3UY4A

Crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate--Beta-Alanine Ligase from Campylobacter jejuni complexed with AMP and vitamin B5
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
total genus 88
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uy4A01
4S1OA 1QQTA 1Q19A 1D2RA 2XRYA 4ZT4A 3ISJA 4JXZA 4PY2A 1MRZA 3X1KA 1H3EA 5LLTA 1OWPA 1WXIA 3A2KA 1XNGA 2DLCX 1O0BA 2NSYA 3DO8A 4QBTA 2WQ7A 4EG7A 2VTBA 1JHDA 2DEUA 2A1TS 4HJXA 4WNYA 1MAWA 1NUTA 3TQIA 4CQNA 1JIIA 3P0JA 4MW6A 5HUJA 3INNA 1WY5A 5TEVA 1NUUA 4ZCQA 2CYCA 1QU2A 4ARIA 1O97D 3IODA 1O96B 4MUFA 2J07A 1HYBA 2X0KA 2PIDA 5EKDA 4KR6A 3X1MA 4HPWA 4XFDA 1ZUNA 2IJGX 3AIIA 4MAFA 1N2OA 1MB9A 2QUHA 3IUBA 4MQ6A 3CLRC 4GRIA 5J58A 1WZ2A 4ZT2A 2EJCA 2IP1A 3K9WA 4JXXA 1YI8A 3HGMA 4G5YA 4XSVA 1R6TA 5J5AA 4EG8A 3Q4GA 3H97A 4MUIA 1PFYA 1ULHA 5TS2A 2JANA 1TYAE 2D54A 1U3DA 4CT0A 1LW7A 3NBAA 1MOPA 3H99A 1G8GA 2PZBA 4WSOA 2GKSA 4TS1A 1QNFA 3DPIA 4Q93A 1TFUA 1LI7A 1GTSA 1O95C 4OUDA 3TQOA 4UZEA 2PZAA 2A84A 2CFOA 4BWVA 1J1UA 1TYBE 1YIDA 1EJ2A 1RQGA 4K0RA 3CA8A 1JZSA 1VLHA 1VBKA 2C5SA 3P0IA 1GLNA 1TYDE 4NAHA 1Q77A 1QJCA 2BTEA 4ZCRA 3ZJUA 2YXNA 3KT6A 1IRXA 2WB2A 1J1ZA 1S4MA 4J75A 3E27A 1WXEA 1OWLA 1O97C 2X3FA 4R0NA 2I1LA 1WOYA 2RD2A 5TGTA 3RK1A 1H1TA 5DB4A 4MW4A 1OWNA 3K32A 4CDMA 1T9GR 3OP1A 3A4IA 3QTTA 5H7XA 4KPUB 2A86A 1J70A 2JAXA 4X0EA 3IOBA 4MWDA 3FDXA 3P0HA 3LCJA 1G8FA 2HGZA 1IQRA 2J09A 4ZCTA 4KKVA 4MUHA 3CVVA 3HFJA 3ZJVA 2GOYA 1IHOA 1IH8A 3ND6A 1EFVB 4ZCPA 3N8HA 2E0IA 4NAUA 4UZFA 1R6XA 2QUKA 1OWOA 3FNRA 3MLBA 4MW5A 4R2MA 3A04A 3COZA 3SZ3A 1QRSA 4EFKA 3AFHA 4YP5A 1IFXA 2E21A 3CLSD 1SURA 4U63A 2A1UA 3P52A 4MW0A 2TS1A 3PNYA 4MW9A 1M83A 3GLVA 4ZT5A 2CV2A 3ZGZA 3UK2A 3ZUGA 3GMIA 2IELA 3HZRA 4MUJA 1JECA 1NURA 2A88A 3IMCA 1M8PA 4DDKA 2Z3VA 1Q11A 3FG9A 3N2YA 4MW7A 3SZGA 3SEZA 4DJAA 1P7PA 3Q12A 5TEWA 1QRTA 2DERA 3N05A 3CVXA 4RUKA 2ZUEA 4MWBA 1J21A 1I6LA 1LI5A 4H3SA 1TYCA 1T9GS 4F4HA 1I6KA 1ILEA 1EFPB 1XJQA 1KH1A 2V0GA 1BS2A 1GZUA 1K4KA 1X8XA 2J5BA 2X1LA 3FH0A 1O0CA 1JEDA 3G6KA 3H9CA 1QRUA 1VBMA 2V0CA 1MB2A 1B6TA 1KP2A 3SDBA 2G36A 4AQ7A 1OBCA 1T6YA 3F3MA 1O5TA 3H9BA 4MUGA 1KP3A 5F23A 1KAQA 5JBNA 1JMVA 3I05A 2E89A 3PNVA 2H29A 1PG2A 1YIAA 3FOCA 2PZ8A 3SYTA 4YBRA 4YMIA 1WXGA 2YY5A 3IOCA 2B7LA 2GM3A 3COVA 4MW1A 4JFAA 2XRZA 1GN8A 2J08A 3IMGA 3X1JA 4DE5A 1U7XA 3CLSC 1QTQA 1WXFA 3FI0A 4JYZA 1J09A 5DEOA 3IH5A 3FY4A 2R5WA 3D6UA 2AKEA 1PFWA 1JIJA 3CLUD 1GAXA 4PBSA 1GTRA 4ZT7A 1WQ4A 4FZJA 2AG6A 4DNXA 5KWVA 3KT8A 2QJFA 2CV1A 1EE1A 1JILA 3A05A 2CYBA 1Q15A 3NV7A 3TNJA 5LFAA 4L2IA 2VTBB 4CDNA 1T6ZA 1TQ8A 2YWBA 1I2DA 4A91A 4GU5A 3BL5A 1JEEA 3GUZA 4ZT3A 4RPIA 2OV4A 2QTMA 2ZP1A 5LM3A 1V47A 4ND6A 3MUEA 1KR2A 3DLAA 3FWKA 1M1ZA 5H16A 3U1VA 4AS1A 3Q10A 4MUKA 2AZXA 3S3TA 1A8HA 1KH3A 3G59A 1O96A 5FO1A 3OTWA 2RE8A 4F3RA 4EG1A 1K4MA 3ELBA 1K97A 3IVGA 2D13A 4ARCA 5KHAA 4QREA 1KQOA 1VBNA 1YUNA 4MW2A 2CT8A 4KR7A 2NZ2A 4DDHA 5HUHA 3L93A 3AG5A 2VXOA 3ZXIA 1N2BA 1OD6A 5BNZA 3KT0A 3KT3A 1F7UA 1NYLA 4P2BA 3UMVA 4EG3A 2PFSA 4MVCA 1J20A 3N9IA 4YP7A 5IJXA 5DK4A 4E1AA 3CVWA 1KAMA 1EXDA 3RHSA 3TS1A 1PFUA 1N1DA 3CLUC 4EF6A 1NP7A 2WQ6A 1DNPA 1F9AA 4U7JA 1IQUA 3KFLA 4J76A 4HK4A 1N2HA 1N77A 2QJTA 1QU3A 1WKBA 2DUMA 4ZCSA 1XNHA 2PG3A 1N75A 1OBHA 2CSXA 2CYAA 1YUMA 4MULA 3ZJTA 5K0SA 2QTRA 3ND7A 3ILVA 4I6JA 2HMAA 1EUYA 2CV0A 1M8GA 2QUIA 4PBTA 5AHWA 4G6ZA 1CT9A 1H3NA 5IHXA 3TZLA 1WQ3A 1F4LA 1PG0A 3UY4A 1U3CA 2X1MA 1O94C 3PRHA 4ND7A 3UC5A 1MC1A 3G5AA 4NX2A 2A7XA 1N3LA 1OWMA 4MUEA 1PFVA 1NUPA 1TEZA 5HG0A 3D6VA 3IOEA 1U7DA 1K92A 2Z08A 1WXHA 4KPUA 4MUNA 3L92A 3HMQA 3HV0A 4NDAA 1V8FA 1N2EA 2OQ2A 1XNJA 4OJMX 2WSIA 4G5FA 5DASA 2ZUFA 3MLAA 4EG5A 2YWCA 1M8JA 2DXIA 1EFVA 2A1UB 3M5WA 3FETA 4JZYA 2O8VA 4ZT6A 4MWCA 4XFJA 4I6EA 3FIUA 4HJRA 1ZH6A 3CLTD 3JXEA 4I6GA 5J59A 3AL0C 4U8HA 3QE4A 4YP6A 3MMXA 1ZJWA 1M8KA 4MVYA 3LE8A 2QJOA 1COZA 3CVUA 3UOWA 3FHJA 2BYTA 4NATA 3QTBA 2D5BA 3ND5A 5FO0A 3VRHA 2QTNA 3ZXSA 1X6VA 1Y42X 1KQNA 1JGTA 1VL2A 3COYA 4QRDA 1G8HA 3LOQA 1KORA 1U0BB 3NBKA 3COWA 2CUZA 2DPLA 1MJHA 2O5RA 4MWEA 5K0TA 2JA2A 2DETA 3IVXA 1JIKA 4Q16A 1G59A 2EL7A 1O94D 2A1TR 1KQPA 3ZIUA 3IUEA 3C8ZA 1ZH0A 4KR9A 4EGAA 2H2AA 1N2IA 4K03A 3IVCA 1GPMA 3AKZA 4EG6A 1YULA 1EFPA 3PXUA 1IVSA 1N2JA 5KCMA 3SP1A 1N2GA 3TZEA 5FNZA 1EUQA 2E18A 2PXHA 4DLPA 1T6XA 2A4MA 3AG6A 3CLRD 4EG4A 2HZ7A 2QUJA 3IDFA 3RFFA 1NUQA 3MXTA 3RBAA 3CVYA 3PNBA 3IMEA 2Z09A 4MVWA 3SEQA 3VGJA 1O6BA 3RJZA 1I6MA 1NSYA 4DDMA 3DV2A 4OUDB 1KKUA 2DR2A 1MBZA 4PBRA 3RK0A 1F7VA 1FFYA 1KH2A 4NZPA 1JZQA 1N78A 1R6UA 3CLTC 1UFVA 1MAUA 1IQ0A 3VU8A 1H3FA 1NUSA 4MVXA 2J4DA 1NZJA 3H05A 1FYDA 1M8FA 4MLPA 4R2LA 1O95D 1NI5A 3CR8A 1WJGA 3HL4A 4L2IB
chains in the Genus database with same CATH superfamily
3HBAA 3AUKA 3OC6A 3C48A 4QYIB 1JKJA 2HCFA 2FKNA 4G3XA 1S4QA 1PLJA 4J16C 5FYQA 4D74A 2WHEA 1H3EA 2OQIA 4ZAXA 3OIYA 3GRYA 2C2HA 5BV8A 1QR6A 2GEJA 1FLDA 2CFRA 3JQEA 3WDKA 4LSGA 2CVQA 3M3DA 4IHAA 3OURA 1UBCA 1W5FA 2QX7A 3BIXA 3IRUA 3U4QB 1PR5A 1J2JA 2VBGA 3RO7A 1IL0A 4N5LA 3IA2A 2IU3A 4YRJA 2G76A 4YAKA 4Z51A 1AN9A 4A6XA 3ANSA 3FOBA 4HWPA 5I51A 1SCNE 1H2BA 3ZR4B 3ZBTA 3DOHA 3C5CA 1PTJC 1L5LA 3N39C 4GPAA 3HCBA 3R0QA 3NOVA 3A4NA 4S2EA 1GKUB 1HQDA 4KR6A 5IWAB 1C81A 4PNEA 4R1QA 2PN1A 5IFKA 4HPWA 3LQFA 1VMIA 2PS0A 1RWWA 4KX3A 3LCCA 4TVOA 2IY9A 3GC6A 2GD6A 3SEFA 2CL0X 3WJ1A 4A0GA 4BP9A 4LRQA 3NRCA 1WZ2A 1UMBA 3NDBB 3TJMA 4YFVA 1Q84A 4CPDA 2DFPA 2QORA 3K4PA 1S7CA 4ZOLF 4OLBA 3L6RA 2ZLBA 4B8ZA 4D57A 4CV1A 1NT2A 2MHCA 2YBEA 3H97A 4XRRA 1SA0B 2YVLA 4MQMA 1FMLA 2VK8A 3UG7A 1KYYA 3ILHA 3LKVA 4CI9A 1AD2A 3NWEA 4LNUA 4NBVA 1PWHA 1EHIA 3EH2A 3A31A 3TL2A 3T5BA 4AROA 3HA7A 4CKEA 1G8KA 4BO6A 1UJBA 1GGJA 1Q0SA 2GKSA 4C6HA 2QN9A 1ZH8A 4TYNA 4FR5A 4JLSA 4OXKA 3B6IA 5D00A 4LOIA 5ED0A 5CT8A 3AFOA 3GFRA 2Q3CA 3QE0A 4EAAA 4CEIB 5EOVA 1EK1A 4D9BA 1N9GA 1PS9A 4E2YA 4AO8A 5EY5B 2AFIE 3WVNA 2REQB 4OHZA 1E63A 3W2HA 4ENRA 4CMBA 2C54A 1L4FA 3IDQA 4R8MA 1JIXA 1QFJA 4GI7A 2HH9A 3H6KA 3EGXA 4P5DA 4YJ2F 1WSDA 1JXAA 1P4AA 1XEFA 3KKZA 1JUDA 1PZHA 4K9KA 4DCMA 3DOJA 5IXSA 4K6MA 1KTVA 1NV8A 2CXOA 3EBOA 4HDQB 1GCOA 3QBEA 1U3WA 2H1HA 5DISB 5FWXA 2G88A 3JZDA 4GT1A 4ZN6A 4US2R 3THXA 2Z3WA 3EQ6A 4B9EA 2I62A 4X41A 4U7TB 5FUBA 1NL3A 1YB6A 3BM5A 5D5HA 2OCYC 2GR8A 2BI8A 3JQBC 5C2JB 2BFOA 2PLNA 1OH5A 2IOHA 2W48A 5HK9A 1SCAA 4OG2A 4WKOA 5IZCA 2Y99A 2WPNA 3L8ZA 4JFRA 3THRA 1HYGA 3SSAA 3EQZA 3GLHA 3GCWA 2JHCA 3NTUA 3IB3A 2Y4NA 3QWHA 5KYGA 1KAGA 2O2ZA 3AKEA 4RULA 3ADOA 2JEOA 1I4OA 2B36A 2EX1A 4DSTA 2X9GA 1ICIA 3PFKA 5L6LB 2YR0A 3PWKA 1W9HA 5IWCA 3IUPA 4MGHA 1MG5A 5JRJA 2JVKA 3PUZA 5KYXA 2NXCA 3LLUA 4O1IA 4AVYA 4TZKA 1WB4A 4AY6A 2C9YA 1ODIA 3FSJX 4PZYA 1C0IA 4MX8A 4AB1A 3PQ6A 4N41A 1IPHA 2G9ZA 1Q20A 1X7HA 2GOYA 1IHOA 4IYJA 3ZK8A 4TVSA 1E2MA 2NSJA 3DYIA 4HEQA 3F73A 1T5DX 1A5BB 1GU0A 2V7QA 4MKGA 2FZ4A 3MC1A 4P7BA 5ALGA 4WBNB 2P9YA 1ZD9A 2VNSA 3GRAA 4D97A 3INRA 3MBKA 4KYIB 3C6YA 3A9RA 4IOMA 3H8SA 1LX7A 2AFIB 5JSYA 3SFVA 4FQ8A 2TMKA 3JYQA 1IK4A 1IFXA 4W1RA 4N3AA 1C7JA 1NNLA 3EMKA 2A5DA 3EQ9A 1TXGA 2PX8A 5DM4A 1ZVVA 3B3FA 5CK5A 4YUZA 3ZY6A 3D4IA 1NLMA 3GCGA 3T4UA 4EHIA 1P2FA 2JARA 4RZXA 5CVTA 5KKNB 2HU7A 3QE2A 2NTEA 4MS1A 4C3ZA 2HTFA 2IELA 2VBIA 3I34X 3UVEA 2JH9A 2W6ID 1IN7A 3RARA 5FPTA 4F4UA 1TQ2A 1L4MA 3I72A 3MRXA 4H17A 3H1BA 4NBTA 4AMYA 2J85A 4PZUA 1Z5PA 3CRRA 1YQWA 5IF3A 3MWEA 1D04A 4QSMA 5CK4A 1J07A 2VQ3A 3OY7A 1T9BA 3DLIA 3BSSA 3KK0A 4HGQA 1X74A 4ZWNA 1VLMA 5LA6F 2XZDA 3R5HA 3CVXA 4BJ6A 1QGUB 1S5PA 4TMKA 4NCBA 4D92A 1A95A 4P0PB 1KI1A 1SXIA 4ML3A 1Y7IA 1FYVA 2YMLA 1WULS 2QL5A 4K88A 3OBIA 2F8LA 2X8LA 5GV8A 2ZUWA 2VSOA 3H8WA 4HHEA 3T5MA 3TQFA 5BSGA 5JBIA 2SKDA 4OMDA 1ILEA 1NVMB 1XJQA 2OO5C 2XLCA 3C2QA 4LISA 3L79A 3AIOA 3HVHA 2J59A 3SSNA 2ZIXA 4GOLD 3N6XA 4O1MA 3X1ZA 1A7UA 1TLTA 2I2DA 2I7XA 3REQB 3TQHA 2Q45A 1XQ1A 1UM9B 5FOWA 3FFWA 4JS0A 4GR9A 2YVKA 1VE6A 3ELWA 3EWSA 1TA0A 4WKGA 3FYCA 4HVLA 1CQXA 3SDBA 4GZMA 5B3KA 1K8RA 3ZWPA 3AUSA 4O0LA 3OLZA 2ZE8A 5BW0B 1RKQA 1BXGB 1WKCA 3A6PC 3I0ZA 3K2QA 2UYOA 3VTFA 1QCDA 1ZH4A 2J0UB 2J3HA 2H29A 1NMZA 4Q3DA 1YIAA 4R31A 2GEVA 3VVMA 5A5EA 4JI7B 3AFIA 4KMMA 3OICA 1YVRA 4X95A 1LZKA 4I4CA 3WYAA 4BNHA 3BORA 3IOCA 4R83A 5JYEA 1G60A 2J08A 4QPJC 4C4OA 1R1DA 3DM5A 3HZOA 5JJBA 1DQRA 1P44A 3JWIA 2A9JA 3N8GA 5EUQB 4LHYA 2XPCA 2OLEA 3SY8A 1QHEA 2P30A 2O7QA 3RNOA 3V2IA 1XEXA 4OOFA 1V6AA 5LQSA 3W4IA 1M7HA 2D6FA 1DIHA 1LVGA 1XLVA 4EDFA 2B99A 2PSFA 4HTFA 5DX8A 5FUQA 2GN0A 2N75A 3CZMA 1L8OA 1Z4LA 3FB1A 4ASUD 5JS7A 3DMHA 4Q3BA 1ZFNA 3JAWB 2PRJA 5EGNA 1VQ1A 3VOAA 3T3IA 5A5GA 3ODGA 1CQZA 5B4UA 5BYAA 5IVKA 4PRZA 1Y7TA 4HB2A 5FPPA 1NIJA 3BDAA 3CZPA 3HDTA 3L6OO 4L7QA 2NN3C 3L05A 4UTPA 2RH9B 2WU4A 3LQ1A 2G1JA 3BMOB 5HP4A 1Y6RA 3KVYA 2E4WA 4N47A 1H22A 1Q0RA 3E1KA 1VP9A 3AHHA 5COQA 2JFNA 3ROQA 2JGDB 4UXHA 1WZUA 2ERXA 1V8PA 3NT5A 3OKFA 1GU1A 4BKOA 4R40A 4D0NA 2V7TA 2YYAA 4HQ6A 5AKXA 1L7MA 2ASEA 1MKYA 4UM7A 2ZRHA 4LPSA 5HBGA 2ADOA 1QVRA 1Z5WA 4CTMA 4PGFA 3SR0A 1BDHA 3ASUA 2I3GA 1JEAA 3OWXA 1EINA 3HR8A 4IIHA 2ZBRA 3K1TA 5CIWA 3GARA 3VSBA 5LQAA 1OB2A 1VLZA 2WP0A 2DWOA 1ES9A 1PU2A 3T9EA 3ZTYA 1SMKA 3GH3A 5JZBA 4XGKA 5LYJF 3G5TA 1FIUA 3QELA 3JWHA 2QG6A 1NYTA 2JHGA 4AO6A 2Y2UA 4FNMA 3VZBA 1C30A 2OESA 1BJKA 3MJEA 2EOAA 3N07A 4R1MA 4DCSA 1UWLA 2F43B 3D6HA 3QU2A 3TR0A 1P80A 1E2PA 2BTQB 3CC8A 3OQBA 3BWVA 1UBHS 2IYXA 4ARZA 4BO8A 5JZMA 3STTA 3OOJA 5FX2A 3AG5A 2YY6A 1L8XA 4PV7A 5TVKA 3VDRA 5T4FA 4EABA 5JYBA 4QU0A 4CHGA 5KCZA 1MZPA 3A8TA 2C2WA 1AQ6A 1LDMA 1RRFA 4NF2A 3E5RA 2PNJA 1DKQA 3FVRA 4JVOA 2CXNA 2II6A 3FUUA 4PGMA 2FFQA 1L5KA 2HQSA 2YH2A 3OBBA 3VPBA 2BHRA 3M6IA 3NIBA 3VH3A 4E1AA 5HKAA 5L51A 4OREX 4QNMA 1A50B 1OFHA 3D0QA 4LK3A 5TMDA 5JSZA 1F6WA 3LBIA 1VKHA 2H7XA 3RU2A 3OEEA 1JEJA 3SVLA 2A9KA 3H5IA 1KI8A 2YC4C 4QQ8A 1XFDA 4U7FA 1L5SA 5JVDA 4AKHA 1V3UA 4EG0A 5KAMA 3HG7A 1H6BA 1IBKB 3LUKA 3U0BA 4UBKA 2WWRA 4MUAA 3SHTA 3P27A 2XB8A 2O05A 2B2NA 5AW5A 1A71A 1YFKA 1GXSA 1TW3A 1UJ2A 2WKSA 2XJ9A 3DUFB 3KHTA 1ZS9A 4MAMA 2W71A 1XZBA 3AJ9A 3OTQA 4ZD6A 1EG2A 1R4MA 3W8FA 4E2FA 4TS3A 2R66A 3ZZ0A 3THWB 5FV7A 3LBFA 2IUUA 4RVSA 1M8GA 1BGVA 3RJMA 1FP1D 1GSHA 1PEDA 2ZJOA 2QW0X 4J6FA 5I5EA 3M70A 2FFAA 3HVKA 1OLXB 3DEZA 1Z5UA 3VO1A 1CT9A 2Q9AA 5KUTA 4N0PA 2IIBA 1YL7A 3G2OA 1A9XA 3ZH2A 2YHUA 3K53A 2X2OA 5DXFA 4BGEA 3G88A 3VUEA 3HBLA 4CIWA 1NW5A 3GELA 1BMDA 5KB3A 3FOFC 1OE0A 3D81A 3JQ9A 4OAOA 4OEHA 5AI8A 3LL7A 1E5VA 4RKYA 5LZ8A 4CV2A 5B1EA 1C29B 1MC1A 5JPDA 2HEIA 4A9AA 1EE9A 4NX2A 2VJAA 2XNKA 1W36D 1K5GA 1SZDA 2I6UA 1BE8A 2CXQA 2QT1A 5AO9A 4E7OA 4D6YA 2V7WA 1N3LA 2VC2B 2G1PA 2O54A 1I2CA 2PMKA 4KC0A 2ADFA 2GYUA 5E4YA 1PJRA 2JC3A 3IDOA 2XYQA 5AK6A 5B55A 3JD0A 1W4LA 3A6HA 3B1FA 3GZNA 2OGFA 1Q95A 4LMAA 3SDZA 3MD9A 4IZOA 4ETNA 1J5PA 5EXXA 1PCXA 1PZXA 5ESWA 4INAA 4FE4A 4L7VA 4QYXA 5DASA 3CBQA 1COWA 2R5FA 4QOHA 4EZEA 5LUBA 2BRUC 2PTGA 3HWWA 1E6UA 1PD0A 2CL6X 2JAPA 1SHZA 1TM4E 1QF7A 1RR6A 3ZU2A 1RXWA 2BGWA 2HYDA 4Q19A 2WUGA 1Y48E 2XWBF 3HCPA 3E23A 4RY0A 3UWMA 3C6MA 4MPJA 3ONWA 2C03A 5J59A 1Z35A 3VHLB 1ZUWA 4D3YA 2RHBA 2D62A 2WDZA 5EXSA 3MMXA 3ACDA 3WDMA 3GLGA 1LRKA 2CXUA 3V7YA 4Z8YA 2CUKA 3Q2OA 4FX2A 3CF2A 3DW1X 3B78A 3HJTA 4J0IA 1P5ZB 4EFDA 2FZEA 1OR8A 4PG8A 5C46F 1SUEA 1UMKA 3F67A 1J8FA 3D8SA 1YXMA 4DREA 1JTEA 1Y42X 3HL0A 4Z6KA 2O07A 4HVTA 2GHIA 2OCLA 1YVDA 2Z5VA 2VTEA 5FA5A 5J4LA 4B5LA 3WXBA 3T3OA 2DJ5A 1IY9A 1F5SA 4XVUA 3L8EA 3ZTTA 2ZZMA 1K6JA 3I5YA 1R9JA 4HLUC 3EZ9A 4BNYA 4KODA 1GO2A 5ALRA 4CN9A 6YASA 3FKSD 2EL7A 4Y9RA 16PKA 1KQPA 3IUEA 2GBPA 3USZA 3WQSB 2O50A 1G7SA 4EHJA 1GT6A 3EOBI 3OOEA 1I7SB 4ALIA 2JASA 2EBUA 4MV8A 1N92A 2FA9A 4LWPA 2NUAB 3RVKA 2QROA 1YULA 2LMEA 1LJLA 1U9JA 3B70A 3AF0A 4GRDA 4CL8A 1ZKMA 4CRWB 3ZCQA 2BKXA 2JDIA 3AHIA 4FBLA 4OSPA 1WNFA 4EYOA 3PD0A 4ZCMA 4LJ4A 3RF7A 3SS8A 4JBXA 2VPQA 4FR2A 4AMVA 3R7WA 3U5TA 1Q3TA 1XU4A 1FSSA 1BHJA 1CE8B 3CLRD 3CRZA 3DJYA 1LSSA 2HMUA 4CL3A 1U99A 2BEUB 5B3LA 1GL6A 2BFEB 1TU4A 1WAMA 4PNHA 3IDFA 4C6TB 2YFQA 3O92A 4EPYA 3RC8A 4HAIA 3U3XA 2R85A 3KTFA 4GUAA 6GPBA 3V5NA 2MINB 3LUJA 4V39A 3VDNB 3ZCUA 3BKXA 2ICAA 2GNPA 1LD3A 3FUVA 4GMDA 3UBMA 4C4SA 4DPKA 2J3LA 1ZLXA 5HM6A 2A30A 4FQ7A 3UGKA 3ZHYA 7YASA 3TTXA 1FFYA 1QB7A 3SLRA 4DLNA 2P9FA 2VKTA 2CFIA 2V5VA 2IYPA 3K92A 1D4AA 3V1MA 4F6RB 1ZC3A 3W0LB 3GLSA 1IN8A 1HV8A 2FW1A 2P11A 2WB4A 4WCFB 3AEKB 3PFBA 3PUVA 4F9EA 1AUOA 3WYNA 3UW1A 1LV8A 3FGPA 1YRBA 2JGIA 3Q1KA 3RYFA 3WNDA 1AXEA 2EYUA 4JBNA 2QZSA 2VXCA 1L4HA 3E5NA 2TYSB 4MK4A 3K30A 1D2RA 4EY6A 4WBNF 3FNHA 3BN3A 1BU5A 2O0LA 2V65A 3PENA 1M74A 3UYLA 1V6CA 1ZJ6A 2VF8A 3PEWA 3ABSB 3D0RA 4YLGA 2ZAYA 3LA8A 2X41A 1XDUA 3PGA1 4R6XA 5H9VA 2RMKA 1S2GA 4XPIB 2OBFA 4G4SO 3JV7A 2O57A 4WE3A 1OFIA 4PYRA 4RTNA 2FHSA 5TIIA 5F5XA 1R10A 4HWSA 1DKMA 2L69A 3V7WA 5JH7B 2DTEA 1GCAA 4EB3A 4F93B 1AKWA 1NQUA 2PS9A 1FW6A 3FOEC 3ICEA 1X0XA 5G02A 4B6GA 3BTOA 3F4LA 1TJPB 3P0FA 4J8PA 3ZH9B 4C0KA 4ZJUA 2QN3A 4MOWA 2ZG6A 2B6HA 4DSAA 4FFRA 4B6PA 3V8PA 4JSRA 3UYKA 5JLAA 2JNWA 2YJ5A 2QLMA 4MHOA 3VPCA 4EH1A 2A6PA 2BM9A 2DQSA 3DMTA 3DGEC 3HJUA 2QQ5A 4KXNA 3K71B 2HJVA 2HRZA 3MSCA 2HQ1A 4I99A 1FOEB 4LRWA 4M1SA 2O8EA 3ZEIA 1KF0A 3AOEC 2F90A 4GZLA 5IH7A 2IJGX 2ZI5A 3VOSA 2BD0A 2O2GA 3SHWA 3UIEA 4QPDA 3C1TA 5J58A 1NJFA 4A5OA 3ZZ1A 1S6YA 1O6ZA 3T7EA 3H7AA 2G80A 3OT5A 1JQ5A 1DT3A 4AYTA 4JBGA 1NW7A 2CHFA 2O3JA 1P4RA 4JDPA 5DWDA 4WJLA 5KKAA 1RJFA 2PWZA 3EJWA 1JU3A 4MEAA 2IRWA 4XSVA 4BN0A 4DIFA 1MC4A 4ZVPA 1ARZA 1LFDB 4F3TA 1ODCA 4Z9XA 1ZHOA 4UD2A 2GKGA 4GNKA 2QI9C 3WL4A 3O90A 4XIFA 1PQYA 1B42A 1DRWA 4JMLA 1MOPA 4JB8A 2R1TB 1EHYA 1K63A 3D6TB 3T0FA 4CL2A 4WY5A 1QKJA 3ER9A 4HH0A 3WJ7A 5IABA 1J25A 2EFCB 1QF9A 4Q3OA 5GMOA 1TAHA 2BSXA 3JD1A 4BQOA 5DNUA 1LBQA 3IL2A 3BQNB 3NT4A 5DXJA 2V4MA 5EKSA 1T8TA 1GVNB 1TZMA 2J8ZA 3LF2A 1GYPA 1IZ9A 2PD6A 1P7YA 4JQCA 3AU9A 4RHTA 4ZVRA 2N1MA 3A1FA 5CFZA 2IHVA 4OSEA 1ULAA 5THXA 1T5HX 2GJ4A 4ZRMA 4G09A 4RY2A 1E1RD 2YFHA 4AWXA 1J49A 2PT7A 1A77A 4K0RA 4LC9A 1NXSA 5AUNB 1YU6A 2IXDA 1U98A 5BR8B 3BSWA 1Y9JA 3NWOA 3MWKA 4FDTA 2X1VA 3L4SO 5K6AA 3AI7A 3N2ZB 4FGZA 4A2PA 2PPLA 8ADHA 4H6WA 2G82A 1XFAA 2I6FA 5HE9A 1VJCA 3EIQA 3A25A 1EGQA 4L5YA 5IP5A 1FFEA 3P2IA 1T1EA 1JR2A 3PLNA 4JC5A 1V7ZA 3BQ9A 3PTZA 4G25A 4EAQA 1SD5A 3G79A 3RSQA 1BX0A 4L16A 4AMZA 2Y4OA 3NHUA 4OQYA 2VPPA 5TGTA 3VHXB 5C3MA 2IUTA 4D98A 3GJRA 2IQ5A 3CR7A 3QKSB 4WZBE 4QUHA 2YV3A 3I42A 1PNVA 4NOKA 2Y68A 4ID9A 2PV0A 5F3RA 3VSEA 4CM9D 2HI0A 3GQVA 1KY5A 3BHIA 1NN5A 1H6AA 3B6MA 2YC2C 3QZUA 1IHDA 5LN1A 3OQMA 2KPOA 5JV5A 3G0CA 4U9IS 2OZVA 3HB9A 3KQOA 3BXFA 2FSSA 4QVKA 3C45A 4DBZA 4MUHA 2XOXA 3HFJA 1FX0B 1GFWA 1U8EA 1JYFA 4WESA 3RTGA 1A4UA 3WRXC 1BXRA 3OOSA 821PA 1JMKC 1M0SA 2NADA 2AFVA 2FX5A 3NHZA 4E88A 1U0SY 1RNLA 4YMVA 2XQFA 3DBVO 3O4GA 3PVZA 2NVUB 4WCDA 3ZPXA 3ZQUA 2PVCA 4RJIA 3ZQ4A 4YJHB 2JI9A 3W5BA 4DCOA 3GFPA 2M9MA 3GRCA 4JOQA 1QGYA 4IJKA 4OBEA 1GCIA 2FG7C 2ODAA 2VJOA 3QV1A 4Y3UA 2HA5A 4HNAB 3DEHA 4MA0A 3JR7A 2ZROA 3TMAA 3TBKA 4MEJA 2PJZA 4MUJA 1K3FA 4ZO8A 4ABYA 4YGXB 4S04A 4LEIA 4UHBA 2A88A 1LRJA 3FA2A 1XXLA 2VJNA 3FUWA 5DWVA 3X43A 3G02A 5EXDA 3AETB 1WB6A 3FG9A 1CQPA 1SBQA 3IIIA 5TGZA 1CNMA 3ILSA 3QMVA 3TAUA 4FI3F 4XQGA 1JJAA 2XYPA 2NSLA 1EESA 2F9LA 2AKAB 2AJLI 3A7DA 5KSPA 4WZBB 4AMBA 5HGJA 2GJ9A 4BKUA 5SV2A 2GZ2A 4JIGA 1YE5A 4LYJA 1OTXA 2O2YA 5EXEA 2YXLA 1UXHA 3E48A 1CJBA 4RF2A 3WE7A 4DBVO 5I5GA 3WGKA 3GJ5A 1NY5A 1PS8A 1C7RA 3N3BC 3JQ8A 1WL8A 3AERB 5IMBA 5A71A 3L2OB 4L72A 1RCTE 1JLKA 2Q9UA 4DJ5X 3GCZA 2QRVB 4CIAA 5FTLA 3LLMA 2XZPA 1OBFO 4IUBS 2OCXA 1AX9A 1L9XA 1WMSA 2HD4A 3T7DA 3VR2D 1TPZA 3GAZA 1E9AA 3HU1A 1T6YA 3G5UA 5KPJA 5KNLA 5L3VA 1A76A 5LYJA 3NUZA 2NW6A 5JNLA 4HDKA 4WLFA 3WI7A 3I05A 3OLVA 3LFHA 4FWIB 2LBPA 3WJ2A 2GJ8A 1SVOA 4D8UA 3E0XA 3PC6A 2MSNA 2WMDA 1ZAKA 2RKWA 4Z9AA 4DPMA 3IT1A 1P6QA 3IS3A 1CJMA 1P2DA 2YY5A 5CPFA 4MW1A 2V7PA 4G0MA 3LHFA 5CVJA 4B9AA 2FF7A 3PT5A 1CQIA 1TF5A 1EFKA 1TT7A 2LUOA 4UKDA 1CUCA 4C2AA 3L8FA 3RODA 3DCYA 4N6GA 4ALJA 4YWHA 3IH5A 1T43A 2DPGA 2GZMA 3C1UA 3ADKA 2H9AA 5I7WA 3O8NA 5DTIA 4PSCA 2EZ4A 4DS3A 4KV9A 4HRYA 4LGCA 3I1FA 4L0QA 3L0YA 1HPLA 2G5CA 4C4TA 1K1EA 1O4WA 1E6MA 1S9HA 4PBSA 3UUWA 3Q1LA 3K9QO 1F4PA 3PDUA 2Q5QA 3RWMB 3E9RA 5EP4A 3RRZA 1YVUA 4AF8A 4YXFA 2CV1A 3N8IA 4ER5A 5ES4B 2HRRA 1W35A 2W58A 3B7WA 4CVNA 121PA 4QKQA 1WX1A 2VHYA 1OLUA 3BMNB 5B4VA 5K8VA 3BWEA 5JAQA 1XA4A 2I29A 2NV2B 4FYKA 2VNIA 4IIVA 1UJ4A 3DAGA 1XZFA 4OJTA 3UXMA 4RMHA 3TX6A 2QTLA 1ZM9A 1K08A 1G2QA 1M2OB 3AI2A 4IBOA 4GECA 4LWQA 4E5NA 5HOQA 2OP1A 4WL0A 2GF0A 2V4UA 3ZCXA 3BKWA 3SK0A 2ZYTX 5LNK6 4UUMA 4AG6A 1CS0B 5J1TB 2UYQA 3CKLA 3JAKB 3FWKA 1M5RA 2WHPA 2XEDA 2XQIA 2O8CA 3MSXA 4UOQA 1O08A 3VTAA 4CMGA 3DDZX 4ZJYA 3DKPA 5D5PA 4DUPA 2A54A 2W6IA 1G6KA 3GXOA 3SEAA 3UMGA 5EJ2A 5EWJA 2H2GA 1XTUA 3Q6IA 1FSFA 4TMXA 1CUEA 1QO0D 2Q3BA 3KQYA 1M2NA 3PKZA 1T15A 4ZO7A 5ALXA 1FFAA 4BO2A 7GPBA 3EG9B 13PKA 4WZAE 2IZ1A 2K5UA 3NTQA 3I09A 2JLQA 2NT4A 2EKPA 2ZRNA 3JYOA 4A36A 1GKIA 5CVEA 1VKNA 4C03A 4IJVA 1OGIA 4YJFA 4G01B 3TLBA 2IBSA 2J3EA 3JQ7A 4DLXA 2ZYAA 5ANRB 5BNZA 3KT3A 4J0GA 1ZSNA 2BDTA 2CJXA 5EE1A 4D43A 5I6DA 3UMVA 1VRVA 4LF8B 2Z5GA 1LZLA 1QVVA 1YZFA 3D0KA 4A8TA 5B58C 3UAXA 3HK2A 4TV8F 5DEIA 2B98A 3G23A 5K3FA 1GLGA 3UHAA 3NU1A 1LVUA 5L3SA 1W30A 4IIYA 4MVJG 4TV9A 5F4ZA 3HSSA 1OFUX 3PC4A 4M21A 4H1TA 3K5HA 1XAJA 4RESA 3S29A 4FE3A 3ST7A 4EDHA 1P9OA 1I1QB 4OKIA 4V3BA 3ESZA 1KJYA 1L5HB 4QWMA 5ILGA 4EPVA 3ANLA 4BFXA 1KO8A 1PHPA 2N3ZA 1DJPA 1RPAA 4X6LA 4EB6B 3K0FA 4QGGA 1CS4C 4KFTA 1Z6QA 3OPQA 1FVOA 2WF8A 1O5IA 4CMAA 4V0MA 1U7HA 3J81k 2AUNA 1YUMA 3O4JA 1EGMB 2J9XB 1J22A 1XTBA 2QTRA 3M34A 3MD0A 2UZ4A 2HMAA 4XQEA 4O4LF 1EUYA 2OORA 4GP9A 4AUEA 4ALLA 4TLCA 2AVDA 4MRRA 2UVPB 1CJSA 1S2IA 1EDDA 3LOPA 4QHSA 4C0JA 5EZYB 1A5SB 4WX2B 2OKGA 3LP5A 5DM1A 2F00A 5DIFA 4DZRA 2P35A 4RD0A 2IHNA 5IHXA 3OFKA 1WQ3A 1DIGA 3FFAA 3BGOS 1HTBA 4WZAB 3CQ9A 5CAEB 1NM5C 1OY1A 3N2GA 3RVRA 3UY4A 3FSGD 5I9NA 3ENZA 3TCKA 4K28A 4ASUA 1D7AA 1Z16A 2GPSA 3KQTA 4CCYB 1XOIA 1G9TA 3QEAZ 4ROSA 1HX7A 2WDPA 1LI4A 3IPRA 3WC4A 4O2RA 1N1MA 2CNWD 4ZPJA 1PFVA 1ZK0A 5GZ1A 1NXOA 5HG0A 5DGTA 2OOSA 1B6RA 4ZVVA 4EY8A 2R1VA 3D1VA 3KZXA 5JH7F 1INLA 4AC9A 3PYXA 2ZJ5A 4KW7A 2HR1A 1IXKA 2C4WA 5TF0A 5EN4A 1TF2A 2E4UA 3EMDA 3DL2A 3EVTA 4Y1FA 3S7TA 4DMLA 5K2OA 1HI9A 1L1EA 1FP4A 2CXXA 2ZUFA 1IHXA 1VSUA 1B73A 2X2EA 3OE4A 4KO3S 1RPNA 4I8IA 4O08A 4C5CA 3GRRA 5IM5A 2J3JA 4EGQA 3RJ5A 4DLUA 2V8BA 5H8WA 4D9MA 3IV9A 1AMOA 3X2SA 1OXMA 1KNXA 3DJFA 3ONFA 4EUFA 1FQWA 2VPXA 4LZLA 3C39A 3MILA 1X80A 2I2FA 4R51A 4RSHA 5K1ZA 3D3WA 1CUYA 1TQ6A 3LBYA 3VNVA 3RASA 5FTNA 4BLSA 3TIGA 1GADO 5FWNA 2GVNA 4GI1A 4B2YA 5IYZA 5JISA 4D44A 5A02A 5CDUA 5JS1A 1D0VA 4I55A 2W6JD 3A0RB 1YCFA 3FHJA 3ZLTA 1QFXA 5HIAA 3VRHA 1WU8A 4OB7A 1UQTA 1JXOA 1FFXA 1MIHA 1RXEA 2ZBEA 4P3KA 1KQNA 2EQBA 4O3FA 1GY8A 4PINA 3VNQA 1GU7A 3PYMA 2H48A 1WCIB 4BNKA 3GJTA 4B3SB 4HS4A 1ZGHA 2O5RA 3C3AA 5CJ2A 5FBRB 4G0UA 3E7PA 4YASA 1SHTX 2JFQA 1Q1QA 2LKDA 2GN2A 3I64A 5K0TA 3LT1A 1JIKA 4RTLA 2AMLA 4G8DA 5KTOA 1FCJA 4LFBB 1AMUA 4JROA 1Z45A 4EEZA 4WXEA 2E4ZA 4OX9B 3TQRA 4F06A 1LTHR 1VCNA 2BH9A 2VK1A 2X8WA 5BRNA 2RKOA 5L8VA 1RKBA 2XUOA 2HPZA 2PNFA 3C3KA 3HWRA 3IT2A 4ZCSA 2BM1A 4V38A 1KZ7B 1JEQA 1LPAB 2XECA 3AKZA 4YHBA 1NI4A 1ZN9A 2PMFA 4DR3B 5CR9A 5ARDA 1H23A 5BW6B 3K35A 4OHRA 1Y8RA 4QFBA 2AF3C 1NW9B 1KOFA 1PR9A 1V5GA 2I65A 1ID1A 3VYRB 5A1JA 5JANA 1GG8A 2BWJA 4Q66C 2F62A 4WOKA 3RW9A 2CCGA 4HB3A 2HZ7A 5HQJA 2ZI7A 4RFSB 2OILA 5LP6A 2OZPA 4G2TA 1B4DA 4QNNA 4JL6A 5I47A 5AKGA 2Q4DA 3HKCA 4OFXA 3NLLA 3J80A 2VSFA 5F7JA 4F4CA 2L42A 4KQKA 4Z2YA 3UWSA 4HT3B 1MBZA 3EXEB 1F7VA 3R7AA 1GNVA 1D6JA 1G4HA 1Q7RA 3AZQA 3GA7A 3BWBA 2PMDA 1Y7PA 1T6NA 1M2FA 2RCNA 2W8BA 1J97A 3H86A 2FUCA 2ZR7A 5CDFE 3DB1A 2AW5A 4MPPA 1DAOA 3VU8A 4TOIA 4CV0A 2UXCB 2O8BB 3DTVB 4Q1EA 5LMUB 1C1DA 2RIPA 4P1ZA 1CQJA 2R6CA 1HZJA 3CX3A 3DV0A 3FMVA 1E96A 1UBRS 2V7EA 5AIBA 3KPYA 1SG0A 1WRBA 3C4VA 3W6NA 2ZIZA 4IDBA 4OFBA 3E7FA 4ISBA 4KLRA 1DRUA 3V1TC 3IGFA 3OX4A 1BHQ1 5ADUS 3I62A 4ZYWA 6NULA 4M55A 2BLNA 2XMCA 4DN6A 3RWBA 4PRKA 4I1RA 4OGFA 3NYQA 4N48A 2DH6A 4ACAA 1E4YA 1Y7LA 3CH6A 1WHSA 1LPPA 2H52A 2Q3LA 2X58A 3GFBA 4JOBA 3VX3A 4E51A 3ESAA 4EHFA 3IE0A 1JYEA 1NNSA 4H1VA 3TQIA 4G23A 4X64B 5HUJA 1YZQA 2VCYA 5ED4A 4DMKA 3OHPA 2ZI9A 2JKYA 4BNUA 2GAFA 1RWMA 1SU8A 4RJ2A 5LSAA 2ZVQX 5ERXA 2H63A 3QVMA 2FVYA 3GDGA 4K8RB 3MMPA 1KIMA 1WDTA 3ENKA 3HDGA 4QJ4A 5IX8A 1OF1A 1PWZA 1BRMA 2GNOA 2OK7A 3MBOA 4PC3A 1DBPA 5HQ3A 2GT1A 5JAOA 1QORA 2VZ9A 4L4SA 2RB5A 2ZPUA 4RD1A 3DHVA 4MKZA 3WKDA 5JTUA 3IP3A 1XQVA 4BBZA 2D5IA 5CA0A 3J81A 2F2TA 1E62A 1JR3D 1X7YB 1H6DA 1GPYA 3BMXA 4A6EA 3IKTA 3NMUF 3HVRA 3NB0A 1CQWA 1PT5A 2WK1A 3ETHA 4GMGA 2G6TA 4D9IA 4MVJF 4JLDA 5BSRA 1YTLA 3PCRB 3S68A 2O19A 1D2HA 1VM6A 3FKSA 1Z3IX 2DQKA 5DTMA 3UZUA 2C3PA 3V4FA 1GTG1 4QOGA 4MUIA 4I1PA 3ER8A 1RLMA 3FWYA 4CKYA 3OZCA 3AI1A 2ZB7A 1TTTA 2C5EA 1B0ZA 2GSDA 3KYJB 4W9NC 3W06A 3I6MA 5GONB 3Q8WA 3NBAA 1J5EB 3H99A 1NMQA 3ITNA 4IJ5A 4TX1A 1ZOPA 2GPTA 3TRJA 6CHYA 1O58A 1EJ6A 4KACA 1EUZA 1TFUA 5JMTA 4O59O 4IXJA 1V1RA 2UYCA 2YJTD 2A14A 1IZ0A 4QGHA 3BTUA 3NVDA 3WXMA 4DCUA 5AVYA 3EE6A 2CFOA 3WK7A 4BWVA 4DIKA 2ZYWX 2AMJA 3SNKA 4B34A 1ZICA 2Q1YA 4NH4A 5D85A 1R0CA 5EG5A 4EELA 1Z82A 3OESA 2F67A 4CEHA 3QI2A 3H1AA 3KFVA 4P7FA 5A9TA 2XWJI 2FH5B 3UJBA 3CNEA 3QFTA 1L5GB 2PA3A 4NG4A 1K66A 3C15C 3FWHA 5AM0A 4E09A 2BF7A 5JALA 1LPNA 1G8PA 3I1YA 1RM5A 1NR7A 4TL8A 1QJCA 2WVHA 1L4KA 3M6UA 4WK0B 2XTNA 2Z5LA 1JDVA 3LXUX 2JJ1A 1XDGA 2BKAA 4JH0A 1YI0A 2XZTA 3DH0A 3E7XA 2CDRA 3U4GA 4H1UA 4GLJA 1UOOA 3CEJA 1T1RA 2AI3A 3TLZA 2ZBVA 2CLOB 2ZAGA 4J0QA 4IP0A 4QDOA 3B6EA 1XV5A 1P5RA 4OHBA 4WLEA 5JD3A 2RHHA 4RC9A 3DAFA 5I7RA 4IXMA 3L4EA 3W9SA 3TPFA 1KI7A 3FDZA 4GF5A 3L6CA 3E53A 2HRBA 2IIQA 4HAZA 2GD1O 2PZGA 3DKIA 3GLIA 1F2TA 2JAXA 2OLKA 3C5HA 3PE3A 5LXTB 4PWYA 1E79D 2Q3DA 2I7DA 4Y9DA 4BO0A 3CTMA 3QEMA 1ZHFA 2IP4A 3LQ2A 3CRVA 3DZJA 4KKVA 2NZYA 4DV5B 4CHTA 4E94A 3RTDA 2ZSFA 1EFVB 1T2VA 1YR7A 5AVTA 1XB2A 1CB7A 2FAXA 3NH9A 4XR9A 5T4EA 1C7ZA 2PUDA 2GZ3A 3SFZA 3D2CA 3FVQA 1VHDA 3KL2A 1RRPA 5LYYA 1ADFA 1SIOA 2E21A 4K9PA 2PHZA 4G0VA 4PIPA 2E4XA 3W5HA 4TTTS 1TJNA 2E48A 1W46A 3MB5A 2PU5A 3Q3HA 4INOA 4UTXA 5FI3A 3UTDA 3H2YA 3K0BA 3ZD9A 5HUQA 5A5DA 1B3BA 3X1MA 4WZZA 2BFWA 4MW9A 3IDSA 2R6DA 4RSMA 2Y6UA 2YV4A 2OHGA 1AQYA 1MT0A 1W5SA 4LBWA 3E9MA 4FHFA 4BAUA 1CRLA 4IW3B 3UATA 3KCQA 4N5HX 4UFNA 3N2KB 3DMPA 1J00A 3JPYA 5HIKA 3LSTA 4IIFA 4PG4A 3WA6A 1BGXT 3EHEA 1MX1A 3OQVA 1HR0B 5IVHA 4DR5B 4MPTA 1E58A 3D8BA 1W0CA 4NFHA 4UBLA 5BUSA 2WKWA 1MDFA 1BAPA 4OP2A 2HK8A 4MQEA 1W5BA 2DP4E 1U8YA 4JLWA 5FUYA 1MAVA 4I1IA 3ZK9A 3C7CB 4ARSA 1USGA 4V3CA 2HPHA 3RVLA 1OSNA 3HA3A 1SK9A 4RUKA 3ZWYA 1FZQA 4ND8A 4GKAA 4MWBA 2ZIAA 3AHCA 5BV0A 1J21A 4ZXPA 1DS6A 2XDQA 4KGZA 4JLUA 4S1VA 5AH0A 1UM8A 2COEA 3PUYA 5CIQA 3SS9X 7MDHA 1G1AA 1PP4A 1EFPB 2Z58A 1GGMA 4OMFG 2AQIA 2WJIA 2DZDA 3OWHA 4OY3A 4UHHA 3OIGA 1XA3A 4PLZA 2JI4A 3IQXA 4RVUA 4A8JA 5B30A 3IP7A 1XNQB 5MFPA 4C76A 3KD3A 1EUDA 1QRUA 1E1RA 1G8JA 1Y9ZA 3S2SA 1O9GA 4XWWA 4GS5A 3OEYA 4O4IB 5E1OA 4AJEA 3UQZA 3KL4A 4I2VA 1DBVO 3ZWQA 2VO1A 2X6TA 4WCFC 4EVQA 3OCVA 5E1MA 5ABPA 1KBOA 3IR5A 4NOJA 5KINB 4FOTA 4IR7A 4H59A 1YJAA 4NMWA 5AI4A 3G68A 4QJBA 2BY4A 3L82B 4KWTA 1VI6A 2JLSA 5DNVA 3RFXA 2PGIA 4U7WA 2NU6B 5BSMA 1U02A 4BLUA 4NE9A 5TGDA 1GZ6A 4OKNA 3OZGA 5AOVA 1JFSA 3TTSA 4BJ3A 5C81A 3V3TA 4RTOA 1M34E 3E18A 1ELOA 3P5BA 5L3RA 3NVMB 1CUXA 3ROXA 3GEDA 4GQAA 1DPFA 1XRMA 3ZW8A 4WKBA 5TQ0B 2DKOA 1XE3A 1Q1ZA 4ER3A 3HO6A 4QTXA 3TRDA 4WJZA 2Q3JA 5DIZA 4ENTA 1PFWA 2OZEA 2P2DA 2J7PD 4M1EA 3H11A 3O8OB 3D6JA 1CG6A 4IQFA 4NHEA 2CMGA 4TLDA 4M6WA 3KVNA 3RVQA 3LVRE 3C74A 2B5OA 3H2GA 2ONJA 4XX1A 1E8DA 1RZUA 3A9UA 3ZWWA 1UKEA 4HMQA 3QVGA 2P8JA 5CXQA 3CB2A 3QX8A 1FMTA 1KYWA 3DR3A 3ZX5A 3HB4X 1CUVA 1UFQA 2WFMA 1N9ZA 3K0EA 1JBEA 1Q17A 3V32A 4JITA 1NN0A 1C7QA 1UPXA 3BIWA 3OLCX 5F9MA 4AZ0B 1ZCJA 1X1BA 3IPAA 4S1TA 1KY2A 5HF8A 4LF5B 1Q57A 3SKVA 4YRQA 4IIJF 4HQ0A 3MUEA 4TT8A 4TVKA 3LPDA 1PQPA 1X1RA 3X2FA 1EEHA 4R01A 4P8RA 5HFNA 2IL1A 4PTZA 2WJYA 2PUFA 3GUCA 3H1PA 3ZVLA 5JZ9A 2WSMA 4MPRA 3T7JA 5I3ZA 3DFZA 4ZOAA 1P75A 1ZUIA 4INJA 2F64A 3BSYA 3HXPA 2W2NA 5IAOA 2ODPA 4XCXA 3O8QB 5AJUA 3DC7A 3DULA 4J7XA 1W1IA 2MIIA 4FYXA 1X1QA 3ON5A 1OX4B 2HLHA 5BVHB 3M6XA 4LRTB 4W1PA 3L8YA 5E2IA 4F4JA 1Q1NA 2OGSA 4GE3A 3LQYA 1RM3A 2BEVB 2O2DA 1RWBA 4FFLA 4X8HA 5ESRA 3QLVA 3ZOZA 4DDHA 5G0WA 2H2WA 1JP7A 1ZI6A 2MDTA 3L93A 5DBFA 5TQJA 3WLJA 2DRIA 5J2TA 4PC2A 4ZMBA 3CKMA 4KX5A 1R2QA 4WFKA 9LDTA 2VNHA 4N49A 3PIIA 3Q8KA 1XNRB 4A0FA 4E4TA 1C80A 3H1EA 4FIZA 2EARA 3U3JA 5HXAA 1BVUA 1TJ3A 4E14A 3QM1A 1Y1TA 1Y81A 1BQ4A 3PEEA 5DJ5A 4B45A 3EXFA 1FW8A 1ZSYA 2V74B 2FWBA 5KI6A 3KVOA 3VR4D 1JAXA 3SC4A 1RQXA 1RLOA 5LP1A 2WQ6A 3DKVA 3VR2A 5ESXA 2NXJA 4CMEA 3R6GA 1L4YA 3MMSA 2OFPA 2J0QA 5DHTA 4A1OA 3I0NA 3EVBA 4L78A 1IQUA 1W5EA 3WL8A 1W0JD 2DBVO 1UBNA 3BMCB 3OX3A 4IIDA 4XYGA 4Z0TA 4LSWA 2ZWAA 3AP3A 4IVRA 3PR1A 1O8BA 1C0EA 1DAGA 4RWEA 5EP2A 5HMLA 3DBHA 8AT1A 3K5WA 2BGRA 4ENWA 3NDRA 2P1ZA 1I4EB 5F51A 4B79A 3DFFA 2ZSDA 1XIVA 1KHTA 1FTSA 2FSGA 2PUJA 3DMFA 3UOAB 4F8JA 2BR3A 2SHKA 4JK3A 4ZYLA 2XX3A 1DKUA 2WLSA 3PXEA 1EB8A 3PXAA 2JCVA 5EFZA 5IT4A 1A9PA 3S2YA 3QWAA 3RS2A 1PJQA 1D2GA 2BC9A 2EEPA 2VSNA 1TGYA 1PSZA 3U13A 4YIKA 2DYKA 4RH0A 2ENUA 3EXG2 2ZIEA 1CZNA 1ZVQA 4JEMA 3QKRA 1HEYA 1RW4A 2HK9A 4TMWA 1YZTA 4Q4AB 2GEDA 4GLBA 3VNSA 4YLYA 1J2EA 4J1TA 3R0VA 1FJHA 3A3NA 2ISSD 5AW6A 3V9PA 5IULC 2QXUA 3GEPA 1U28C 4CLEA 1C8BA 1VMDA 2DECA 3SVZA 5BSEA 5C5DA 2J0EA 1T1IA 2XWPA 5CA1F 3BIOA 4WN9A 1E3LA 1PQWA 4H6PA 4L73A 4Y1RB 2B3TA 3TZCA 3UT5B 4G0YA 1CZOA 2QSZA 1ZW6A 3O5AA 3D7KA 3VBCA 2R11A 2VEOA 1GNSA 2J41A 3SOPA 3OCZA 4DCGA 1O94A 2GZAA 4GR5A 1T5IA 2W2KA 1TMGE 1KC1A 1A8PA 1OMOA 1T6BY 2ZUBA 3H13A 4JKOA 4MWCA 4XFJA 1VXOA 5IAEA 3FIUA 3OE7A 1OKKA 1QO0A 3FPFA 4AS2A 4U8HA 2OCPA 1NVBA 1EDEA 2CBGA 2HMYB 4H4DA 3TW0A 3EEYA 1DINA 3AMVA 2QNIA 4AW9A 1XMJA 1M8KA 3KD2A 1QHSA 2QJOA 3QUTA 5B4TA 1ZK3A 4EYQA 2CXHA 3B12A 3T3GA 4BASA 4ODIA 3EDMA 3HWX1 1CXZA 4PRLA 4YFYA 2Q3EA 5CD1A 4K9LA 4WH0A 5E0KB 5ALTA 4G0WA 1Y5NA 3PQDA 2P9TA 4BNDB 2I4NA 1AF4A 5ES3A 1TZ2A 5LNK1 5GONF 2GJKA 4DHWA 1JGTA 3KIPA 1NRXA 1ZX1A 3DDCA 3WGMA 5AVOA 3KU4A 3VQTA 2Z9CA 4NYIR 5ALQA 2HU5A 4BZQA 2OHVA 5DPMA 4PZ9A 1T1GA 4EUEA 5U4QA 4ZV9A 2JA2A 1SC1A 3DO6A 4XUCA 1KU6A 2CE7A 4JP3A 4Q16A 1RE1A 1H0KA 1NW3A 3VKVA 4PANA 3ROKA 4AG3A 4DQ0A 4AKIA 3B9PA 1L5OA 2C00A 2Q2QA 2HCJB 3ETDA 3B1ZA 1Y9EA 4FOPA 4ZA2A 2JZOA 3VJKA 4R0MA 2RBGA 2OPHA 4YMLA 3JQFC 2B9EA 1NJSA 3D2LA 3H0KA 1I4DD 2BFDB 5AM4A 5E8JA 5FORA 1D4OA 4DBLE 4EX6A 1GPMA 2JIBA 4H6VA 3DHNA 4AQDA 4PQRA 5DLEA 1R8YA 2YL2A 1XZGA 2Y93A 2YWXA 1S3SA 4PFQA 3T3DA 3TZEA 1TZJA 4PLHA 1T4GA 1M7BA 1RDFA 3O4FA 2ADMA 5SYAA 4N6NA 4QM6A 1I3CA 2VRCD 3F4KA 5EYPB 1EP9A 3CX4A 1VCHA 3KKPA 2R47A 3TD6A 4R8LA 3ENVA 4OU5A 2G8LA 1TUBB 4QDTA 5AK0A 3AYZB 3K1YA 1ZA2A 2RJNA 3K70B 3OPNA 1UH5A 1M6EX 4KH0A 1I10A 1MJ5A 1ZN7A 1DPGA 1EQUA 2V96A 2VJBA 3FSGA 4DDMA 5IVIA 1PIWA 5JLJA 3TE7A 3QW2A 1P4HA 1KH2A 5GVRA 1L3BA 4NZPA 1GZDA 4J0KA 4BKPA 3CF0A 2GRJA 3F3KA 1ANKA 2DY1A 2E1RA 1KO4A 3CLTC 3IEXA 5DVZA 5LXTF 4AKSA 2R48A 2CNWA 2AEJA 1Z4KA 2NZWA 2V7GA 5JAHA 1NUSA 2NV6A 4FDVA 5FIUA 3M83A 3TFWA 1VYVA 2D8MA 1EVIA 4YV2A 3STWA 1Z25A 1X7DA 1FYDA 1QAOA 1TZKA 1U5AA 1N8SA 2I4IA 4Y0AA 5JR3A 1N2CA 1DZIA 2ZJ7A 1VGRA 1ZXBA 3MHPA 4NBSA 3R40A 5JOQA 1QV6A 2WV9A 1Q19A 2GA9A 3ISJA 1VPTA 3V4SA 3ZU3A 3A6JA 2SCUB 3FGNA 3ZKAA 4JDUA 1E8NA 1KQ3A 1KXJA 3L18A 6ABPA 1L5YA 2VWGA 4X7RA 2C9BA 5LZ5A 5BRAA 1N6NA 5KTMA 3NDPA 1AA6A 5F77A 3PHHA 4WNYA 1KYQA 1L1RA 4OQQA 4CN8A 1NU8A 2NUTA 3W2FA 1ZGBA 4ZDIA 1G19A 3INNA 1TAGA 2Q8NA 2OQRA 1DP4A 1GGFA 1WY5A 4W82A 2XKKA 2OV2A 1QHYA 4BOYA 4M9ZA 2VDKB 2CYCA 1GARA 1TO2E 1WBJB 1GSOA 2XQKA 3IODA 1O96B 1J8YF 1D1PA 2J07A 2W6JA 1E9EA 2JVIA 2JLAA 3SXUA 3N7AA 2X0KA 3U6KA 3M6LA 1PYOA 2P5UA 4WXHA 3DGFC 2D1QA 5CW1A 2LR0A 4MGZR 5IF9A 3VAAA 3GJ7A 1YZUA 1BMFD 5DBHX 4J16A 5JAUA 4HUQA 1YMVA 4K86A 4WXMA 3Q2IA 4O4HA 4JU9A 5TY0A 1KMHA 4HAUA 4NC9A 4C0AC 4E1VA 4JXXA 3NEPX 3KNZA 1EZZA 3IMFA 4BX9A 1RPTA 2WU8A 4OBBA 2AFRA 2IEGA 1V3VA 3AKYA 3TUIC 3FROA 1U6JA 2NNLD 3TZQA 3A1VA 2PH5A 3IPLA 2CL5A 1CUSA 1KJ8A 2FSPA 4DMRA 1NQAO 2ZXUA 2I66A 3RE1A 5KYWB 2D54A 3NXKA 1EIZA 4UREA 5CJJA 2CJWB 2ZI3A 3RU7A 2INGX 4CXMA 2DBZA 1ZRSA 3DLBA 4LVCA 5IM4A 1PX0A 1QCYA 1PTJA 4O4IF 3EFOA 2BKVA 3ZNPA 4A5SA 3OIWA 5IJ0A 3QBTA 3ZHXA 2BMJA 4ENVA 4RADA 4TS1A 3EMOA 1JN0A 2KM1A 3MTDA 1GRQA 2X76A 1PGOA 2FN9A 4YQZA 1AKQA 3KPUA 5CHEA 2WIBA 1OPRA 4EY3A 4DAOA 1TGVA 2V6IA 5E6UB 2X19A 1V96A 1EWTA 2EQAA 1YF3A 1LLUA 3KB1A 4N0EA 4QTYA 1P4GA 4KNYA 1PD1A 2OD9A 2YJ6A 3GLTA 5AUOB 2H11A 4D82A 1GUYA 4YAEA 2ZSJA 3IBSA 1Y6QA 1P0FA 4K3UA 4LY3A 5E6RA 2D7DA 1I32A 4DR6B 1SU7A 3JVDA 2QIPA 1Z08A 1WF3A 1LBTA 3EY9A 4R9NA 1X15A 4PF1A 4C3VA 4Y2GA 3AP1A 5K51A 4AUMA 1K5PA 1PHRA 2KI5A 4MP3A 1WMAA 4QUDA 2QM3A 2JLBA 3KT6A 1N32B 3PKJA 1XCLA 4QT4A 3GEIA 5FBVB 3PRKE 2L17A 2PSDA 3JD2A 3GJ4A 3ZHUA 4IKOA 1NMSA 2JBWA 3HN7A 5FTMA 4RJKA 2YV2A 4UPDA 3ZNOA 4DQLA 1O6FA 3KOWA 5CDSA 2ALJA 2QMEA 1CY7A 4YRBA 3MK31 3FMOB 1CUAA 4R9UC 4QM7A 3OP1A 4POAA 2OR3A 3T1VA 1QIFA 3V6MA 4XUGB 5K0ZA 5AFSA 3PTLA 4OQPA 3IEIA 4FD2A 4KPUB 4W8HA 4BMXA 4L76A 1QH1A 3VV2A 5JXJA 3ZLJA 2GPWA 4P54A 3BAZA 5CXUA 1GL9B 2GERA 4Y7CA 3CW2A 2QAIA 3QLUC 2QMHA 3ZHVA 1IQRA 2J09A 3AYXB 2GPAA 4ID3A 4UMDA 4EA9A 1Q7GA 2RG1A 3BCHA 2P4QA 5AESA 5JI2E 2Q1WA 1QG0A 1P9WA 2EKQA 4DXHA 3FNFA 1V8BA 4IHJA 1BKSB 3EF0A 4RPHA 4WEOA 1PZNA 1SZPA 2OZLB 3R3YA 2YHBA 5D7BA 5E2AA 1MAAA 1Q2XA 4QOSA 5BYJA 4XVHA 3AKDA 3GPIA 1M2JA 1Q0PA 3C3YA 4MWSA 1FSZA 2YYSA 3LQ4A 1U3FA 4G9BA 5IK2D 4L0CA 2OP0A 3TFOA 3AW9A 1YS4A 4J1QA 3M5PA 1DO2A 2X4DA 1RJWA 3IKMB 3ZE6A 1WUJS 1D2EA 2IVFA 4MW0A 4XDYA 1Z8HA 5ECYA 5I7EA 4OQLA 4B40A 1Z7YA 1LLDA 4BATA 3ICCA 1T5LA 1JR3A 2CLSA 3PPWA 2MWMA 5CNJA 1I4TD 2C5GA 3S40A 1M1NA 4DIOA 3T5CA 4MGIR 1WEKA 1JWLA 1GGVA 4NJOA 4OHYA 1NQWA 2FK8A 4YI3A 2X0FA 5LQJA 2WD7A 1JECA 1TC2A 1WG8A 3H5VA 2ZK7A 2VDWB 5EESA 3G89A 1KFJB 1M10A 3PA8A 5IFLA 3OCCA 2AZ4A 2MMGA 3N2YA 4GYYA 4TKZA 1CERA 2Z8YM 1FNMA 2HJGA 4MWOA 2E49A 4BN4A 2NU7B 1XVLA 2C5LA 1M1YE 2O7VA 2J3DA 2ZVJA 2O3TA 1R64A 2IPXA 3MGGA 2OFWA 4YT2A 1Z2OX 2Z2IA 5LQRA 4W8OA 3UAYA 4OP1A 2Z1DA 4FYPA 2ZANA 3QA9A 2ZB3A 5I7SA 8MHTA 2Q4EA 1W96A 1UEXC 2BFMA 4E08A 1KTIA 4UQPA 5L4SA 1ODTC 1EVQA 3Q5GA 3CNBA 3FI9A 4I66A 2BELA 3O91A 3FB4A 5DNWA 5MGNA 5CT4A 4GPBA 2RBEA 3L0SA 2I52A 1IUOA 2FNAA 1EH5A 1UIRA 1DVRA 1A97A 4TS4A 1VBMA 3CLVA 4FMCB 4UDYX 1F5NA 2CEKA 1U9CA 1LPBB 1C14A 1A7AA 1I36A 3R9IA 4BP3A 3CPJB 1N5MA 4BNGA 1U63A 3I3SR 3PL5A 2FPXA 3RLFA 4H3KB 4RU1A 1G66A 1RRVA 3WYDA 4CEJA 3TI9A 1MW9X 1RZ3A 2O5VA 4L27A 4UVHA 3DZCA 3PC8C 2EF0A 4HSEA 1DKNA 1Y6JA 2GB4A 4R98A 4RMNA 1T91A 4E6PA 1GQQA 1ZIYA 1V4VA 521PA 3UGTA 5I3CA 3GV0A 2FJPA 2H4FA 3NHBA 4FDMA 2X7XA 4WOPA 3CWZA 3GFSA 4WADA 1C7IA 3CLSC 2OO5A 3Q0EA 4ZVMA 4F21A 4Z5XA 3UKJA 2UUCB 3FX2A 2JAQA 4BNZA 4YRNA 4LX8A 5DW3A 2Z4SA 3LFTA 1MNQA 3D6UA 4BYMA 1YONA 1IPFA 1ZW1A 2DGDA 2O1WA 1E79A 2QMZA 4JY7A 1Z13A 1ISMA 5LLDA 1M1YB 2YZMA 3BFXA 3ZE1B 4Q39A 4RD4A 2HA4A 1F3OA 3TW8B 1PNRA 3ZY5A 3ILYA 4DNXA 1E5TA 4TWJA 2ZIUB 1U5BA 1QPBA 3AR7A 2VSYA 2QRUA 3A4TA 2XR1A 3OI7A 3CFYA 4N12A 3DE7X 1Z2EA 1JLRA 4BMNA 1VPWA 1U9IA 2ZJFA 3O73A 1HRKA 1A0OA 3ZKWA 1IOZA 4K9MA 3H1GA 2G1UA 2ZTLA 3I23A 4ZAGA 5EKTA 4OO3A 1V43A 2BEWA 2X8BA 2M6RA 3E81A 3NHFA 4IRUB 1U1GA 1CUZA 2QPTA 4CM8B 1DSSG 1RTTA 5KVAA 2ANCA 1LTQA 4ZI7B 4W5NA 1U11A 3IX7A 4MV5A 5M29A 4DIEA 1VXRA 3L0OA 5JHHB 3LXMA 2ZR8A 4LWZA 4YP0A 2PUVA 4Z1MA 5TPWA 5BPFA 4MUMA 1NPYA 3TD2A 5U9CA 4E5KA 2RHMA 3WJAA 1F1JA 2IYRA 3IBGA 5FL3A 3RYCA 1WLSA 2BV3A 2YWFA 4GKBA 3OT4A 3LI2A 2O6LA 2ROQA 3JAMA 3VC3A 1EIWA 3OTWA 1IYZA 1W5AA 1NQOA 3ANTA 4PNZA 2VK2A 5A4MS 5IHPA 2MSWA 1KPIA 5JT1A 2AOUA 4RA9A 4WECA 3CW8X 2QN7A 4BUJA 3CHYA 1UL1X 2YMQA 3QTLA 5KBYA 4TYQA 1GDHA 2BMDA 2D1SA 2CT8A 1W2GA 3V9AA 2HL6A 4WNCA 3ZBQA 4WDQA 1TA4A 3NM6B 2WF6A 3CMMA 5FBZA 1TZBA 2PKYX 2R751 3T5TA 1NYLA 4YCCA 3SBXA 4Q05A 3PA6A 4M8LA 2PQ6A 2YASA 4J1NA 3AGQA 1D6NA 1X9GA 2BGTA 4TRRA 4Z4EA 4KQ6A 2AOXA 1IN1A 1VPVA 1XZDA 2I03A 1YJCA 1Z5ZA 3KKNA 3ZGVA 3PXBA 3UJHA 4FKMA 4EECA 1VG0B 4Y1EA 8OHMA 2JFYA 3HADA 1Y8QB 2H1LA 3TIVA 1AVTA 1JJFA 2JBAB 3DT6A 2P2CA 1GTVA 4F1KA 4MXDA 3UHPA 4DRZA 2IHKA 3N8KA 2A52A 1GRNA 5IRCD 1EBUA 3GFQA 1UFOA 4PYQA 1GRRA 2BN4A 2VZ0A 1E3IA 4CM3A 4UM5A 2PLFA 2LW7A 2CHGA 2KLBA 4C0SA 3T7CA 1GUFA 3SM3A 1XNHA 3DNPA 5BMVA 3OP4A 3P9YA 3QOXA 2VHEA 3F78A 2I99A 2OXRA 4INZA 4BE7B 2B0JA 3EASA 3K0CC 2UVQA 3EFHA 3O4VA 3CURA 3AM1A 4QUKA 1E2FA 1IJBA 2GN8A 2JGJA 5I4KA 4I50A 5F2OA 3BFVA 1MB3A 1QS0B 1G38A 1I2AA 3KR2A 2JIDA 3IV6A 1NFQA 1VL0A 1BU8A 2G7MC 4XQ9A 3DBLA 4MVJM 2BE9A 4QDZA 4DEYA 1KGDA 1VTKA 5EINA 2TECE 4J2HA 4H3VA 3G5AA 3OMWA 3ZHTA 2GEBA 4ZHSA 1JPNA 5FNVA 3WIBA 3WBBA 5I4BA 2VDRB 3IKJA 3TLEA 4DOMA 2ZRFA 3NIFB 1FU7A 2PZLA 3FF4A 4EL0A 1TEZA 1L5QA 1TI7A 2HU2A 5HCUA 4AJ4A 4HXGA 3IOEA 1U7DA 1EX1A 1QC5A 1LDBA 3KR0A 1T0UA 3MVEA 4FMPA 4FYIA 5ALFA 1BJRE 2D3TA 1ITZA 1BE0A 1N5LA 2AOWA 2PKCA 4W7HA 5E6SB 3TDNA 4Q12A 1JH8A 3EISA 4MYRA 2R96A 1L7QA 1PX2A 2D0DA 4AIIA 1E8MA 4PHCA 4A92A 4FHZA 4P0TA 4PG7A 4RXUA 4I9NA 1Z68A 1E9SA 2RAPA 1KMCA 1Z2CA 1M1UA 3B3QA 1P73A 4IEEA 1VA4A 2FPIB 4KE7A 2W93A 4X8OA 5DCLA 1T2FA 1UPBA 3DZFA 1AGNA 3AESB 4GC9A 3D7RA 3TSWA 3FETA 5BN1A 5K45A 3ZVNA 2G09A 4QAJA 1LXCA 3MAAC 2UZ1A 4GM1A 2I55A 3LDHA 1DOHA 3IEMA 3AL0C 2EU8A 1JSZA 1NVXQ 2AYZA 5A3QA 1KSJA 3JTEA 4R84A 3ZYCA 3B89A 4BWFB 2QJWA 1DTWB 2X23A 2HXYA 3O2JA 4JIMA 4MCHA 1OIVA 2G9VA 2WHXA 3GAFA 3GA5A 3LYHA 3BMQA 1YR3A 4H7JA 4NATA 5SZIA 2X13A 4UULA 1DG3A 1WXQA 2P9JA 5GGXA 3ZU6A 4YPFA 4N18A 5H4HA 1T2CA 3P2EA 4XYLA 4V0KA 3ZIAA 4Z7OB 3WK9A 5ELMA 3WOVA 2QPOA 3L7DA 4IF6A 1IAVA 3LUCA 5GV7A 2A78A 3T9BA 2V5UA 2BRUA 5SZHB 1WZNA 2CBXA 3GZ4A 2VHXA 1GYRA 1KVRA 4TS9A 2DPLA 2HA2A 1SXHA 4Y2YA 5KMGB 4BXOA 1YRYE 2Q41A 1GKKA 3C87A 2WIAA 2ZVDA 2P75A 3OHMA 5SYMA 4AG5A 2YV5A 4ZVQA 4EMBA 1FS4A 4ALNA 3RUIA 3HCRA 3O26A 1JA0A 5EZ5A 2C7OA 4P7KA 2IITA 4CMIA 2YFKA 2CC2A 1HDCA 1VPLA 4GX0A 1T9ZA 3KLOA 2P9CA 1AGPA 3F6CA 3H5RA 3T3PB 2IUYA 2JJ8A 2ZQZA 5BNFA 4YV7A 3K8OE 1WLYA 3G9TA 4DRXB 4DMHA 1NX6A 1N2GA 1BEZA 2UXDB 2QDXA 1XO1A 1NDUA 1SCDA 3CTPA 5IDYA 3FN4A 2XCUA 4A2CA 3P5SA 2A4MA 3I8SA 1NF2A 2JAOA 3FHOA 1WF6A 3C6KA 1LCIA 3PK0A 2DLDA 4KQ9A 4LXYA 1Z12A 3RFFA 3TR5A 1E1LA 3CNNA 2ID8A 4HLUA 2IYTA 1THTA 2Y67A 4O0MA 4OXYA 3TLCA 2GBFA 4NPAA 2EVWX 5DYYA 3QMWA 5FOXA 1ZJ5A 3DV9A 3PT9A 1NSYA 3OTIA 4JA0A 1W85A 4QBGB 3DV2A 5C31A 3U2QA 1KKUA 1X38A 3M6AA 3GNSA 2VPIA 1O2DA 5BYBA 4ZI3A 2NYUA 1XJCA 1WPQA 5DK6A 4C9BA 4FYVA 3P9ZA 3IAUA 1J8DA 4YJ2A 1MAUA 1RADA 2CDNA 3P19A 1RFLA 5DNAA 5C8YB 4DXAA 4WGGA 2C0CA 2CFCA 1AGXA 1IEWA 3AEXA 1QZZA 2R7NA 3HU2A 5D8DA 1SGWA 3SYKA 4E2XA 3BH6A 9ABPA 2WD9A 4CLRB 3CB4A 3LWBA 3DLPX 1D3AA 3PPVA 4S12A 4B84A 4K6GA 4HUJA 3EIOA 1OHHD 3HJHA 2NTJA 3P94A 4L2IB 4Q7QA 5KTPA 5A1TA 1AH2A 1E0SA 4G67A 4Z7JA 1FDOA 1D8TA 4KEAA 4XAQA 1OH6A 3H2HA 3CPEA 4EITA 1AU9A 4BMOB 1MABA 4R7TA 2R4QA 2KQUA 4CLOA 5JAPA 2P41A 2WJWA 2H07A 3DO8A 4MO9A 1DAPA 1IXSB 3P9RA 3AFNA 3WY9A 3GMSA 5JS6A 4MV1A 1J0EA 2H0RA 1GHTA 2IOFA 4JEHA 1JR4A 5DM2A 5BO5A 1ONPA 4IIUA 5EIFA 2DCMA 2Y05A 5H02A 1UKCA 1TIPA 1JIIA 2GYYA 3WL7A 1BS1A 3F5MA 4KVAA 5CX1A 3VA7A 1YKFA 2ECKA 1Y4DE 3L1UA 4JLAA 3O94A 5P8WA 3WS7A 5YASA 1WR8A 1DADA 3D2AA 1QXSA 4MUFA 2B34A 2RHGB 4LZNA 4MLCA 4UDXX 5DBEX 3I52A 3Q8LA 1M2VB 1T2AA 4V24A 4Z7QB 4DV7B 1IRIA 2B7BA 2GCGA 2PBZA 4YONB 2I7VA 3LHSA 5GJVC 3ABQB 3K5PA 3LGXA 4I36A 3WGGA 3BVPA 2OC9A 4Y6GB 1NTOA 1O89A 2QT0A 1IM5A 5GM2A 3AIIA 5BSKA 4ND1A 5B3JA 3FYUB 3KTAB 5JS8A 1G8YA 4NL4H 4DUZB 1I14A 5A0VA 1JH9A 1CD5A 1SR8A 2EJCA 2KW5A 4FONA 1OTYA 3HGMA 2AQKA 1GPAA 2G70A 1Z63A 4G5YA 2H1VA 5J5AA 4D9EA 2R44A 1XTTA 1X1TA 2YUTA 3EFBA 5F1KA 3AXSA 2PLRA 2JANA 1RWKA 2C3UA 1X2EA 5JAMA 5K0GA 4ZQIA 5CB0A 3HEBA 5EL0A 3KS9A 2QU8A 4JI6B 1CEXA 4FMCF 4CM6A 5BWMA 3OUTA 1TJ5A 4M89A 4BJ5A 1KFCB 1KJ9A 3I9KA 2BHNA 5D5QA 4YT4A 5BNIA 1MHTA 1V8OA 1KMMA 4GPTA 4ZQCB 2O1SA 1MX5A 3MJRA 4HDMA 4G5OA 4I14A 3WLAA 3A4MA 1QIHA 1AXGA 3RFCA 1PJBA 3AOEA 3WL5A 1IN4A 2VRCA 3CFFL 2OWEA 4H08A 4IV5A 2I6TA 4OQZA 5LA6A 2C78A 1BIFA 3C41J 1V8DA 4FHEA 5HCIA 2JBHA 4N0QA 2CXPA 4FINA 5E8RA 5BUZA 3RTEA 1R12A 4ZICA 1U8UA 5KNBH 1RQPA 2B4AA 3J7TA 4QYMA 5EHGA 3KWFA 1TD1A 2GQ0A 4HLNA 3T4PA 2P4HX 1WDKA 5ILQA 1X0VA 4JJ8A 2C97A 2GLXA 3T52A 4Y6RA 1H8ED 3OZTA 3BF8A 1T3LA 1XHLA 4M0FA 5SZKB 2AXEA 2E55A 2FPRA 1DAEA 3B1KA 3NAZA 4N5MA 2WNSA 1ZYUA 1UXKA 4URHA 3SSMA 3QA3E 5CYFA 5ADHA 5KDDA 5H3LA 5T3UA 4J75A 3ZBUA 5JI3E 3E27A 4QQFA 4BCBA 3AEZA 5L95A 1LU9A 3ULKA 1X2BA 4JNCA 5HGXA 2IZ6A 5IH3A 1NVAA 4NBKA 3KU1A 2J5QA 5DZSA 1GIAA 1BJTA 1RM4A 1J39A 1IMOA 1S7GA 4S1WA 4DSUA 2NT3A 5FPYA 3T1HB 3PX7A 4Y2SA 4BX2A 4PXAA 3OJ0A 2IQIA 5KYNA 3JWEA 4U8GA 3UJAA 3RDPA 2XYHA 2AHOA 2H51A 3CT4A 3DP7A 2PANA 4B35A 5HNKA 3UJCA 4ZI7F 1AB6A 3LCJA 1I7QB 2D2FA 1DEXA 1FTGA 3IDZA 2HEGA 3OT1A 4L4UA 4K05A 4P4GA 4RKWA 2I33A 3K20A 3RVSA 2NTYC 3OQIB 5EIBD 2HKIA 4LNAA 1RZRD 2V6BA 3ROTA 4MWGA 1XWFA 3HCOA 4TKUA 1KYIA 2X4LA 1XQ6A 1NQ5A 4EX7A 4U6NA 4WBSA 1CJVC 4Q7EA 4EFKA 1UP7A 4C7OB 2CY0A 5JMWA 2J9RA 1Q14A 1SELA 3BJRA 4LE0A 2OVFA 1JJ7A 1UJMA 4GDMA 3NVAA 2EHJA 1JXMA 1U3TA 5KNCH 3D6NB 3TUJC 3Q3VA 4BX3A 1A4XA 2ZJYA 3CH7A 3L7KA 2D2IA 4Y2PA 4PZCA 2YMPA 4Y2JA 5E1DA 3BA1A 3STXA 2Z8XA 1PR1A 1X86B 3IAS6 1MH1A 1ZZGA 3OX2A 2PFGA 2WM2A 1GYQA 1SJ9A 2XNDD 4HG2A 4RYLA 4X60A 2WFZA 5K4GA 3T7TA 2F55A 3WL3A 4LRSB 1S3FA 4UBNA 5AIAA 3H5LA 3KHSA 3L6UA 2CNOA 1CETA 4RHXA 3IP8A 3N05A 1IBSA 1E66A 4HL6A 1NFRA 3QUCA 2YS6A 4PO8A 3NRBA 2EHDA 3BGDA 1MA3A 1I6LA 1TAUA 3LUBA 1U2GC 1WUYA 1DJMA 1HF3A 3R76A 4YMTA 3K70C 4ZQHA 3T7KA 1BZYA 2XDAA 4WI1A 3DVAB 4RJLA 1KP9A 2P3SA 2J6HA 2O2HA 3L7CA 3NONA 1O0CA 1JEDA 4EHKA 2XGMA 5JSHA 1AQIA 4AP5A 1GKLA 1J9EA 2V0CA 1YRAA 3AHGA 5BQOA 3NQ41 3R7LA 5ALLA 1JQEA 1WS6A 2PX6A 2XE6A 2Y1LA 3ZN2A 1Y5MA 1PDVA 1YL5A 2H8KA 2ZRDA 4LY6A 5CTAA 4CT5A 4L6CA 4UVEA 1ZJZA 3WMEA 1CZHA 4W1SA 1NYQA 1NTRA 2NZ8A 3EN0A 4U2BA 4ZYVA 4DJJA 1J5XA 4CQLB 2E5FA 2C5AA 4P7JA 4UAGA 1XTZA 1DEOA 2FZ5A 2X40A 1P91A 3PDIB 3NHAA 4GPEA 3U4AA 3KQVA 2XRZA 1U0EA 1E3DA 2O48X 4PVDA 5L3ZA 4A1FA 4BV3A 3KETA 2ZZKA 2OGUA 3QXJA 1G9XA 4LXXA 3GXBA 3I6IA 3EW7A 4INPA 2BFNA 4X5OA 1XDBA 2ST1A 3LBAA 1AY0A 1R88A 3OQJA 5EE3A 1Q7CA 1HXHA 2BI4A 2QSYA 2JFOA 3UHJA 1ZM2A 2WTMA 4DQKA 1L6IA 3TZKA 1OFVA 3W34A 5A3SA 3A26A 3ONEA 4DLWA 1PZEA 1V71A 3N0RA 5A3JA 6Q21A 2WU0A 2JGMA 5IXYA 3H1TA 1T9KA 2W7TA 4X6YA 3KT8A 3BUSA 3L3BA 3WO0A 5K8JB 2LRHA 4WA7A 5CX4A 4DCTA 1HFEL 1Q15A 2X4GA 3QPBA 1DXYA 4R1LA 1P29A 1QM5A 1T6ZA 3NNSA 3P26A 5K2MA 3LIPA 4QYIA 2IZ5A 1GNTA 4GSYA 4YPOA 4OHPA 2L2QA 3TKLA 2IH4A 2FR0A 2VNKA 1KZ4A 5IK2A 1SVMA 3KJGA 1QSGA 2A1IA 2BPOA 1C4OA 3RK4A 1ORHA 1DRVA 4TV9F 2J9ZB 1TKAA 1FC0A 4TWIA 3DOCA 2PWYA 1QGOA 4DVJA 4ZK2A 2WF9A 2QOEA 3W78A 3WL6A 2ZYUX 1YR6A 1CDEA 2YV1A 4K9NA 2GAAA 3HU3A 3U4QA 4R1SA 2XCSB 1XJ0A 2PGXA 3PF9A 5AR1A 3WGZA 4DV6B 2QW1A 2AI2A 5AKKA 1N34B 1J0DA 3BFJA 2QQEA 3N74A 5H16A 4FZRA 3Q10A 1HKHA 1K7YA 4LZZA 4NXMB 2B20A 3EUFA 1XEWX 2EF1A 3NV9A 1ECFA 3PE4A 4FS3A 1KJZA 5HE8A 3G59A 5FCDA 2V7VA 3AUXA 4D25A 9LDBA 4TLMB 1BHO1 2JCYA 2YOHA 3KSRA 1CZLA 3WBKA 2PX0A 2H5LA 4CM4B 4MIYA 4AN0A 2WJ4A 2Q0QA 2WAOA 5BT8A 1P5FA 3W8EA 2BGGA 4ESVA 2L0XA 3KYIB 2FVXA 1CUDA 3PRJA 5INTA 1UODA 4H77A 1YZNA 3Q8MA 2NO7A 2RI1A 5I7VA 2Q6IA 4X94A 1HWYA 2VRBA 5IEJA 3QFSA 1THMA 2XMGA 3HLKA 3HPQA 1FYXA 5DW0A 1T8WA 5CDTA 3BE6A 4ZYZA 4B48A 2IV3A 1SPXA 2ATCA 2Z3ZA 2DBQA 4JP2A 1SA0A 4NEHB 3T12A 1AO3A 4OL0A 4TSFD 1UEJA 5FLYA 3PVSA 1IN6A 5IJXA 3IP9A 1E0AA 5AW8A 2NSHA 4W6QA 1Z47A 2E5LB 3IQDB 1RMYA 4M1MA 3RUEA 4NARA 5KO2A 1EVJA 2ZJ6A 3CLUC 5EIXA 1VG1A 4TVBA 3FWZA 1NBHA 3V2GA 5JRDS 3KYDB 1F9AA 5JXHA 5AHOA 3SXJA 5KWSA 3C6QA 3KKEA 3HR4A 4NFLA 2QVZX 3EGEA 1KAEA 1Q7EA 1C4XA 1ZD2P 2Q1XA 3ADDA 4DR4B 4CEIA 2GILA 3ELYA 4KRYA 2FMFA 3UANA 3NEJA 1R0RE 3DMYA 2IH5A 4EQ6B 2REQA 4Q5IA 5GGYA 4UNNA 4EUNA 1CDZA 4LRUA 4TWRA 1RBYA 3P8ZA 3ZHOA 1JHYA 4D26A 1Q12A 1SC4A 3D8UA 5G0UA 1C3OB 2Q2WA 5T5QA 3ZU4A 5DHUA 5HRCA 4JLNA 5CTJA 2V1UA 5LUAA 4W5WA 4IIBA 5FOUA 5FYDA 3NZEA 4Y8VA 4PLVA 1XSEA 4B32A 1N6IA 1Q1GA 2B1GA 3NO4A 1KARA 1PG0A 3FTCA 4I55F 4DQXA 4NJEB 3T5AA 1Y3HA 1JSRA 2VJMB 3RPEA 3G49A 3EEQA 1MG0A 3A11A 3GAMA 5EUBA 1CVLA 4F96A 1EX6A 1UT5A 1FUIA 2GJAA 1PKEA 4LHZA 5HJ7A 1R16A 2PD3A 3BWXA 1O4VA 3G2NA 3KPWA 4MCAA 3SZOA 4D79A 2LDBA 5A6SB 5CCXA 4O4JB 3QX9A 4RMIA 5G3YA 3SI7A 2UUAB 1K92A 1H2AS 1MX9A 2XCQA 3ICVA 5B1HA 2XKJE 3L92A 5KJ1A 4TLAA 4E03A 5BURA 1H4TA 2EGUA 2Z2KA 4NE7A 5JWOA 4HYEA 1HQCA 1N3BA 4MVJI 2OG2A 2HK7A 5JQWA