3UY4A

Crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pantoate--Beta-Alanine Ligase from Campylobacter jejuni complexed with AMP and vitamin B5
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 88
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uy4A01
3G6KA 2QJFA 3N2YA 1H3NA 2G36A 4YMIA 1YIAA 2QTMA 3CVVA 5KHAA 1N2IA 1WKBA 1R6XA 1ZJWA 2QJTA 3GMIA 1NZJA 1XNJA 2CYCA 3RFFA 4DE5A 2JANA 3CVXA 4ARIA 1O97C 4PBTA 3DO8A 1FYDA 1TYBE 2GM3A 3FG9A 1T9GR 1M8KA 1EUYA 4G5FA 1M1ZA 1G8GA 1IRXA 3ZJTA 1T9GS 2PXHA 3FOCA 1CT9A 4I6EA 4KR9A 5LM3A 1NUPA 4MUKA 3LE8A 1S4MA 1U3CA 1WZ2A 3HL4A 3H9BA 3HZRA 1B6TA 3A4IA 4UZEA 3UY4A 2A84A 3AG5A 3CLRC 3PRHA 3ISJA 3Q10A 4ZT5A 3N9IA 4MVWA 4P2BA 4EG6A 1VBKA 1QNFA 2IP1A 4NX2A 1PG2A 3FHJA 3ZJUA 1FFYA 1T6XA 2E21A 3RBAA 2DLCX 2X0KA 2BYTA 3IMEA 1M83A 3UOWA 1PG0A 3MUEA 1N1DA 1VL2A 1MBZA 1J1UA 3D6VA 3LOQA 5TGTA 1IVSA 4RPIA 1M8PA 1OWNA 1Q11A 2YXNA 1N2OA 3CVUA 4EG3A 3FY4A 4G5YA 3TQIA 3HFJA 3FNRA 1MB2A 1QU2A 3IUBA 4XFJA 1ILEA 1QJCA 4EFKA 1WXEA 1G59A 4Q16A 5FO0A 3CLUD 1NSYA 3HV0A 4MAFA 3HMQA 3TS1A 4EF6A 3FETA 4DNXA 2OQ2A 1KORA 2A1TS 2GKSA 4MW0A 1YIDA 4R0NA 3KFLA 4ZCRA 2DETA 1O5TA 5AHWA 4MW9A 4QBTA 4MUJA 1WXFA 4OJMX 1EE1A 2IJGX 1O0BA 1WQ4A 3COWA 1M8JA 1O97D 3FI0A 3ILVA 4MVCA 1XNGA 2DUMA 4QRDA 5IJXA 2AZXA 3ND7A 5LFAA 3AFHA 4KPUA 4CQNA 1QRTA 4MUIA 2J08A 5EKDA 5JBNA 2DR2A 4GU5A 4YP5A 3OTWA 1OWPA 1N77A 3P52A 1JHDA 2YY5A 1RQGA 3RK0A 2CT8A 1Q77A 1JECA 3QE4A 1F4LA 4AS1A 4MUHA 4S1OA 2V0GA 4YP7A 1GTSA 1K92A 1MAUA 3TZLA 2Z08A 3PNYA 1EFPB 1KKUA 3CLTD 1XNHA 2VTBA 1H3FA 4EG7A 3D6UA 4KR6A 5K0SA 1X6VA 4EG8A 4HPWA 3X1MA 1NUUA 3CLSD 1T6YA 1J09A 4F3RA 4MLPA 1TEZA 3SDBA 3AG6A 4MWBA 1F7UA 2XRYA 1O0CA 3DLAA 2V0CA 3AKZA 3ND6A 2PG3A 4RUKA 1Y42X 3K9WA 1N75A 1WXHA 1JZSA 2E18A 2J09A 3P0JA 3ZXSA 1KR2A 1KQPA 1R6UA 1NYLA 1F9AA 2ZUFA 1YI8A 2QUIA 4QREA 4JXZA 3F3MA 4OUDA 4EG4A 4AQ7A 4JFAA 1TFUA 1OBHA 1H3EA 4MVYA 3IUEA 2CFOA 1GAXA 3DV2A 3QTBA 2WQ7A 2X1LA 1U7XA 1JEDA 1LI7A 2ZUEA 4DDHA 1LI5A 3JXEA 1KH2A 2EL7A 2DPLA 1JIIA 2D54A 5H7XA 1I6KA 1U3DA 4X0EA 2A7XA 2YWCA 2O8VA 2PZAA 3SZ3A 1H1TA 1KH1A 4R2LA 4MUNA 1WXIA 1O96A 1SURA 2J4DA 1NUSA 1I2DA 1Q15A 4Q93A 4KR7A 1JIKA 5DASA 3CR8A 4HJXA 3AL0C 1JGTA 1MOPA 4EGAA 4E1AA 1I6LA 3UC5A 4MWCA 1J20A 1ZUNA 1OWMA 1G8HA 3RJZA 1ZH6A 2J07A 1Q19A 1R6TA 3HGMA 3KT0A 5J58A 3ELBA 1IHOA 1OD6A 1PFUA 3CVWA 1JIJA 3K32A 2A4MA 1JMVA 1V47A 4MUGA 1NUTA 3H9CA 1XJQA 2E89A 3TZEA 1ZH0A 3IDFA 4J76A 4I6JA 3ZIUA 3RHSA 3SZGA 2Z3VA 1WY5A 1IQUA 2YWBA 3FIUA 2CYBA 2R5WA 1I6MA 4DDKA 1MB9A 2QJOA 1MJHA 4CDNA 3NV7A 2WQ6A 1KH3A 2JAXA 2J5BA 3IVGA 1D2RA 2QTNA 2VXOA 1TYAE 4H3SA 3G5AA 4K03A 5J59A 3COYA 4KPUB 4UZFA 3PNVA 3DPIA 5HUHA 3INNA 4ZT7A 4JYZA 4PY2A 3NBAA 2CV2A 4ZCQA 1A8HA 3CLSC 2WSIA 1GZUA 2DEUA 3A04A 4MW1A 1VLHA 2D13A 1IQ0A 1N3LA 3A05A 3MLBA 2AKEA 3ZGZA 3NBKA 2CV1A 3CLTC 2IELA 4ZT4A 3ZJVA 2XRZA 5K0TA 1F7VA 2CYAA 5DB4A 1QRSA 3IODA 4MW7A 4L2IA 1NURA 4WNYA 2QTRA 4NDAA 3SEZA 3UK2A 2A1UA 4G6ZA 3SYTA 3KT8A 3IOCA 3MLAA 4PBRA 4K0RA 2X1MA 4R2MA 1IQRA 3PXUA 2RD2A 1T6ZA 1K97A 1PFYA 4CDMA 1HYBA 1N2HA 1PFWA 2Z09A 1JILA 4FZJA 4ZCTA 1V8FA 4GRIA 2HMAA 3FDXA 4XFDA 4NZPA 1EUQA 4JZYA 4MW4A 1N2JA 5F23A 1QU3A 3U1VA 3KT6A 4J75A 3L92A 4YP6A 1PFVA 3Q12A 1O94D 1KAQA 2QUHA 4YBRA 3IOBA 4MUEA 1M8FA 3CLUC 5FO1A 3M5WA 1MC1A 1KQOA 1UFVA 3QTTA 1JZQA 4MWDA 3SP1A 4U63A 4ZCPA 3AIIA 4DLPA 1JEEA 1OBCA 1EXDA 1EFVB 1YUMA 3COVA 1O6BA 3VGJA 1EJ2A 2ZP1A 3SEQA 4MW6A 4OUDB 4MW2A 2AG6A 1VBMA 3FWKA 1TYDE 5TEWA 3N05A 1BS2A 1K4KA 4XSVA 4U8HA 2DERA 2E0IA 1VBNA 1QRUA 3VRHA 3IVCA 4WSOA 1GTRA 4MW5A 4MULA 3GUZA 3VU8A 3Q4GA 3IMCA 3CLRD 4MVXA 4ND6A 3P0IA 2HZ7A 1J21A 1YULA 1J1ZA 2HGZA 1KQNA 4TS1A 1O94C 4ND7A 1COZA 1GLNA 3MXTA 3OP1A 3IOEA 4HK4A 1WQ3A 4ZT3A 1N2EA 5LLTA 1G8FA 3UMVA 2O5RA 3IMGA 4ZT2A 2X3FA 1QQTA 2PZBA 3FH0A 3ZXIA 1WXGA 3ND5A 2DXIA 3N8HA 4JXXA 1O96B 3L93A 5TS2A 2A88A 4DJAA 1U7DA 3TNJA 3GLVA 2EJCA 1OWOA 1U0BB 5FNZA 4KKVA 2TS1A 2CV0A 1MAWA 4ZT6A 5HG0A 3IVXA 1P7PA 3I05A 4L2IB 4NAHA 4ARCA 2CUZA 5KCMA 4EG5A 1N78A 2PFSA 1YUNA 2JA2A 5HUJA 4A91A 3X1KA 4BWVA 3CVYA 1TYCA 5DEOA 2A1TR 3PNBA 5TEVA 3P0HA 2H2AA 1IH8A 2RE8A 1NI5A 4U7JA 1IFXA 1LW7A 3E27A 1O95C 2NSYA 1NUQA 3IH5A 2OV4A 5BNZA 1OWLA 1NP7A 2A86A 2I1LA 2D5BA 2VTBB 1J70A 1TQ8A 4HJRA 4MWEA 1K4MA 1KAMA 1N2GA 1EFVA 2CSXA 5J5AA 1GN8A 2GOYA 2PIDA 1KP2A 4I6GA 2PZ8A 3LCJA 3C8ZA 3S3TA 1X8XA 3COZA 1GPMA 2A1UB 1QTQA 4DDMA 1M8GA 5H16A 2QUJA 3A2KA 3X1JA 3TQOA 2NZ2A 2WB2A 3ZUGA 1WJGA 2BTEA 3H99A 1KP3A 3BL5A 4CT0A 3H97A 4ZCSA 2C5SA 3KT3A 4MQ6A 3H05A 1O95D 5KWVA 1N2BA 4PBSA 1WOYA 1ULHA 2H29A 1EFPA 2QUKA 4NATA 5DK4A 5IHXA 2B7LA 4MUFA 3CA8A 3RK1A 4F4HA 4EG1A 1DNPA 3G59A 3MMXA 4NAUA 1MRZA
chains in the Genus database with same CATH superfamily
5BNFA 4RCYA 4DM7A 3KVNA 2AZDA 1P1FA 2HQBA 1NNLA 2WU8A 4FNGA 4JQYA 5IARA 3CVVA 1RABA 2VDLB 2ZRCA 4IX1A 1BMFA 2LMEA 1Z0ZA 3LBFA 4QFBA 2EP8A 4OFXA 4ZVUA 4XOUA 3RNLA 2DAPA 1ESZA 2IZZA 1HZJA 3ZXYA 4M54A 2H0QA 1JZTA 2GM3A 2ZJ5A 3CNNA 3UGKA 3NVMB 3UUFA 4MGKR 1VHQA 4B47A 1Z2PX 4S2EA 1T9GR 1M8KA 3AF1A 3GN1A 3GLHB 4GQAA 3PGMA 4MX8A 4KH1A 3MSXA 4H6WA 4PPGA 2VT2A 1Z62A 4X1KB 4F5ZA 1G8GA 2NZWA 4QFCA 4L4SA 4BE4A 2BKEA 1HYEA 1HE4A 1N5KA 4KFSA 1EFRD 4QZVA 3OZXA 4Z9FA 4Z51A 3INTA 5GP1A 1KP9A 1EFKA 1JIUA 3ASVA 1M66A 1U3CA 3L7LA 3WBKA 1UMDA 4MSUA 1NR7A 3GROA 3O1IC 4MOWA 4TKUA 1NVWQ 2FZEA 1PTJA 2X0FA 2B3DA 4F56A 2P2DA 3RQIA 4LFAB 4MVJM 4O0MA 4U5QA 2MOKA 5CNKA 2GXQA 2AEFA 3ADOA 1DV2A 1T24A 2OXEA 4PQYA 4EG6A 1I3NA 3AI2A 1FFYA 3RBAA 2ZRPA 1E7SA 1NBEA 4XQ9A 4AIIA 1Z0SA 4L4ZA 3L7KA 4A82A 1OXKB 3AUYA 4FSDA 4BMZA 3MUEA 1I4WA 1SWVA 1X3LA 3Q5GA 5K8CA 3KQUA 1G60A 1HDXA 2F9FA 3PXCX 3DGEC 3WKAA 3OJXA 2OENG 5EWJA 2I8CA 3GVXA 4HXGA 4KV7A 1R88A 2P0EA 2ZQ5A 3AXSA 3NUZA 4M0KA 3R7DA 4B0PA 3NHFA 5HGXA 1E2GA 1U99A 4F7DA 3A6PC 1GFSA 3UAXA 4TZ0A 3BSWA 5FEMA 3CIFA 2PWPA 2PS0A 4INOA 4ZQCB 1BS1A 2GZAA 1IBSA 4CR7A 2XMRA 5GINE 4RKEA 3K2QA 3DYVA 4M1MA 2NXCA 1ZVKA 5A05A 5D1HA 1QYCA 3ON5A 4BVLA 1KY2A 3CLUD 3VPBA 5C9ZA 1PT9A 2ZRKA 3V1NA 1GJRA 1VYUA 1WOMA 3KEMA 3DDCA 1VCIA 2VYCA 5TQJA 3UHAA 4WKNA 2OQ2A 4I66A 4RL4A 1R8XA 4WESA 3RRJA 4BO1A 1YUBA 4JWTA 2KBEA 4C0SA 1ZNZA 4COOA 2FMHA 2P2LA 1Q91A 2JF0A 1K7SN 4RVDA 3V3KA 1DINA 2XXJA 3EGIA 4IRUB 4N49A 2AW5A 4ERXA 5IANA 3FOZA 1A27A 2YVQA 4KYTA 1WSAA 3ZNPA 3H1BA 4X9XA 1ULSA 1FY2A 4KXWA 2OXIA 3G0BA 2Z5VA 1USGA 2WNHA 2PTGA 2VLIA 3ONDA 2PKRA 1NKSA 1XTBA 4Q4HA 3WS7A 1K08A 2AUNA 2P6MA 1XF9A 3K0AB 5D5HA 4UOZA 1ADFA 1YJBA 3KEGA 1F0YA 4X6YA 1RW4A 3ZWKA 1MV5A 3UV7A 4HYYA 4DCSA 3G3EA 1JECA 1ZG3A 3QE4A 1T8SA 3O21A 2NVOA 3T1VA 4L85A 5L4SA 3W6UA 4WAUA 1YRLA 3BHNA 3G1TA 5H83A 3UM9A 3TX2A 4BLWA 1WCV1 4Z8YA 4LF4B 1ZWLA 3S4YA 3Q3VA 4NAVA 5EPEA 3SLGA 3KE8A 4KOEC 5AD1A 1LPAB 2GAJA 2PL3A 3U44B 1K9SA 8AT1A 3D6UA 3W5VA 1CS4C 4HNSA 3IAM6 3RIHA 3X1MA 4HH3C 1KI6B 4FZRA 1KVSA 2OGWA 1U0NA 1W0CA 4H17A 3AFIA 3HCDA 4D02A 3PWKA 1T1JA 1VM6A 2PJZA 3BDVA 1MQ8B 4KQKA 4ZVVA 4ZPXA 1WMBA 1YRQA 1SCAA 4FYVA 1P8JA 1NJ6A 4S35A 4UFPA 2Z6QA 1E6LA 3HVIA 3NHYA 2NUBA 3DV9A 4GVPA 2R2GA 3RUPA 3T9EA 4A0RA 1EAYA 3ZBTA 2O8NA 2FDXA 4WXYB 4O8ZA 4MVJG 5KSPA 4YP0A 1F14A 1JR2A 1CY2A 3KB6A 4UHHA 5F33A 1LNZA 2XZPA 1VE1A 3SSNA 3TOZA 2AZTA 2XZOA 5GPBA 2Z5LA 1Z29A 2JHGA 1KC3A 4NHEA 2X2FA 3CRMA 1E9SA 3ABQB 4RZ2A 2SCUA 9GPBA 1V8ZA 1TCUA 2BZ0A 3H9UA 4J8PA 3WK8A 2L17A 4YX9A 4OQYA 2JIQA 2YZ7A 5E3JA 3RVRA 4ZJPA 3MD0A 1HQKA 1YZNA 2J48A 2QAGA 4YAOA 3T0GA 2FRDC 1N8NA 4J0EA 1ZOLA 2W2LD 4PQFA 5JHHB 2C04A 2B1IA 2G04A 5KX5A 2JCSA 3VVCA 3NT2A 4AYXA 2MSCB 3RFXA 3TL6A 1H4QA 2PV7A 3FJYA 3FNGA 4X7BA 2GD2A 1C3OA 2KB0A 3ZK9A 4WJLA 3PHHA 1N25A 2Q0SA 2OZLA 3C3EA 2LDXA 1CFJA 3WGNA 3UWOA 2J0QA 3Q3GE 4G56A 1X1RA 4PC6A 1Z2OX 3HMKA 3W9UA 1QB7A 2YN0A 2FWBA 3ULKA 1C29B 1LB1B 1U2RA 1NQUA 3MTBA 3HV2A 4J4BA 4L0DA 3ZTTA 1DPFA 4PX9A 5A0TA 5KTOA 4MKGA 5EZ5A 4Y3UA 5C8DA 5L6MB 3PFBA 1KH1A 5IFLA 5CRIA 1QV9A 3E5MA 4QODA 4M21A 4WIAA 3F96A 2PFKA 3GLGA 1E2MA 4F9TA 2QU8A 5KI6A 2HY7A 4FFBA 4RFLA 3F9CA 3K70B 3N8KA 5IH3A 5FBQB 4R1PA 3NRBA 3ANMA 3A6JA 5AXAA 3DMRA 2AZ4A 1T2EA 1MOPA 1BHO1 3OUUA 3T7DA 2HJWA 3D4NA 4XPIA 4ZYZA 1MW8X 1H1LA 4MWCA 4A92A 5HWSA 4KUEA 4POOA 2YJ3A 1J0DA 1OWMA 1PK7A 3FMFA 3GJXC 4J4TA 3OFNA 3RAJA 2F43A 3RB8A 1D1TA 4DOMA 3FPGA 3P45A 4RY0A 4B3GA 1R6TA 2OILA 3OZUA 3B82A 3MT8A 1GPLA 4R16A 4YRIA 3TQRA 1DAOA 1K8YB 1TAHA 2DKNA 2G5PA 4YN3A 1O5IA 1X8KA 3VKWA 1QIDA 2CXPA 4M9UA 5JDCC 3R8FA 3U4GA 4QELA 1SC1A 1GN9A 3H9CA 1RJEA 3CF0A 5JCOC 5IUJC 3UMRA 4OYHA 1CR2A 4EEZA 1UBKS 3AUXA 1IEVA 3IQDB 3WJ7A 1O6GA 3R5SA 2XNKA 4O1MA 3MBKA 5AJZA 5ALIA 5SY4A 2IZ7A 5LOVA 4R5HA 2RH8A 1SKMA 1TUEA 1MB9A 3PBKA 2HA7A 4BEVA 3N7TA 4H6XA 1NDHA 4QSMA 3FBGA 3QITA 2ZWOA 1Z9BA 2B4TO 1QR6A 1TYAE 2RGXA 4L1KA 4DCUA 4OHZA 3NJ4A 4B32A 2DX7A 3ZNQA 4DQLA 4IDQA 4PX5A 4JP2A 4JUCA 1V11A 4NP6A 4ZYYA 1CERA 1DAKA 2XF8A 4PY2A 3R9IA 1LSOA 1EVIA 3NT4A 4K3UA 2O8DB 3LCVB 3S2SA 1GG2A 1J9ZA 3H4VA 3CUUA 3U7QA 1ZNWA 3CJTA 3KDPA 1U04A 2CL0X 4FFNA 2VP0A 4GI7A 4XGQA 1EWVA 1Q7CA 4G26A 4KFRA 3ROPA 4BZWA 2IODA 1VC2A 3F67A 3NBKA 4FWBA 4DRXB 4HUQA 3AB8A 4K8RB 3NHMA 1P2UA 4PX3A 4A6PA 4U39A 5HOEA 2CV1A 1Y9DA 2CMFA 4RS3A 1J2YA 3RHZA 3V2UA 1DEOA 2R79A 3ILSA 3CRW1 1B8PA 2FSGA 4JLPA 4RXTA 1HE2A 4E2XA 3DZ8A 4H6PA 5F7ZA 1B4DA 3PXGA 4S0ZA 3FCXA 3TKLA 4E08A 5BNTA 10MHA 1EGAA 4KJXA 3SM3A 3HQ4O 2XD4A 4GOJA 3RT9A 5JNRA 3VPSA 4QQRA 2EJWA 1HG0A 4B71A 2O8CA 2BONA 5ITVA 4ETMA 4R2MA 4OOFA 5CH5A 2B8EA 3E9MA 1HOTA 2AI1A 3CZ4A 1QGUA 1JBQA 4LQDA 4ETIA 2Q1TA 4ZAYA 3PXAA 3TDMA 3FN4A 3H4IA 5F9HA 4CDMA 3RRYA 1W4RA 2O8FB 2VP2A 2CLSA 5L7WA 3CC8A 5THXA 4ZCTA 3MJVA 3WNDA 1P7WA 2JVJA 1AMNA 2JGEA 4RH0A 1Q6YA 4NZPA 2WYVA 5C35A 1B7GO 2EFGA 2VJMA 3MT9A 1BCSB 2ZJFA 2D0IA 3U1VA 1RYNA 1KVRA 1TIBA 4AKSA 2ZRJA 1OXSC 4MEAA 3GOQA 4BP1A 4AIRA 1V3VA 1UK8A 1SC6A 1TJ3A 1DAGA 2AKAB 3KJFA 3NBYC 5C7IO 5FDFA 3HLTA 5E6RA 3HJRA 2E5WA 4B6OA 2W11A 5HIAA 3MMPA 3H1AA 2GEDA 4F2PA 1IDOA 1QIMA 3WV5A 2FVXA 3ZUPA 4BLTA 1RXSA 2ACVA 4KO4S 2JDIA 3TW6A 3OQNA 4L72A 5A71A 3K71B 1O6BA 1Y81A 2YIVX 2A5LA 4ALJA 1S1MA 1KAGA 2QMUA 2ZB7A 2HU5A 2Y71A 3E3MA 5IAJA 1BFUA 4RM2A 1ZN9A 2GJ8A 4Q9JA 3EC2A 1E5VA 4D41A 1KDPA 4G0QA 1LV8A 1RP7A 4HDQB 2O05A 5AW0A 3IEVA 3NPAA 5AJHA 4CGYA 3B2EA 4AN4A 1VBNA 1NLYA 2AS0A 5KDDA 1Z36A 4K9DA 4CUZA 5ES3A 1PVDA 4B5KA 2EV9A 1WLSA 3DOHA 4FCTA 2PTHA 4D9JA 4MWEA 1Z83A 2B0CA 3BE5A 4BIIA 3EGCA 1NQXA 1J9EA 2C4HA 2OLKA 3ESQA 1M1UA 3RYHA 1YB6A 3UPUA 4M8IA 1U2PA 5KAPA 1KQNA 3SU8A 2HHHB 1R6BX 1O94C 1A97A 1FQOA 3EZNA 4DMCA 3PF8A 4ZDKA 4RENA 3O2SB 3C3CA 3GFSA 3I32A 3K20A 1P33A 4LHWA 1RZVA 2Y1KA 3OIWA 2PVCA 3C7TA 4G07A 3ZWYA 8ABPA 1DTWA 5DRYA 2K6GA 4CIVA 2H54A 2AR0A 3IJ5A 4FYHA 1A4XA 4IILA 1OLXB 1MX1A 3QLUA 1ENYA 3DBHA 4MYDA 2RHOA 4LG1A 1YQTA 1DT3A 2AK2A 3IAS6 4ND3A 4OYLA 4NK5A 3KSMA 1YCGA 4FYIA 3AB7A 3GZNB 4LY6A 3WL8A 2XOEA 3DBOB 1XD9A 3CKYA 3CO5A 4K8OA 3UJDA 1Z5ZA 2J31A 3C3KA 4UE2A 1G9TA 2KPOA 3WNZA 3T15A 3Q6MA 3UA3A 3LA6A 3TDNA 3KLMX 1P9OA 2IEAA 4ITUA 4TSFA 2IS6A 1BE8A 1XK6A 3OEEA 3LO5A 1B00A 5JARA 2HREA 2OCLA 1SXJA 1F6WA 1V8OA 1ZQ1A 2X0DA 1YUNA 5F2NA 1Q0ZA 4FONA 1P2DA 4L5JA 1BA2A 1MB3A 3T06B 4CYMA 4GLBA 5DBIA 3ONWA 2BFCB 4JX9A 4ZZ1A 2OTCA 4CFYA 2PUBA 1GAJA 2JI6A 6YASA 4BJ5A 5K0EA 2YJNA 3WP0A 1GG5A 2ZAYA 3GRYA 5DYYA 1QVRA 2G4VA 1G5RA 2JCYA 2V3WA 4IZOA 1Q0QA 1LW7A 2IYNA 1P5FA 3O4FA 4NK4A 5JQGB 2ZUCA 1ULAA 4V0NA 2NUTA 2VWQA 1B26A 3KKPA 3NEJA 1R0KA 1W1IA 2PRKA 3D02A 3HG7A 2C9CA 1UP6A 4BNYA 2M6SA 1CXZA 3UGJA 1U0EA 4C21A 4CLOB 3CV3A 2I52A 3HJFA 4I5GA 3QUTA 4JBNA 3MNFA 2GN0A 5FX2A 4QGBA 1AZLA 1V2GA 4UNSA 3TQHA 4XZ3A 2B83A 1G1AA 3QBJA 1SB8A 3LCJA 1QTNA 4IF6A 4PXSA 3C8MA 3EODA 1DAHA 3COZA 3WVNA 3M1IA 1R0LA 4LWQA 2BFDA 2D1QA 4LJYA 2ZJOA 1C7ZA 3I1JA 4RIHA 3ZWMA 4B81A 4MICA 3WKBA 4B3HA 5ER6A 3UO8B 5FBLB 1U9CA 1LNQA 1VHDA 3GEBA 1WJGA 1PCXA 4HDAA 1P1KA 4KYIB 4Y2PA 1LNSA 2JCXA 4QXAA 1KP3A 4CKBB 3DBHB 2FEMA 2H31A 3GQBA 3P9PA 2OOKA 1QFYA 1SO8A 3QX3A 5EJIA 1KRWA 2F9LA 4D6YA 3FDJA 4TVBA 5EZYB 1NBMD 2Q2VA 4NH0A 2BZGA 7MDHA 1D6MA 3PD0A 1SQ6A 5CB4A 3FLEA 1Y6JA 4RVHA 5T67A 2I78A 1B16A 3L4BC 3JARA 3EWSA 4FHDA 2OVFA 2NV0A 4NJEA 4TMYA 3V8MA 4HX5A 2W6PA 3V1UA 1JHMA 1C9MA 2MYTA 5FWYA 5KYNA 1EK5A 2ISSD 4L8YA 4YRJA 3ZCTA 3W9YA 1R6XA 2QZSA 3R5FA 1RACA 4HLUC 4HX2A 2OA0A 5H4GA 3E81A 1PJCA 4PCUA 4BQSA 3R6GA 1JI0A 1T6NA 3C87A 2CMGA 1WBBA 2WP0A 1BHQ1 3QM1A 4WLOA 2Z1NA 1PR4A 1D07A 2I2WA 1Q7EA 4RF3A 5F77A 1TYBE 1JG1A 3AMVA 4YQEA 1NKVA 4RGBA 3A1UA 4MHTA 4UUBA 1XVTA 4YMSA 4G5FA 2YXLA 2L69A 1MCZA 1UM9B 4MRNA 2NACA 4KLRA 2OGZA 4PAOA 3WYDA 1JA9A 1PT5A 1SCUA 1ZD2P 4PSVA 2ZU6A 3EMVA 5B3AA 3EMKA 1L3BA 1KWGA 4EHBA 1NVDA 2YMPA 3EPRA 3GMTA 3FF1A 3I28A 4LDNA 3WRWA 3B78A 4HXEB 5I7OA 1W36D 5EUQB 1AO3A 2OB1A 3L5KA 5G40A 3LHFA 3VPXA 3ESBA 4DABA 3KVVA 1OTYA 821PA 1W52X 1KYIA 3HXLA 2NW6A 1A1SA 5DBEX 3LLSA 4BKUA 1PUJA 1CIVA 1EJ0A 1ENZA 2J3LA 2H1RA 1FMTA 1NF2A 2O0JA 3LKBA 4GDFA 3DKRA 2VT7A 2ADFA 1P29A 4OHOA 4BGUA 2RC5A 2WU1A 2ZJ8A 1RPAA 1SOUA 2DECA 3KOZA 4GGMX 3Q1LA 1REQA 4NFHA 5G53C 3X1YA 4ZHSA 1SD1A 1H6CA 4PZ9A 3L4JA 1ZP6A 1QNFA 1C1XA 2IP1A 2Z4RA 2AVNA 3B20A 3DAHA 3FHJA 3QA3E 4FHGA 1T6XA 4LOKA 4MRMB 5LXTF 3DL7A 3BMQB 1TA0A 4JA0A 5JBQA 3Q2OA 4B44A 3S1SA 5KWSA 1E9EA 3KPYA 5J23A 1HDRA 3TUIC 1C30A 1E2NA 4CLHA 3IHLA 1XA3A 4YXFA 2P77A 1J1UA 1RWMA 3EG9A 4O63O 3WWYA 1RQXA 1OLOA 4I8DA 1C3LA 2PQ6A 121PA 2FQQA 2ZSEA 4PYIA 3O8CA 2J3HA 4XIIA 4RPKA 1V37A 2JA1A 5F73A 2WVHA 3NEYA 4LDQA 2IYOA 3PGA1 2A9KA 3THSA 2CF5A 1BTOA 2G67A 4TTSA 3ADPA 2V6IA 4KP7A 4RULA 1IY0A 4ETWA 4RMHA 2XMZA 4JCCA 3RVKA 2B7CA 3ASUA 4UD2A 4HTFB 1ORTA 3UANA 3LFTA 2KLBA 3ENKA 4NENA 1SC3A 4OJYA 3HNPA 2PR2A 4UNIA 1HRDA 3QH4A 1G21A 4UAGA 1BNCA 3NTVA 4H77A 2QTZA 2ZIEA 3MWEA 5BMOA 3C0KA 4XGRA 1KMQA 1O54A 5B53A 1TTTA 2NUTB 2C2MA 4IM7A 2D1FA 5DM4A 2DCMA 4E1VA 2CJWA 3EY9A 3JPYA 2DE0X 3OOHA 1NMZA 2J9GA 4XWTA 4E5KA 4YQYA 1YACA 5LLSA 4LXXA 2QTGA 2QN1A 1TVMA 1H22A 3WLPA 2ZBQA 3BILA 2V7EA 3KYCB 521PA 2HLNA 2Q45A 5JS8A 4JI6B 1BEZA 2Y1DA 2PNJA 4YXWD 2DUMA 2OBXA 3SLRA 1J42A 4E2ZA 1DVRA 1Z88A 2GVNA 1HK7A 3N2KA 4XB6B 5K3FB 3QFSA 1PK8A 4MUIA 3QKWA 1Y8RA 4JR0A 1ZJ5A 3CFHL 2I2BA 2BTQB 2XYHA 4ML3A 1L5QA 4TYQA 3U7JA 3AUTA 3CSUA 3N6XA 4ZN6A 4R8LA 3TLEA 3T3HA 1TK3A 2C31A 2WHEA 4EJ6A 5ALTA 2OCPA 4EKYA 4IJQA 4G97A 4WXRA 2P35A 1P2GA 2H7YA 3ZDRA 1RKXA 4A0HA 1YMVA 2HHJA 4TKMA 3IJPA 3MJ4A 4RHYA 2QTAA 1ZMRA 2JAUA 2XWBF 3B38A 3R5KA 1KEKA 4XIFA 4LQCA 5SY9A 4EG8A 4KNYA 3U17A 3LUDA 4GI2A 5TS3A 3KB2A 1BE0A 2GETA 2NO5A 1TAGA 3KBBA 3NALA 5FL7D 2AYXA 2RBGA 4MLPA 2CC2A 1POWA 3G7UA 4MYHA 4QYWA 2YS7A 2GLTA 1GQQA 1DMRA 4MQEB 3TDKA 3UA4A 3PR3A 1TX4B 5JYEA 4FW8A 2GCGA 3ND6A 1FMJA 1VCHA 2P41A 1E7QA 3LP8A 3QWBA 5JSZA 2P3SA 4B9EA 2H52A 1R37A 2GARA 3HCCA 3MELA 4ENVA 3W4JA 2DB3A 3HBNA 1V39A 3IDOA 4MDYA 4R3NA 4YRFA 2YUTA 4JT2A 5KYWB 1PEYA 1KQPA 1K1EA 2RBEA 2IV7A 1J8DA 2IU3A 5BUZA 5F7XA 5LJIA 1SH7A 1SB9A 3D3QA 3CXRA 4QYMA 3ZE9A 4XWOA 1X70A 3K2BA 4IRMA 5AM3A 1IOLA 3M6FA 2HT6A 4ZI7B 1TT5A 4D5EA 4JXZA 2IZ6A 3FUUA 3QPAA 1G8YA 3OM8A 4UZSA 5HGJA 4BX3A 3HJAA 3AB3A 4HFNA 2QW0X 1GUBA 1HDZA 1RQPA 1FFWA 1TFUA 2DFKB 3GC6A 4FPXA 1N1GA 1E8DA 3TLBA 3AEKB 1L6IA 4PVDA 1XDBA 4WBXC 3LI2A 4KV9A 3KAJA 2B9EA 3Q9SA 4LNAA 5TV2A 4PHFA 1HLFA 1XMJA 4GUDA 4IFIA 1HY3A 2ISCA 4Z5XA 2QRQA 1MG0A 3PGXA 3FHTA 5JJCA 4OI0A 1EDBA 1GNTA 2UYQA 3AFOA 4UEOA 1O6ZA 1PDWA 1KH2A 2ZPAA 3K5HA 4DV6B 4NPHA 3I2HA 4P58A 5DM2A 4HMPA 3OIGA 1N5MA 1DKMA 1WETA 1MMFB 1ORIA 3ONNA 2HRDA 2IU0A 1J2JA 2ERXA 1G6OA 2O8VA 4XFKA 3RUAA 3SJCA 2G6BA 3DLCA 4X8HA 1HFWA 3NOOA 3KKZA 3MWDA 3I42A 2VF2A 4W99A 1SURA 1U9ZA 2ORYA 4ZV7A 2XRMA 4W1SA 5DTMA 1MG5A 1NUSA 1I2DA 1RC0A 2ZU0C 3KYIB 4G81A 4YRPA 3PFNA 2D1RA 1OLXA 4C04A 1V4NA 2EW2A 5ITZB 2P75A 1QX3A 4J1QA 4JYBA 1XTTA 2UU9B 2V7QA 5AUNB 2ZIXB 5DNCA 1TQ2A 4X91A 1U9JA 2ECQA 1X1QA 2QDXA 2VF8A 3JRXA 4HOYA 2ECKA 2DU8A 3IHTA 4LZOA 4J3NA 3W8NA 4A23A 4LN1A 4D9IA 4YRTA 2NMVA 1R4AA 1T8UA 1SZCA 1H42A 5DGDA 3RVJA 3AK4A 1UDCA 2G8LA 1QHSA 4QXRA 1KO4A 3W34A 1ZICA 2VK1A 3AVPA 5HKKD 4V39A 1V45E 2Q3DA 3W8RA 1EWQA 5LQJA 1JWLA 1P61B 3MW8A 4RWEA 1G3UA 4UDXX 4BVJA 4C5AA 1PFKA 4DMGA 4MUGA 4BGVA 1UAGA 1RJ9B 1T43A 3I37X 2WF5A 3O0DA 4M83A 4TTAA 1WPQA 1FRZA 5K3AA 5BWMA 2PX6A 1XAJA 1FMCA 1Q3HA 3GFTA 1JAZA 3MWYW 4FN4A 4NTZA 5DF1A 1NDUA 2XDYA 1DIOB 5GTDA 1YO6A 3DBVO 1XZEA 3RVQA 4ARBA 2RJOA 2RGEA 2BFBB 2G3DA 3UAWA 1IXSB 3T1HB 2OO7A 3DLPX 4HZUA 3ECAA 4M7WA 2ZXFA 1AG9A 1JFFB 3U3JA 1FX1A 4IXWA 2FRVA 4CEIB 3MTDA 4BJ3A 5C5EA 3BBPA 3UG7A 5E4JA 1AXEA 2XQJA 2YY6A 3G5AA 3N58A 3QVOA 2IQIA 1RBYA 4BQRA 5LZ5A 2XCRB 4IH4A 2L2QA 4PHTA 4UBJA 4CR6A 2D2EA 4LOJA 3WJAA 1JEYA 2Q3FA 4YMVA 5JSHA 3RSOA 1EP1B 1ECLA 2C99A 1I5RA 4I4IA 1OXUA 1OE0A 4BFYA 3VKHA 3SIWA 4MW1A 4M0DA 3OMWA 1ODTC 5EMLA 1CUVA 4IWNA 2VHJA 3UQYS 1ISRA 1J9GA 5JNTA 1PZXA 3P4XA 2B4KA 1SZPA 2PLRA 4JC4A 4B35A 4ZT4A 1DHTA 1N6PA 3V1MA 1WZNA 1A9PA 2IVZA 2WHPB 1CSEE 1JAHA 1HGXA 2GN4A 3KTDA 2I8LA 3CR3C 1H2AS 2VCEA 4MS4B 4OFWA 3VC1A 5BN5B 1LVGA 3B3FA 3DD5A 5D8DA 1ZNYA 3UJ6A 5HCNA 2UZ3A 3PZBA 4OHKA 1VKRA 2QTRA 3SEZA 5T4EA 3S5UA 2Z0MA 3MLAA 2WA1A 2XCOA 4Q4JA 5BW5A 4E2YA 3GT3A 2P65A 3LBAA 2GCPA 1O57A 1MNQA 3LTEA 1CY1A 2H06A 2ODWA 2QRVB 5DK6A 2GTIA 3IAS1 4ZRMA 2X2PA 4RQUA 1LS6A 3G8DA 2EIHA 2M9MA 4FFBB 5AJTA 1HYBA 2PZFA 4BV2A 4KQWA 1UEXC 1YR6A 4PRYA 4M7PA 4NYMR 2P9QA 3NTXA 4RZUA 5IDXA 2HU8A 5JC1A 4YFYA 2N75A 3ELDA 5C0OE 4GSYA 3VHLB 2WWHA 3H5RA 2CVQA 1U2EA 4C5CA 4E5DA 1HSZA 4PXAA 1OVMA 2XDWA 1S2MA 1UPBA 5DSXA 1KAHA 3KSRA 2V4UA 5MN4A 5FPTA 3N6VA 4J75A 5F4ZA 1G63A 4LMRA 2AG8A 1GGVA 1J2UA 3PNPA 2IEZA 2BLLA 5D7NA 2OFXA 1NVUQ 2P6PA 4P93A 3KO8A 4M2LA 5ICCA 4BFVA 1AN9A 1Q3TA 1Y6QA 3HKDA 1Z2DA 1WTCA 2ZI7A 4RIGA 1SG6A 2HWKA 2HBRA 2QL9A 1DSSG 3QE2A 4YP1A 3W9BA 4B3XA 1OBCA 1JQLB 1ZISA 4QOEA 2G5GX 2W6ID 2GBCA 1IXRC 3USCS 4JBIA 3BIFA 2H7VA 2XHZA 5CJPA 3T5CA 4P7JA 2ZZKA 3SYLA 3DHWC 4HNRA 3RKUA 3TUZC 4RA9B 4IUYA 2V55B 4C7JA 1E2FA 2IW3A 3ZU3A 3OZBA 5JANA 1X13A 4UBMA 1WNTA 3MGCA 3PQEA 4GX0A 5IN5A 2JL1A 2W6CX 5FLYA 2PWZA 5DBGA 1A88A 1II8B 3G9TA 3BCSA 3JX9A 3N7AA 4ZXPA 1B41A 3IVCA 1E2IA 2ZRQA 3FROA 3TW8A 4AXBA 4DC1A 4I08A 2Q3EA 3AL3A 4QBKA 2A94A 1JXAA 3K72B 2OPHA 1KZGB 1TLTA 2OO5C 2WE7A 4V0KA 2G5TA 4ANFA 2HZ7A 2W98A 1UEJA 3HNOA 4BU1A 2VNAA 3M4XA 1RE0A 3EGEA 2IYWA 1GLNA 2A5DA 3MXTA 4JENA 2PDAA 4LRYA 4N6GA 5CT8A 5FOWA 4ZO6A 1N2EA 3AFNA 3TOXA 2RAUA 1Q1BA 2XUHA 3I4LA 4UTRA 4RKYA 3U3DA 3A1NA 2YYAA 1WPRA 1XCBA 2HSDA 2PZBA 3BCHA 2UV8A 3S8MA 3SHFA 4V0LA 5ECYA 3VMFA 2ZE8A 1EM8B 1RR6A 2CL7X 2ZVDA 2GAFA 5EJGA 2QVCA 4CMIA 1HV8A 2FTKE 1JU9A 3UJPA 4D9HA 2QA5A 3ZYCA 3I8SA 1Q0LA 5TS2A 3D8HA 4BO6A 5K0ZA 4LWOA 4A15A 3QFFA 2FW9A 1M5RA 3DTVD 2X0RA 5KQGA 2O06A 2OP1A 3VAAA 5KSZA 3A3PA 4DG5A 4IDOA 1AUPA 3H1PA 5BVGB 5A62A 1K63A 1E3IA 1PP4A 3LL4A 1J2RA 1MAWA 2WKQA 4QATA 1E1RA 5FBWB 3VDQA 4ZJYA 5LQNA 2V6GA 2FFAA 2HMTA 4HMOA 5AVVA 3ELYA 3OF3A 3IHKA 4R4JA 2UVDA 4HD8A 4ZCIA 2MSWA 3O7MA 1H8HD 2JA2A 3ZX4A 4F2HA 5IBPA 3OX3A 5EHIA 1ZPDA 3RUFA 1WP9A 4CMEA 3UPTA 3IUJA 1BCSA 1DXOA 4OREX 3T3DA 1IVYA 1AHIA 1T0JB 3F6YA 3NNNA 3SQLA 1NULA 2H2HA 4RA9A 3R8CA 2IIVA 2YYYA 3R76A 2XKJE 3P19A 4RH1A 1FJ2A 2IU4A 4Q47A 1NMQA 5AI4A 2XCTB 2ZAOA 1QPZA 1L1QA 4YI3A 2A86A 2QX8A 5TT0A 2VTBB 2BMVA 2OXRA 1TD9A 1NX9A 4QFDA 3PXXA 1MNAA 4KVAA 4Y9TA 3WLFA 2HRBA 3RRZA 1BXGA 1XZIA 2R6R1 1BW9B 2X2EA 1YJCA 5E0KB 1SHLA 2YHBA 5J5AA 2A9PA 2GOYA 3QMVA 3KL2A 1CLEA 3AJ8A 4PTLA 1EFHA 4YJ3F 3G0CA 5FYDA 5HFAA 1IHPA 3WB0A 3DDOA 5CLIA 4EB0A 2HADA 2ZSUA 3JZMA 2AJLI 2GQ0A 3A27A 5EUBA 1KYTA 2JLXA 3EQ9A 5DI3A 2WHYA 1U98A 1FTGA 5G0TA 2AJDA 1L9KA 2GN2A 4RNDB 4UM5A 4XR9A 4YLYA 5HM6A 3GEPA 1H65A 5IAGA 2REXB 3DAFA 4J3JA 3B1FA 4YMLA 2NU7B 2VUHB 3AFMA 4UKDA 3UAGA 1Z56C 1NFRA 2ZJ0A 2HQSA 3D6JA 5TDHA 1RXWA 4EGSA 2ZSIA 4IZIA 4WY5A 2QTTA 5KWVA 2OT3B 3M4JA 5DW3A 5DK4A 2IYSA 2PKXA 3RBVA 2AXNA 3O4RA 4WN9B 4QECA 2DEUA 4ITRC 3RK1A 1CDZA 2EFHB 1V11B 5KNCH 3KWJA 1SXJE 1VLLA 5FBRB 1EK0A 3MMXA 3K9CA 4NVRA 3DDNA 3R0VA 4QUEA 1PDVA 3OQMA 4BNGA 1JX6A 2EARA 2ZBUA 3G1WA 3K73O 2W37A 1G8AA 2ZXEA 3M0EA 1O1YA 1QQ7A 3OLWA 1T9ZA 2Q5FA 4OGLA 2HTFA 4DJEC 2VCYA 5CURA 3U7EB 2PEYA 1U2DC 3A14A 4OQQA 4MTLA 4PZZA 2CBZA 1KNXA 3HGTA 2AMLA 3ZXUB 1RU3A 3L06A 1PW7A 5HS6A 2QJRA 4ISCA 3LXXA 1V3UA 3PT5A 2R7LA 3O4JA 4BO9A 4K9NA 4DWOA 2D5IA 2XUPA 3GPBA 1BWSA 3VJMA 3N2EA 4R6WA 4D4KA 2FXIA 4B34A 4FWTA 1H8ED 4QPPA 4YJ3B 1VPLA 1QP7A 3HB1A 1V7ZA 3DOJA 1JEJA 3FWPA 1EX9A 4EKGA 4YR7A 2W2QA 3OCXA 2J5XA 3PC7A 3FOCA 4F86A 4X1KA 5AI0A 1XJWA 2J5KA 4KNVA 4DC9A 2BAGA 3IVRA 1V1RA 2G5ZA 1QDUA 5LM3A 1SMKA 1E9RA 4CG2A 1S4MA 4KPYA 3RFUA 1GNVA 2SNIE 2VHQA 1G6HA 1Z3CA 3WLMA 3TNDA 3H9BA 2Y1XA 3OQIA 5C4GB 1M7GA 1ISHA 3V2GA 3AR4A 4C0BA 4QOGA 3TAXA 3RIMA 3ZE2B 4TQUS 3DR5A 1YBHA 4O0LA 2ZVPX 2H5IA 2Y1OA 3PPXA 5KINB 3QP9A 5ILOA 4KN8A 4Z3KA 2AFHB 2QD4A 4TL8A 1TMOA 1PL7A 3K96A 5DLYA 2WYUA 1Q50A 3U7FB 4TXNA 1Y9AA 4DIUA 3QWIA 3UJ9A 2F4VB 3LM8A 3HPQA 1JKXA 3F90A 2P9HA 1HM5A 3SJAA 2FUNB 1LRKA 2Y1FA 1BGXT 4ME6A 4U6NA 3VKVA 5TGTA 2G06A 1WXDA 4MYCA 4TN5A 2ZUUA 1CRWG 2BGUA 3PEWA 1KSHA 1OX4B 4P82A 2HXYA 4PLCA 4TTQA 1GCIA 3KXPA 4UEJA 3S2GA 1ZJ4A 4BVBA 5KHOC 2CUNA 4F60A 3VJLA 3QELB 1JHZA 2ABWA 3AQ4A 5HE9A 1MVNA 4PNZA 2XB8A 3U5TA 2R6HA 4XRGA 3CNOA 2W6IA 4MAMA 3O4VA 1GQOA 5EQFA 2A67A 4DT1A 1O87A 3WWOA 2DCUA 3CBQA 1OH8A 1IK4A 5TXGA 3GRUA 2UUCB 3I9OA 2WWTA 3MQ4A 4I7EA 1XO1A 4L8LA 4FYWA 3L0BA 2OBNA 3R7WA 5EZYA 2XHEA 1NT4A 1SBZA 2ANCA 2G40A 3AV0B 3R3YA 3FB4A 5GV7A 5LYJF 5KJEA 5BOSB 5BWCA 3EZLA 3REOA 1A95A 2HV8A 1XB2A 3UAYA 1QHNA 1X7ZB 6PFKA 2BUBA 1TUGA 2VXYA 4JP1A 3RWBA 3C8DA 4ZDIA 4IHJF 1VKJA 3AILA 2CJXA 1DL5A 5IBCA 1M8JA 4QRDA 5JLJA 4MVCA 1D6SA 1L4KA 1XU4A 4QDJA 3X3HA 1U2TA 4X7RA 1XZHA 5EXXA 3ZQUA 1OU4A 3MS2A 3SC4A 4F2GA 1JG4A 2JZCA 2ZM6B 1GPYA 2WUWE 3DFZA 3ANXA 2AQHA 1T15A 2VJNA 2Y0EA 4BVGA 1G7RA 5ARBA 4HDNB 1QF6A 4ZAFA 1RQGA 1KJ8A 5ESDA 1RM3A 3AP1A 1F3LA 1Y9EA 2O8BA 3WIVA 1UBOS 1OI3A 3ZWQA 1CZRA 1TM4E 4PG4A 1Z45A 3R5TA 1K9VF 4TLDA 3ZPXA 1RYHA 4AWAA 4B82A 4EYEA 3PQDA 4LJ5A 1D0VA 2X8BA 5BQFA 3O38A 1JR3E 2DHEA 4KR6A 3CWZA 4FE3A 4KLZA 4NDZA 4W5OA 4NNJA 4QTXA 1AQYA 1J5PA 3Q72A 2ZETA 4BNHA 2H6EA 2BKLA 2FW8A 3JYHA 4JVMA 4G24A 3SWWA 3AR3A 1VA4A 4AZ0A 1DJNA 4AWBA 1E0DA 3MWDB 4Q3BA 4ALMA 4G0VA 1C8KA 1DRUA 1U80A 1UPTA 3BCRA 1P8AA 4Y9DA 1F2VA 2O9JA 3GFQA 1KSGA 3DP7A 3UZUA 1OC4A 4M53A 1RT9A 4GMXA 1OAAA 1UOQA 4PINA 5ALXA 3OH8A 3G85A 4BMVA 1R4MA 2ZWPA 3W5BA 1LDGA 4RSMA 2W2TA 1NJFA 4KI0A 4FT4A 4TRRA 1F9AA 1SRRA 4G2NA 4FDTA 4KDCA 3QOXA 4HZGA 3EXIB 1CD5A 3F5DA 1LLFA 4FZVA 2JH3A 2FPLA 2A54A 2OGFA 1OYOA 5DGTA 5CIYA 3T4EA 3U0BA 4F4FA 2J9FB 1Z07A 3OUZA 3SF0A 3QYAA 1PJLA 4OQXA 3CY6A 4E09A 3E9EA 1XBTA 2WQZA 5KNBH 3C2QA 1ZK1A 1Y6RA 1J23A 1PVOA 3GAMA 3L1HA 3PT9A 3OG9A 4R69A 2UYHA 1BU8A 4DCPA 4L3WA 4TV8B 2WPNA 1Y33E 3C1AA 3CT6A 3IQZA 3EMBA 3FZQA 2X1LA 5FLKA 2Q7OE 2KYRA 1P5ZB 3JXEA 4D0LB 3RS8A 4DLSA 5C8YB 1NJ8A 1AK9A 3Q7QA 2RGAA 5L3ZA 4EYSA 4Z3OA 3ZU5A 1RXIA 2HJRA 5H7XA 1I6KA 4JQCA 1PWYE 1OBOA 4X24A 4LHSA 4NV3A 4X0EA 4KRGA 4CXMA 1H0SA 1MHTA 3ZWDA 4ZHQA 3X44A 3OU2A 1BYUA 2C29D 4PS0A 4TWRA 4D96A 4IH9A 1CQIA 1Z16A 3KJHA 1WXIA 2FB9A 4YMTA 2J4DA 3U3XA 2A30A 3L6CA 4K40A 4D9FA 3VV2A 2E4ZA 2HHCA 1E5XA 3NHJA 5E6UB 3TEMA 1UDRA 1J24A 5DASA 3DE0X 1TEVA 4C29A 1DOZA 1U3VA 3VA7A 4A0SA 5DM70 4X54A 5FTJA 4NC9A 3EGDA 5GWXA 4RTOA 3T12A 5JAHA 3L8HA 4KKXB 4E1AA 1AA9A 4JC0A 3AESA 3O4IA 1Z5PA 4AJ4A 4LTMA 2VXCA 1PN3A 1OVGA 2I2XB 2GPYA 1B8NA 1G8HA 2IUFA 3ONFA 5EQJB 1TVCA 4FJ2A 4KVGA 2IDJA 3X43A 5HW0A 4XR4A 4KNWA 2NU9B 4D44A 4IL5A 1XMQB 1R6DA 2XQGA 5H82A 1QKJA 2OBYA 4PC7A 1IOVA 3K32A 4DHWA 2XYPA 3KOXA 4YUXA 4D6PA 3L82B 4J2TA 3KQLA 1SWWA 1X39A 3H6GA 3E7XA 1BS9A 1E2PA 1V96A 2WG1A 4EY5A 1K86A 4M38A 1TU4A 3A9VA 4V1CI 5IDQA 4UCWA 1ZH0A 5AJYA 3WXMA 4I3GA 4MYRA 2BISA 1I4EB 2JFNA 2X5JO 1JUDA 5CDTA 5ADWA 3THWA 4V2IA 5FAXA 1S8OA 1A50B 2AQIA 1FSSA 1ZL2A 2RHDA 4GLJA 3WB2A 5D00A 5I8PA 1USUA 3I8OA 2V1UA 1OILA 2ZT7A 4NCAA 5K3OA 2H1FA 3BMOA 5NULA 1QOQB 1PD1A 1JV2B 1Q12A 3NCHA 3CFFL 1Y82A 3PQ2A 4L6CA 2HUPA 4GR4A 4O29A 3B9QA 3VBCA 1J1IA 1V6CA 1R9NA 4G0NA 4IP0A 4AMVA 4BCDA 4F1WA 4IMJB 2FF7A 1H5UA 4KPUB 4BRSA 1N5OX 4HH1A 3NYRA 5F3WB 2NG1A 3PDHA 2IWHA 2GS9A 2YMQA 3CPJB 5NLLA 2GPAA 4RD0A 2Y27A 3IO3A 2WSIA 4RY9A 4M60A 5F35A 1W9HA 1U5BB 4BNDA 1QH0A 1CTQA 3RIEA 4DNQA 5ICSA 2ID8A 4N7RA 4ZVSA 3UMCA 3A28A 4HDRB 1G3IA 3DEHA 2XWSA 2V03A 4X62B 1Y3CE 5CFRA 1NXQA 4BAUA 5H70A 3P9XA 4AC9A 5AW1A 2AUMA 2XYRA 3II6X 3RU9A 4OI2A 5TPWA 2WZBA 1Y8QA 2JGFA 1KYWA 5B1DA 5DKFA 5FPSA 2IYPA 3A26A 3WOHA 3N2IA 3DXZA 3OHMA 4F8YA 2EEPA 4OUKX 3OCVA 2JBHA 2A3RA 4OQLA 3QVGA 4U2KA 3W5IA 2ZBVA 4PC3A 1JKMA 5DBOA 3ENZA 4P4UA 4YRAA 2OAGA 1CZUA 2FMXA 1RADA 1GGJA 4GI5A 5IUKC 3ZHZA 3REGA 4EJSB 1CNMA 1NUHA 2OE2A 4UHKA 2IOQA 1TL7C 3TTTA 3IURA 4EHLA 2FZKA 5KTTA 4ENRA 1BXZA 1GU1A 3DFIA 2EJUA 1KDYA 1SKQA 2Y6VA 2Q2WA 2RKOA 2H9IA 5EXEA 3SFVA 4YJ3A 1YZFA 1JDBC 2OYSA 3I5UA 3RW9A 4HT3B 2X5XA 1ZD4A 3AETA 1W34A 5H8WA 3B6MA 4MKRA 4ZGBA 1MRSA 4MPJA 5B7QA 1QYWA 5HXAA 3FE2A 5B7PA 1QFSA 4LSWA 3OPVA 4G25A 3LT1A 1IJKA 3MRTA 2JEYA 4Q21A 4C20A 5B6IA 2XXBA 3CFYA 3ET5A 3QXSA 3V8NA 2G5CA 5IF3A 3W2TA 1JE1A 3BRCA 3P26A 5DLPA 3GUCA 5CR9A 3GP5A 5KWJA 3IV7A 3L04A 1NE7A 1UC4B 3HBMA 3SC6A 4C7BA 4DY6A 4UEKA 5KTRA 1LRLA 1ZK2A 1RBMA 4UXJA 1JEEA 3OQ1A 2HU2A 3R5XA 1YUMA 4X45A 5TPZD 4C7OB 4LOHA 2GDJA 4PCVA 5IYZF 3H0EA 3UMGA 4BZXA 4RTMA 3TIGA 4FYYA 3FPCA 3R9KA 621PA 2QPTA 5IKXA 4R83A 1E1DA 1OYWA 1GV1A 1VE7A 1VBMA 2VDWA 2ZBDA 3MJRA 4H31A 4I50B 3U3ZA 4ED9A 4ZIRA 5G4LA 3QXXA 4ASUD 2HIHA 3TRHA 1W9MA 4O4JA 3V7UA 1DX4A 1JJ7A 3C1TA 1GRQA 3EBOA 4HYEA 1U94A 1VG1A 1V6AA 4NZNA 1DUIA 2DERA 4Y2RA 2P68A 3ER9A 2HKIA 1I1QB 3JD4A 5KVAA 1QRUA 4Q12A 1E3SA 5LQSA 1HZZC 1LJ8A 3IA7A 1MH1A 5FI3A 3ZWWA 3EX7C 3K4PA 3B12A 3B2QA 5IT0A 4CTNA 3QUAA 4GM1A 4RVNA 3FKQA 2ZUSA 4INPA 1YFLA 4BNVA 3S2EA 4QWWA 1J1ZA 1UPUA 1YRAA 2WUVA 4ZA2A 2CD7A 3RS2A 3TEFA 3DDZX 3FWZA 1ORHA 1E89A 3IOEA 1TZBA 2OBMA 1RLMA 2DQ4A 1JLSA 3CRVA 4RY8A 4EYQA 4D0GA 1W88A 3HB4X 1QHEA 2H92A 3V7YA 3VPDA 1XA0A 2GUWA 2W4QA 1E7YA 1I0ZA 4B3IA 5E2AA 4HSGA 4X64B 1WXGA 1P7ZA 2D5CA 1ELOA 3IDZA 3N8HA 4YRRA 2DXIA 4ZICA 3KUXA 4EHNA 4P33A 3WLQA 3CXUA 4BXOB 3JAKA 3RUEA 3A70A 2XW6A 2FWIA 1W1UA 3CRQA 5LSAA 4ASUA 2Z2YA 3K9FC 3T7RA 1DCMA 1ML3A 1UBHS 2P2ZA 2YASA 2DFTA 3LY8A 1LVUA 1Q44A 1JA1A 4CIWA 1P7PA 4HYQA 1H93A 3EK2A 7AT1A 4QJIA 1N78A 3AR2A 3ZY2A 2B25A 3L02A 4PM4A 4WX2B 4OGWA 2G17A 2GK6A 3BPSA 3NHKA 3EULA 3W1VA 3AIOA 1ZAKA 2GEFA 3WBJA 3C4JA 2JHFA 2C4TA 2R5FA 3M70A 4Y9UA 4Z9BA 1E0KA 2O6LA 4L5BA 5KYYA 1X87A 1WNFA 1ZX1A 2VDWB 3D9QX 3HP4A 4FGZA 1QH1B 1RWWA 1VPTA 2O7VA 2XMQA 3H42B 4ZTZB 4O4JB 1I2ZA 5DHUA 3SK0A 3GPCA 3T41A 1QFMA 5T4FA 2RHHA 1WCIB 2BM0A 3IVAA 3P5SA 4NCIA 4EDHA 3LUBA 3K6JA 1R00A 1EINA 4IXDA 2HH9A 1IB6A 1O95A 4TWIA 1XTJA 3BFKA 2Z6UA 2OHXA 1CK4A 3S2ZA 1RM4A 2OVBA 4Q48A 4JU8A 4Y6RA 5I7AA 1ITZA 5ADHA 2BKXA 1GN8A 1FNCA 1Y8RB 3OIDA 3SJUA 3CWQA 4QUIA 4DMMA 3AHDA 1JPNA 2C95A 4YMUA 3ZNNA 2YINC 4D4IA 1OT5A 2YVKA 1F06A 4FJ1A 3K9LA 1VE5A 3QKRA 5EIWA 2QUJA 5H16A 3UH1A 3FR8A 1NFFA 2H1VA 3QVMA 4AJ2A 3BWEA 3H2SA 4H0NA 1CR4A 2HA3A 3ZWBA 4CLEA 2WR8A 3EQZA 1Z5OA 4A5SA 5JI3E 2BTEA 1KJZA 2XUKA 1IDN1 3BZWA 3BK2A 1N0HA 3PPIA 4P4SB 5E4TA 1EWTA 1CY8A 1FP7A 3H97A 3TIXB 2J87A 1FQKA 2CMKA 2CXXA 2FPXA 4XWYA 5JMTA 3CFIA 1Z6TA 3QEMB 4E07A 4G0WA 5IWCA 5JU6A 3NC4A 3IVMA 1RTKA 2XH8A 2Q2NA 2QL5A 3R4VA 4MZXA 4F1KA 4Z7JA 4MUFA 1IHUA 4U2GA 2O2JA 2R1TA 4EFDA 4GDMA 3UJBA 3I76A 1YZVA 1MAAA 3HN2A 4J16C 4OVKA 4I4LA 5AJUA 3WXBA 1ZJZA 4FGLA 4QPCA 4YMIA 1TKRA 1LQ2A 4U6QA 3FMPB 4X7PA 4Q39A 1GCUA 3BL8A 5A3JA 3BXFA 3W2EA 1VYHA 4ZKDA 2WFLA 1LDEA 3O8NA 4N5LA 1OFUA 2NZVG 2WJAA 4WKCA 2NPFA 1W85B 4BS9A 5IHPA 1YQWA 3ZG6A 3PB3A 1F3OA 4C7MA 2FUKA 3IUYA 4TLBA 3IT3A 1GPNA 2RETA 1XZNA 4WNAB 3OF5A 3R7SA 5IX8A 4OX9B 4PZDA 1G66A 3PQ3A 3A10A 1IRXA 2BGNA 2GCOB 3TR0A 5FTWA 3S1AA 4LW8A 2X58A 1PUIA 4DR4B 2C1EA 1P6XA 3ESZA 4YAEA 2P6RA 4LZZA 4GG1A 3U7GA 1CT9A 3L5OA 4GGOA 4M88A 2NXJA 1IM2A 5JSFA 1GUAA 4N82A 4XD7D 3K92A 2P2CA 1NASA 3FPKA 2OHJA 3BB3A 3G68A 4YCLA 1F1JA 2AN5A 4MV1A 1WKCA 1RJGA 3RD5A 5A1TA 3WZ2A 4ER0A 2ST1A 3V4OA 1DBIA 1MB0A 3G8BA 5ALHA 4D4JA 3UA0A 2QK4A 3C6XA 1G8SA 1GT6A 3QU5A 4HADA 3ZK8A 1JT9A 1NJ1A 2VZ9A 5C37A 1JVBA 1L5YA 2Y93A 2YHSA 4UM8B 3UW3A 4YV1A 3C45A 2XYQA 4YAFA 4ZO4A 5AP9A 2OK8A 4YGXB 1OHHD 1X1EA 2GSDA 3DD1A 3QU2A 2ZVJA 4H7JA 4MCIA 4TZKA 5EP4A 3U80A 1YKGA 4B2IA 4ERNA 4LY0A 2RCYA 2ZWAA 2A92A 4MP8A 4X1YB 5CCDA 4AU1A 1X86B 1UBTS 4UREA 1X7XA 4QEKA 1M8PA 2FRDA 3ETJA 3ZR4B 4C0LA 4FB5A 1IVSA 2WE8A 2XJ9A 2ZUWA 4NQZA 5FOSA 4KN9S 5JCOA 3ZHYA 5D51S 1KRXA 3ZKWA 4Q0MA 3SC2A 2JFYA 4B79A 5FWNA 2YFKA 5EI5A 5CVTA 3D0RA 2LKCA 2VYVD 3VC7A 3HFJA 5KREA 1BA3A 3IUBA 3GH3A 1SKUA 4YASA 3B2NA 3N2ZB 4XASA 1Q0RA 2ZTUA 3TSZA 2Q6TA 2AIRA 1R9JA 4GRAA 4RVGA 2B7BA 4OI1A 2GEJA 1YA6A 3IEIA 3ZLTA 1QIFA 3GDGA 4LC0A 4A8PA 2YJ5A 5KQPA 5L51A 3NHAA 1Y37A 2W8BB 4I9FA 1WCIA 1E4EB 3DXXA 4PO9A 4LNUA 4UNRA 1M73E 3JR7A 3OUTA 3R41A 4A03A 2PV0A 1E79D 4JJ6A 4R0NA 3T3GA 2P9JA 4C6TA 3A6LA 2FWPA 1O5TA 2H08A 1PK9A 2H2FA 4HDSA 4KAXA 2GZDA 3B85A 2HSZA 4BY9E 2HXSA 1R8SA 3U40A 1WVGA 2UUPA 4N5MA 2IJGX 1Q21A 4K6KA 1O0BA 4G67A 1R5NA 2R66A 3R9WA 1QIIA 5DNWA 1X38A 2B1GA 4A16A 2WG2A 2D62A 1OLSA 5EHQA 1W48A 3AIMA 1I94B 3KVYA 5JXWA 4C06A 4CQNA 2QX4A 3SZUA 4I4TB 4U1RA 4CV0A 4LX0A 2DR2A 2N1MA 1MA0A 3CGGA 2WWVD 1N77A 3JV7A 2F3PA 4UBOA 3G9UA 2A9OA 2X7HA 1K3FA 3RROA 2PX4A 1V3QE 2BRUA 1BEUB 3CPEA 4W6QA 4ZRDA 4ZYUA 2GRUA 4R2KA 3U60B 2YV1A 3EQ2A 3BXOA 4X1OA 3ZGXA 5T4BA 1I01A 1RXYA 3WFJA 1E77A 3PNYA 4UDYX 3DLHA 1OZ0A 3CLTD 1P6UA 3HL6A 1E6EA 2A52A 1XV5A 2H7CA 3D0QA 3EZFA 3AVOA 4M1TA 4OHUA 1JYSA 2MTBA 3GOHA 2XTZA 4O2BB 4ECAA 3KG2A 4GYWA 3SMVA 1JTVA 3NU1A 4FFLA 4O5AA 4CBVA 3DQZA 1AS0A 1SBNE 3PJFA 2MHCA 5SZHB 1I2MA 3AI1A 4MYSA 1WQ1R 4HWOA 4EY6A 3KZXA 3GAZA 1F7UA 5GJCA 3RE1A 2XV1A 1O0CA 1IY9A 1E6UA 1U0OC 1V9SA 3JD2A 4ROSA 4XUCA 4LF8B 1I9CA 1EFTA 4KZPA 3NEAA 1ESMA 1ZRSA 2V0NA 2HV9A 2ON6A 3ROQA 1CX9B 1CY4A 1ZITA 2OZLB 1EB9A 1KYYA 2W5UA 3ODPA 4KXLA 5J4LA 3WGOA 1Z5VA 3ZXSA 1R74A 3LDFA 2FZLA 4WLVA 1G17A 1G98A 3DS8A 2C4NA 1T4BA 4LYYA 1FDRA 3ICOA 1O03A 4JVNA 4F6RB 4KRFA 3SCZA 4WKBA 1ODFA 2PWBA 3CNHA 3N8NA 4BJ6A 1WHSB 4RZIA 4J1TA 2GHIA 2PMKA 2QUIA 2F1JA 3G2JA 4G01B 1YZHA 3AY6A 4NCKA 4OQNA 4MV9A 4EZIA 4F93B 3K5IA 2A0WA 1SOVA 2R97A 2PR7A 3MCZA 4OHVA 1BYIA 4JELA 4AFNA 4EG4A 3HYTA 4ZI7A 2I7CA 3BHJA 1US8A 3S81A 2UVPA 3T9DA 4PYLA 4DNPA 1K98A 1QBKC 3I73A 2FFJA 1E2KA 4C3ZA 2M1ZA 2IXFA 4EVQA 2DBQA 3GPIA 3CF2A 5IG2A 1EX7A 5MHTA 2YXDA 2ZI3A 4HLQB 4RQAA 3BF8A 2A5GA 1GYRA 1N5JA 1VI6A 2ZUDA 3KYBA 4DKJA 1E1CA 3AUJB 1LI7A 1G7SA 2FU5C 2BFDB 5F78A 4YRSA 5TGDA 2FSIA 4W8OA 4L8VA 4IJVA 5DMHA 2EL7A 3H5LA 3RAGA 2NUAA 5BR4A 3OPYA 4EEKA 4DG8A 3H17A 5LA6F 1ECGA 3RYCA 2C94A 2XA2A 1DELA 3BXEA 1GA4A 3LIIA 4O6VA 4DCGA 1LQUA 2QRPA 1L7AA 2AOUB 1ZUWA 3BMCA 1X7XB 4I1OA 4IQ8A 2AXQA 2HO4A 2KHZA 4HQKA 3D7RA 3R9XB 1IZYA 4LWPA 1CB7A 1XRMA 2VNJA 5CW2A 3DTVB 3S55A 3FLMA 4LC1A 4TS9A 2H4FA 1SAYA 4R8SA 5HF5A 3DCNA 2PFGA 5CX1B 1LX6A 2HJSA 3QY9A 2O2ZA 2ZRMA 4KRXA 4Q1EA 1TM1E 2FN8A 2H4ZA 4ALNA 2ERYA 2JHAA 4HQNA 3E58A 5KOHB 3SKVA 3QHAA 1GG8A 3D4OA 4XSGA 3NWEA 2AQ8A 4OCZA 4RNCA 3RODA 1YJ5A 3I61A 3IPCA 5G1NA 4Q6BA 2OSBA 1Y1PA 3PHGA 4J9UE 4MITA 2XBLA 5EP3A 5EXDA 1JMVA 2BBSA 3VNAA 4XYMA 2PS9A 4BKRA 4Y1RA 1VA5A 4HY3A 2A9QA 1RXEA 5GZ6A 4DV4B 3L43A 4R6XA 3RJ9A 4B76A 2GEVA 1IBLB 1JKJB 1E2DA 1MOZA 3LY7A 2Y2UA 5J40A 5JNVA 3FYHA 4FFPA 1XZKA 3EA4A 4EARA 3OCCA 4KIGA 4X3OA 4YB8A 2CYBA 4FMBB 4BJ1A 2APJA 3FYSA 1DS6A 1U8AA 1RYMA 2EW1A 3QVLA 3KQWA 3HRKA 4A2CA 1QQAA 1Q1EA 1L7OA 4CDNA 5JY6A 4EGCB 3ZD6A 3NV7A 4QDXA 1BMDA 2JLRA 4IX9A 2J5BA 1E5TA 4P22A 1C3XA 3A9SA 4FKMA 1II0A 1VPEA 2AMVA 4ND5A 4HATA 4D25A 1PNRA 5HUHA 4CEIA 4RKFA 4EAQA 4QX6A 3EIXA 4S3MA 3RYFA 2JI4A 3PGKA 5J4KA 2YV2A 3W8FA 1DZ3A 2PUCA 1WXXA 3BGDA 2WKSA 5TMBA 3ET4A 1NW6A 5JCJD 3GEMA 3ZHOA 4ZI3A 1EWKA 2UYGA 2VSOA 3GBVA 1SEVA 3HJGA 4LJ9A 3EZGA 3LC7O 3FNHA 1TVKA 3MJHA 3GMDA 4P1ZA 4OP3A 5IKMA 5JJLA 1GSIA 1UJ4A 2POQX 1Q14A 1NQOA 2OLJA 2YC2C 1IBMB 2DHRA 4HB4A 2OQIA 5AMXA 2WWIA 3UICA 3AONB 1T0HB 4C7XA 4UULA 3RS7A 3WGZA 1PT6A 1F7VA 2GZRA 1PR1A 4JODA 1LBEA 3QV2A 4FE7A 2XE8A 4U4AA 2IPAB 3ZZ0A 1XEFA 4L2IA 4HFMA 4CTMA 5DHSA 5LL6P 3QE9Y 5L40A 1NJSA 3GQVA 3LXUX 2QB5A 4GMFA 4LZJA 4CFZA 5K45A 3SC3A 5KEIA 4OLAA 1USWA 3FYDA 2VTKA 3TAUA 2PSEA 4X94A 3I39X 5EYPB 3UXHA 4B7UA 4C01A 5L8VA 1FB5A 2GESA 1DXQA 3OPXA 1NVBA 1X19A 3HADA 4HGPA 4D8VA 1SUDA 3AVVA 1NVMB 3A37A 2WYIA 2W6JD 2RD2A 1C50A 4LRUA 5KU1A 1AKUA 5AVWA 1KO1A 4C0JA 3E9QA 2NU7A 1KSJA 2ZRBA 2FG6C 3VU0A 2QIOA 2P27A 1XCJA 4OKSA 2ZJ7A 2YNMA 1K2VN 1UKAA 2QU7A 3CKMA 2R751 1AHHA 1DEAA 1XCPA 2JATA 2WMNB 3H5OA 4RKRA 4DWWA 1N92A 4EZEA 1FLNA 1NW7A 3S1AB 3ZE0B 1RM5A 4KLCA 4DA6A 1B6RA 3QEAZ 2UUBB 1A9SA 1RLIA 5MFZA 2F6RA 3LT2A 1Z68A 2HA0A 3I2KA 3KCQA 4YH1A 1E8MA 1BE6A 4OSEA 5FV4A 5IJWA 3LKZA 2POCA 4P7GA 3VTFA 2CN1A 4P3OA 4Z4QA 4E5PA 5T7BA 3FGZA 2Y3IA 3C7DB 4LHZA 4J6EA 3D7KA 3DE7X 3DE2X 4RLHA 5KMGB 5MF6A 5A3SA 3N8DA 4TTIA 1UR5A 2J32A 4MKZA 2R85A 2OR3A 2YBEA 3G2PA 5AKHA 5I6DA 1JJFA 2WDZA 1RE1A 2VP5A 4TQAA 2PH5A 1D09A 1BKSB 3OMXA 4CVNA 2GLUA 2BBTA 1C2TA 2BMJA 2LCFA 3FWYA 4I8XA 5F52A 4NZMA 4RFSA 4D6XA 1Y1LA 4XYEA 3T3OA 1JPVA 2A1IA 2QVXX 4CUJA 3NM5A 5D3ZA 1WZCA 2C7PA 4KEAA 1CE8A 2JJ2D 4LE0A 1MOQA 4AW9A 3QNMA 5KYYB 2E1PA 3UT6A 1Z8DA 3I9LA 4AI6A 4FCVA 4WSOA 2XOKA 3DZJA 4MULA 1JDVA 4IQ4A 3DYBA 5HP4A 3PL1A 3BJEA 4GMDA 5C4IA 1JWBB 4OHBA 4RABA 4ND6A 2IHJA 1UKZA 4L16A 3DEJA 1YVUA 4HGOA 1L5KA 3OU7A 4GYKA 5REQB 3Q0EA 3RUIA 2JI8A 4S04A 3EZ2A 3OP1A 1E7MA 2IOFK 3QVXA 4DTCA 1D2MA 3OEYA 4P7FA 2O8FA 4FQ5A 1MTOA 3DTNA 5JATA 3UMVA 3SR0A 1RC8A 3TEJA 2P5SA 5K99A 3NBFA 3BEOA 2AEMA 2X3FA 3VR4D 1Y5RA 3FH0A 3P97A 3VMMA 1JBKA 4A10A 1UC8A 3IRUA 4M9RA 2QLJA 1BX0A 4EHJA 4ALLA 3ZYZA 4KAAA 1R6VA 1XDUA 3PK0A 1E2BA 2A88A 3EIHA 2IDMA 5T64A 2BSXA 1Q22A 3ENNA 5M3BA 1ACMA 3K6RA 4XYGA 2YJGA 4FI3C 5EIBD 1LUAA 4XCVA 2YHIA 3I05A 2R00C 4FQ7A 5G0WA 3OD1A 4JJFA 3WHPA 5KCMA 1RZRA 4QUHA 4QYXA 3NMUF 1RWVA 3LG2A 4GKAA 1T2CA 2HAEA 3SOZA 3HB9A 1C7EA 4MWTA 2CNDA 1J2EA 1GPAA 4UAVA 2VOJA 4V03A 4BWVA 1TYCA 3OJOA 3ZE1B 1BQEA 1HDIA 4HAOA 3S2UA 4KREA 1I7NA 5KVQA 5FEUA 3IKVA 1MXHA 4OM8A 4P35A 2O3SA 4RV9A 2JJQA 1IFXA 1O8BA 4G4SP 4Y0AA 3TD9A 7REQA 1FTWA 2B5OA 1X7ZA 3BBLA 1Y1SA 2WYWA 1BCRA 1MN6A 2G07A 1Z12A 4ZEWA 2AN3A 4F8JA 5BNZA 4HP8A 4BQIA 3NFRA 3W6ZA 4YV2A 2Y99A 3T7CA 1WUYA 3D7NA 1C81A 1ABFA 1A9XA 1XQYA 1Z3IX 2CFTA 4ZGGA 1K6JA 4WESB 2R6FA 2ZYTX 1JMKC 3RVBA 2WTBA 1XLUA 2ZAGA 2HSJA 3K8QA 3ZVMA 2YICA 2PIDA 3DBRB 4PAWA 2XRFA 4Z9AA 3ZHRA 2AJBA 2C9ZA 2PZ8A 4HDNA 1WMFA 1Z5NA 2II6A 1Z63A 4FOSA 3CRRA 2ZSHA 2FPUA 4ISBA 4NU5A 3UUEA 5ALLA 1D2EA 1P0PA 3HJTA 1HPLA 2NZ2A 5JIBA 2QSYA 1LY1A 1UPFA 1WCXA 4NRDA 1SVKA 4OH7A 5JH7A 1DFGA 1SGWA 4CT0A 4F9GA 3NBUA 4NBVA 4K87A 4OHFA 1NHGA 3C3WA 5BWBA 1ACJA 4IVPA 4MVJP 5C31A 3PI7A 1I6WA 2HO5A 3ML1A 2VAVA 1S3IA 5K3BA 1SBCA 1U6IA 5CYOA 4LDJA 2PJRA 3F8SA 3DB1A 3M83A 1PGQA 3EZ9A 4HLDA 4MGEA 4W9RA 4L28A 2QS9A 2BEVB 4PR3A 1WE2A 2C3UA 5K6TA 3F8WA 5CYGA 2FOIA 2ZJ3A 2HMWA 3DT9A 4ABYA 3BD8A 3N2YA 5IN4A 1Q7RA 5EE0A 3LLUA 4LV6A 3RTGA 5KBYA 4FNOA 2QTMA 3LK6A 2G63A 3L6RA 3PJRA 2GN1A 2HA4A 1DUSA 1IY8A 1NN1A 1ZGAA 2ZJZA 3GFRA 3FTDA 3P94A 4IDGA 2DQSA 3FTCA 1NZJA 1SIBE 2ECOA 3KC2A 2H4XA 2AG0A 2HJGA 6NULA 3F4KA 3KUKA 3V1YA 1YMQA 1FYDA 1JPUA 1LTKA 1KFEB 1X1DA 2WFMA 1EDOA 3JWGA 3LMKA 4JOCA 2P2GA 4V3BA 4RZSA 5FHQA 3SQMA 3WK7A 3ZKAA 3ZZ1A 2O5EA 2AOUA 4GMKA 2O48X 3A9WA 1XKXA 4QDZA 2HIGA 4B7XA 2J3DA 1M1ZA 3AR9A 4BTEA 4L6IA 2ZRAA 4Y6LA 3MBIA 3BIWA 2G0NA 4PGAA 3T7IA 3FNBA 3W4IA 4BUZA 3ZWOA 4BNNA 1QZ3A 4Q4DA 2BFFA 3PDWA 4UAUA 1JEYB 5LKRA 4A2QA 1Z7EA 5TQ0A 1X42A 2V6FA 4HNVA 4YIHA 1CB0A 4QUJA 3HABA 1IN8A 1NUPA 2B21A 4EF4A 2BEKA 3K0CA 3OFJA 3BWDD 4IHJB 3ZCSA 1WU8A 5D2CA 1UPXA 1N2CE 3DR3A 4GT1A 4KU4A 4LJLA 3OTHA 4M49A 3QU7A 1J6UA 3Q10A 4DLTA 4NS4A 3E84A 4OSPA 2Q5LA 5EGSA 1SU6A 2Q1UA 1XP8A 5IC5A 3VYSB 3BIOA 4Y2YA 3L1VA 1OLSB 3SBXA 1W35A 2PANA 3IP5A 4NMXB 3O2JA 4HAIA 3OLYA 1YIOA 2FUG6 5CVCA 5LP6C 4L4RA 1SVOA 1ZC3A 3B70A 3DZBA 4P32A 4XQGA 1OW3B 1JVNA 1NNUA 1X77A 1YDHA 3GNLA 4YWJA 3RQSA 1G20B 1ZD9A 4NPCA 4R05A 4JHLA 3VDXA 3K1AB 1A7KA 2JIDA 5I8WA 1ZDMA 1J06A 1TOAA 2XB9A 1Y80A 3B8EA 1MDBA 1PYGA 2QYHA 3OSZA 3R0QA 5D01A 2IC5A 2R6DA 3EGOA 3FNRA 3ERCA 2OBLA 5I4KA 2C2HA 2MWMA 4URXR 1QJCA 5KWIA 2CDBA 5KKNB 3RS5A 1GDTA 4YJ2F 3HNRA 4KQGA 3WJ2A 2VJAA 4UHBA 4C3UA 4DYHA 4WZ6A 4US2R 3H9EO 4NJEB 3F6SA 2GM5A 1ZESA 2ZBFA 1BCRB 5CA1B 4J16A 1KZ7B 1MFPA 1OXBB 3IV9A 2FFQA 1RRCA 3K0SA 3FMIA 1GZ7A 1DEXA 4MVJA 2V97A 2UXBB 1WXFA 4JI1B 1U7OA 3R8XA 3NNDA 3OC6A 2BUAA 2B4QA 4UAJA 3K70D 2PX2A 3WZLA 1O97D 1U0GA 3FI0A 1MPXA 1SG0A 2HTEA 4PSKA 2YNMD 5KX5F 2OHHA 5LOVF 1OQAA 1KE2A 1Z4PX 3IESA 1F9EA 3LH5A 1ECFA 3QX7A 3I6QA 3ZDAA 3MS7A 1U5CA 2I4IA 4JR1A 1UJ6A 2P79A 4OLJA 4UUNA 1YJ8A 4H08A 3ENQA 3O3NB 4Y2HA 4EHDA 5HOQA 1RZUA 5D3KA 1OAKA 5KVSA 3E1KA 2I4LA 3OTWA 5LQKA 3MF4A 1JHDA 2PZMA 3ECSA 3PZRA 5GZ1A 1SVIA 3HVJA 1EH5A 4YT8A 3JAKB 4FLEA 4HPXB 1Y5LA 3CINA 2FZ5A 3FW1A 3OP4A 3QVJA 4HFJA 1UT5A 4JUFA 1GPKA 2ZRLA 1IXKA 1QUEA 2RI6A 3DEIA 3O0TA 2JIMA 4LVOA 3WRXA 5J4VA 4UTNA 3RC8A 1NY5A 4D2IA 1DKRA 3OCYA 3LW7A 3LBHA 1P77A 3ROKA 4LF6B 1CJSA 2J46A 4PLHA 4BLQA 2VH2A 2QLTA 3SYMA 1KEWA 2X0IA 1Z7BA 1ZSVA 2JCBA 2R00A 5FQOA 3T35A 1Z6XA 4E46A 3KFXA 1TYEB 2VDRB 9ABPA 1QE3A 1CEXA 1M34E 1Q7BA 3FMGA 1HR0B 2GO7A 1DCKA 2NM0A 2I7DA 1OI7A 1ND6A 1NVEA 1QZZA 4PZUA 4DR5B 3OZTA 2E18A 3GL9A 2PT5A 4JP5A 4MUYA 3E3NA 4DSUA 2B2NA 5G1OA 2H3EA 2O14A 2B36A 3LQRA 3T34A 3E7FA 4Y2QA 5I48A 1VSBA 3EOAI 1K8RA 2ZUFA 3PUZA 4ZJZA 4KHPB 3A25A 4K9QA 4KDRA 4K9PA 4CTOA 2AXEA 2LRHA 1GEEA 2IYZA 3HDTA 3ZZUA 4H7IA 4OH1A 5HFNA 2HMYB 3NXSA 1JP7A 1RJWA 1NVKA 3HUDA 1C1XB 3WAKA 1LK5A 4DQVA 1DMSA 3KVOA 1F48A 4GC9A 1QGAA 2PLNA 5C7YA 2ACWA 1XAIA 2Q5OA 5BV1A 4KO3S 5AFSA 3JASA 3IUEA 2BT4A 3DULA 4OHYA 3FTQA 4B85A 3DE6X 4M1SA 1ATIA 2V6BA 5EE3A 8GPBA 1ST2A 2EYQA 1E6KA 3B1JA 4TMKA 2G08A 2IIQA 4A2WA 1PGPA 4ZOAA 1CUYA 5H80A 3E0XA 4RTLA 4MJXA 4MKXA 4J0KA 4R7TA 4NBRA 4IZ6A 5EUCA 4D9NA 2A7XA 2LVBA 2X8WA 3BXZA 5FI1B 1UBEA 3QQ5A 4UNNA 5JAZA 5KDOA 4EEXA 1DDGA 1MIOA 3Q9NA 4KXMA 1K0UA 1S2DA 1EGMB 1H1TA 3P0RA 1QG0A 1ETHA 3TM4A 4CM4A 3UBMA 5CXSA 5AT1A 3WLAA 2P9BA 2XADA 5AHOA 2DBYA 3K0FB 3BMXA 3MTIA 4LRSB 4BNWA 1EB8A 1G21B 3QKTA 2B8WA 3D81A 3QJGA 4XA8A 4RAQA 1OFVA 1ZKDA 2VAXA 3UKOA 4WOKA 5B6JA 1YVPA 2ZZNA 3RO7A 2RGBA 4C0AC 3DAYA 3H5IA 4OL0A 3IO5A 5FQNA 1U3UA 1T4CB 1AKEA 2IHBA 1XN1A 3REFA 4D4GA 5TT1A 5K2MA 3GRVA 2A4KA 2WVGA 2E1RA 5F5XA 1C1DB 4MRAA 1J8FA 5GM1A 4LDRA 5AUOB 1S8NA 3TIVA 4LWZA 3NANA 1JALA 3GH1A 4Q9NA 3L7CA 5GONB 2DUNA 3IDQA 1I1NA 4PEVA 3IXQA 4IJ5A 1IHOA 4OXIA 2ZJ1A 2QZ9A 4IMRA 4KTVE 2EX0A 3CS3A 1W25A 2AFIA 4FLMA 4ZCMA 2FETA 5K0JA 1PR9A 2FP3A 5DU2A 1Z0KA 1UJMA 2QQGA 3A0RB 4PGHA 1SU7A 1KEZA 1ZYUA 3GIWA 4RW0A 1N36B 3MGGA 2BC9A 1CIPA 4IGAA 1EK1A 2O0KA 3EDOA 1IPHA 4UVEA 1SG9A 2VHCA 3ZIUA 4A73A 1IRIA 4FDLA 2D4HA 4MR7B 1GAEO 1QJ4A 1Q1ZA 2YWBA 4YONB 1JQDA 2XMCA 3DT8A 4YO8A 2YWJA 1W4LA 3V48A 2VIIA 3U9TA 4G89A 2I2CA 3DBIA 2VP6A 4N5DA 1G42A 1UBJS 1BMFD 3LA8A 2XGMA 2P91A 3AEYA 3KSBC 1ZGJA 3PU6A 4D9CA 4H3SA 2OBFA 4L75A 3TR5A 2GFHA 4C4XA 1MR3F 1CZLA 3KCNA 4TLMB 4RTKA 3HKCB 1OIXA 3INNA 3HWWA 3VJKA 1LEHA 1X7YB 4DFDA 1TZKA 2RCNA 3NBAA 2J0SA 2Z58A 2ZI6A 5L9AA 4DV1B 1RBZA 2AD5A 1A5TA 1R0WA 4U2FA 1XP5A 5K03A 4DRXA 2WJYA 1Z18A 3L0DA 4RVCA 221PA 1YZTA 1CUSA 3KJQA 1NBHA 1N3LA 2WWRA 3JS5A 3L7OA 1J0BA 3MLBA 2CLCX 3ZGZA 2HF8A 3ID6C 2JHPA 3F6CA 3GYBA 4XIYA 1V5IA 2FHSA 4HRYA 5JCXA 4E2FA 2QX7A 3JVDA 1QLHA 1JSCA 1QRSA 2NUAB 4HKTA 5IXSA 5L3VA 2XQVA 2QRHA 3MWLA 4G1EB 1UWVA 1KTVA 1L5ZA 1Z5WA 4Q1CA 3HY4A 4R54A 1WA5A 1EGVB 1ZU5A 3IUPA 1LRJA 4FKZA 2O8CB 3LCRA 3NBZC 2DPMA 1U7UA 4RMIA 5EHGA 3TZQA 3WWCA 2E37A 2NSHA 2Z2IA 3SY8A 4BECA 2PAFA 2TRSB 3ADKA 5EPOA 1U28A 1VJGA 3WMGA 5J2UF 3MSCA 4MIEA 4H7HA 3AM3A 2ZWVA 3DHNA 2QTWB 2HDWA 3PDCA 1QO0A 3E5NA 1H66A 4B8WA 1T6ZA 1DPGA 4N0MA 4QU0A 3PA8A 3I5MA 2Z95A 4PG5A 3MC1A 2FXVA 4GBGA 4D9GA 1OB5A 3UENA 3ZHBA 4KQ2A 3W2FA 1QCCA 1VRVA 1MX3A 1PGJA 2DWCA 2O1SA 3F97A 3G8AA 3DJYA 3PUWA 4JT8A 4P3NA 3DWIA 5IJAA 1XZBA 2AN1A 4RLSA 3BE4A 1XT6A 1WP4A 3LHKA 1CETA 3FPEA 3MINB 1OTXA 3KDSE 3KQHA 2HQOA 1PZHA 3OOEA 4P08A 4Z4FA 3ER6A 5DWVA 3I5YA 4G9GA 3ZZTA 2PVPA 3D3NA 2BWJA 3K16A 3D4BA 4PTZA 1JHOA 2CCGA 4YMWA 4CL8A 1PV4A 3ZHXA 1ZLXA 3CUEF 4QEZA 1TCBA 2FPGA 4YLGA 1HTBA 3H5NA 4ZCPA 2HLHA 5FPYA 4CM8B 1NFQA 3HBFA 5LQUA 3E9NA 3LNTA 2AH5A 2HEIA 1N7GA 4REOA 1LLUA 4D3DA 2GN9A 3WX0A 5GJVC 1E1QA 2ACKA 4ZAZA 1W0JD 1TVEA 3G0DA 4MW6A 1DRJA 4I55A 2AG6A 3AT1A 1H69A