA 3VPHA 3AUUA 5CDSA 1XSEA 2C20A 2Q50A 2RBEA 3ZNPA 5JMPA 2OORA 2VWGA 3FBTA 1LQUA 4DYDA 1PGNA 2PLAA 1WZIA 3UCEA 1J5PA 1U2GA 3ZN2A 4JCOA 1QR6A 3ZU4A 3SX2A 1XIVA 2EHDA 1DIRA 1ENOA 4O63O 4YAGA 3DQPA 2UV8A 3UHAA 2BGKA 4GI2A 1B14A 5CHEA 4Q3CA 2XOXA 3P7MA 4W9NA 2X0NA 2YDXA 3N7UA 3RQSA 1R66A 3DBVO 2I5PO 1I2BA 2PGLA 1LRKA 3F46A 4Y9DA 3GA0A 1PJBA 4XDZA 4ZRMA 5JDCA 4PLYA 2HQ1A 1ARZA 1EQUA 3WX0A 4CL8A 4MDHA 4MKZA 3RWBA 1WZEA 4BKPA 4BNKA 2EERA 1RWBA 1J0XO 2O23A 1WMAA 1H93A 2NU6A 3DMYA 1M66A 4BO8A 1XHLA 5DCWA 4E5PA 5B4UA 4K28A 2OO5A 3IJPA 4JP3A 4BOYA 1E1KA 4J4BA 4GAEA 3ZWYA 4FC6A 1ADBA 1XEAA 1DEHA 1XKQA 4GLOA 3WICA 2C07A 2ZIZA 3OICA 1FDTA 2WSBA 3MJTA 4K6CA 4UUPA 1PL7A 4IBOA 5TT0A 4D46A 4XZ3A 3I6QA 2Y93A 5G0TA 4W99A 4R1UA 2DTDA 2NU9A 3BMOB 1LLDA 4MVJD 4E5KA 3VZPA 4FFLA 4NBUA 4ND4A 4CM4A 3E5RA 3Q2KA 4WOKA 1YL6A 4L8VA 4KMSA 4IINA 5KWEA 1QV7A 4ALKA 1VJ0A 1E6UA 3QLJA 4E2WA 2ZYAA 1H5QA 1VL6A 2PZKA 5C7OO 3B20A 4OO3A 5KKCA 5C7IO 1N8KA 3RFTA 1A4IA 4YBZA 1H2HA 3T4EA 1DC6A 3K9QO 3H65A 4BGVA 3FNFA 4DA9A 2X0RA 3H6KA 4YPOA 1ONNA 3WTBA 3ZDFA 3GGGA 2OP0A 1WDLA 5TQVA 4EDFA 3IJRA 4GGOA 4PVCA 3KRTA 4NU6A 4PLGA 3D0OA 1H6BA 4KP7A 3FR8A 1IHYA 4ZRNA 4FOOA 1GYPA 4L75A 2Y1FA 4OM8A 3SC4A 1XU9A 3M2PA 3P5SA 2I65A 1DC3A 3QVTA 2J3IA 3CINA 4NK4A 3RBZA 2X9GA 1FMCA 2X6TA 4HUJA 4AL4A 3JQ9A 2Q49A 3LT2A 3IOYA 1NHWA 4E5NA 1LDMA 2AG8A 3JSAA 3NT4A 1PR9A 1YJ8A 4CMEA 1P74A 4U5QA 5IXYA 1DIAA 4HKTA 1UP7A 1I3KA 1ENPA 2OMEA 1NFRA 2X58A 1GV0A 1NP3A 4UUOA 4BV8A 4DIFA 2BGMA 2P68A 1RYDA 4JLWA 1B8UA 1QMGA 3AJRA 5JAMA 2DC1A 3LC7O 1YQGA 3INRA 3QA9A 3INGA 4B4OA 1B7GO 2DT5A 2WYUA 2VWPA 2QYTA 3E1KA 4QXMA 1B15A 1V6AA 1BXGA 1V35A 5DCUA 5DP2A 1UZLA 1ZNQO 4Q3BA 3KEOA 2DTEA 2FWMX 1P3DA 5L7YA 3GDOA 3R3JA 4IIUA 1KVTA 4YRBA 1SO8A 1YJQA 1FDVA 1RM3A 1RM5A 1U3TA 5KVCA 1UXHA 3KYCB 3BMQA 1EVYA 3ONDA 1SBYA 1ZCJA 3NT2A 4D79A 5DCYA 4GVLA 1UP6A 4N5NA 4B3HA 5TF4A 3U5TA 1QRRA 4L9RA 4RPGA 4UVIA 1U2DA 5CDGA 5DOVA 1A7AA 4Z9FA 1MG5A 4I08A 4OKNA 3RJ9A 3O8QB 4CUZA 1BHSA 4BGUA 2NTJA 4D44A 1U3WA 3OIFA 2LDXA 2Z1MA 1DAOA 3DFZA 2O3TA 3WR5A 4DQXA 1VSUA 5A1TA 4RVDA 1KS9A 1MFZA 3BXXA 4DWVA 1X13A 3DDNA 3LQFA 3K96A 2W8ZA 5G4KA 3GC6A 1LDGA 1XQ1A 2AG5A 3AUTA 4G2NA 2I9PA 4XYEA 1MXHA 1T4DA 2I99A 1EUZA 1E7SA 4M86A 3VDRA 1LC0A 5L7WA 2E48A 2IXBA 3PTZA 1RKXA 3O4RA 2WTBA 4CV2A 4J4HA 1H6CA 3F4BA 1PJ4A 4RZHA 3GRPA 3JV7A 4YAEA 3RBXA 1Q2XA 4BO1A 1Z6ZA 5COBA 3MTJA 4OHUA 3KYDB 3ANNA 4J2OA 3ROMA 3C1AA 3IL2A 3JQCA 2EV9A 2WD7B 1TLTA 3OECA 3I9OA 4BNIA 1T2CA 5K6AA 4II3A 5JAZA 1I2ZA 5A06A 4BNXA 4YTEA 3RFXA 5AOVA 1LDYA 4NBWA 3UXYA 1PS9A 1LRLA 2BKAA 3JQAD 4YJHB 4H16A 2TMGA 3DZHA 1DRUA 1T24A 5KJ6A 4BNWA 4OL9A 1EDZA 3ONFA 2F1KA 3U0BA 3D7LA 5IDXA 3DMTC 3JQFA 3RVDA 5L40A 1GV1A 4I1IA 1E7YA 3ROQA 3HG7A 1JVBA 1EE9A 1O8CA 3MWDB 5T64A 1DC5A 1UR5A 2DUWA 3GNSA 3LF1A 1DHRA 2JJYA 3BZUA 4XYBA 4D3DA 3ZV3A 2PD6A 3U09A 3M1AA 4IJVA 4LK3A 2PGJA 1ZO8A 3JQ6A 4II2A 1PU2A 2GNAA 2JAPA 4FFNA 2JCVA 2PY6A 2QQ5A 4XR4A 1ZJYA 2WMDA 3OEYA 4DVJA 2B83A 4DIOA 1E3EA 2NTNA 2IDZA 4CV3A 2DU8A 2UDPA 1I2CA 3OQ1A 4QO8A 4WLVA 3ZWOA 4Q3EA 4LN1A 3VVCA 4P22A 3U49A 4EJ0A 2GDZA 4CQLB 1U5AA 5IAAA 1DFIA 3FD8A 3ANLA 5L4LA 3MTGA 1EVIA 2V7PA 2YJZA 4IQGA 3G3EA 3BHMA 4A5OA 3EK2A 3Q3CA 2GO1A 2PD4A 3VHRA 1R4NA 4YJGA 3GVCA 5IDWA 1NYTA 2O4CA 4K6FA 3KSDO 3O03A 2HO5A 3PYLA 3LZ6A 4J9VA 2AHRA 3B1KA 4ZQBA 2Z95A 5IXSA 1N5DA 3E9MA 5JMWA 5GMOA 4WLUA 4D7AA 3PRJA 5KJ1A 1N92A 1SEPA 3U9LA 2CDCA 3KBOA 4PGFA 4CLRB 1PZEA 1HLPA 2AQKA 3Q2IA 3NYWA 4BQRA 1E1LA 1HDGO 5T57A 3JQ7A 2VRCA 4FR5A 4PZDA 5A02A 1R0KA 4NFHA 4DLLA 4L74A 3DZIA 4FPXA 4UUMA 5BQFA 2BRUA 4PVDA 4ONEA 4R5MA 2GZ3A 1D4FA 3UICA 1A9ZA 4G81A 4R16A 1C14A 3EMKA 1BMDA 3H9JA 1QP8A 3HNPA 3L6DA 3IKVA 2X0JA 3EHEA 4LRTB 1EVZA 1GU7A 1GUFA 2WE8A 5COQA 1VSVA 4J91A 3H5RA 1TT5A 4M89A 2PNFA 3VZQA 3ASVA 4P38A 2PKQO 2HRZA 2X22A 3CIFA 2BI8A 2NVWA 1V9LA 1Z82A 3M2TA 3NRCA 3UVEA 4M1QA 1VC2A 3DBRA 4W82A 2BF7A 1TVEA 3TSCA 3L4BA 5ES3A 1B8PA 1ZK2A 4BNGA 4TZKA 4R41A 5T8KC 3TZCA 2CF6A 2X5KO 3M6IA 1F14A 5KVSA 2CVZA 4NH4A 1XA0A 4WJZA 3NJ8A 1RM0A 2FZWA 2IZ1A 4PLTA 3ICPA 3F5SA 1HDOA 1PEDA 3ZHZA 4YRDA 1PWZA 3ZW8A 4CMKA 3E9NA 1P1IA 3PJFA 5ER6A 1ISIA 3W6ZA 3MJCA 3D4PA 3LYLA 1N1GA 2BFAA 4CL3A 1UZNA 2NSDA 5JO0A 2Z5LA 3ZHBA 2W4QA 1QSGA 5MGBA 4RVUA 4S3MA
chains in the Genus database with same CATH superfamily
4CT5A 1EXMA 4G5HA 3B6JA 3QBVA 4B74A 1KEEA 4D45A 3C6YA 4LECA 2FN7A 4BLSA 5K2OA 1J5EB 2WSMA 1PR0A 4PCLA 2VSNA 3AI7A 4Y1RB 3D3WA 1G5IA 1N6NA 1FTYA 1Q7TA 4OMCA 4TTQA 4URFA 2PKYX 1XD2B 4IQFA 4BLTA 3DWFA 2QGFA 3A3OA 4L9AA 1W87A 1YS1X 4OP2A 1FZTA 2AMVA 1UKAA 1I1HA 1CNMA 2IUSA 5DBIA 4DPKA 4FQ5A 4MR7B 2Q1TA 2ZT8A 1G0OA 1N6LA 1T91A 2EOAA 2AR0A 2EW2A 1NQUA 3ME5A 3OQVA 3RK0A 2YC2C 1PL0A 3SBEA 7ADHA 1Y6JA 4MITA 4QJ5A 4JLUA 5K8VA 4IYJA 2P9YA 3AX6A 3C3DA 2BGGA 3G0OA 1I4TD 4JJZA 1GFZA 2REQA 2AWNA 4X66B 5J2TF 1B6GA 2VPPA 621PA 3EGXA 1SB9A 1R50A 3LWNA 3NIFB 1E3MA 1PTJC 2QVGA 3LU1A 3JQPA 1DBQA 1TK3A 2FPPA 2YMMA 4IJKA 5A05A 1M9NA 2HHCA 3B52X 5IULC 4C2AA 4Z53A 3TGLA 5I51A 1XYGA 4HQ6A 4LSMA 1T8UA 3GFPA 3LH5A 2BFWA 5SV2A 4RELA 3HWWA 5E0OA 3L4KA 2BMFA 1KMHB 4DA8A 4D6XA 4LMAA 1PFKA 3STUA 5LYJA 5L3QA 2QNIA 3PWTA 4U1RA 3E48A 2G82A 3C7KA 3N7TA 5BNWA 2O8CA 1SUPA 5IRCD 2QRHA 1H0HA 3Q40A 4CIXA 1U1EA 2JFHA 5I4CA 5DOZA 3K2IA 3SF8B 5FWYA 1WZNA 1FW6A 1TZJA 1JHZA 2GVDC 4HUQB 1BW9A 4UCFA 5IW8A 3VMFA 2J3JA 4ASUD 1G8YA 2QROA 5EJ5A 5LR6A 1NJGA 3G7NA 1A7UA 2HDWA 2DXIA 1DOAA 3LFUA 3ORQA 4Q4JA 4AJKA 4WNIA 9LDTA 1UMCA 3DL4A 3WL8A 4Y6PA 3UG7A 5ALXA 3REFA 5SZIA 2Y77A 1QORA 3NTOA 4DANA 1L4BA 1BGWA 4RY9A 3UWKA 3H9CA 4E3ZA 5J2UF 2P11A 2HDHA 2WU8A 4N39A 4NYIQ 2ZUTA 4EFMA 2W2KA 3S2FA 2P9FA 2D1SA 3Q6MA 5DHPA 5LMUB 1GGMA 1OKKD 4YS6A 2IOHA 5AUPB 2E6KA 2BT4A 3EDCA 5L3SA 2CLLB 1P7YA 2B0CA 2ZWAA 2OXFA 3QG5A 3QVGB 1JPNA 2Z5FA 3KWLA 1SIWA 2WJWA 3AF0A 4KX5A 4PS0A 1UMBB 1OBCA 4UBLA 3V7UA 3MCUA 2BUAA 4HV4A 5JWRA 5K0FA 3RKRA 3QVOA 2OGTA 4C0XA 5K7SA 1UH5A 2P3LA 4Y6SA 3TTWA 1T10A 3RYCA 3I9V6 3UJCA 3U62A 3GLGA 1AUQA 1G3IA 5SY6A 1MAVA 1V41E 2FEPA 5AJUA 4A8JB 3F9IA 2BTQB 4ND6A 5G3ZA 1JSZA 4ROSA 5IM5A 5BW5A 2J1LA 1ZL2A 3W5IA 4R98A 1A9YA 2G25A 1MABB 1KY4A 3PDUA 3UK7A 4BP1A 2V6MA 1B1CA 2DR2A 1SQ6A 2GGSA 4QDTA 3I34X 3G9UA 2C2ZA 3K6RA 4GRIA 4YDHB 3A27A 2G1KA 3TBHA 5K8JB 2A92A 2WEKA 3WRWA 3U5ZB 1HETA 4NMHA 5I7OA 2OGZA 5LP6C 2Z6QA 3MLAA 4XQCA 5FXMA 5HEKA 3QMPA 4IIGA 2ZRGA 5EE3A 4JL5A 1JHUA 3L1HA 3M3PA 5KVVA 1T4BA 5JEDA 1ZUNA 4PYMA 2A9FA 1S0UA 3MPUA 4Y2YA 3WVNA 3CNNA 3X0DA 2O2ZA 3CX8A 4XYLA 2WDPA 3D7KA 1M2WA 2GD0A 2VZLA 4DREA 3O2QB 4ZGGA 3ZCQA 1U7UA 4U5XA 1YR9A 4HQOA 1UKBA 4U3JB 4M7OA 3DAHA 2IA5A 1QHNA 1U94A 2JFFA 1U90A 1XQXA 2DH5A 5KB3A 1YSCA 3QNUA 4XAQA 3R44A 4YP0A 2A5YB 2FRDA 5DIFA 2BEUB 1S2LA 4Q4AA 4Y2RA 5AKIA 5FX2A 3ABOB 2A0XA 4O2BB 4C6TB 5IX8A 3PCTA 2C2WA 1KOJA 3QTLA 3T4XA 3WNBA 2RJOA 5IBPA 4GMXA 3AW8A 3OHPA 1EFVB 2R6HA 1I6MA 4D0SA 2ACVA 2GZRA 3JQGA 7AT1A 2XMZA 5FBKA 4EUKA 1K6IA 1R12A 3OG9A 3OLYA 2C77A 1COWA 3ZK8A 4EVQA 2IEDA 2ESRA 4AZ3B 2I1LA 1PL6A 2NP6A 1LB1B 1RWNA 1RI1A 4HGYA 3AL2A 1KI9A 2NV2B 4ER7A 2IEIA 1KQFA 2I3GA 1CJKC 5EAIA 1K2WA 4EY5A 2ZB2A 2DPLA 3FPAA 1GAWA 1LBIA 3L41A 2JVJA 3LGSA 3IVCA 1G21E 3B1XA 1E9FA 1Z08A 3AINA 5AJVB 3T34A 2BELA 4DPLA 1M2GA 3G9QA 2HW8A 3TIVA 4GOOD 3RTAA 121PA 3HVUA 4JEIA 1IK4A 5FOWA 5AM1A 1SOVA 1ECPA 4K9OA 2QMOA 3NOQA 5CYOA 4TMYA 1K7XB 2G06A 3L04A 1Z36A 5KYWB 3AVOA 1OWMA 2F00A 2QMZA 3M6AA 3DE0X 2P4QA 2Q6VA 3QFTA 3UW3A 1NOKA 4A15A 3FLEA 2RKWA 2GO7A 3VA7A 4MV6A 4JJ6A 1K4KA 1RPJA 5FJJA 2C97A 1BXRA 4IAOA 2IZOA 4DMUB 4M0KA 4YR9A 3PICA 4MZDA 2Z6VA 1DADA 3LK7A 1OZFA 4WSOA 5IJ9A 1L6RA 1EDOA 1GPJA 1D2AA 5KNDH 1Q91A 3DFMA 5K4HA 4W9MC 4J29A 4BNZA 1Z0JA 4NF2A 4B6EA 3HHPA 1JZSA 1DEAA 4TRRA 2JI4A 4YASA 5CB4B 4HSGA 1NZDA 3CRZA 2P75A 1E9BA 1CIJA 4L4XA 3GO4A 1X9GA 4JYCA 4WCFC 3IE0A 1O95A 2C94A 4FGJA 2NUTA 1TEHA 5JYDA 2SCUB 4IJ5A 1LU9A 2H8GA 4YQFA 2IIQA 3TTUA 4RKYA 1N5LA 4YJ2A 2PLWA 3L0IB 2WKPA 3INTA 3OFSA 4E1AA 5IZCC 3W4JA 2JGDB 3ESDA 4ZALA 5HK9A 1L7NA 4A6PA 4AO6A 4HGQA 3L4JA 1Q0UA 4Z7OB 1SBHA 1YIOA 3T1VA 2F3QA 4IMIB 4YI3A 3I6MA 3ZZ0A 2NQ8A 4FW9A 5KOJB 3G02A 3MS2A 1Y1TA 2QYHA 2IE0A 2PSEA 2ZJAA 3U3OA 3F3SA 1HQDA 1ZM2A 2AD5A 4LDZA 4NV0A 1KKMA 5BWCA 5GVSA 4UTRA 2O0MA 1D5CA 2QRJA 1QYRA 1BVRA 3A4LA 1ECFA 3ECCA 4IJMA 3RHTA 2QVBA 3ETJA 4LJAA 2WZQA 4XA8A 3S2EA 2IS2A 1V7ZA 1OLSA 1ZRSA 2J3DA 1O4VA 3ZD9A 4KW7A 4KUEA 1T34A 3EOAI 1X6VA 1V5WA 4AWXA 3I6BA 1AX9A 3L8HA 4MYHA 1OSNA 4QTTB 4Y0NA 2LPMA 3IKJA 2I66A 2DB3A 2OL4A 3FW1A 1PF7E 3ZE7A 3DMNA 4IMJB 2B8WA 3LGAA 2VHCA 3NMUF 1W4ZA 1TQ4A 2O0KA 4DW8A 2ZUDA 3P27A 3G68A 3WGJA 2VRCD 1U1GA 1PW5A 3D5QA 1M2VB 3GUCA 2Z08A 3UMFA 4MYTA 4JEHA 2D1YA 2C9YA 1CQWA 4V0RA 2AFIE 3M6XA 3MCTA 4W63A 1M72A 1MX3A 3HADA 1EFCA 4C7VA 1EIZA 2C9DA 5HX7A 5K0ZA 1XVIA 3GAMA 1S9DA 2AXNA 2JI9A 4KH0A 4XFJA 2V7GA 4GX0A 4KN6A 4TVOA 5DM0A 3RD5A 3RW9A 5K20A 2JA1A 4IVRA 4I5FA 2IYFA 4Q18A 4QYSA 1R6BX 3SS9X 4IXNA 2XE4A 1ZUHA 2FW6A 1U3DA 4TTIA 4URVR 4IPTA 2JS7A 1N3IA 3E53A 2POCA 2P65A 4PLVA 2C61A 2XDYA 4OPMA 1M83A 5AVZA 1QO7A 4BJ1A 4DIKA 3DL7A 3JRWA 1EHCA 1RKQA 4Z4FA 3OP1A 3EIOA 3MBIA 5KINB 2ZOSA 4AN4A 5GONB 4GUDA 1U9YA 1VIVA 4Z9BA 3T5TA 3WLQA 5EJEA 3GJZA 4YRNA 3KOWA 1VL5A 1ZHOA 3OVMA 3WGMA 1WXQA 3ZTTA 1S2NA 2I6TA 2VHVA 1Q22A 2ZPUA 4FBGA 2EP5A 4BVBA 4C9BA 1VCNA 2QN2A 3IBTA 1WDMA 5IH3A 4PSAA 3TGWA 3D0RA 5BR8B 3H19A 5HGXA 5JJLA 2ZSUA 3DPIA 1FFHA 3A6LA 2CXHA 2IXAA 1KZGB 1CJUC 1JDTA 4BFYA 4DTIA 3E7XA 1P3JA 1BJTA 1Y80A 1PG5A 2HV9A 2DECA 2QTHA 3IXQA 2XUJA 3QUBA 3WNCA 1Q0LA 3Q7TA 1BA3A 2DBYA 4IY1A 3EY4A 2FW7A 1P29A 1QRDA 2VXBA 3H4MA 3OZGA 1XVVA 4EX7A 3C3XA 1YZ3A 2YWJA 1HY3A 2FTKE 4FM9A 3RAEC 5P8WA 2GESA 4OV6B 3G49A 1Y8CA 2R4QA 1G60A 3JASA 4F2GA 1VYVA 2AKAB 2I6UA 1BWQA 2L17A 4O2AF 3J7AC 2A9JA 1KI2A 3FCEA 4YB8A 3PVSA 4BAUA 4E7PA 5AVXA 2W2LD 1JSLA 1A98A 3EZXA 1QIHA 1WSAA 1QO0A 2D2FA 2Z5VA 3KB6A 1PT5A 1O97C 3UXMA 1X8XA 4MQ6A 4JVNA 4LOKA 2OWDA 4QEKA 1ZYUA 1UJMA 2QL9A 3IA7A 2P30A 1CRQA 4CIVA 3IKTA 3OTOB 3A1CA 1C0LA 1Z0SA 4PAOA 1L8LA 4N18A 4A9AA 5LVAA 1LPAB 4I9UA 2J3LA 5J4LA 3W8DA 2GBGA 1YZFA 4HDMB 5HCUA 4Q12A 4QJ3A 4CL2A 3RK1A 3RYFA 5AFSA 3Q8LA 1QRTA 2C5EA 4Z4QA 3WLMA 2CVOA 1MVNA 2X7HA 2M6SA 5E6UB 4YT4A 2DFPA 4BUCA 5KYYA 3PCXA 1QIFA 3AVTA 1DAHA 1K27A 1R8SA 2XTNA 1WU8A 1ZIYA 1RHMA 2C4HA 5JE8A 2V7WA 1PD1A 3B82A 2OCDA 4OQZA 4YAFA 5SYMA 1W48A 1Z8NA 1ADCA 2F8LA 5DW0A 3NJ4A 5K0EA 1DZIA 1NJ5A 4H7IA 1XA4A 4XFKA 3IDZA 4QSMA 3RABA 1JX6A 1XWIA 3RSZA 3LTNC 1ES9A 1X74A 3CUSA 4MI9A 5FWXA 4E12A 2V3CC 3SEAA 3HJFA 4Y2VA 4D5GA 2JIQA 3RBVA 3AM1A 4M1KA 1E4YA 3QWBA 4EKYA 5BPHA 2B5VA 4FKBA 5H83A 2FX5A 1LA2A 1P2DA 1UAYA 1YB6A 1KMMA 2WICA 3A9UA 3M5CA 3NVMB 1YZUA 1OLUB 3PUYA 3CSSA 5F21A 3V8BA 4B6FA 5KWVA 4R1TA 5FEMA 3KP1A 4RFSA 2J3MA 4GT1A 2J5RA 4YMIA 1L9KA 4N0PA 5C1OA 2WKRA 1MOPA 3UCXA 4KAAA 1P1FA 4XDYA 5A9TA 3W7BA 4DLRA 1T3ZA 2AMFA 1EP1B 4FBMA 3V32A 3TUZC 1KPGA 3NHFA 3WZ2A 1AQLA 3FUTA 3G6KA 2IV2X 3B9BA 4RF3A 4DILA 3U19A 1L4KA 1P9NA 4MR9A 5LLDA 3C6QA 5FA8A 3UA3A 3BMCA 3ZLBA 1CB0A 3JX9A 5TNXA 5KUTA 1J0CA 2AFHB 4NULA 2V4MA 1ULTA 1UBKS 2I62A 2V4ZA 3LX8A 4OYLA 2XCOA 5DO9A 4AY2A 1YQDA 1EDEA 2ZGVA 3W05A 1SC3A 1ZVJA 4EJMA 3KD3A 4HATA 4H6XA 4HNQA 2QGNA 2QU8A 1O1YA 4CXMA 3B51X 2FOIA 2WU3A 1NVXQ 2RHJA 4UHBA 3LJKA 5ARCA 1NONA 5FFNA 2J3EA 1VMIA 2JGRA 2QUHA 2JIOA 3GRFA 2Q46A 3LPLA 4G25A 4L1KA 2MINB 4RCVA 5JNLA 3I3OA 1ZH0A 2OSVA 2ORYA 2X1LA 5H68A 2J3HA 1PX0A 2CL7X 5IM4A 4EPVA 3ITEA 1USGA 1N4DA 4PNHA 4G9BA 2MSWA 4URUR 3RODA 4X3OA 4X7MA 3AU8A 4KEAA 4M88A 4I3FA 2DBQA 2A88A 2Q27A 3JTMA 5C1PA 1GCOA 4F45A 1YDWA 1FMLA 2CNDA 3TTYA 1L7DA 1SUBA 2ZRLA 3LD9A 4IJWA 3WIEA 3Q8MA 4K9LA 1P1KA 1WUYA 2VRBA 1PYDA 3FX2A 3FXAA 3K2BA 4FHFA 4Q1AA 3VAYA 1PJRA 1NZFA 3E8MA 3U3ZA 3TLXA 4W6QA 1WXIA 3UV7A 3O6VA 2ILTA 4NNPA 2C1EA 4O4HB 1O58A 5D87A 5EUCA 4NOKA 2YY7A 3RVNA 1T4GA 1TM5E 3A6JA 4KQGA 4MGKR 5K9ZA 2R85A 3TQRA 5IAEA 5KNLA 4TRJA 1US8B 1NC1A 1TF5A 1DWPA 3O94A 2CJWB 5EQTA 5LMZA 3OM0A 5IHPA 1ODFA 4K8OA 2NVBA 5D3MB 3FOEC 2GEKA 2OKCA 2P7HA 3PNQA 3DR5A 2Z83A 3VHLB 1J20A 2YDYA 3QVLA 4FOTA 1BCRB 1ZEJA 4TXJA 5TMDA 1BOOA 3OJ0A 1EG7A 2Q1WA 5AI5A 2D1RA 3O8DA 1WMBA 4CCYB 4KXLA 4JR2A 4CEJA 3EXEB 3VU0A 2J8ZA 3AHHA 4ZYTA 1EUCA 4BLUA 4MTCA 2EFHB 4UQPA 5CA1B 3PR3A 4HR7A 1OGYA 5F9MA 4FGKA 1AS3A 3GT7A 2PLNA 3JYQA 3W79A 3KYDA 1LVUA 4K9NA 4LDQA 1X39A 4PZCA 3HA3A 3BJIC 3IEUA 4DJ5X 1HQYE 3DZDA 3ITNA 3GU3A 1OUMA 4EK9A 4Z5XA 1GKKA 1R4NB 3CNOA 4Y2PA 1U0JA 2IDKA 4RA6A 1WUTA 5CT5A 2VPTA 3DO5A 4HWPA 5HWSA 1Z4LA 4LNAA 5M5BA 1H8HD 4MVJE 2C59A 1ISGA 2WSYB 3COPA 4R2XA 1U8CB 2Y6VA 1JQEA 1TTHA 2HPAA 4A6XA 4Q3NA 5CJPA 1UKZA 2W6ID 2YFQA 4FXPA 1N0VC 3C5HA 4MXDA 4WLOA 1DKMA 2Q0XA 4EZEA 1QFXA 2CLDX 1C9EA 1X2EA 4UUNA 3DAGA 5KJEA 5LCXA 1EVQA 4G1CA 1NN5A 4FHEA 4WEQA 3NP9A 4UPEA 3UJNA 3HXTA 4PZPA 1YOVB 1A8SA 3NQ41 3BD6A 3S40A 3DTYA 2R6GA 5BSFA 3ZY3A 1N8SA 1XCBA 2BSAA 2EFJA 3CNLA 3NCHA 2YJ4A 5EJMA 3ZTWA 4HQKA 4JENA 1C7FA 2BONA 2FZEA 4P08A 4BO6A 1WQ1R 1E8NA 2AW3A 3BTUA 5FI5A 4HEQA 4DA6A 1NF9A 2HBZA 3BVPA 2FMXA 1Z4JA 4CDMA 2FUKA 2NSYA 4JJFA 4KDFA 4M9QA 3RSHA 3EGDA 4Y67A 2JFGA 3E9DA 2W37A 1T8PA 5J3JA 1GXSB 4P4SA 4JXKA 1TMGE 2CJFA 5FNZA 1LDBA 5LZ8A 3C39A 3EGEA 4B6JA 2ZZKA 4RDXA 1SWVA 1Y4AE 1K9SA 4PO3X 5K6AC 1IM2A 1K8ZB 4OMUA 5IN4A 4OXIA 4LTDA 3UV6A 1DIGA 2J9RA 4L0QA 1RHRA 1EX1A 2WJ4A 3DR3A 2RGWA 2A9RA 4IDEA 1OJ7A 4WZBB 1UFOA 2FW8A 4QYWA 2VDLB 1C0IA 2IP2A 3P1JA 1RJ9B 1UDCA 1XVTA 3S5UA 3JQFC 3GEBA 4L5AA 1TT5B 2IC5A 5BSUA 5TVKA 1AKNA 4CEHA 1ULBA 1JA9A 5KC8A 4ESHA 1RQXA 5JFTA 4A6DA 1H42A 1RQRA 3DZJA 3I9JA 4R1LA 3B2QA 2YRFA 2VP0A 3E9YA 4X1IB 5F2KA 4EF4A 2GEJA 4AICA 2G0NA 1ONOA 4G26A 2DBZA 3ZZUA 5AJWA 1OX6A 3GJQA 1K97A 2ZUBA 4ZV7A 5AW0A 4OLBA 4JITA 3L01A 4MUAA 2VK2A 2OD9A 1PRYA 5JATA 2OV8A 3LDFA 3RTBA 4XPZA 2GK4A 2J4FA 4B4WA 4MGHA 3HBLA 2QG4A 5EZ5A 2YWXA 1AZLA 5CA0B 2PKXA 2PGXA 3BXOA 3H87A 3JWHA 3NIGB 1JB1A 2H1SA 4FGSA 1IMOA 2Y1DA 4ALNA 3PE3A 1P4GA 3DEAA 4XD7A 3H9EO 1LTQA 1MRZA 5MF6A 3B6IA 5EJ7A 3FTCA 4MHOA 1WXXA 3PXCX 1POWA 1NYLA 2I3BA 3LRXA 4Q05A 2VT3A 4DMGA 5F1YA 5K6RA 3P8ZA 3VR2D 1VZ2A 4D57A 4CLRA 1M6VB 3TLJA 1U2PA 4BRWA 1RCFA 1Z15A 5DSZA 5TLSA 4JI0B 1JNYA 4RCZA 3W9SA 4D3ZA 1MH1A 5MHTA 1ZR2A 2QTRA 3ZJ4A 4F3YA 4RGVA 3LPNA 1WV1A 1KVRA 3GZ4A 4DCUA 4LVNA 5CVEA 4Q9LA 3EQ9A 1M0SA 1NQAO 3ZBUA 1SKYB 2CT8A 1FX0B 1O6GA 2YWRA 3SKXA 3TE7A 4BY9E 5CCXA 1L5QA 3UWSA 3F3MA 1FDWA 1MO3A 3D1LA 3ASUA 3QPBA 3FOBA 2GN6A 1K6JA 3QLUA 4ZAWA 1VG0B 2OMKA 4A8HA 4AQYB 3WLFA 2Z2JA 3BTOA 3OZTA 3JD1A 1F4PA 5ALIA 4HWRA 2VJCA 4MRMB 1U2SA 1ATIA 2I2FA 4QFBA 4DC0A 1KFEB 2WP0A 2QEQA 2KMLA 1LJLA 1SZJG 1WPXA 3HDHA 3NBAA 4OQYA 1QCDA 4Z0TA 3STVA 4LYGA 3AVWA 2A86A 3O82A 1YMQA 4PW0A 3FPJA 5HA5A 3OQNA 4RWEA 2W2QA 3T99A 4ER6A 1FP7A 3VX4A 3MS7A 4LX0A 2HB6A 4V1CI 3C8ZA 4R8VA 1IM8A 1AG9A 3I4LA 3JATA 3OC0A 4QYIB 4XR9A 4LC1A 3F1LA 1KIFA 1L4FA 1QJ4A 1Z9BA 4HLNA 2VNIA 4R6WA 3WB0A 3ZEIA 3ZDXB 3MQFA 2P35A 1EBUA 2JFOA 3OQIB 4WFQA 3TLKA 2WU0A 4JZKA 5K8CA 3P0IA 1N2CA 3H0EA 4MQLA 4K9KA 4BFVA 1E1CA 2G36A 4KQKA 3IIJA 4ZD6A 1Y3BE 1UCFA 4OHFA 4AZTA 1W0KD 4DDWA 3X1MA 3KSBC 1G42A 3BE8A 3DZBA 3HA2A 1VZ3A 3QELA 3K05A 2X0IA 1MB9A 6AT1A 3PUWA 1M2OB 3GEGA 4KVFA 2EGGA 3GHHA 4F8YA 4JROA 5E7MA 1U8XX 3W3AH 3PI6A 5AR1A 5C1BA 4PC7A 2O8DA 1F0YA 3ZWNA 1Z34A 1ZNYA 3OKCA 5HTOA 2I7VA 4BX0A 5CEFA 1W85B 4MIYA 4CF3A 2IU0A 2WIBA 4MYUA 3RREA 2PMCA 1CQIB 1QYVA 2HK7A 4R1SA 3TDNA 3SM3A 1RD4A 1RRPA 5HOEA 2GAAA 2WJPA 2QPAA 1TI7A 3I05A 1QYCA 3DL0A 4V02A 2IOYA 2NO7A 1YUMA 3AVQA 3QHAA 8LDHA 3NBFA 1KOFA 4GLFA 3OWXA 4FDTA 2C04A 1QQTA 2QTTA 3O0TA 4Z99A 5BNFA 2D5LA 1C4OA 1QTRA 3EH1A 1ZMTA 2BFEB 2JVKA 4JLBA 3DMHA 4LEIA 3SQMA 3JQBC 1QB7A 2CFCA 2ZQZA 4PLHA 5LOVB 2W2NA 2WUGA 2Y4NA 3F96A 3VU8A 3AEKB 2WIJA 5JS8A 3CZ9A 4HLUA 1ID8A 3QEAZ 4XRGA 1I0ZA 2XGSA 2G1PA 2IYVA 3P2MA 3OZBA 5HFNA 1F1BA 1PDVA 3KTFA 1V8ZA 1YDGA 3DW3X 4JLAA 1QH9A 3HY6A 2FFHA 4KACA 4ZVLA 1H22A 4IOLA 1JWBB 1ZGZA 4QUEA 2M6KA 4D0LB 4BWGA 1A69A 3GLIA 3OZRA 1V37A 2WYIA 3O8OA 2B98A 1W73A 2WTMA 3HKBB 2RJ3A 2ZWMA 3USZA 4BMOB 2VTKA 3TFWA 1F3LA 1OC2A 3EFOA 3Q5DA 3CO0S 5JVDB 2P6PA 3BBLA 3IB6A 1RMQA 2JJ8A 4INJA 1NSFA 3OETA 3SX0A 3ZQJA 3A8TA 1ILEA 2H6EA 2XPCA 3EQ8A 4ABYA 4F21A 5LDHA 3LDAA 1TX4B 4L2IB 4LPKA 1V5FA 2XSZA 3NT5A 2EFEB 1Y4DE 4N76A 1MEJA 2ZBVA 1EWVA 1NW4A 1W1WA 1XLVA 2C7GA 3R6TA 2PL1A 3EXFA 2IYPA 3V6MA 5F3WB 1PK9A 3B3AA 5CH5A 3HU5A 4R01A 3PEEA 5FOXA 4E32A 1E6EA 2VP6A 4Q37A 1Z2AA 2FSVA 1K6MA 2RHBA 2OFXA 5BMVA 2ZRCA 3MB8A 3R3VA 5J5AA 1S8OA 4XQGA 1Z06A 2MYTA 2JIMA 3AFIA 3TPFA 3O95A 3I9NA 2WSIA 3MILA 1QQ5A 1DKLA 1OMOA 4IW3B 3OEEA 4HNTA 4LJ9A 3AWIA 1P7WA 3Q72A 1TE2A 3RT1A 4LBWA 3AEYA 1D5WA 2PAAA 2JKZA 3Q15C 3GUVA 2BGJA 3HEMA 4NZNA 3TMYA 2CD9A 1UK8A 2ZULA 4NCIA 1JDBC 1A5BB 1XXHA 3QI2A 4R31A 2YY5A 1D2MA 2RKOA 5BN3B 3N3BC 4QLAA 5SY9A 1RDFA 2D00A 3C5EA 4L0CA 2UVPB 4YJFB 4Z3DA 2R6DA 2OCLA 4DEVA 5K0TA 2QJRA 4LMBA 1ZI8A 4JQCA 4YIHA 2PMEA 1KY3A 1IL0A 1U8FO 2XR1A 3FRJA 3I2IA 3NIDB 4P4NA 5FHRA 5HILA 2BGRA 4ENTA 2PCJA 1W6UA 3EULA 5BR1A 3AHFA 4U7FA 2M9MA 1RLJA 3IE1A 1IHPA 1N8TA 1P60A 1CZKA 1KI6A 2AOXA 4YV7A 1T15A 5JAUA 1S3IA 3MZ0A 5A6VA 1R88A 3LAWA 3D6HA 1H4VB 3TEMA 1ESCA 4WI1A 1UKCA 3ILVA 2FOLA 2O1XA 1EYZA 2FV8A 2LZ0A 2ODTX 3H13A 3OLXA 2XOKA 3JPYA 3UFBA 2D7JA 1MQAA 2G83A 3K0CC 2GK6A 3O8LA 1ZNWA 3A2KA 3BXZA 3O8CA 3RUIA 1KAQA 4GP9A 4OQQA 4P3NA 1KZ6A 4DA0A 4EYKA 2H7CA 5JNWA 2P9CA 1VA5A 3VDNB 2LW7A 3CF4A 3R7DA 3I01A 2HSEA 2DX7A 1JDPA 1JYFA 1SCKA 2QTFA 5REQB 3EF3A 3ZXIA 2I1QA 4G65A 2IXEA 2QV7A 1QK3A 3KJGA 1P61B 4DMFA 3ROKA 2BFBB 3HFJA 2WG1A 3BB1A 2BFDA 1KSJA 2AX4A 2CMDA 4LRUA 4Y7DA 3OLCX 1SU4A 4JBLA 1W35A 4PO9A 1S7GA 5ALTA 3THOA 3VR6A 4IXTA 2EKDA 4YRMA 1Q44A 1Z5WA 1RWOA 2JBAA 3W6UA 4F06A 5AI6A 1QHHB 2W93A 1BAPA 1ZD4A 2HPVA 1X77A 2WZBA 5FA5A 3VPBA 2ZPTX 2BLLA 3LT5A 3IIEA 5ICMA 3INNA 2XNDD 1IBCA 4PYQA 1FUEA 1NU6A 4GM1A 1UBLS 5FOQA 2R8PA 1GPMA 4LQDA 5F35A 2RH4A 1MUUA 3K0FA 3HR7A 3PPYA 5GPBA 2OM2A 4MRSA 3ZU2A 2OFPA 3VJLA 4IR7A 2CB0A 1FSSA 2RAPA 3CNHA 4IQ8A 1VOTA 4S12A 1E7QA 2AJLI 5DMHA 2QVCA 4IKEA 5DX0A 2JKYA 2WVGA 3I92A 4PANA 5ULLA 3OCXA 3WSWA 4CQMD 3U1BA 4JJGA 2DOKA 1QP4A 4BNFA 4LDNA 1GPUA 4QOFA 4RK6A 1E5XA 1T4CA 1Y5NA 3AR5A 4XB1A 5ECGC 3IT3A 1INLA 2D4AA 3IT2A 1TJ5A 1QLHA 2VHZA 1GR1A 3DOHA 3M6WA 1R4ZA 4YV2A 4QU9A 5KYGA 1E6CA 4YP6A 4IV0A 4RW0A 3ZCTA 3DZGA 3L8EA 2XVAA 3L6CA 3R75A 3EQZA 4XWAA 4CRWB 2J09A 1XE3A 4CGZA 2R2GA 1GP2A 1BO6A 2ERCA 2MIIA 2WPDD 3E3MA 2D06A 5JCOC 2X86A 3KKPA 4AY5A 3ZVRA 2BH2A 3D6MA 2IEAA 4J1QA 2BDEA 2GD6A 3UMBA 4PIPA 1IDOA 4C76A 4A82A 3R9XB 3I61A 4DR6B 5IJ0A 1G16A 4EL0A 2PT7A 4N40A 3TVYA 1WHSB 2OE2A 3U81A 1GOTA 3QFFA 2D1TA 5CLJA 4FB5A 3SJZA 5HMLA 4YCCA 2IXTA 1MB4A 1KARA 1NASA 4YJ3F 4U63A 2QD1A 2AC2A 3Q3HA 4YDRA 1IHXA 4BC1A 4HT3B 1YJAA 1Z29A 3SLRA 2FWNA 1OFGA 3RVOA 3MBOA 4J16A 2CY0A 1PSZA 2Q5FA 2ERYA 3IVMA 4NONA 4X1KA 3H4IA 1NF8A 3PQEA 3T5GA 1Z3CA 3IR7A 4E14A 1KEVA 3U7QA 3ND8A 1IVNA 2GN2A 1J0BA 3ST7A 2IPMA 4EBBA 2DQKA 3LWDA 4WN9A 4CMGA 5JQGB 4BXOB 1CUBA 2ZKIA 3O91A 3LHIA 5JD6A 1JEDA 2F3UA 1E1QD 2P2LA 1EWKA 1II8A 4KB5A 3NP7A 3IHLA 1LDEA 2JIZA 2X40A 3HKDB 3BYZA 3P0EA 4IFEA 4BS9A 2EP7A 3DKKA 1B6TA 2DGDA 1P77A 3BQMB 1IBRA 2GTHA 4WOJA 4JOBA 4NXMB 4DV7B 3IUMA 2QPTA 1JILA 1PLLA 4JGGA 1WWKA 2JJ1D 2YHIA 4URZR 1QIDA 3FCYA 3P2OA 3UK6A 3BRSA 1MJHA 1OU0A 1PT8A 2LR0A 4GG1A 2PUHA 1IPHA 2VAMA 2IIPA 2RI0A 1L0BA 3IV9A 3T4UA 4AKEA 2D5CA 2IYEA 4JP5A 2G0AA 3TPZA 4AULA 4CLOB 1AKRA 3GPDG 1O6CA 1K0UA 3N0RA 4KG7A 3QPWA 4MB6A 3VR0A 1QDEA 4B9EA 3ZVMA 1JR3A 1PW7A 4QOSA 1UFRA 3DF7A 2BUCA 3UAWA 2ZYUX 1JIKA 1OTHA 1SXJA 4WASA 1FYVA 3EVCA 2XB9A 4LMRA 4RABA 5LQUA 4W7SA 2CW5A 1OA1A 4P0TA 4RHTA 1KTIA 3AZPA 3PDJA 3HCDA 5IK2D 1W5AA 2B7BA 3OZEA 4EI7A 1KYTA 2F2TA 2R5NA 3IXLA 4IFIA 1JHDA 4BWFB 5FPQA 1I6WA 3THXA 1BD3A 1N6HA 1O6ZA 1KAEA 2C7PA 1SQSA 2YJGA 3HYCA 1NYRA 1XK6A 1RYYA 4DHEA 3JQRA 3QX7A 4QPCA 2RAFA 1WMEA 4KSCA 3NTQA 3TN7A 1D04A 4NCKA 3GOHA 4FMDB 4MYRA 4ZO9A 3HUFA 1GJRA 1EXDA 3UXEA 1MXFA 1ZRMA 1JHYA 2J87A 1O08A 4QRHA 1B4DA 4QYXA 1W1IA 2HMVA 3L1KA 2ZUCA 2RHHA 3N86A 3NC1C 1G5QA 3UWDA 2HRRA 4FQ7A 2VF2A 2Y1LA 3K09A 3M5DA 5EZYB 1WNFA 1GGJA 3ZY6A 4B2YA 1I2DA 5JNRA 3SDSA 3QE9Y 4R2WA 3M1LA 3FYHA 4HB4A 1PT9A 1P2FA 2XNSA 2CDAA 5C18A 3U4DA 1Z22A 3FOFC 4K03A 4NMXB 5JMOA 2ZSFA 1UDWA 1ZPDA 1PI3A 2Q5EA 2AQHA 3CLTC 2EJWA 3L8CA 4I9HA 3F6RA 3FTPA 4LZLA 4AXXA 2FE1A 3UUEA 5HKKA 1S7CA 1NM5C 1NQXA 4RNCA 1NN3A 1YA8A 1WMSA 3HLTA 2UUBB 3LVRE 4P7GA 5B58C 2ZSAA 3E6AA 5G0WA 1EESA 1PFWA 4C06A 2CSXA 5DGXA 2OO5C 1YI8A 1YBMA 3FHOA 3Q7RA 3VOSA 1KVSA 2OGUA 4Q24A 1FQKA 3FMGA 1XRSB 3TX6A 4RMJA 2UXCB 1RWQA 5IAOA 4OHYA 4JLKA 1E3SA 3F5FA 4PF1A 3P52A 4FK8A 4URHA 3ZV5A 1TA9A 3DFFA 3LW8A 4MS4A 3ZWDA 1GY8A 3GRKA 1OBOA 2ACWA 3HA5A 3LCCA 4UQOA 4B43A 1SXPA 1JQLB 1PL8A 1OVMA 1TA0A 3V7YA 2QD4A 3OZFA 2GCEA 3WFJA 4AKGA 4L6CA 5SZJA 4DL9A 3MMSA 1G7SA 4WNAB 2C31A 3BTVA 2VTDA 2NO1A 4FZVA 1O3YA 4MQEB 2AOVA 1H2YA 1DX9A 3VYTB 4B3MB 1O4WA 4E94A 1CZRA 1Y7LA 1ZD3A 3K6KA 3MWEA 3SIWA 5L9AA 5IBRA 3RYIA 3ZZMA 3SZRA 1U4NA 3V7WA 5CDUA 3WYGA 2H4HA 1G8FA 3QJGA 1ND5A 1R9GA 4G5FA 4R0NA 4GYJA 3VNRA 4LZOA 1YZHA 2D2VA 3B5JA 3QOWA 4IZ6A 4U2DA 5FL7A 3C1TA 3DAOA 4E5DA 2G88A 4IVPA 4NFSA 1E7WA 1W2GA 4XKJA 1G7CA 3UWOA 3WYAA 2DETA 2JD0A 2NUAA 2H0QA 3NONA 2Y05A 1MW9X 3FYDA 4PE5B 4BFXA 3K9LA 5ALUA 1VJGA 3OPYI 3Q6NA 2FPXA 3NM6B 1SBCA 1TW3A 1L8OA 2C9BA 4KGDA 4KRXA 3TE6A 2Z2IA 1I4WA 3F5DA 2VS1A 2V6GA 1VMKA 3TXAA 2FOXA 4MK4A 1S6YA 3R8XA 3V1MA 3T5CA 2FGJA 4URYR 4KYUA 1SEVA 3W78A 4X6UA 3QU7A 2ODNA 2XRYA 1AA9A 1CW2B 2IEGA 3LC1O 4U9IS 3NS7A 4X94A 3PB3A 1RPAA 4QARA 3DD5A 5C4IA 2WNIA 3AHJA 1JEYB 5K4AA 1D4ZA 1VGQA 3DH0A 4FEYA 1IHOA 2MWMA 4D4HA 1YA4A 1FX1A 4ITUA 1ZGGA 2NP7A 1WCXA 3ZHSA 1ULAA 1USKA 2ZRAA 3BXEA 3GRRA 1A8IA 1C7ZA 4KE7A 4TKUB 3PPXA 3CUVA 4B4VA 4BQEA 1Q0HA 1SVSA 2A84A 2IODA 3NHAA 4Y6RA 2QZ9A 1J21A 3H7AA 2GCOA 3R3ZA 2QNRA 5LDGA 1RABA 2H1VA 2VN8A 3FKJA 3OEHD 4G1EB 2IYUA 4GLBA 1PVOA 4A91A 2FSFA 2Y9MB 3X1YA 4JLOA 5EZ6B 3GUZA 3UY4A 2VNSA 4O2LA 4PYNA 1CUIA 3EG9B 4M0LA 3TSAA 2HMYB 3CVJA 4C0HA 1NBEA 3KR2A 1NQTA 2N9UA 3OIDA 1Z2DA 4G67A 4PRLA 4WEOA 3E2MA 3LLUA 3UOGA 3ZEAA 1IJBA 4Y2GA 4LRWA 3G89A 4XUDA 1YJCA 2PG3A 3CLRD 2WYHA 3PFNA 4UTOA 4IV8A 3V2IA 1EM6A 1BYUA 5DDIP 5GJVC 2GBLA 2J6CA 3L0SA 1RRFA 4RGYA 5FPKA 3OIGA 4IIYA 1JJBA 1C3XA 3OKPA 1P4SA 5TQ2B 4ZO4A 4K6KA 4MW9A 3MXTA 2A2ZA 1LH0A 3QKSA 3R40A 3RFUA 1TFUA 3ZXYA 2JRCA 4EJ2A 5K0GA 4K9SA 2I2DA 1LXCA 1EBFA 3TS1A 3MUFA 2DVMA 2GPSA 5FI0B 1CDOA 3O38A 1KYXA 3A1VA 2G0TA 2IPNA 1DBPA 3B7WA 3EISA 5SZHB 1EINA 4MGZR 3RYTC 3WSVA 5K09A 4OHBA 5AW1A 4M9RA 3EVDA 3MHPA 4JSRA 3WKAA 4FLEA 4ZN6A 4DWWA 4QQKA 2Q6KA 2H00A 1ZH6A 5IKXA 3QX8A 1XPOA 2XNCA 1N0UA 4Q02A 4HAOA 1FOEB 4YN3A 3TAHA 1CEQA 2HEGA 3OU2A 5AK4A 3U4CA 3L82B 3ISJA 3VO8A 4HADA 3C41J 2GYVA 3NZEA 4RTRA 1QYDA 2GSWA 1GGEA 3BPSA 1RXUA 2CL5A 3ZX5A 2NU7A 1QGUA 3HBNA 3N39C 1V7CA 4CN8A 3F1KA 3O21A 2WNSA 3KT0A 3LNTA 4UOQA 4AJ2A 4DDHA 4EA8A 1PN3A 1CQJA 2BCJQ 2VYVA 2WAMA 3D3JA 3OU6A 2PUBA 1DHTA 1HK7A 3R0JA 4QXAA 3EMVA 5GIOE 4EFLA 4PSUA 2GJ8A 4RIGA 2QAGB 1QE3A 5JW6A 1F60A 6CHYA 1C9MA 2KBEA 4IIJA 1P4AA 4BE7B 1T6BY 3IPCA 4LG1A 3RS4A 3DT9A 4R1QA 2PCLA 2GXUA 4L76A 4C14A 1TYCA 1MDFA 3C97A 1G20A 4V03A 1JHRA 3TZKA 1DARA 5BUSA 5LNK6 3A4TA 4JBNA 2BZSA 4MQBA 3QKIA 3I5AA 4ZOLF 1KH2A 4DV3B 5DTQA 1XL0A 2G76A 5SY4A 2Z6UA 3RLIA 1JVSA 2VHYA 2XD4A 3ZU5A 4TSRA 2GZDA 5LU9A 1GUYA 2OLJA 3QI7A 2QLFA 3JQ8B 1E0KA 5JD4A 2V0CA 3PXDA 4HRYA 4I4CA 2ZT7A 2G4LA 1IMJA 1XGKA 1IIBA 1AGNA 1KO1A 2E6UX 4JA0A 5KTMA 4O8CA 4TUYF 3AHEA 3A6GA 4NY1A 5EXDA 1MQ8B 1KJWA 4DBLC 4IXDA 3FJOA 2KI5A 1ZOLA 2YHUA 3V5NA 3G2QA 2FVYA 5C3UA 1UK7A 4XWWA 3FMVA 5E9AA 1N2HA 1WCYA 1ZJZA 3F9RA 1JSXA 4KLAA 4M49A 2HWXA 3DXYA 2QPLA 1E3JA 2HLDD