3UY4A

Crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
b'AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate--Beta-Alanine Ligase from Campylobacter jejuni complexed with AMP and vitamin B5
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
total genus 88
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uy4A01
1Y42X 4MUGA 2J07A 2A1UA 3SYTA 3KT3A 4H3SA 1EJ2A 4PBSA 2OQ2A 4I6GA 4U63A 4EG4A 4YP6A 4CT0A 2X1MA 4RPIA 1MAWA 1F7VA 1JGTA 3RK0A 2ZUEA 1KR2A 1JIKA 1G8HA 1QJCA 5K0TA 1JEDA 1J1ZA 1G8FA 3AL0C 4R0NA 1GAXA 2J08A 1N2IA 3CA8A 5KWVA 1IH8A 3HGMA 3KFLA 1O6BA 1RQGA 3H05A 5J58A 3UY4A 1OWMA 3KT0A 3NBKA 1V47A 3I05A 1J20A 3CLTD 3GMIA 1N2BA 1T9GS 1JIIA 1M8GA 1YIAA 1LI5A 1COZA 1R6XA 2A4MA 4PBRA 1K97A 1KAMA 2A88A 3FHJA 3H99A 5TEVA 2WQ6A 5TEWA 4UZEA 1U3CA 4KPUB 2X3FA 2C5SA 2QUKA 3MLBA 1CT9A 3IMEA 3A04A 3K9WA 1EUQA 2AKEA 1H1TA 2BYTA 1NYLA 4F3RA 5DEOA 3IOBA 4DLPA 3X1KA 4WNYA 3G5AA 2DR2A 4QREA 4MUHA 3CLRC 4ZT3A 3A4IA 1U7DA 1J70A 4ND6A 4DDHA 1KQNA 2CV2A 5FO1A 2R5WA 2WQ7A 3SEQA 2OV4A 2E89A 3GUZA 1WZ2A 3SDBA 3S3TA 4TS1A 4ARCA 1O94D 1WXFA 2J5BA 4ZCQA 4GU5A 1H3NA 1WXGA 2A1UB 1I6MA 5HUHA 3CLUD 4NATA 3IVGA 2E0IA 1BS2A 3IVCA 2YWBA 1TYBE 2A1TS 4HJXA 3LOQA 4XFDA 4KR9A 2V0GA 1VL2A 3TS1A 1S4MA 3CVWA 1PG0A 1YULA 4E1AA 1U0BB 1V8FA 2HZ7A 3UC5A 4ZT6A 5BNZA 2RE8A 1MB9A 3H9BA 3FIUA 5F23A 1O95C 2XRYA 1G8GA 2GM3A 1UFVA 3A2KA 1OWOA 3CVUA 4MUJA 2NSYA 4I6JA 3IDFA 1KH2A 4PY2A 2CV0A 4MUEA 3P52A 1N2GA 5H16A 2BTEA 1MJHA 2PZBA 3ZXSA 4MW5A 1R6TA 2E18A 1U3DA 1JECA 2PG3A 2TS1A 5IJXA 3JXEA 1QRTA 1EE1A 1Q11A 1N78A 1GLNA 3H97A 1QQTA 1WOYA 1T9GR 4KR7A 1Q19A 1O0CA 2A84A 3K32A 1I6KA 4EG8A 1QU2A 2PXHA 1A8HA 1MAUA 1EUYA 4Q16A 1IHOA 2QJOA 2EL7A 2WSIA 1IRXA 4MVWA 5J59A 2J09A 1XNGA 2A86A 4MAFA 4CDNA 1ZUNA 2Z09A 3MUEA 4YMIA 3ZIUA 1EFVA 3IOEA 4DNXA 4MVCA 2DUMA 4ZCPA 1IQRA 2GKSA 3AKZA 1M83A 1X6VA 2DERA 4MVXA 1KAQA 2QTRA 5H7XA 3PNBA 3LE8A 3ZJTA 5HG0A 3RJZA 5AHWA 1O97C 1O96B 1QRUA 3HMQA 3ND6A 4EG1A 1YUMA 5JBNA 2DXIA 1XNHA 1XJQA 4BWVA 3VGJA 2HMAA 4MLPA 1K4MA 3L92A 3CVYA 2DLCX 4MW7A 1R6UA 3FI0A 4NX2A 3FH0A 4J75A 5FO0A 2A1TR 3ISJA 4MW1A 1T6XA 1MRZA 4PBTA 3IODA 2JAXA 3RFFA 1IFXA 2XRZA 4R2LA 1FFYA 4L2IA 4MWBA 1O94C 3GLVA 2ZUFA 3ZXIA 3BL5A 3F3MA 1I6LA 2O8VA 3ILVA 1IQUA 3Q12A 1T6YA 2QJTA 3CLUC 4ZT7A 4OUDA 3AG5A 3IUEA 1JIJA 3HZRA 2VTBB 1M8FA 4G6ZA 1KKUA 4ZT4A 1TEZA 2QJFA 1KQPA 1QNFA 1ZH6A 3RBAA 1GZUA 1YUNA 3X1JA 3P0IA 1N2OA 1N3LA 4MWEA 1N1DA 2YY5A 3HFJA 3UMVA 2H2AA 4JFAA 4G5FA 2V0CA 1WKBA 1PFVA 1VBNA 3D6UA 4ZCSA 2B7LA 3FG9A 4I6EA 4R2MA 4XSVA 5LM3A 1EFVB 2CV1A 4YBRA 3ND5A 3H9CA 3FETA 3FDXA 2J4DA 3RHSA 4AQ7A 4MUKA 4AS1A 1KH1A 3PNVA 2DETA 4K03A 4G5YA 1TYAE 4EF6A 2VXOA 1WY5A 4NAHA 1F4LA 3Q4GA 1JILA 1NUPA 4ZT2A 1TFUA 2DPLA 5LLTA 3CLRD 5LFAA 1NSYA 1HYBA 3FY4A 3ZJVA 2CFOA 2CYBA 3AFHA 1OBCA 2CYCA 5DASA 1H3FA 4DDKA 4CQNA 1JHDA 3HV0A 4XFJA 3PXUA 2HGZA 4MUIA 1WXHA 2D13A 1QU3A 3ZJUA 5KHAA 3CLSC 2Z3VA 1YI8A 3TNJA 1KORA 1JZSA 4F4HA 1J1UA 1OWLA 5DK4A 2D54A 3TZLA 4MWDA 4HJRA 3G6KA 2O5RA 2QTMA 2AZXA 5J5AA 4FZJA 4KKVA 2PZ8A 1K4KA 4ARIA 4GRIA 2H29A 1FYDA 2G36A 2DEUA 3IOCA 4OUDB 3DO8A 4JYZA 4KPUA 1D2RA 1LI7A 5EKDA 2QTNA 5KCMA 3QTTA 4MUFA 3SP1A 5DB4A 3DV2A 3FNRA 4EG7A 4JZYA 4MW9A 4DDMA 3A05A 1O0BA 1NP7A 3CR8A 3IH5A 3L93A 4NZPA 1KP3A 3CLTC 4MW4A 4WSOA 1H3EA 3IMGA 1WJGA 2Z08A 4MUNA 1NURA 3E27A 1M1ZA 1ZH0A 3KT6A 4DJAA 1ILEA 3MXTA 3N9IA 4EG5A 3IMCA 2A7XA 4MULA 2I1LA 4YP7A 3COZA 3UK2A 3QE4A 4OJMX 1M8PA 4MW0A 1F7UA 1B6TA 1QTQA 4A91A 3P0JA 1PFYA 1GN8A 1DNPA 3ND7A 1MBZA 1N2JA 3FOCA 5FNZA 3ZUGA 3COYA 3UOWA 2QUHA 3SEZA 2CUZA 4P2BA 1NUTA 1OWNA 1N77A 5TS2A 3ZGZA 4DE5A 1SURA 3HL4A 3MMXA 2X0KA 3N2YA 3PNYA 3N8HA 2PFSA 2YXNA 5HUJA 2WB2A 1KQOA 1X8XA 1OBHA 1VBKA 4KR6A 3DPIA 2JANA 1N2EA 2X1LA 5K0SA 1IQ0A 3TZEA 3CVVA 4RUKA 4QBTA 3TQOA 1M8KA 1O97D 4ZT5A 3IVXA 1WXEA 3COWA 3SZ3A 1EXDA 3CVXA 1NZJA 1PFWA 3Q10A 1MOPA 4YP5A 5TGTA 1Q77A 4UZFA 4MQ6A 1NUQA 1JMVA 3TQIA 1N2HA 3C8ZA 2CT8A 4HK4A 1WQ3A 4EG6A 2CSXA 1XNJA 4NDAA 2EJCA 1JZQA 1EFPA 3PRHA 3DLAA 2IP1A 3INNA 3G59A 3RK1A 2JA2A 1J21A 4JXZA 1KH3A 1KP2A 1WXIA 2CYAA 1MC1A 3VRHA 2PZAA 1J09A 1WQ4A 1U7XA 1JEEA 4EFKA 2RD2A 1Q15A 4MW2A 1T6ZA 5IHXA 2IJGX 3OTWA 4EGAA 1ZJWA 2NZ2A 4MW6A 1GTRA 2GOYA 3X1MA 1VBMA 4CDMA 4X0EA 1P7PA 4ZCTA 1YIDA 3KT8A 1TYCA 1O96A 4U8HA 3OP1A 3LCJA 2D5BA 1I2DA 3M5WA 1TQ8A 1G59A 4J76A 4ZCRA 4L2IB 1LW7A 1OD6A 1PG2A 1GPMA 2ZP1A 3FWKA 3U1VA 4U7JA 4K0RA 4MWCA 2E21A 4QRDA 3VU8A 1PFUA 4ND7A 1QRSA 3NV7A 1TYDE 4NAUA 1MB2A 1O95D 4S1OA 3ELBA 3NBAA 4HPWA 1NUUA 1OWPA 1O5TA 3MLAA 1NUSA 4Q93A 4EG3A 3SZGA 1N75A 1IVSA 3AIIA 1K92A 4JXXA 4MVYA 1M8JA 3COVA 2QUIA 3CLSD 1NI5A 2YWCA 1F9AA 2VTBA 2IELA 3QTBA 3AG6A 3P0HA 1VLHA 2AG6A 3N05A 3D6VA 3IUBA 1EFPB 2PIDA 2QUJA 1ULHA 1GTSA
chains in the Genus database with same CATH superfamily
4D3FA 4PTZA 3AJDA 4HLUA 2ZB7A 4JB3A 4Y6QA 4ZJPA 1B6GA 1MRNA 1WZUA 4II7A 3AY6A 4L95C 1DC8A 3COPA 2AOUB 5E3HA 4MTCA 2PEZA 1Y3FE 1KEUA 3LX8A 3FMVA 3QU4A 2DBQA 1FX0B 2YVLA 4F72A 3GAMA 1JGTA 1UZMA 2FUKA 2WZQA 3UMBA 1LPSA 4LZWA 3S1AB 5D3MA 3TSAA 2VDLB 1N2IA 1IOLA 1LLUA 2WHPB 2ACWA 3G2HA 5H9WA 1B14A 1WMSA 1XK6A 1LDEA 2ZB3A 3HGMA 5CIWA 5CEJA 5GTDA 2WF5A 1K3FA 4BUZA 4DANA 1IWOA 1VL8A 3N2KA 3C1OA 5JAUA 2AFHA 2J0UA 3GDHA 3PFKA 3A6DA 1L7VC 5JECA 1H2EA 4DWWA 2NTEA 1V11A 4GZ3A 3AY3A 1JHAA 4RO0A 4XB1A 3OY7A 4FFOA 3ZZ0A 1JKFA 1T5DX 3FZEA 1MF7A 4OHBA 5AJUA 1DP4A 2BFWA 4BZWA 1UR5A 2FF5A 2Y4NA 4AJJA 5EWJB 4WA7A 4CF3A 5FNVF 5A4JA 4KHPB 1Q3TA 4X60A 1E1DA 3VYWA 1Y1SA 4M1WA 4ZIRB 3HNPA 1DC7A 2I54A 1JDSA 3V5NA 5KYWB 4D97A 3VOSA 4MS4B 1BTOA 3A4VA 4P5EA 4KXUA 5JT1A 3U1TA 2MSLA 2BWJA 3CUVA 3FDZB 1UEIA 3GJQA 3GEHA 3PIRA 2FDXA 2I67A 5F77A 1CQJA 4GGMX 3N6XA 4KVZA 4HTFB 2O48X 1NYLA 4DLBA 3SR0A 2YUIA 1NBMD 1WSBA 3LUAA 1F17A 1CFJA 1ZYUA 1RT9A 3WMRA 3ZCVA 3TOSA 1JN0A 2XNDD 2EJBA 1ESNA 3OJCA 1XZQA 3JQ7A 4QREA 4R40A 5AVJA 2IK8A 1GG2A 1KXJA 1E79A 2IVZA 3BWDD 4I1VA 5KCZA 2L19A 2WF9A 4KFSA 5M7EA 5CLHA 2V7QA 3PFCA 4R16A 4EJSB 4OKSA 3FNIA 2G5TA 2QZPA 4M1YA 4PTYA 3U62A 1BEEA 1PL8A 4DBZA 4EUEA 3KLNA 1QV6A 4A8HA 4WJZA 4ZOLA 3WL4A 3TD6A 1C7JA 3JVUA 5CH3A 1SQGA 2QRJA 4LRWA 1QK4A 5HZGA 1P8AA 1A9RA 2JVJA 3LW8A 3X3HA 3UPUA 4FWTA 1ZP6A 2E55A 4NZYA 1IAQA 3N8IA 4RKWA 4ZO7A 1T3SA 2WIFA 4TM7A 3FDJA 2HQBA 1HG1A 3R0QA 2VP9A 3I2YX 3QGMA 4JV5B 2ZB8A 4CDRA 5LA6A 2O06A 1PG0A 5F1YA 1I7LA 1O6CA 3Q8KA 3NYRA 2Y0PA 5FJJA 3C8UA 4XIIA 2UUBB 4POAA 4UOZA 16PKA 4ZYWA 2O14A 5L45A 3LC0A 4OLJA 4PF1A 4RF5A 3W6OA 2AXPA 1S4QA 4G01B 3FB1A 4ZZ3A 2ZQZA 4CEHB 3CNEA 2XRYA 5SZJA 3ZQJA 2QLFA 2GA8A 2VRBA 2JFBA 3FLMA 5IHPA 1CEXA 3WNCA 2X5OA 2CF5A 3GJ7A 4YA6A 3LKDA 3NJ8A 3ZEAA 4M87A 4TL9A 4QFMA 3OKCA 1FDRA 2ODBA 2OENG 4GQBA 5B2ZA 1DWQA 5DTIA 5FTLA 1PWHA 4I1RA 1RP1A 3W8DA 2REXB 4ZDIA 5DVZA 3Q2KA 4JS0A 2TMGA 1T8UA 3UT0A 1JKIA 1K66A 1TMGE 1VP9A 4R8SA 3RO7A 3OQIB 4YWJA 3EC2A 4ICIA 4N18A 2PG3A 3OWHA 4PO8A 3IKJA 4N0DA 1CUSA 3H6HA 2WUWE 5L3RA 1DL5A 1FUEA 4RD0A 4GZ6A 5T4BA 1HEUA 5K3EA 1QYRA 4NDNE 4UM5A 2C4UA 1Z4QA 2XITA 1P1RA 2MR6A 1J22A 2D00A 2Q3JA 1PN3A 1QQTA 1QGOA 2MR5A 5JPIA 1SD5A 2GPYA 4YJKA 4ABYA 1YE8A 3PXGA 3LZDA 2I4MA 2VPZA 3BIFA 3F8WA 5IVKA 3RKUA 4IX1A 1PSWA 4AJ2A 2FEXA 2IU0A 3N0WA 1C8BA 4DRXA 3ZE8A 1UBFA 5TJHA 1R0ZA 2GBFA 2W6QA 2QTFA 3TIIA 3WWZA 5HP4A 3CPEA 4NBVA 1G5RA 2IYTA 3D3QA 3LL7A 1X1SA 3F7TA 3HKDA 4MCIA 2GESA 1S2IA 1TJPB 3IOEA 2FRDA 2JD0A 3JQ9C 4Q3OA 1M3SA 2I7DA 1THMA 1UFRA 2PLNA 2XUOA 3K5PA 4IXJA 1RBQA 1IAVA 1M2EA 1YONA 3HYRA 1L8XA 3FVRA 5E6UB 5AVQA 1Z0JA 2H5JA 1KE2A 4X62B 1H42A 1BE8A 3DMNA 3FBTA 5DBHX 1G6HA 4QTUB 5C31A 3VJMA 4S24A 1HDGO 3R0VA 3ZHXA 4KDRA 4L07A 3ZXYA 4HDNA 2PX0A 5WRFA 4FGUA 3IE2A 5IDVA 1XTSA 4WIAA 4C87A 5KOHB 3FKSA 3TR5A 4G1MB 2QD1A 4ODIA 4CL3A 3QVKA 3EGXA 4JCCA 3AFIA 3VU9A 2DXIA 1LCIA 1LDBA 3KB2A 3CB2A 4UXJA 3OX2A 2I6SA 4LGVA 5JVDF 1NVBA 2FRVA 4L9AA 4Z3KA 1GILA 3CVJA 4E2XA 2ES4A 3PC7A 2BHSA 4OQPA 3QXSA 3U56A 4R7GA 2DKOA 1FMLA 2F1RA 4JBXA 4MW1A 4YUYA 3P27A 4CLHA 2ZZMA 4MI6A 3GFGA 1PZFA 2EIHA 4E5YA 4C89A 4ZI7F 1ZN8A 2X5KO 1RHQA 1EAMA 3BRWA 1J7JA 1U7PA 3IEPA 3N2GB 4IICA 1CUGA 4LOHA 4YJ3A 1O58A 1NR7A 2ZBUA 1ORVA 3QV1A 3UJDA 1AO3A 1DJNA 1IM2A 1VBFA 2G7ZA 4PM4A 2G40A 1DKPA 1UKAA 5DRTA 4DA6A 3DXZA 4OD0A 2AXNA 2ZS8A 4EYEA 2A0FA 1SOWA 3H19A 1CF2O 4BFWA 3IFSA 3FHLA 3D6MA 4PYIA 4FXOA 2VHTA 2Z6AA 2O54A 4Z9AA 3AG5A 1ENZA 1JTVA 1CY6A 2XX3A 1I3MA 1NF8A 5HJ5A 4ZZ0A 1YRBA 4HGRA 4LC9A 4KMOA 4MWTA 4M1MA 4U7GA 3PFGA 3PPXA 1X7WA 3S7TA 4IDGA 1QC5A 1KO8A 3MMZA 4GMFA 4B09A 3PGMA 3E05A 1ZH6A 3MCUA 2H4XA 4XX1A 1ZMOA 2ZE7A 3HMKA 4KWTA 2YY5A 1C0PA 3UMVA 5CA0B 1U8TA 3BC1A 5DXJA 1GFIA 1C1DB 5BW5A 1W36C 1NMQA 4HDRA 1JH9A 4KFTA 3GRFA 4LNAA 2J9YB 1CR1A 4L73A 2H0AA 5GAJA 3C4VA 2IH5A 4MKFA 2VDOB 1T0PA 3A4LA 1EJ6A 3FDXA 3QX9A 5T3UA 3ZY5A 4BTLA 3TRIA 2VBGA 5DHRA 1KH1A 4LY0A 2W0MA 4N40A 4XM0A 4EF6A 2GAIA 4O1HA 4YHBA 5DH9A 4FFNA 3Q9LA 3Q4GA 2WDZA 1KSJA 3KL2A 1OHHA 1ZQ9A 4F11A 4H4EA 1W5FA 4OLFA 3U4GA 2XB8A 1WMDA 5EUMA 2EKDA 4HQKA 1KC1A 3V1KA 1MGPA 2I7TA 4WVLA 4HDKB 3GP5A 3ZJVA 2PZEA 3GAAA 3AEUA 1FFAA 2WK1A 3H4TA 2QQ5A 3LUGA 4XJSA 1JEQB 2XVAA 1Z38A 4XFJA 4ZQFA 4K3VA 3G2JA 1SZCA 1YVPA 3DLHA 1V95A 5GP1A 2JKZA 3VR5D 5K3FA 4E5SA 2E3JA 1NIPA 3N0RA 4EO4A 2PMCA 2PGLA 5KHAA 2ANBA 4UTVA 3RV4A 1FDWA 4BOYA 3PPWA 5K4AA 1JQEA 3TOCA 2C9ZA 4OY3A 5JCOA 2BN4A 4AT1A 5K20A 1NYTA 1YJCA 3H1AA 3O8QA 3HE3A 4PC3A 5K4HA 1I80A 4YGYA 2NO4A 5FI5A 3OZWA 1QGUB 5BQ3A 4CKCB 2PX6A 3GCDA 2NXEA 3GK3A 3PIIA 4H7IA 4JUCA 4PAOA 1ZD4A 4WHMA 4Y2UA 5CBPB 2XEXA 3L0SA 5HIKA 4FQ8A 1PO7A 2BEKA 4XWTA 3BXEA 4OGKA 3ZU4A 4CV3A 3QWIA 5FL3A 2KS6A 5B1YA 5C1PA 2RGUA 3DO8A 2RHJA 4KPUA 4F06A 2OLJA 3UENA 4ARSA 2DKFA 5AKHA 1BWQA 2PU5A 3ZIAD 1FUUA 1G2IA 1Q1ZA 1YHNA 1X92A 4JR0A 4B79A 2WC1A 1ICEA 4RA9B 1PK7A 4P3YA 3HJFA 1I4OA 4Q1DA 1CSEE 5F21A 2FLVA 2BFBB 1GFSA 3AHGA 3IPAA 4GR5A 3U09A 4O59O 1UC8A 1DXQA 1CNMA 3VXKA 5J9FA 5DWDA 1Z5OA 1IZYA 1XHFA 2P2NA 2NSLA 1U9ZA 1UPAA 2WWGA 3AJRA 3CLTC 3G89A 5THKA 4V0NA 1H3EA 1WJGA 3Q3GE 1RRPA 2QNBA 2OXFA 4PLPA 3QF4B 3S2ZA 2JHGA 1JA9A 4Q0MA 2FP3A 2ZJ3A 3RJMA 1ZJZA 1PZHA 4GICA 4C88A 4DDWA 3TQCA 5BRAA 1V43A 4JENA 2R62A 1VE5A 4MIKA 3UH0A 4NZOA 1G21E 3OI7A 2B82A 1Z6XA 4IUBS 4QULA 3IT1A 3QVSA 3VV3A 3ZBPA 4MULA 4BE7B 1WUJS 1WZCA 1XDBA 3A4YA 1SBNE 1YDMA 1OZAA 2BELA 2ZRIA 3G17A 4QGAA 1JQKA 1M8PA 2CLDX 2M1XA 4LHWA 3MXOA 5E4TA 1DVRA 4W5HA 2P11A 3RIEA 2FUEA 4B7XA 1SQ5A 3LGAA 5IS2A 4UNRA 4S35A 3ND7A 1GSOA 3N3AC 4CR6A 3H2JA 3NQ41 1DFGA 2IHTA 3COYA 2ATEA 5DIZA 3TZKA 5FBWB 2E6KA 2QLNA 3SEZA 1R9GA 3L4SO 5A1TA 3G5TA 3B1WA 4KIGA 1OWNA 4REQA 4R4JA 1BN6A 1N77A 2P91A 1F6BA 2P67A 1CIVA 3F8SA 3QFHA 2HR1A 5GONB 5HOQA 1BAPA 1P7YA 4YIHA 3OZSA 2H1RA 4EVQA 5H82A 4HBZA 4WY8A 2WB2A 3MB8A 5F5LA 4BVEA 2BBTA 1FYXA 4C7VA 1SOMA 3CPSA 2X1LA 1N33B 3K9GA 4RUKA 3CUWA 3ZE7A 4LYAA 4AP6A 3OKFA 2EF1A 1Q1QA 1U5BB 5CLGA 4Q1VA 3G8DA 3O4HA 1ZWKA 1L4EA 1Q92A 3THWA 5FOQA 2KLBA 1EEXB 4ZTUB 2IYQA 5HZHA 3T5MA 4D98A 2OXEA 4FDTA 2A4KA 3C1UA 1NAIA 1JFLA 3C45A 4HAYA 4URXR 2CY0A 4GKKB 4K9MA 2L18A 1NUQA 3JU3A 3V2GA 1JMVA 1YB6A 1NASA 2W7TA 4GX0A 1O0SA 4ZODA 1HM5A 1GVNB 2IS2A 4RPLA 3VUFA 1CUXA 5DCLA 4D4HA 621PA 5ESWA 1WU8A 4M0KA 4K46A 4Q39A 2XOEA 1L8OA 2VQ6A 2WSMA 3HHEA 1KK3A 3BPSA 2GUWA 1K8ZB 2ERCA 2PVSA 4GUDA 4TV9B 2VRNA 4ZOLF 5FADA 3WLOA 4DLWA 4AWXA 2RFLA 3O1JC 3DE2X 3PL5A 5EKTA 5IEJA 4LTMA 4OAQA 1RLTA 2WJ6A 2C82A 1E18A 1GGJA 1XU4A 1Z7GA 4QEZA 3TSZA 2R8ZA 2QTVA 5TV2A 5DGIA 1T0JB 4IGIA 2IPAB 4L5BA 4DNQA 1VOTA 3DBLB 1KEPA 3UMMA 1NY5A 4RV4A 1X86B 2DTEA 4HGPA 5LA6F 3TUIC 4AO8A 2IJGX 3QVMA 3GQVA 3VH4A 4ALNA 4RD1A 3FTFA 2AGVA 5AQ1A 1J90A 4LNUA 4WH0A 4BX0A 2FQYA 2AJCA 3JALA 1NKTA 2B6NA 1UMBB 3LLMA 3MD9A 3R40A 1BCSB 1EIZA 1SKYE 3Q85A 3QUBA 4HPJB 4OQLA 4P81A 5EIFA 5I7WA 2OILA 1O4WA 3LBIA 3NPAA 3VZCA 4PO1A 4S1VA 5HK8A 3ZOZA 5E95A 1YR2A 4IGFA 3JD2A 5AUNB 5IBCA 3G9QA 2VHXA 2XKBA 3ADDA 3OZTA 4HWOA 3VH3A 3PRYA 2NIPA 1OD6A 3DZGA 1OFUX 1BRMA 4QSMA 3FYTA 4MWCA 1ULTA 2X0JA 1RC1A 2PZMA 2ZZKA 4G5SA 1VHJA 2FV8A 1X2BA 2XB9A 2G0TA 3M1IA 3N6RA 4RQAA 5GJWC 1DELA 1FJXA 2Y1EA 4GDFA 4JLOA 2WIAA 4QOEA 3PQEA 2FG6C 2XUKA 1C41A 3WK8A 4DM7A 4KGVA 5JD5A 2IDMA 1O95D 4AVYA 4C3UA 2E48A 2OGZA 2PSFA 3ELBA 1JA0A 3QVTA 4MLZA 1V4NA 1YV9A 4RVOA 2VYVD 5C8DA 5EWMB 5JXJA 1GTG1 5C46F 4N7JA 5JS6A 2IUFA 3H0EA 3WE7A 4WKPA 1QBKC 1MZPA 4YMTA 4Y2RA 4OHKA 3FA2A 3DBRA 2R8XA 4DY4A 5BWMA 4DV7B 1N9GA 1K92A 2B1GA 1PQWA 3NGMA 4FDVA 4F2PA 1WHSA 3FLAA 2E87A 5AESA 4LE0A 5ILOA 2GZDA 2VZ0A 2C2ZA 3PVSA 1GYQA 1I8TA 3I5AA 4FZ5A 1Y3DE 2UVDA 4BO3A 4QYSA 1ZCBA 4Z7OB 4ESEA 2PX5A 3JQFC 1KA9H 2BRUA 5IU6A 3MEQA 3AEYA 3O93A 5HBGA 1W2HA 1C3OA 2Y1GA 1YS2X 4FBMA 2QWXA 1MX3A 1SVLA 4FGLA 3B70A 4HWTA 1R37A 3EWNA 1XN4A 1ZKDA 2ZTMA 3F78A 4MWGA 4QVGA 2I6UA 3P9XA 3RIMA 3TVYA 2OL4A 2VH1A 3PDJA 1NN5A 2Y1CA 3DE6X 1UANA 3RK0A 1Z2AA 2DECA 1ADCA 4ZO6A 1W96A 2YJNA 3G0BA 3MTGA 4UEWA 4B84A 5LOVF 2WA2A 3ZXUB 1U94A 3KIPA 4D9KA 3KYDB 4E3WA 5HRAA 1L7BA 2VNAA 4L3VA 4BNNA 4EPTA 1UIRA 2V6GA 1BG6A 1YFLA 3D7SA 2XY4A 1H69A 3TB4A 3H5WA 4EEXA 2ONYA 3MW8A 3AHFA 3UAVA 2D0DA 4HLQB 2ZYGA 1LDMA 4K81B 2YN2A 1BW9B 3CLTD 4ZPXA 1IZ9A 4QICA 2W2KB 2YXDA 4MHSA 3HRKA 4TMVA 3GUHA 2EFEB 2R86A 4K9KA 1HG0A 1PDVA 1M8GA 1NPDA 2K87A 4LBWA 1COZA 4PBRA 4BKOA 1T5BA 2ZUWA 4X91A 4Y0VA 3ZV4A 4CEJA 5I4KA 2BUAA 3AEQA 1UPFA 1XXHA 2PMDA 5DLYA 4QNMA 4CODB 1AGNA 5L4NA 4N3NA 4ZREA 2O6LA 3NXSA 5EQFA 3VAAA 5A4MS 5HEKA 1OFGA 1KI6A 2P2LA 1A9PA 1CT9A 2YQZA 4M1SA 4N5DA 4TSFD 5KDDA 2FPXA 1K5GA 5ALPA 2R1TA 1JJ7A 1PJ2A 3N6VA 4UUNA 4DLPA 3UEOA 1QFSA 1IJKA 5G02A 3ZWCA 4L9SA 4JT2A 4ZT3A 1KMQA 4Q3AA 4F2GA 4DDHA 4PLFA 4ZVVA 2B1QA 2VRCA 3N87A 2XT9A 3GPDG 2ZJ5A 1MXHA 1N6RA 1E94E 1U28C 1WXFA 4KE7A 2ORYA 3R20A 4BC0A 2Z6QA 3N59A 3PQ3A 1SUIA 2XQFA 3IBFA 1GPLA 1QPZA 1XB2A 2V5VA 4L0QA 1XZCA 3GHYA 2W43A 1L7AA 1AA9A 3WLQA 2E0IA 3I04A 5J2UA 3LPAA 4PNHA 1WW8A 3T7RA 2I52A 1PJAA 4JLMA 1DARA 2GK3A 1FMTA 1A5ZA 2A6PA 2HCTA 2F17A 1IDN1 2EZ4A 3PF9A 1VL2A 3TVTA 1S4MA 3E7DA 2I7XA 3I09A 5LC1A 4B87A 4DAOA 5HA5A 5KPDA 2B30A 1S2DA 3IAFA 3OJOA 1RSZA 4DQXA 2VYFA 1NHWA 3TW6A 3SJZA 3CO0S 1SEVA 3NVAA 3FGNA 3K94A 5H02A 1D2EA 2AOTA 3PFHA 2HTEA 4G1BA 1UFVA 2B2NA 1UOOA 3PTLA 3PIDA 3WDSA 3G2NA 1W49A 3TTWA 2WMDA 4YXFA 4QXPA 3GRAA 4IRXA 3UOAB 1XLTA 1P9WA 2XT0A 1W44A 4C0JA 4ZGGA 3ABIA 3NJRA 3C14C 1E5QA 2YWGA 3QUCA 1FFEA 1DEXA 1PS8A 3M34A 3V4ZA 2WEKA 1N92A 3A9RA 1IEWA 3HCWA 3LP5A 4G1VA 5F9MA 5AWFC 3SHTA 4D25A 1RHJA 2I8LA 1OIWA 1JECA 2PPVA 2QRKA 4JLDA 5CCDA 3SLRA 3OE5A 1BO6A 2XHEA 2NZ8A 4G9EA 5G1NA 4H0NA 2BMAA 3FRJA 1R10A 5BYBA 4UVHA 1J56A 3IUPA 4Q02A 4OHRA 5CT6A 5HTKA 5C1BA 1GLNA 4KQCA 4LG1A 3H97A 3DEFA 4LK3A 1LSSA 2R1VA 1WOYA 4WJKB 1XTRA 2D7DA 4RTLA 1B42A 3MOGA 2IEDA 1IULA 3FLBA 4KGXA 4URYR 4NG4A 2QMYA 4I9NA 4OKNA 2XNCA 4Q01A 4HXEB 4C43A 1EVQA 4LA4A 4PCUA 3EK2A 4AJIA 1H8HD 1V8DA 3OZGA 3QEJA 2J0SA 3JSXA 2X9LA 1N8KA 3I3OA 3MF4A 4HC4A 4MVWA 4H6WA 1KETA 4IVNA 2A86A 2WWHA 2SCUB 4V38A 1EFRA 4ZP1A 4ZAXA 4FC7A 3MUEA 1MUUA 3GMSA 1VPEA 5HZKA 1OH8A 1J4AA 3GNTA 4KYTA 1OI2A 1BKYA 4J2HA 5CFMA 4TYWA 1X6VA 2QW1A 1E60A 2F00A 3BK1A 1H9BA 2VDRB 2WZDA 4MVXA 4RE5A 2O0HA 2WPDD 2ZWIA 3T5CA 5DYNA 3F3YA 4NL4H 5T6MA 2PUAA 1HOXA 2OLKA 1WWKA 1VRWA 3D8SA 4P0TA 1HDYA 3FSGD 4YJFA 2QV0A 5FL7D 4OP3A 3F1KA 4J94A 2VC2B 3A6JA 4YRGA 2AEEA 4MLPA 2EWWA 3BE4A 1QQ6A 1YQQA 1ECBA 3QMMA 3SBOA 1PT7A 3CJTA 3T5TA 4X61A 3U3DA 4JQYA 3ZDFA 1IJBA 4BFLA 2DTDA 1ODIA 2CNWD 3AUUA 1QANA 3GV0A 4OAOA 3UHPA 2H18A 4AX8A 1I14A 1MEJA 3FCOA 1ISRA 4RSGA 4GPBA 1VMKA 2EEPA 1VL0A 4UUMA 1OCEA 1VMDA 3ZNOA 3R9WA 4BAZA 4GHWA 1KDYA 4LYGA 1SXJE 3PBKA 3J7AC 1G3QA 3AR6A 5I47A 5A3JA 2HKIA 3UAGA 1UT5A 4K40A 1NHGA 4HB4A 1KO5A 1XDGA 2W6ID 1QWOA 3G2KA 3HBFA 2HMWA 1SK8A 2JIQA 3OIDA 1T4MA 3R5FA 3D6AA 1GTL1 5E9QA 1VIYA 2H8KA 3B1JA 2BONA 3N58A 3H8JA 1VSUA 3IAS1 1UKBA 3NOOA 3HSSA 3IESA 3BMXA 1H85A 4C6HA 3Q5DA 1HYEA 3OEHA 3V6LA 2ZR9A 2OLEA 2QORA 4FNGA 5AT1A 5DM60 2VJDA 3G0DA 1M73E 5KS2A 1E2KA 3EXG2 4G2TA 4N54A 4DJEC 5AI4A 2CNBA 4F1JA 3I6ZA 2VHEA 3EB9A 1C8LA 2GLXA 3RRMA 4S0XA 1BXRB 1EK1A 1PNQA 4UQPA 5F2KA 4Z3OA 1SBTA 1RAFA 3RS2A 2GYYA 3UIEA 3BWEA 4DIDA 5LM3A 4YBRA 4A1OA 1AQNA 5DHPA 4AYWA 4MINA 4O1IA 5KTNA 1WX1A 4ANFA 2J4DA 1PZXA 4R71A 5A6SA 3C5VA 5ILQA 4Z7NB 2JVIA 5JNLA 4QM7A 4UE2A 3TK1A 1SCNE 2N75A 3HYSA 2BC9A 2OZPA 3MT9A 4OMUA 4L85A 2RGGA 5AW2A 3FUUA 3TX6A 2V7BA 2AJ8A 1NUPA 3UWMA 3PCXA 4BBAA 3U60B 5BV7A 1GTZA 5KI6A 5FTNA 2FR8A 1RPTA 3M6FA 3T06B 1XTJA 2IPOA 2X23A 2P5TB 2XODA 2BDUA 1E5DA 1TL7C 1KDTA 1UQRA 3DYIA 3EBOA 4OV6B 3ZV5A 3NCHA 4B8ZA 3RSGA 2QSJA 4BQFA 1JHDA 3SWWA 3FTEA 2GRAA 1GYPA 3K9BA 1SVMA 2X4IA 4QELA 4EMTA 1DJMA 1XD2B 1GP2A 4HEHA 1SOVA 1WAMA 3ZJUA 1SA0B 1P18A 3L8FA 4M1EA 4X6LA 3G0OA 5C7OO 5KKCA 1U9JA 3D5TA 3NVMB 3R3VA 3IVRA 3OETA 1HI9A 1Y8AA 3SJBA 1HLGA 2B98A 2E4WA 2G28A 2PNFA 3KSRA 1GZVA 5DHUA 5DYYA 4AM8A 4AWAA 3WXMA 3BE6A 3SHVA 3PTZA 2DR0A 3NHYA 2IECA 4WXYB 2VTVA 2WSLA 2OV3A 2PUDA 2E5FA 2QLMA 3TL6A 4PZCA 4R1NA 3FFBA 1I3NA 1HDZA 1R6DA 1Q17A 2R6ZA 4Q3DA 2ZXUA 1VL1A 1TQDA 3BWBA 4OUDB 3K0SA 2E5LB 4JR1A 2EAUA 2R0QC 1E3SA 1V2GA 5COBA 3DZIA 3IQZA 4U2CA 4LW8A 3PG5A 4QA9A 4MUFA 5KWEA 1QIDA 3BB3A 5FPSA 4M46A 4YDHB 3K6RA 4QC2A 2PQ0A 2QX7A 4OKIA 3A05A 5EIAA 1O0BA 2BFEB 3DM9B 1YF3A 1SD2A 1H0RA 4BP8A 4FW9A 2HI0A 1CV2A 3ZDEA 3GU3A 2P2ZA 1EQUA 2FRXA 1L1FA 1EH5A 4J7XA 4Y2YA 1JLLA 2CHVA 1CUJA 1NRXA 3F71A 3C85A 3NH9A 4INOA 2C2BA 4L3WA 4L76A 1LSJA 3CPJB 4PGGA 2EYUA 3LWDA 1EWQA 4ZCLA 3I6QA 1RAIA 4GX2A 4H7KA 4LRQA 1J7KA 3RUIA 4BZZA 3LHIA 4XQ9A 3V9PA 1YFZA 3BKWA 5EXCA 1MZVA 4MVJG 3RUHA 4E11A 5AUPB 3LCRA 5JE8A 4Y9TA 1Y6FA 1EAYA 2RH5A 5KC8A 1UMKA 2NTJA 3LGXA 3TZHA 4OXIA 3UO8B 2CE7A 4DUZB 4UAGA 4QTXA 1D2HA 3W79A 4CIVA 1NQOA 3V4VB 4Q1CA 4PX3A 4LXXA 3IEKA 3SVZA 3C3AA 4ZAFA 2XB2A 2VEDA 3DB2A 2FN4A 4MNTA 5BXYA 1FP4A 4DG9A 4OCZA 5JDIC 2HRDA 2X0KA 1M6HA 2Q1SA 3HO8A 3PNYA 1CE8B 3IP8A 4LTNA 1BXGB 1U2ZA 3VU3A 1NOJA 1AQLA 4CM4B 4CQJA 3HR4A 5LP6B 5HUJA 3TOXA 1KNXA 1NNUA 3ND9A 3GFBA 4L74A 1WCXA 2GK4A 4F6RB 3CVVA 2BBSA 4AKIA 3TSYA 1YB7A 5FBLB 4HEA1 4JBGA 1UM9A 4UVDA 4GSKA 1QR2A 3G82C 2BGUA 3TBKA 2FDCA 5DWVA 1GJRA 5EJ7A 3HCCA 4HRAA 1SKQA 1SNYA 3H5IA 1U99A 2RAVA 3LIPA 4I8DA 3U9LA 1RXVA 4L6CA 4IEIA 3N3BC 1SWVA 4NNPA 4ZVLA 1CZUA 2WJVA 1R16A 2FX5A 2X86A 1U0SY 1WPQA 5IKEA 3ETLA 4X1YB 4DLRA 4N4AA 3I5YA 3FF1A 5D86A 5LU8A 4QDJA 2OK8A 3CBGA 1JB9A 1L8QA 1NFRA 1HO3A 4R68A 1FFCA 1P2DA 1UBTS 3E9RA 4HK4A 3RVLA 3U16A 1USWA 1GUDA 4I66A 2A59A 2AFIA 2ZJZA 4YV2A 4NSNA 4K9DA 1V2HE 3MJVA 3GXBA 4DLXA 3UAWA 2IZOA 5AI6A 2W2LA 4LRUA 3RK1A 1NBOA 2H3EA 4NS4A 1NBHA 3D2BA 3ES9A 3FYDA 5ITZB 1MABB 2Q6OA 1TQ4A 4P5PA 5DLQC 5J2UF 3EGCA 3VR6A 5TF4A 2GD1O 1Q95A 3GC6A 4LDAA 4RHTA 1W4AA 3AUSA 3ZDDA 2ZBPA 4BMXA 3WX0A 4FTWA 2RD2A 1IM5A 5EJ6A 3OTWA 3OX1A 4ZEOA 3ZY6A 4E5UA 5FOUA 3NP9A 1EX1A 4PLVA 4OL0A 3DS8A 3T41A 4D5EA 3G9UA 1LVGA 2GLUA 2PGXA 4TL8A 3QBTA 3K1JA 1YNOA 4GS5A 4OMDA 2RKBA 3KKEA 2ERYA 3V4FA 2HYIC 5EZYA 4FI3F 2GBPA 2Y67A 3G5UA 1OJLA 2XJ9A 5ERYA 5CG1A 5FLXA 1UP6A 5K3SA 2GM9A 7MHTA 1LS1A 3UATA 3WLNA 4EKGA 1MP0A 1GCAA 5TPWB 4FBGA 3W5CA 3KSDO 4PSUA 4N65A 3IEMA 2BFDA 2DOKA 2EJVA 2X1HA 3BA1A 3MINA 5M04A 1CUVA 3RWBA 5JROA 3AJ9A 2JFQA 4A82A 4K6FA 4TTRA 4FCVA 3H42B 2JBHA 1YB4A 5DNWA 1ZVVA 3PQ6A 1QRSA 3NV7A 2WINI 3VV2A 1L5MA 2OWEA 3MNFA 1FUKA 4EY8A 2X4LA 4H27A 4LJAA 3ZQ4A 3HB9A 2HREA 2BPOA 3ZCUA 1C8KA 1DOHA 1BFDA 5A5FA 3LBFA 3KPYA 1RZUA 3L1JA 5KOIA 4CMCA 3KQTA 4IFIA 1GO2A 1TQHA 4UREA 2A33A 4M0DA 2ZUDA 5ED4A 5B53A 1JALA 3QKWA 2OC4A 2HBRA 1Z6AA 1AURA 3EISA 3OZCA 4Y1FA 5AM2A 2JBAA 4U2KA 3SE0A 5AW6A 2H52A 2Q6LA 5AJVB 4DVJA 3BMCB 2D8MA 3MUOA 4PQYA 1M34B 1DAKA 2ZTVA 1U9YA 3TDMA 3IO5A 2IPNA 3CEMA 3TFQA 3WKAA 3R8FA 2JLYA 1MOZA 3CZCA 1EX7A 4BB6A 4B80A 3L6EA 4NCBA 3IUBA 3ECSA 4KQ9A 1DOAA 1EFCA 1ULHA 2AF4C 2R66A 3NDIA 3RV3A 1TPZA 1Y82A 4JB2A 2QL7A 5C8XA 1CP2A 1WKCA 3EDYA 4ACBA 3A7DA 1GPH1 5EXEA 3R3YA 5HKLA 2GEJA 1JLMA 3E9MA 5A02A 1H2ZA 5C5EA 2CEAA 5E8RA 4C4XA 1MAWA 1ISSA 4HAUA 1RRFA 3TYXA 3Q98A 3SC2B 3FTPA 3OZAA 2IV2X 3F1LA 3Q11A 2W2MA 3VOBA 1XFAA 4DUGA 2C8JA 1GAXA 1ARZA 1R8SA 1L9KA 2PT7A 4RAQA 4DIEA 1KERA 5IVDA 1GQFA 1GR1A 1DO0A 1C80A 2WOOA 4OB7A 4AJKA 1T3HA 4X54A 1DBWA 2HN9A 2I65A 2D2EA 3FPBA 4RQBA 3ZHSA 4D3DA 4E94A 1B41A 4M86A 3H2YA 2OORC 2JDIA 4Q82A 3W2GA 4CVNA 1Y5NA 1XX6A 1DG9A 2DPMA 2HA0A 3L8HA 3NBKA 3TBFA 5B7NA 3HUEA 2NZWA 3MWEA 2ZRNA 4LE2A 4B2IA 1RD4A 1OX5A 2O2DA 3D4IA 1WABA 1W25A 3WHKA 5B58T 1PNVA 2E9SA 2OKCA 5BWOA 2ZJ0A 2IIPA 4AN4A 5ALEA 1JSCA 5BT9A 1K97A 2O7SA 4KE6A 4E31A 2G4VA 2AMFA 4RKEA 3UJ6A 2GS9A 3PD7A 5DTRA 2XDWA 4KE8A 2QXUA 5EQJB 4Z0HO 4P3XA 4IGAA 1IC6A 4DBLE 5IAJA 4CLOA 1F2UB 4Z49A 2OFOA 3JQQA 2CDBA 1I33A 2JAQA 3OH8A 4LHZA 3X44A 2QW8A 5AJXA 1IK6A 3AHCA 3V34A 3Q7TA 4DJJA 2IPLA 2C5AA 2JB9A 1SHLA 4LYDA 2OFWA 2QQ0A 3M8KA 3DJYA 1O1YA 1H5NA 3B8HA 3D7LA 3DPSA 3GNSA 4TL6A 3A37A 2CC2A 1VKHA 2ESRA 3B12A 2O8NA 3RU7A 4CW7A 2UXDB 1N4DA 2JLCA 1JV2B 4YRQA 2MSDB 4P83A 3TG2A 4B46A 1XC7A 2Z9BA 2BEUA 1KJ9A 4K6MA 1NR1A 1V37A 3A10A 2B4QA 3PC6A 4R3UC 4UMEA 4QBHA 2AMVA 1JJBA 2Y1KA 4JQCA 7REQB 4RTRA 4IDPA 1XEXB 2JCYA 4KQMA 3NKVA 4HAVA 4X3PA 3C7KA 1PIWA 2EQAA 3AKYA 4AAYA 1ZUWA 1YQXA 1OBVA 2D3TA 3VC3A 6CHYA 1II0A 1BVHA 4WZAE 4CEIB 2F62A 1PLKA 2DBRA 5IC6A 5JSYA 3BMNA 2PR2A 3GELA 1E2NA 3OT5A 4IGEA 4CIWA 4ONEA 3HM9A 4D8VA 2D0OB 4ENPA 3QVUA 2X13A 3I28A 5JYCA 1BMFD 3K70B 1Y81A 2YWBA 2XTAA 4JT9A 4U39A 5B55A 3WGHA 1D07A 4XFDA 4Q4CA 2W6OA 3H04A 1RLUA 2JEOA 4R3NA 4E1AA 2P1DA 1MTZA 2Q3DA 1ZOLA 2EWMA 1FRNA 2QZZA 2Z2IA 3QPAA 4MYUA 4W1SA 4NULA 5FUVA 5LP6C 2WI8A 2W83A 3MGBA 4A2CA 1ZXLA 2RE8A 3KYBA 2O6HA 2RHRA 3CZRA 2O8BA 2SECE 1XRSB 3U4CA 5F23A 4KWIA 4U4AA 4ZI7B 1FJGB 1CF9A 4K87A 3HB0A 2F67A 4F6CA 1UAGA 3FZYA 3KS9A 5TY0A 1TD1A 1VE7A 2C97A 3NBZC 4HSEA 4XD2A 2TMKA 2QLBA 2BF4A 4TRRA 5J40A 4Z2YA 2PNJA 1EGAA 1FRZA 1IB6A 4NU6A 3WGGA 1ID8A 4RSHA 1DC5A 2FHPA 3GQBA 3OF3A 3E82A 4GI2A 3WHIA 3WLEA 4URFA 1DC3A 3UKDA 3MIIA 3W6ZA 3MMSA 4CMIA 2A0YA 5TSDA 3L06A 4JA2A 3BJIC 4UAJA 3VDNB 3W5UA 1NI4B 3RC8A 5CNIA 4OB6A 4B1FA 4MQFB 1ZXBA 3ZWVA 5EJEA 1EGQA 4JLBA 1IQPA 5KUTA 3P5BA 2Z2JA 2ZYVX 1E4EB 1WB6A 2B9VA 3EXFB 1GG9A 3ETGA 5C4GB 3KJGA 1H66A 4D2IA 3KXPA 2W2QA 4LDJA 5F7OA 3GLGA 1AB6A 1U2TA 2I78A 2QTCA 3BRCA 4BLQA 4EY3A 3OX3A 5LD2B 2MMCA 1ZHFA 4PRKA 1T8PA 1AVTA 3GEBA 4UVIA 2EX0A 4FQ7A 4EUKA 5KHLB 1MAUA 1V4VA 2I6GA 2WG2A 3HL0A 1RJGA 3OZ7A 2VNHA 4OF4A 3S5UA 2C8VA 3JWJA 1NV9A 3I4CA 3V1LA 3SOPA 1ZO8A 4FGKA 4CF6A 2AYXA 4HLCA 4NY1A 4B3XA 1XNGA 2HPHA 1DQYA 1VJTA 2J85A 1ZUNA 2ZS7A 3CRRA 4MQ4A 1Z28A 2IXAA 4MJXA 5F73A 4M36A 2ABWA 2PRKA 5K0FA 3BK2A 3DE1X 1IHUA 4BO9A 2GFQA 1PZGA 2G63A 3L01A 4XD7A 3INGA 1A4UA 5EIOA 4EDHA 1W1IA 4E32A 3GROA 1E6MA 5JAZA 1A9XA 4WN9B 3ZCRA 3ZJTA 2ZKIA 5AHWA 5BSHA 3LZCA 1H2WA 4AJHA 3NRJA 5EUQB 1JUDA 1AZLA 1ZIYA 4XVQA 2PUBA 2YL2A 1YA4A 2VF7A 7GPBA 1JDJA 3VZQA 2O2GA 3OM0A 3SS7X 4C4SA 1T9AA 3VGJA 2B4KA 1SIOA 5EGSA 4RJTA 3TUZC 1SUBA 1TKAA 3RTGA 3F47A 2W4QA 5JAOA 1GGNA 5JCPA 5G0UA 4NX2A 3AFMA 1D6MA 3HABA 4UNSA 3CSSA 3IIMA 1RZRD 4DCOA 4O02B 3ZLBA 5EJAA 1T6XA 2RHBA 4TMTA 1UDXA 2QROA 3IGFA 1NXVA 4NAVA 2BISA 3WWPA 4M99A 3GUCA 1POWA 1NKSA 4FYMA 2EP5A 1RTTA 1IB0A 2J48A 4TWAA 1VJRA 2RBGA 1GEEA 1ULAA 3NHJA 4WN3A 1NNI1 2C20A 2FPGA 2OK7A 2YW2A 3BL5A 1Z0AA 2NW6A 4J2OA 4JLKA 5LB4A 2WM3A 4RS3A 1TIKA 1U6KA 1BC5A 3ISTA 1UBKS 3Q12A 4FMDF 3CLUC 4AW9A 2EIXA 2FR0A 4F5DA 4BWYA 1JXAA 1HH4A 1DO8A 1KJYA 2N1BA 3GRPA 4M9UA 4MWZA 3RBZA 2WM9B 3ZWPA 2WYOA 3E9QA 3WLTA 2QJFA 2A2ZA 3EG9A 4ZJUA 2D1RA 3KPWA 1ZRMA 3LSYA 3ZVNA 3O2QB 2OEPA 1ULZA 1DX4A 3ER6A 4KZPA 1JVBA 4OOFA 2JJ1D 4BNZA 2EZ9A 4BNMA 1E63A 2XYVA 4TSKA 5CJPA 3HPRA 5F2NA 4RDXA 1Q3HA 1Y8CA 2IQ5A 4QGGA 3U7QA 2CBXA 1D0SA 5A3QA 1U0GA 3A2LA 1NI3A 2UAGA 4IHQA 2WIBA 1DCFA 3RHSA 4UATA 5D3MB 5IJZA 4GSLA 1URPA 3KUUA 1ORWA 5FWXA 5HE9A 5CFPA 1I7DA 1LLDA 2G0AA 2DETA 1P5ZB 3V00A 4EI8A 2B0CA 3DOCA 4J43A 5DP2A 2M2IA 5CT4A 4PE5B 1KSGA 4MRSA 4JI0B 4UBLA 1K9SA 3OE7A 3U81A 1EM8A 5KSOA 1IZ7A 1D2AA 2C96A 5LLTA 1P4AA 1BEZA 4WNCA 1H22A 3TB6A 2V1UA 1JPVA 1V11B 3AFHA 2DWOA 3GDWA 3HCEA 2WY2D 3W77A 3NHMA 5ICEA 1C7IA 3O8DA 1GU0A 4DDKA 1CRLA 1UWLA 2VAXA 3X1YA 1CVRA 1M7GA 4EB6A 1FTSA 1ZH2A 2XMCA 3RADC 2QN8A 5EZYF 2V1XA 1NFFA 2FI1A 3FMFA 3EZ2A 5JHGB 3B6IA 4Q9NA 1AGXA 4GC9A 2KSQA 3SJCA 4MWDA 2XVMA 2AXQA 3UMRA 4NEGA 1CQJB 3SSNA 5JMOA 1XU7A 3MT8A 2CHEA 1W19A 1UJ6A 5ECDA 4GBGA 1U2DC 1TC2A 2GNAA 1RMTA 1GKIA 1SOUA 3H5AA 2XW6A 3PEYA 3IQWA 1D1SA 3WY9A 5AVXA 1IVYA 3TJMA 4ARIA 1FVHA 5TXGA 2DFVA 3VH2A 3LQ1A 4LF8B 2B4YA 2Q9BA 4L50A 3OBIA 3KHSA 2BCGY 1RACA 4JXJA 1RFGE 3GGPA 5FYQA 2ISQA 3LVBA 3QEBZ 1Z7WA 1DWPA 3HA5A 1KI9A 4ND1A 1QJ4A 2DQZA 3R6WA 2PUVA 3GT4A 5CJJA 5KCMA 2PJRA 3F6YA 4EX7A 4ZOLB 5DB4A 1V1RA 2DPGA 3Q9NA 3NBFA 3KKPA 3K70C 3FNQA 2C2OA 4WGFA 5AKKA 2XUHA 4TXLA 1JYSA 3IHTA 1ZVJA 3LRPA 4IFTA 2UYHA 1CIJA 4QECA 1UPXA 4DQDA 2F3UA 1YI0A 1LNSA 1YQEA 2FWAA 4WSOA 3X1DA 2G1JA 3TXYA 3GRRA 1F8YA 2HRCA 3ULKA 4LI3X 4RDHA 4JJZA 2VJBA 2X2EA 5K6AC 3MXTA 4JD5A 4MS1A 1PJSA 3T7KA 1PFQA 3O3OB 4MP3A 5HMLA 1YDGA 3M6IA 3E35A 3PXAA 1OTHA 2O1EA 3G79A 4WCVA 4BRUA 3EIQA 3QX8A 4EDFA 1KTIA 2OCKA 2IX9A 4PYMA 1LZLA 1B6TA 3H4VA 4CMBA 1XMSA 2BP7A 2QN7A 1CULC 4E51A 3CCCA 3QYAA 3HADA 4FEYA 3OCZA 1UH5A 2WD9A 3CKLA 3LC2O 1T4BA 4QDUA 2YVAA 1W1UA 3DNPA 4L5IA 4B2YA 5AIBA 2CUZA 4FNMA 5D1NA 3CGWA 1UXHA 2KHZA 3PUYA 4L4XA 1NUTA 3UUFA 3QKIA 2WG0A 3DA8A 5F3RA 1IY0A 3FUVA 1AIPA 1N3YA 3L6OO 3MMXA 5C53B 5BSWA 3N8HA 2JIDA 3IULA 1GXSA 3NH6A 1G5HA 5J43A 3LY7A 1I10A 3HU2A 1FDVA 2QM3A 5LD2C 1XWIA 1U8ZA 3NDRA 2Z5FA 4FOLA 1TM3E 1KDZA 2CVZA 4LFBB 2FE1A 5J47A 3N0VA 2QXTA 2IBMA 3CURA 3T9CA 2WWYA 3DC2A 4ZTZB 1KRXA 4JYPA 4WXHA 4DA0A 5D51S 2Q5HA 2BKUA 2VT2A 1XF1A 4Z4QA 3A3NA 3CJRA 1CVIA 1NXWA 4V0OA 3ENVA 3VHRA 3WYBA 3OECA 1F9EA 3VKWA 1XT6A 3EA5A 5FI1B 1C5KA 2ATVA 3RK4A 3WLRA 3TI9A 2RKWA 4DRXB 1BVUA 1X1RA 4YP5A 3QLJA 1E3DA 5D85A 4BZQA 4W7IA 4C07A 3TQIA 1Y5LA 1CLEA 3FVWA 4AS3A 1JJAA 1ZM7A 3HKDB 3OOHA 3WC4A 1WBDA 1WDLA 1EG2A 2P90A 1XRNA 3CF4A 5EJMA 2Q4TA 1UJNA 3KV3O 3GEDA 4KXLA 4YONB 4YRIA 1GV0A 4W8HA 1BXKA 3A6ZA 4FYJA 1I1NA 4Z1MD 3OQ1A 1BH6A 5DBIA 1EFPA 2C88A 2IZ7A 3DZJA 2DY0A 2OHHA 4F8JA 4I3HA 3S6JA 4GH5A 1WBBA 1QYCA 4IIVA 5LOVB 3UBMA 2LCIA 4HDNB 1QLJA 2BGTA 3AP2A 3KLPX 3NLLA 4HCJA 1E69A 4J0FA 4YDRA 3ZY3A 1W76A 3H11A 2QE7D 3EGXB 4UCFA 2XUFA 3VU9B 4EZEA 2X14A 2EG9A 1TGVA 1E6EA 3EGDA 3T0GA 4YUAA 2CK3D 1K8QA 4HWPA 2VSOA 2AG8A 1ECGA 1G64A 1NVEA 1R5JA 4Q1AA 3CIOA 4O6VA 2P41A 5KQRA 4RZUA 1M10A 1X74A 2GOYA 4BU0A 1LRKA 3X1MA 4I1PA 2ZIUB 3CEPB 3IKLA 3UXYA 2IA5A 3TXAA 1JSLA 3H5RA 3KT8A 3EIUA 5JRDS 2VQ3A 3IAM6 4F2WA 2IS1A 1DTWA 4YJ3B 4DCCA 4OEHA 5AM4A 1ZDMA 4AN0A 2H08A 4NCXA 1P3JA 1X1QA 4DW8A 5CR9A 3CH7A 1RIFA 4GLFA 2PUHA 3VU8A 2GXAA 3PR3A 5HQ3A 2IZ6A 3DHVA 1G2QA 4MR7A 3DM5A 4JDUA 2ICAA 4WADA 2B5VA 2EQBA 4Q9LA 2I4IA 3TNDA 3O8LA 3CWQA 3H6KA 5CDFA 2IUUA 4TLDA 4WZ6A 1AUQA 1XLWA 2PX2A 4R8LA 5IAGA 3EVEA 3H3FA 5JD4A 3EPHA 2GF9A 1YL7A 1XCMA 4DLYA 3DZHA 1NVUQ 3T7TA 2ILTA 4G8JA 1KI7A 3UA0A 1NUSA 3JR7A 3WYCA 2II6A 2WJZB 2C8LA 2HO4A 1DADA 3FOZA 4IF4A 2HC9A 4EA9A 1KZ6A 2IODA 2QVCA 2HA3A 4TKLA 4C0HA 1L3IA 3WK7A 3KUKA 4HDRB 5EXXA 1VGQA 4NCHA 4OXRA 3U4QA 3A1VA 4H3HB 2V6IA 1L0BA 3G7NA 3OTOB 1XTQA 1XR3A 3VHXA 4ER7A 1R18A 5HSGA 2PIDA 1NTOA 2BKEA 1NJFA 3WJ2A 4BYMA 1Y5IA 2AB0A 2HFJA 3OHPA 1ZD3A 3D6HA 4HY3A 3RRJA 5KDOA 4GYYA 3AFGA 1V25A 3ZZTA 3CH6A 3PHHA 4WLNA 3LS2A 4JJ7A 4ENUA 3KAJA 2A9KA 2Q5OA 2OBLA 2QR3A 3OLQA 4P4GA 3U49A 3W2FA 3NWEA 4CV2A 3PKZA 3TKYA 3URMA 4TT3D 5IPFA 3UMCA 3QLUC 3AEUB 4WL0A 3JD0A 1TNDA 3F3SA 1G8HA 3EIXA 1IDOA 1JL3A 1JQJC 1T8SA 2NXNA 2WT4A 4GXTA 2ZBVA 5K3FB 3AK4A 2NO0A 4EYGA 4BLOA 4JOQA 2VPWA 5ALLA 1W581 3ICCA 1RYEA 1YRYE 1PEKE 4UCWA 1ZUD1 1T15A 3K0CC 4KB5A 2FSUA 4QPPA 3T61A 4RANA 4D45A 1WSAA 3I05A 2HEIA 5JDCA 1SULA 3O8QB 4IMRA 4ETMA 3SMVA 2E85A 2XQGA 2WUVA 3FGZA 4NH4A 1JIIA 2QR2A 4C4RA 5CVTA 4QT4A 1XZLA 4P7GA 2P4HX 2KW5A 3GUUA 5C5DA 4JDPA 4UJ3A 1M5RA 4MJ3A 3UCXA 2AEJA 3AHDA 2CKMA 4KPUB 2X3FA 5ICSA 2OBYA 2KPOA 4NCKA 4IHJA 1VLMA 5I7OA 3KXIA 4GUAA 1P73A 2ID9A 3ICPA 1NM5A 3KQSA 2W8ZA 3I39X 4I1UA 1GKLA 1ADBA 2UVQA 4EA6A 1C1HA 1TW2A 1E7SA 2D2FA 3NUGA 3KEFA 3X1KA 4ENTA 5NLLA 2HCRA 2HO5A 1M2OA 3OKAA 1ONSA 3B6EA 3CLRC 3LNTA 5LKRA 4TLEA 2HBYA 4X66B 2B2XA 5DGDA 3WICA 2Q99A 3QMVA 4TL7A 4E70A 2PSJA 3SDBA 1OSNA 2AH5A 5HCUA 2WYHA 1I2AA 1U1GA 4IOLA 1R8JA 3H2ZA 4KN6A 5EZ5A 1EWVA 2G80A 2Q2QA 1H3NA 2YRFA 3WAGA 5HUHA 5JFTA 3GPCA 5JS1A 3K8ZA 2WTBA 5HQJA 1YZQA 3TCXB 1V5IA 3IVGA 3U3KA 2BEJA 5AM5A 1OKKD 2DRIA 3CXUA 3CMMA 5E1OA 4D42A 2AYZA 1V5FA 2C59A 1EESA 1ODCA 4NJOA 1OAAA 2OGWA 3OO0A 3RSHA 2O5EA 4XVHA 3C39A 3HBMA 2JLQA 1XP5A 3I04M 4GPTA 2JGMA 1GUAA 4FDAA 1H6BA 4P7JA 4M7WA 5DYGA 4HNAB 4KODA 4M7RA 3TS1A 1U0BB 5FUBA 2HZ7A 2Q2WA 1OY1A 3NASA 1GARA 3HGQA 2Z8YA 5EWLA 2HSWA 4Z9YA 5KOJA 2GETA 5M5BA 1JDTA 3ZJYA 1A4IA 2JLUA 3SFZA 3VDQA 3G8BA 4DSTA 4CV1A 4HNUA 3JYNA 3ONDA 3GPLA 3IP7A 2ZJ8A 1DKNA 1I4TD 3CVUA 2WQZA 1ZC4A 4MPDA 3WK6A 2O19A 3QQ5A 3R2JA 4MGHA 2G4CA 1FMFA 3QJGA 4JI8B 2C1EA 3T1NA 3OOJA 3VFDA 3VR4D 3CISA 4MPJA 4BEVA 2QA5A 1MJHA 2V74B 1NXTA 1Y34E 4M88A 4V0SA 4ZQIA 5G0VA 4N03A 2WBLC 3W1VA 2VAVA 3MCTA 4GO1A 3PNMA 3CR3C 1N3BA 2VUSA 3TOVA 3ZCSA 3CEJA 3EZLA 3ML1A 1LV7A 2M98A 1V4BA 2A56A 1TGYA 2BM0A 2E7ZA 2FHSA 3QV2A 4DMFA 1QH8A 2C78A 3G9TA 3H5OA 4GW3A 1LKZA 4PEVA 4ED9A 3TIXB 4D4KA 3V4RA 1P2BA 1QV7A 3DLCA 4IG9A 3HYTA 1EWYA 4IDNA 2Z6VA 3H18A 3HU5A 3MPUA 8OHMA 3TGLA 2X0DA 2OSVA 2ZYRA 1JWLA 2BI4A 4F3KA 2JLZA 4WESA 4BN5A 1A8HA 2XE4A 4ZEMA 4D79A 4LFAB 1U1CA 2XSZA 1C7ZA 1UADA 1GQSA 1MDBA 2CMHA 2GX6A 3BIOA 3OC6A 4ER0A 4RHEA 4O2AA 3IUSA 1OYVA 2WSIA 2QTVB 4U6QA 5JHHB 5IT9A 4GOMD 1GZ4A 4BB0A 4KO2S 3W9UA 3L0YA 1THGA 2GCEA 2OESA 3DFKA 1YJBA 2W9XA 2NYRA 2YXBA 5MFPA 2EBHX 4LNUB 3Q8XB 2DT8A 2UZ3A 3JALB 2DERA 2ISSD 3WSTA 2AC7A 4RULA 3V8VA 4JT4A 5A3VA 2A3RA 3RJZA 1U65A 1II8A 3GFPA 3A27A 4Q48A 5T6BA 3WDKA 4CLXA 3ND6A 4P3OA 1MNQA 4R2IA 2Q6VA 2ZJOA 4YLEA 2QI9C 1TUIA 1AJEA 1OXXK 1XJQA 2WYIA 2VF5X 4DJFC 3ILSA 2VDNB 4BWVA 1TAHA 1E2FA 3I2HA 3OD5A 5K99A 4DLAA 1DQZA 4W99A 1G8YA 4GWGA 2H6EA 2YC2C 3T4UA 3U4DA 5FLYA 1M5UA 4MW7A 2QDKA 2CLLB 1IL0A 2YN4A 2EKBA 2VAMA 2XV1A 2OD9A 3FH0A 1ZD5A 3OESA 4FYIA 2RSLA 4G0ZA 4MXDA 4Q4LA 4ZHQF 3DZKA 5KMGB 3BBLA 1VL6A 3WBJA 1M2NA 3WIEA 1XJCA 2NU6A 2IHVA 2RGRA 4C4YA 3P96A 4DR6B 5IXYA 1UJMA 2ATCA 4KV9A 1F06A 2I03A 5TVKA 5BW8A 5KYNA 1GRQA 3CRZA 4P08A 1OROA 3LCCA 1Y1KE 1IBCA 2B5WA 4LJYA 4KXFB 2NX2A 1PYOA 1UF9A 3F3MA 3T95A 4B82A 2WRZA 4Z51A 1LC3A 1TLFA 2FTKE 2UVPA 2XKJE 4FK8A 3W9SA 1T6YA 4L6AA 1CB7A 1WHSB 2PO5A 2R751 3ZWMA 4FSDA 1PJBA 3PI6A 3R4CA 5HFAA 1ZMTA 4KIWA 5AMXA 4G6ZA 4B3RB 1KKUA 1NMEA 4ZT4A 5H80A 1BDHA 4YR7A 5ITVA 3A32A 4Z8XA 2BCJQ 3C7TA 5TGZA 2VG8A 1JYEA 3D02A 4D0RA 4KWEA 1E79D 1E96A 1J2EA 1UC9A 1O87A 4IH4A 3TQHA 1UMDA 3CNQS 2HYDA 2XNSA 3RVDA 2V7QD 4MB0A 5HILA 4CTJA 4POOA 4PPGA 3VO9A 1PE0A 4D8UA 3G9ZA 3HCOA 1P1BA 2K2QB 1EB9A 3AFNA 5D84A 4ZCSA 3ICEA 3RUCA 4DIUA 3LXXA 4QJ4A 5B4VA 1ISGA 5CM9C 3KOYA 4P86A 1KYIA 3PZRA 2J5XA 3WHLA 1SU7A 3FYCA 4B75A 5EJ4A 4QOFA 4ETWA 1E2JA 3F7OA 2ORWA 1YHZA 2ZTUA 4RFVA 4YLYA 5BR1A 5DM70 4CQLB 3RT7A 2ONKA 2FWNA 4EPRA 2W0SA 3RVBA 3ZZMA 4TXHA 2QYHA 1N6LA 3MGCA 3VTFA 1CHNA 2AC4A 1EUZA 1RJEA 1QHNA 2COUA 2BHLA 3P0RA 3V8EA 1L5WA 2HDHA 2GCNA 2OKGA 3WOHA 5B57C 1CS4C 3RM3A 3T5DA 4BNJA 2DPLA 4BQOA 4DIOA 5C3MA 5B3JA 3CLRD 3O83A 1ZJYA 3G2LA 2ADOA 4GBED 1JRLA 3D31A 3DW3X 3OCJA 4IIHA 4LMBA 1PX2A 4UHCA 2MYUA 5H0IA 1OBCA 3Q0IA 3CFYA 4D5GA 4C21A 1WMEA 1FPMA 3W7BA 1ODSA 2FSVA 4BFCA 4R8RA 3ZWNA 2OGSA 2AG5A 4XQ0A 5CK4A 3UJCA 3VX3A 3RRYA 5MHTA 2I3ZA 4AK9A 2BV3A 3AEQB 2B69A 3UAOA 1C30A 1E7WA 1XXHB 4L72A 5FJIA 5FA8A 2QD4A 1DHTA 2ZRDA 3PXDA 2EF0A 4YXWA 3TNJA 1JU4A 3VQTA 4Z7QB 3DO6A 4B74A 1OZHA 3PLAE 2PGJA 2WJAA 4N3BA 1XEFA 4BMPB 3K9HA 5CK5A 3PPYA 1NPTO 4KAFA 3DT6A 3OLWA 4IMJB 4NU8X 4FEAA 1XL0A 2JKYA 2R1TB 4KMRA 3RFCA 3THOA 3VZBA 4X41A 2QLTA 2CMDA 1WDKA 2HY7A 1PEYA 3DEHA 5M2QA 5JZSA 5KTYA 2VJKA 4H7JA 2TYSB 2Z9DA 3I1YA 2DEUA 1K68A 1NVTA 5K0NA 1EUCB 2QT1A 5BV1A 4OXKA 3MT7A 4DV4B 1E5LA 2P65A 3MT0A 1E1RA 1MO6A 4JL5A 1D4ZA 3HVUA 5K3OA 1ZMRA 5G40A 2FXIA 2MSKA 3RTEA 1QOZA 3RPEA 4OIFA 4KQ1A 3UM9A 5JSUA 2RH4A 1EK6A 4W7SA 1ZG3A 2H7XA 2A5FA 1A2OA 2WKRA 5HNKA 2IYPA 4L8WB 1QFYA 5DFAA 1QF9A 4NBSA 2EBFX 5FFMA 5FQOA 5J2UB 2OAQ1 3ZGVA 3BHIA 3L93A 1GA1A 2OV6A 4ND2A 2BUBA 2VHUA 5LKAA 1QGAA 5DZSA 1AH2A 4Q1BA 1DDGA 1EG7A 3SZOA 1M1ZA 1ZH0A 1J24A 3HBJA 1AQJA 3DTYA 5ALHA 2PRJA 3PJEA 2QENA 3ANXA 3NHAA 3E5HA 3MRTA 3D8HA 3QPWA 1T91A 2PKEA 3VYSB 1Q2UA 4HXGA 4K9OA 5M3BA 1KYVA 1MTOA 5GY7A 1ORIA 2YFQA 3MJSA 3RVRA 4E5DA 3MILA 2YIJA 3FBGA 3AVUA 3G5LA 1X42A 2HA2A 1YBFA 5I45A 1EVYA 3BIXA 1FVOA 2NYAA 1MBZA 1N2JA 1O3YA 1ZLXA 2W6ZA 4TXMA 4V2IA 3IKVA 4ZQCB 2HK9A 2HLHA 2H1CA 4OAPA 3H1GA 1PT5A 1T2AA 1TK9A 3BGSA 1RM5A 2H1LA 2P79A 3GAZA 2WDPA 2GBCA 4B3JA 3ZDAA 4IINA 1CRPA 1GL3A 421PA 3ZGZA 1N1GA 4DE5A 2WUFA 3AUXA 2EFHB 4MRPA 3NC1C 4L8VA 1PTJC 1XD8A 3WQQA 2VQDA 5CMLA 1MR3F 1KI2A 1HE8B 1OC4A 1RWVA 4IDQA 4KYVA 1N2ZA 3HJBA 2EYQA 4NBKA 3ZYCA 1XHEA 2R4UA 1N5OX 2MOKA 2WKWA 5JZ9A 3BRWD 2B94A 2VDPB 4HFNA 1J9EA 2BR3A 3GFRA 1GSHA 3O2JA 1NOKA 2H7VA 3OJXA 1RXWA 2Q5EA 4K1LA 4QBTA 4IHJF 3T7JA 1JBQA 4UUPA 5GJCA 3STVA 5LNK1 2VSFA 2J4CA 1QHGA 2PJZA 5CVDA 3HY6A 2YINC 4ES6A 2IHNA 3ZOKA 1FXWA 1Z4IA 4P84A 1RYHA 4IKEA 3THSA 2G1PA 2J3DA 4HYQA 3UUEA 4A0QA 3KXLA 1UKEA 4XR9A 1JAIA 5I7RA 1C0EA 1LNZA 2AW3A 2QTWB 3T3NA 1KKMA 5I9LA 1U0NA 5IG2A 3RAEC 1MPXA 3LVRE 3O5AA 1DLJA 3C8ZA 4WZBA 1OGYA 4JIMA 2RH9B 4B35A 3AV0B 4RVNA 4ISBA 2EJCA 2QN1A 3KOZA 2JFFA 2NAPA 4LCBA 4JSRA 2OGUA 1EDOA 3L1HA 4L5JA 4YROA 3AFOA 3ZGLA 4QKQA 2A1IA 1HKUA 1R50A 1W85A 1OU4A 2CHGA 1MW9X 2OHIA 3A1NA 1NMYA 4XR4A 4XJXA 4MDEA 3L6UA 4Q3KA 1VE6A 1DKRA 2N47A 1RQ7A 2O3TA 4E21A 1CRWG 4YJFB 2ZYWX 1DIAA 5HF9A 1C9MA 2W6MA 3IHKA 1WQ4A 4RZ3A 1JEEA 1NW7A 1DEKA 4FS8A 1V9SA 4IYRA 4N9WA 4QHSA 5L3QA 6AT1A 3WI7A 5JAMA 3C4JA 1X39A 3HB7A 4WKGA 1DO2A 3KWMA 3LM8A 3M83A 1OBFO 2OV1A 4HN9A 5CYFA 3TF5A 4G5OA 4DIKA 4A0FA 2WNIA 5E8JA 5EESA 3RYTC 4A8JC 5ES4B 5TJ9A 6ABPA 1BROA 4JP2A 3PF8A 3QKSA 4HNVA 5MF6A 5T4EA 2IYSA 1P75A 3EPJA 3ROPA 2GZHA 1QG6A 1QYXA 2ST1A 1TB4A 1J99A 1AUPA 3FTDA 3PXCX 2ZP1A 2M6KA 4RF2A 5JARA 4DQVA 4EBBA 2Q0HA 3HDHA 3CV3A 3RBXA 3F97A 2D1SA 1S02A 2E21A 1R7RA 3NG1A 4Q4JA 5L3ZA 4E07A 3DT9A 5IJ0B 4KZKA 2H59A 1XMPA 3BVPA 4KQEA 4PO3X 3IJRA 1M33A 4KO3S 3W04A 3CO5A 2R6R1 5LDDC 3WFZA 1OFIA 1XZBA 3BFVA 4N5MA 4TV8A 2O0JA 1PLJA 3FCSB 5I51A 4BLSA 1JR2A 2QAJA 3GFTA 3MAJA 1OT3A 1JHRA 2FUNB 4HAXA 4RK4A 4X44A 5F51A 3PUXA 1I7QB 1XF9A 2QPTA 5E1DA 2F4NA 3OLZA 4KNYA 1YI1A 3NIDB 5AOAA 5LZ9A 4ACAA 1V3QE 1WV0A 2VWHA 3B89A 4FDMA 3RI3A 5IH7A 2LKDA 3L5KA 4GMDA 1V35A 3OHSX 4UBKA 4F3NA 2ODTX 2I8CA 4LSGA 1Q1EA 2VQFB 1NQ5A 3M9XA 1R3UA 4AJLA 2QB5A 4JY7A 1E8NA 1LTKA 5CGQB 3H0KA 1ZW6A 3AM4A 5A6SB 3WLMA 3LF1A 4O2AF 1TVKA 3S1LA 1C3JA 1P7WA 2HMYB 2JGKA 2BEWB 2OXRA 1NQUA 2WFLB 4MUGA 3LT2A 4NYJR 5AK3A 4L02A 5A9SA 4QL3A 3T1YB 3ORHA 5AKLA 2PMKA 2C58A 4PXSA 2J9XB 4JQOA 4U63A 5F12A 1E3LA 2WU4A 4FR5A 4AZ0A 4PHCA 3CIFA 2CMGA 3F5SA 4MWOA 3PYLA 3AHEA 3Q8LA 5CVEA 1JIKA 1SCIA 1W4RA 1EGVB 3LFUA 3MTDA 4RW0A 3RYHA 2ADFA 1WY7A 1JEDA 3GG2A 3K6SA 3RRFA 4U6SA 1QFJA 3BX1A 4MK4A 4WPGA 1KWKA 4G4JA 2X41A 4JH0A 1LK5A 3FSEA 2ZR7A 4R54A 5ENZA 1UDCA 4EUFA 3AZPA 5A5VA 1U5CA 1EK5A 1MX1A 2C4VA 3BJZA 2VKTA 4XIYA 3SN6A 5AM3A 5KYXB 3HYCA 1PHPA 1XKLA 1V47A 2X2PA 4G1FA 4ND5A 3KKZA 2XTNA 2YXLA 3GB9A 3O47A 3LBYA 4LGYA 5DLPA 3RG8A 4EGJA 4EY6A 1TM5E 3LF4A 4L7VA 2J3KA 3M4XA 2GN9A 4K6HA 2JGEA 3FMGA 2O5CA 2CXRA 1PJ8A 3BF8A 3AXTA 3HXQA 4FCWA 2NYUA 3CZ5A 1I3KA 1U11A 3HUDA 5ITSA 4UZEA 3PC8C 4AXXA 5U4QA 2LP4Y 3KTDA 5EKXA 2HPVA 3K8QA 4C30A 2BIFA 1JSXA 1IG0A 2O2EA 3BGIA 3KLOA 4CLDA 4K1XA 4NP6A 4LBZA 4M0LA 5FXMA 1X7XA 1H1TA 1ZM4A 2DKNA 3O91A 3T3GA 3MM4A 3D2CA 4BMOB 5TQ0A 5DEOA 3S2UA 4QLOA 4RIIA 3V48A 4F3RA 3ZCQA 1WCIA 2AMYA 4M1ZA 1N6NA 5I6DA 2JIZA 2HF7A 4GECA 4M1QA 1M1YA 2OCGA 3SBXA 1M2GA 4XYEA 5EIBD 1KKLA 1ECFA 1T0UA 4GE3A 2EV9A 1PG5A 3MBIA 1JLLB 4PGHA 4X95A 5I01A 2ZWPA 821PA 3ZWKA 5A7HA 3CI0K 4I9GA 4DV2B 2O7QA 3B1XA 1UBNA 4ZCQA 2C2GA 3UTCA 3L46A 3WO1A 1W0CA 4CUZA 4NATA 1RHUA 4GIBA 3UKJA 3B7PA 2AR9A 1QGYA 1ZD2P 2YZ2A 3B6JA 1NW8A 5IVPA 2OCXA 2CHFA 3D81A 3QENA 1RQPA 1E1KA 2JFZA 3JQ8A 2UZ4A 2ETXA 4P34A 3FOEC 1GZHB 1H5UA 3B60A 3P9IA 1QAQA 1LZKA 2YWDA 5EPUA 2D1YA 1OI3A 2GXQA 2VF4X 4KHZA 3WL6A 1O4VA 2VNJA 3O94A 1FP4B 5ESRA 4CG2A 2XEDA 3J80A 5KQGA 3DVQX 3RNLA 1RDFA 2G70A 3A2KA 3HY4A 3M2TA 3WLKX 4KX5A 1KJZA 2AJLI 1SHTX 4CQMB 5DGTA 3EN0A 1HX7A 4C2UA 3BUSA 3BGOS 4OI2A 4P4NA 4O63O 2I99A 3STYA 4AZVA 1UM9B 1ZI8A 2F1KA 2QN2A 1X80A 2C5FA 2J6HA 2QIPA 4C4ZA 3CCBA 4EG0A 4YH1A 2GZSA 3A1SA 4G5GA 2XMDA 3SYRA 2FW1A 1R0SA 1W1WA 1XJWA 1HE1C 3M5PA 3PFWO 1KBZA 4MA4A 5FR2A 4OH7A 2D4HA 3ASYA 2QF7A 1ZU4A 1C9KA 1GA4A 3AW9A 5ECYA 1L4UA 2WV7A 3U31A 2H85A 3L82B 3SX4A 1N78A 3OPMA 4Q7MB 5SV2A 5ULLA 2WMNB 2CLKB 3UWDA 4FD3A 1GCIA 4KTTE 1F1BA 4JKYA 4FJ1A 3HP4A 4MUBA 3I83A 5AH0A 3MPOA 2O3RA 4HQ0A 4MYHA 1QO7A 4LSZA 4WACA 1MQSA 4OJTA 2R47A 3RAGA 4E6EA 1DAFA 2AZDA 3MFYA 1YXMA 3WLJA 1XEAA 1J0XO 3NATA 3ZG6A 3V2IA 2XMRA 3NHLA 4TWBA 2O9JA 5CG2A 3AI2A 3LUBA 3DCNA 4OP2A 5C8YA 3HDTA 4ROTA 1VE9A 4AQYB 1DUIA 2P1RA 2X15A 1U6JA 1EP3B 1Q7RA 2XE6A 3IV7A 4NBLA 3I76A 1SFRA 4ZU6X 4F46A 3S2GA 3WYEA 2DUMA 1C7EA 4N5NA 1ZA1A 2PWBA 3WIOA 3HWRA 5CAEA 1CUDA 2QTRA 2V7UA 3LHSA 5IDYA 1S8NA 4JJKA 3OA0A 4A73A 5HG0A 3H7IA 3OFSA 1JZTA 5IASA 2VXBA 4Q05A 3QIVA 5LQKA 4WD3A 3C6QA 4FZRA 5EZYB 3EYWA 1QRUA 4HB2A 3WLIA 1JJIA 4EI9A 2XUPA 1I4EB 5L95A 4FU0A 1UK8A 2BM8A 3HDJA 2L42A 5KNDA 2HMAA 1ZR4A 2P7IA 3MINB 2QAGA 2OMKA 4CMHA 3BE5A 1VC2A 4B44A 4EWLA 4DOMA 1SCJA 3FCYA 3UH1A 4A0GA 1R6UA 4ZA2A 2W6PA 4J75A 4AG5A 4FN5A 4UTRA 4EQ6A 2GYWA 1IXYA 1K6EA 5ARDA 2XMSA 4A03A 4ESOA 3EOAI 2WYVA 4HSGA 4BUCA 9ATCA 2C4HA 2HHCA 2FPPB 2CNNA 2FFBA 1HDEA 2IY9A 5KU7A 1K8YB 1Q0QA 3NUZA 4MKZA 4ZHSA 3IPRA 4P54A 5B36A 3HA3A 4TUYA 1AKRA 4PYJA 1I2ZA 1D4OA 2NP7A 2DFNA 1NY6A 5FPHA 4IJMA 2JBAB 4GL4A 2ZM5A 3UT5A 3RC9A 4EF4A 4ZCIA 1YKGA 3IQFA 2FPRA 2YFYA 4KOAA 2JEYA 3RANA 5CFOA 4ZT7A 3IJPA 2I76A 5CXXA 4EHAA 1E0AA 5IAAA 1FXWF 1L4FA 2XCQA 2BGJA 1FNNA 2V5UA 2W90A 2R00C 2JAHA 1WOMA 2EFDB 2PTHA 2HJGA 4PNEA 5KYGA 2VT7A 1KQPA 3LY5A 2NU7A 4Y1EA 5KJEA 1NL3A 3ASUA 2JJ8A 3R1IA 4TQ9A 5B4TA 4KSBA 4PFKA 4U2DA 3UBTA 2O1XA 2FSHA 1WKBA 2WG1A 3D4BA 2QRNA 4RAOA 1KP9A 4GXNA 1JI0A 1CBUA 4YO8A 2QGFA 2TMYA 2FPLA 3FETA 3H9CA 2VZ8A 3MJHA 4QPCA 4RJKA 3U7EB 5AKEA 3CE9A 1O6FA 2Y92A 3AB3A 2QRVB 2Y71A 3DP9A 3PWTA 4MV5A 4B4VA 3LAWA 5LMNB 3DBVO 4KW7A 2IXFA 1BD3A 5B6JA 1QDUA 3JQGA 4GR4A 4I50B 1A7AA 1MORA 1PVDA 3JQDA 4QJ5A 5HMMA 3ROFA 1NNEA 4NEQA 3AT1A 1V5GA 3A1UA 4KMSA 4NRDA 4A1FA 4AY3A 3F73A 3ZGOA 1RYBA 1TFUA 1G1MA 1TYZA 2UYGA 2UZAA 4RKFA 4LVCA 5LMZA 2GBLA 3GIWA 1U2SA 1J06A 1E3MA 5BUSA 2PKQP 4EZBA 3M1LA 2EGUA 1A98A 5DX1A 2V9ZA 1F1JA 4CFYA 3WIBA 4DG8A 4DDUA 5J4YA 3LY9A 4BN4A 1T2DA 3PXUA 2HGZA 4MUIA 4NCAA 2V7GA 3OM9A 4AZ3A 1N0UA 3TTXA 3UJ8A 3GGOA 2Z3VA 3NU1A 4YRJA 3OVMA 1VSTA 5DK4A 2WA1A 3R24A 1TVMA 1TUGA 3G6KA 4K86A 3HVKA 3L7OA 2WM2A 3GFSA 3U61B 4ASUA 3IQXA 4X20B 4XEHA 2IYRA 2Y76A 3EW9A 4MPRA 5FAXA 1CEYA 5AKZA 3RC2A 1QIGA 3IHWA 4R5HA 4TV8F 4HNSA 2HV9A 4LF7B 1TM1E 4G23A 3K0FB 5JY1A 3D7NA 1E9DA 4JQZA 1IPEA 3OCWA 3PE4A 3T54A 3GVXA 4F0JA 3MTBA 4EKYA 3C2QA 2WF6A 2G9RA 1AS2A 2CXQA 2XHZA 1DG1G 2ZG6A 4PXAA 1E2HA 1VHWA 1T36A 2YASA 1HK7A 4TT8A 2JBWA 4RKRA 1IY8A 3RBVA 4B85A 4D0GA 1XTBA 2C1ZA 2IEIA 3I9OA 4NOMA 4W1RA 1IMJA 3D5EA 4EG7A 3VO2A 4JZYA 1AOXA 2QX4A 1FU7A 3A3OA 1J1IA 3JZMA 4DCMA 1UPUA 4UUAA 3EIEA 3B3AA 5ELLA 4EFNA 4MCJA 4LZOA 1O89A 3RSFA 4XUGB 3KR9A 4L57A 1W4ZA 2A9OA 3SFVA 3OIYA 3R0JA 2AJBA 1OLUB 4YJ2A 1EFRD 2EWVA 4MS3B 1CLUA 4EECA 4WWHA 3WTBA 2HSDA 4R1OA 5LSAA 3QOYA 1QZ3A 1ETHA 1A7KA 1KMHA 2IEYA 5CUQA 2O8BB 1JH8A 1AUVA 1WB4A 1X7ZB 5F1OA 5IULC 4EY5A 4ZQBA 1CUWA 3GCGA 4K8RB 2OCIA 3L04A 4IIBA 3ADOA 4TXJA 2IFTA 2P0EA 4I3FA 4LIPD 3LK7A 3EEFA 5G3ZA 1KPHA 1M2HA 4CM3A 4II3A 3C3XA 2R96A 2I3GA 3K9QO 5GWXA 2GBGA 2QUHA 3AETA 4OLBA 1IE3A 3DWEX 1JB1A 1J5PA 4LMRA 3ELUA 3P19A 5IN5A 3FRIA 5E9WA 1U1DA 1CK4A 2J0VA 1VYTA 1Q6YA 2AWNA 2O0MA 4AY2A 1Y3CE 1JAZA 1Z8FA 4A27A 4ZEWA 3PUHA 2CCGA 3IQEA 1IY2A 2PFGA 1T3ZA 5L7YA 2R4TA 1KOGA 3ZZUA 1WQ1R 4ZRDA 1AHIA 1K7XB 3KKNA 2IZ1A 1SBQA 4G26A 2QQEA 3AP3A 5COAA 4DLSA 4A6EA 2FQQA 2AR0A 3O38A 2PQ2A 4UFPA 3GLGB 4C3OB 3SZ3A 1YOBA 5IK2A 1W2WB 5TQJA 2GKOA 2D4AA 2B1IA 3FROA 5TQ2A 3ORRA 2VJNA 3KR0A 2XCIA 3G23A 4FQ5A 4I5DA 4WX2B 2VL7A 3KVVA 1PR4A 2X0IA 4O4HA 3I9V1 5GIOE 3Q6MA 1W46A 3O0TA 1CUYA 2HSGA 1MOPA 4RHYA 3SEAA 3SZLA 3ZKAA 1UXOA 1U9IA 3NUQA 3A31A 3AHIA 3DB1A 3ODPA 1L4NA 2NUAA 3QU9A 3HWWA 4X9XA 1ZUNB 2ON6A 4Y2HA