3UY4A

Crystal structure of pantoate--beta-alanine ligase from campylobacter jejuni complexed with amp and vitamin b5
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
283
structure length
283
Chain Sequence
b'AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Crystal Structure of Pantoate--Beta-Alanine Ligase from Campylobacter jejuni complexed with AMP and vitamin B5
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
total genus 88
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2011-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3uy4A02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3uy4A01
1DNPA 1T9GS 3D6UA 4KPUB 1UFVA 3Q4GA 4ZT3A 2H29A 4J75A 4KR9A 4MAFA 1MB2A 5BNZA 1XJQA 5HG0A 1KQOA 2A1TS 3AIIA 1KP3A 4RUKA 1Q15A 1XNHA 4DJAA 4ZCTA 4MVWA 3IDFA 4NATA 3RBAA 3PNBA 1CT9A 1U7DA 2CT8A 1OD6A 5EKDA 4U63A 1J20A 5LM3A 3DV2A 3F3MA 4EG5A 3IMCA 1KQPA 4X0EA 1EUQA 3K9WA 2CYBA 2GOYA 1WXIA 1WJGA 4PBTA 2J07A 1F7VA 1ZH0A 3MMXA 1NI5A 1JIIA 4ZCSA 3ZUGA 3COVA 1U7XA 2QUJA 4MW4A 1O95C 1N2OA 1TYCA 4K0RA 1PFWA 5FO1A 3SDBA 3COZA 1JMVA 1QRTA 3FDXA 2J5BA 1KH1A 1M8PA 2DXIA 1H1TA 4MW6A 3H9CA 3CLUC 2OV4A 3IVGA 4GRIA 1O96A 2V0CA 1R6XA 1LW7A 3NBAA 1MB9A 1NUTA 3FNRA 1T6ZA 3ND6A 2DEUA 2B7LA 1JECA 4YBRA 3SEZA 2V0GA 1YIAA 4MQ6A 2E0IA 2X0KA 3ZJTA 2J08A 2PZBA 2JANA 2PZ8A 1VBMA 2NSYA 1M8KA 3A04A 4JXXA 1QQTA 2QTRA 2DERA 4GU5A 1EFVB 4ZCPA 4MW9A 1N2IA 4CDNA 2J4DA 3ND5A 1VBNA 4UZFA 3RJZA 2R5WA 1H3EA 2CV2A 3HV0A 1M83A 5TS2A 4E1AA 2A1UB 2PFSA 1QTQA 4MULA 4J76A 4ZT2A 2X3FA 2DLCX 3COYA 1QNFA 3UMVA 1NP7A 4MW0A 1NUSA 3QTTA 3H97A 5H16A 2JAXA 4A91A 1Y42X 4QBTA 2GM3A 3CVWA 1SURA 2XRZA 1GAXA 4EG6A 1K97A 4QRDA 3UOWA 2QUHA 1EJ2A 1PG0A 2G36A 1Q19A 1J09A 4NAUA 2CV0A 3FG9A 2DETA 2QTNA 2YXNA 3GLVA 3CR8A 1Q11A 1MRZA 3CVXA 4Q16A 2YWBA 5KHAA 3H05A 3KT0A 4TS1A 3IODA 1J70A 1GTSA 3PNYA 3KFLA 3MUEA 3SP1A 1QJCA 1MOPA 1I6KA 2GKSA 3IVXA 3SZ3A 4CDMA 5JBNA 1FYDA 4NX2A 2O5RA 1QU2A 1O97D 2E89A 4KPUA 4XFDA 1PG2A 1JGTA 4EG8A 2X1LA 2PXHA 2HGZA 4YMIA 1NZJA 3RK1A 1G8FA 1K4KA 1NUPA 1LI7A 1JEDA 1KH2A 3CA8A 1KP2A 2YY5A 1IQRA 3H99A 4KR6A 4MW1A 1NUUA 1O94C 4Q93A 2IJGX 3FY4A 2WB2A 2ZUFA 1OWLA 2I1LA 3ILVA 5HUHA 4MUHA 3ZXIA 5K0TA 5TGTA 1N2BA 1KR2A 3HFJA 1TFUA 5IJXA 3GMIA 3JXEA 1A8HA 4G5YA 3G5AA 1GN8A 4AQ7A 3U1VA 3N2YA 2HZ7A 1TYDE 4BWVA 3RK0A 3C8ZA 2H2AA 2VTBB 1H3NA 1EE1A 1JZQA 1PFVA 4G5FA 3DLAA 2D54A 1F7UA 4MUEA 4HJXA 4F4HA 1WKBA 1KORA 4ARIA 3LCJA 4U8HA 3A4IA 3MXTA 3H9BA 4MW2A 1VL2A 4KKVA 4DLPA 3K32A 4ND6A 1PFUA 2BTEA 4MUKA 2AZXA 1WXEA 4EFKA 3Q10A 3SYTA 1TYBE 4UZEA 4EG1A 3M5WA 4ND7A 1MJHA 4OJMX 3X1MA 1M1ZA 3BL5A 4EG3A 3CLRD 1WZ2A 4G6ZA 3UK2A 1EFVA 3CLTD 3VRHA 1KH3A 2DUMA 4H3SA 1K92A 1FFYA 3A05A 4KR7A 3FIUA 1G8GA 4MVYA 1YIDA 3IUEA 1M8GA 4JYZA 1PFYA 4HJRA 4NAHA 1XNGA 3ZGZA 4R2LA 1ULHA 4I6EA 1O0BA 1TQ8A 1O96B 1O6BA 1JZSA 3N05A 1N2JA 1QU3A 3X1JA 4ZCRA 1TEZA 5TEWA 4MW5A 1U3CA 1EFPB 4P2BA 4U7JA 4MWDA 1B6TA 5H7XA 3IOCA 1JIJA 3TS1A 1KAMA 5DK4A 2BYTA 1V8FA 3TZLA 3HZRA 1G59A 1GPMA 3RFFA 1I6LA 4YP7A 3VU8A 3IMGA 1N78A 1R6UA 3IH5A 4CQNA 4I6JA 3L93A 1MC1A 4L2IB 3IVCA 3DPIA 4FZJA 3CLSD 2WQ6A 3AL0C 4R0NA 3AKZA 5KWVA 4OUDB 4DE5A 4WSOA 3CLUD 4ZT4A 3SZGA 4MUNA 4WNYA 5FO0A 5DASA 3QTBA 3KT3A 3ELBA 2RD2A 5HUJA 1U3DA 2ZUEA 2WSIA 4YP6A 3S3TA 1ZH6A 4DDMA 4MUJA 1Q77A 4RPIA 3P52A 1EXDA 1M8FA 1LI5A 2A88A 5LFAA 1D2RA 4ZT7A 2RE8A 2D13A 4MW7A 2QJTA 2PIDA 4NZPA 4PBSA 4EGAA 1ZUNA 4ARCA 5J5AA 1X6VA 4MWBA 4EF6A 1N3LA 1WOYA 2A4MA 5J59A 5FNZA 1NYLA 1WXHA 3KT8A 1KAQA 2C5SA 1XNJA 1BS2A 1IHOA 1OBCA 4EG4A 1NUQA 1VLHA 5KCMA 2OQ2A 2VTBA 3TQOA 1KKUA 1J1UA 4YP5A 1IQ0A 1N77A 1MBZA 4XSVA 3G59A 2AKEA 1OWNA 1N75A 1G8HA 3PNVA 4R2MA 3ND7A 1J1ZA 3P0JA 4K03A 1GZUA 5DB4A 1O0CA 1VBKA 3INNA 1OWPA 3IMEA 3IOBA 3NV7A 4JXZA 1JEEA 3IUBA 1OBHA 2YWCA 3GUZA 1WQ4A 1H3FA 3PRHA 3P0HA 2A86A 2XRYA 3OTWA 3E27A 1MAUA 2EL7A 1T9GR 3FI0A 5LLTA 1YULA 3CLSC 3ISJA 2PG3A 3MLBA 1TYAE 3TQIA 3HMQA 1WXFA 4QREA 1MAWA 1JHDA 2IELA 2D5BA 2A1TR 3CVUA 2CYCA 2A7XA 1COZA 5DEOA 3PXUA 2QTMA 4MWCA 3FETA 2X1MA 3VGJA 1J21A 2Z09A 3NBKA 4ZCQA 4MUFA 1K4MA 3FOCA 5AHWA 1KQNA 4PBRA 1N2EA 2NZ2A 2ZP1A 1O97C 3HGMA 1N1DA 1JILA 4JZYA 3FWKA 4DNXA 1M8JA 3HL4A 1I6MA 1YUMA 2A1UA 1ILEA 1N2HA 1EFPA 1WQ3A 1WXGA 1I2DA 4CT0A 4EG7A 3ZXSA 3OP1A 2Z3VA 1O5TA 4MUGA 1GLNA 1YI8A 2DPLA 3P0IA 3KT6A 2QJFA 4JFAA 2VXOA 3LOQA 3SEQA 1O94D 1OWMA 2CUZA 3MLAA 1WY5A 2QUKA 3AFHA 5F23A 4ZT6A 1F4LA 3RHSA 1GTRA 3QE4A 1QRUA 2E18A 4PY2A 3UC5A 2CYAA 4F3RA 4ZT5A 1U0BB 1HYBA 3DO8A 3ZJUA 4MLPA 2AG6A 4DDHA 5J58A 4L2IA 1IFXA 2A84A 1IQUA 1T6YA 2EJCA 1NURA 4MWEA 4XFJA 3Q12A 2CSXA 3N9IA 1IH8A 1NSYA 2TS1A 4OUDA 1IVSA 1O95D 3LE8A 4AS1A 2PZAA 3IOEA 1F9AA 3CVVA 2E21A 1RQGA 1N2GA 3X1KA 3G6KA 3D6VA 2DR2A 4I6GA 2IP1A 4MVCA 3I05A 1YUNA 1ZJWA 4NDAA 1T6XA 1IRXA 1OWOA 3AG6A 4HPWA 2Z08A 3ZJVA 4HK4A 3ZIUA 1JIKA 2CV1A 1R6TA 3A2KA 2QUIA 1X8XA 1QRSA 2J09A 3TNJA 3AG5A 3CVYA 4MUIA 5TEVA 3L92A 3N8HA 2QJOA 3CLRC 1V47A 3FH0A 1EUYA 2HMAA 5IHXA 3CLTC 3TZEA 3UY4A 5K0SA 4DDKA 2WQ7A 4S1OA 1P7PA 3FHJA 3COWA 2JA2A 4MVXA 1S4MA 2O8VA 2CFOA
chains in the Genus database with same CATH superfamily
1SBZA 2W2LA 4E4YA 2OYSA 2M1XA 4WCFC 1U0JA 4JI1B 3DBRA 4MV0A 1R66A 1U9YA 1RR6A 1BFDA 1FVHA 3HCAA 2LD4A 5KKNB 1FDUA 4EFDA 1T0IA 3QU2A 1RHRA 2GN4A 4Y2SA 1GCOA 5SY6A 1ORDA 3C74A 3QX9A 5K45A 3T7CA 1R5OA 3RBAA 2I67A 1QYDA 5CEJA 5EKDA 3DUWA 3GLHB 2A9KA 5EZQA 5CCBA 1UFQA 4ROSA 4C7MA 3P2YA 1JSXA 1O9BA 3FF4A 2JFXA 3WWYA 2W8ZA 5KVSA 3OM1A 1E1QD 1NBWB 4LKRA 5IC6A 4M0CA 4REQA 1VMDA 4XM2A 4C9BA 1NM5A 2FSVC 1JLRA 1YQQA 1V1JA 5IF9A 1ZHOA 3FUUA 4AF7A 1GT91 1T3HA 2F43A 4MP8A 4NESA 3S40A 1P2DA 4PWZA 1XJWA 3DGFC 2FPRA 3W78A 1JW9B 1D1TA 1GITA 4WOBA 1ONNA 2FP3A 2VUSA 2QN9A 3K2EA 4QWMA 1Q12A 2C0PA 1XU7A 2WLTA 1Z4JA 1BHJA 2G5TA 5G41A 3BGDA 4H3VA 3WIOA 5HF8A 2QYOA 2Z6AA 3HRHA 4N4AA 5K6RA 3U5ZB 1YRQA 2VQDA 1AKRA 1VPDA 4KQCA 1FTQA 4B44A 1L7DA 4HUTA 2W6PA 4YVFA 2WV9A 2NU8B 1HOXA 1ZUHA 2V0CA 1LBQA 1CDZA 4M0EA 1RIIA 4E0BA 1LW7A 1K7YA 5TQ2A 3WTCA 2EX4A 4PSVA 5ENZA 2O1XA 1U28A 1CUDA 3IA2A 1PJTA 1TVEA 1FMTA 1JECA 2FLVA 3IHWA 3GUCA 5J2UB 3M9XA 4OAOA 5CVVA 2YOGA 3DT8A 1HLDA 2O7VA 3JZFA 1AZWA 3ELWA 5SV2A 3G2NA 4BFTA 4TLLB 3QVXA 4C2TA 1U7TA 4QJ4A 5A62A 3R23A 3PD7A 1QQTA 4G8DA 3OP4A 1GPAA 1CQXA 1V9CA 2GPYA 4ZCPA 2J0UB 5CEFA 1F8UA 4Y2YA 3IIIA 2BEVB 1OFGA 1CR0A 2WYVA 5HS6A 1GKIA 5M2QA 2H7VA 4PGHA 2VNKA 4GOKA 3LC2O 3O8CA 3DKVA 1N8TA 1QM5A 2HF9A 2HEGA 3A1EA 1GTG1 2W9XA 3ITDA 3RJZA 1Z33A 2FN8A 5EE1A 1P2TA 5DHRA 5HKLA 4N49A 4IUDS 3TE6A 1OXSC 2FPXA 2JPDA 1RLUA 2JD0A 2X5OA 3ZNNA 3VQTA 2PKQO 4GOND 1U8UA 2PT5A 1YBVA 2EJVA 4KO1S 4LXIA 3COYA 1N8NA 4ZXFA 2REBA 4OMCA 3IDQA 4HGZA 1HGXA 4WESA 3PWZA 2QD3A 1SUIA 1KYIA 2GM3A 1VI5A 1NPYA 2X7XA 5A05A 4EY6A 4OP1A 4KIUA 2BCGY 2JKYA 2R6GA 2FF5A 4EHIA 4F71A 2FQQA 3PXXA 3ZLUA 4ZV4A 3AEYA 2XVAA 4RIFA 5FI1B 1Q19A 4DN6A 4DV3B 3MILA 3FWNA 5AVUA 5IBQA 1BDBA 1E2LA 3L40A 4GKAA 1BCSA 5A4IS 1M1YA 1NWCA 2RHMA 5C8XA 1BC5A 1UAYA 4EW3A 1EFLA 1G21A 1BN6A 2YWBA 3GEMA 2Y05A 2UVDA 2ZVPX 2ENUA 4H16A 4OBWA 3E03A 4WXEA 3MUEA 1JDZA 1SXIA 3MCTA 3KU1A 5IM4F 1ENPA 4CM5A 3MC1A 1GSHA 1OPRA 4AKIA 1XO1A 2JI8A 3DE4X 2CBZA 2P65A 4DA8A 4OL0A 3T5GA 3WMWA 3MS7A 3JQDA 4IOLA 4CEJA 2FEXA 1OT5A 3IAXA 4RZHA 1XLTA 1PG2A 1Q2UA 3HDHA 1COWA 4IIJB 1P33A 4OSOA 1NRIA 1Y1TA 4ZVNA 4HEQA 5HBRA 4BMSA 1JFFB 1N4AA 1T36B 1NJGA 2AOUB 3FB4A 2VG8A 4JI3B 1CD5A 4D96A 3RK1A 5CITA 4M1TA 3WL6A 3DKPA 2G4LA 2GKGA 1IN8A 3JRXA 2P9FA 4UHKA 4YDHB 3ZHZA 2YY5A 4LMAA 4BO5A 5KIAA 1LSSA 5HS4A 4ZGGA 1CZHA 2W2OA 1M2OA 1PJAA 1SZJG 3BM5A 1W0JA 3IT3A 5FRDA 3TI9A 4YV2A 3ZVNA 1HNXB 3FKSD 3CQ9A 1CUZA 1HNNA 3BXXA 4XPIB 1UAAA 4KSBA 4ZO8A 1AV7A 2VKQA 3JARA 4EVRA 1DE0A 2IYPA 2XWBF 5HMMA 3AR5A 2OXTA 3BEOA 3I37X 5BSRA 3AF0A 3JQAD 4E2FA 2BGUA 4ETNA 3GWZA 4X1IB 2PMKA 3K92A 1V25A 1T0JB 4NBNA 3TBFA 1NX6A 3VNUA 4D9JA 5C51B 3K20A 3QF4B 4FGUA 1NJ1A 1YVEI 4MV5A 1NW4A 2RGCA 3R3XA 5I9MA 2N0SA 5LZ8A 3Q0TA 4CM8A 1RXUA 3TSYA 2OBBA 2W6JD 4JJIA 1LFAA 4ID9A 3S2YA 1SIUA 1D2AA 2J5QA 4JNKA 1NLFA 3WNDA 2VSXA 1YVPA 4PQFA 4LGCA 2JFYA 3F5MA 2XUIA 4IYRA 3JCZA 3HYTA 4TV8B 3VR4D 2C3YA 5D87A 3EXAA 1E7RA 5F21A 3TVYA 3EQ9A 2GLUA 4ZP1A 2QXTA 3CPHA 1II0A 2R6ZA 5BNTA 4MO2A 2ZE5A 3MAJA 2XA1A 4ND6A 2YASA 1D2HA 2HU5A 1UMDB 2OHVA 3ORSA 4V38A 2ZYDA 1WQ1R 1ZO8A 2WD9A 3IA7A 5F1KA 3GN1A 4EFKA 3R0VA 1VJ0A 1EM8A 1BS1A 4UZEA 4IMJB 4CKCA 2WWYA 4RD0A 1MJHA 1E9DA 2W2PA 3RRMA 1B41A 2LW7A 3X1MA 1WZ2A 2CCJA 2DUWA 3WFIA 3UB2A 2C4UA 1GRVA 1UKEA 2IPXA 5G53C 2GQ0A 1J4AA 1J99A 1JH8A 1H5NA 3ZV5A 5DOVA 3UH0A 2OORA 3B89A 4EVQA 7REQA 3PCRB 1YO6A 1Q7RA 4OBXA 2G0NA 1XJCA 2GBLC 5A3JA 5FOSA 3R7FA 4U00A 2FPPA 5U9CA 1TQHA 1C2TA 1CY7A 3OPNA 4HGOA 5IF3A 4PG6A 3N8GA 2VJMA 3W6ZA 3ZI4A 2AF4C 4TV8F 4ZO9A 3UWMA 3URKA 4EHDA 4OO3A 4HDOB 5LZ5A 2ZIUB 2IKQA 4CTJA 3IT1A 5E3IA 1B6TA 5I7EA 3I3OA 4PX2A 4LV8B 4OTZA 3TVDA 3CRRA 2DF8A 3DZGA 1M5RA 3ZHCA 3T9EA 3BE6A 1NVAA 4QFMA 2XV1A 5ALTA 3JWGA 5J3JA 3TRIA 4YPVA 1DFGA 3RC1A 3VNRA 2ZWOA 2HQOA 1CJTC 3F6EX 2HD4A 3LXXA 2TRSB 5B1SA 3M1YA 1JHUA 1PN3A 1O94A 1MA0A 3QKUA 2JK0A 2Y93A 1R6UA 3EZGA 1DTSA 2GF0A 3IH5A 2Z5FA 4KFTA 2XMBA 3NIGB 4QBIA 3VPSA 1PWHA 1K4YA 5EXPA 1AHPA 4K6GA 2GEKA 5EMHA 5CD9A 3CN7A 4UFPA 3IVCA 2H31A 2Z58A 2O05A 3H1FA 1E3WA 3IEIA 4MQ4A 4OJYA 5E2IA 3AY6A 3RF7A 2YMLA 4D8TA 1X42A 5ILOA 4WOJA 4GLLA 6NULA 1R0BA 1CR2A 1NVWQ 3T5DA 1B6SA 4WY8A 1CUFA 1TT5A 4W82A 2Z2XA 3I92A 3FSGA 3AFIA 1H6BA 1N7IA 2VF7A 5CVUA 2J9YB 4EYOA 4G4IA 1SKMA 1KK1A 4PC7A 2VT2A 5AM2A 3V7NA 1SVOA 1R16A 3QXSA 2NW6A 4QLBA 2WSIA 1GZ4A 2ZUVA 3GRYA 2QPLA 3H11A 2ZVQX 3OLQA 1E4EA 3NPAA 5CIWA 3RANA 3ZDYB 1Y8QB 5KNBD 1N0WA 4FWTA 1SY7A 3C7AA 1JG7A 3OMWA 4N41A 3ZW7A 1NVFA 2Y0PA 3SBEA 4UVEA 3DEHA 4B2YA 1AQJA 4MGZR 1D1SA 3KX2A 2P77A 2XVXA 4R4JA 4F11A 4Z86A 1XHFA 3OZDA 4QFBA 4LRWA 4UMVA 2CEAA 5LQDA 1N6IA 2TMKA 2OO7A 1LNZA 1KGDA 1WOYA 1T29A 4ZZ2A 5IYZF 3WTBA 4B71A 4BIIA 2XT0A 3UKJA 4R31A 3HXKA 4ZQIA 1OZFA 1KZ6A 1M76A 1Z2OX 1DRUA 3CEAA 1T9BA 2GDJA 2WVJA 1EYZA 3DTVD 4KXLA 5GJVC 1RLTA 3EVDA 3F98A 4QBHA 3EGOA 4POOA 3RTAA 1XYGA 1VA4A 1KKUA 4XGNA 5JAQA 2OFXA 2G0AA 2Y1WA 2QSJA 3DMPA 3EXIB 3LCUA 4IVRA 4BL5A 1H2FA 2H3HA 5CA1A 1GKUB 3FCEA 3H19A 1ZA1A 3HEAA 4XSVA 1N77A 3I9JA 4BQRA 4EPTA 3LBHA 4L75A 4NK4A 3Q8KA 2OSVA 2ZSKA 3E9MA 4MI9A 4ZOLF 4C20A 1PL0A 2Q6IA 3R9XB 1KU0A 2Q6TA 4RIGA 5KKAA 1PL8A 4R2HA 2J48A 1S2LA 3FN4A 2JJMA 4NF2A 2VNSA 3A06A 5EQJB 4DJ5X 1KR5A 2RGRA 1PP4A 1CYEA 5ALFA 4R8VA 4PONA 4EI2A 4PO8A 2Q1WA 1FA9A 2CNBA 4JQSA 4BU1A 1WE2A 2NU7A 4RD2A 4S3MA 2QAGC 2X58A 1W36B 5E6RA 1DPFA 3ILSA 2OBFA 3OTWA 2PKCA 3WA7A 4CETA 1XMXA 2EL7A 3SQWA 1JEJA 1XD8A 3Q8WA 2MTBA 3QOWA 5H8WA 1CEYA 4DQKA 1JB1A 1DJPA 3ISJA 2H17A 4CCYA 1EK5A 3FMIA 2ZRGA 3GLRA 3KOMA 2PBLA 4GI3A 4PXAA 5I4IA 4KFCA 4YCBA 3QVMA 2JF0A 3WMXA 3DF7A 1LDBA 2UZAA 1P91A 4XYGA 4DUZB 3VR3A 1DARA 4MWCA 4H1UA 2VTVA 2X1MA 4M86A 4G84A 3CXRA 3V1TC 3V5NA 5HJEA 3VH3A 1K9VF 4N7JA 1KQNA 3QHPA 1PAUA 4FSDA 2QTCA 2HBYA 4RWZA 1AGYA 1Z7GA 2GHTA 3C3WA 4OHUA 1Z6GA 4M99A 4N5MA 5EXSA 5FOVA 5TARA 3KAQA 5BW4A 3P0RA 4RULA 5BR8B 4UCXA 1M8JA 1KYWA 1IMJA 3KB2A 5ABPA 1NTRA 4KODA 2Y9MB 1PT7A 4WT7A 4WZAE 3AESB 3GRCA 5GM2A 4LYHA 2HRRA 1R0YA 3V3TA 2EFYA 4AZ3A 4WDQA 2A94A 4Q9HA 1E9SA 1SZDA 3MJHA 5NLLA 4G0VA 2FPWA 3BK1A 3P0IA 3VAZA 1THGA 4Z2YA 5L6MB 3A6JA 1IL0A 1QHNA 3DUFA 1WULS 2CUZA 1OT3A 4GMDA 5EKTA 2HJHA 3U0VA 1P4JA 4E2YA 2GM5A 3IBGA 4PGFA 4HYTA 5HJ2A 3SFTA 1Q84A 1DX4A 1F4LA 2P3LA 1BFKA 1R74A 3WV5A 4WIAA 3GJXC 1JIQA 1GUYA 1JVNA 2I4IA 3LGXA 4LS3A 5KAMA 5REQB 1XRJA 1QFJA 4Y2GA 3WK6A 3R6DA 4YXWA 1C0LA 2OXEA 1UC4B 1YR7A 2RC5A 3ANNA 5JC8A 5KC9A 4RK4A 3B3QA 5GV8A 3OZ7A 5GJWC 3WYFA 4AWBA 3IP7A 4GS5A 1IFXA 3MHTA 3FOAA 4PPGA 4MLDA 1JEAA 4JVSB 3G8DA 3G02A 4JL6A 1U0LA 4MWEA 3Q12A 2LE0A 4M8SA 1T0HB 1IWBB 2CSXA 4KHPB 1TJ4A 5AM4A 2W6QA 3N7TA 4Q9DA 3NTLA 5TY0A 2OHFA 2BZGA 2TS1A 4RDHA 3SOPA 2E5LB 4NH4A 1SA0B 2BP7B 1FYEA 1MH1A 2QIPA 5BUSA 5JJKA 1O1YA 3HVIA 4Y9DA 2FMUA 2QVGA 4JBLA 2QSYA 4NJMB 4ESEA 3D2BA 3F78A 1RQGA 2YVAA 4PIMA 5KZMB 3BWEA 1YNSA 1DELA 4Q9IA 3D6VA 3IUQA 4YUXA 2FW6A 4I6GA 5FA6A 3AHDA 2C7QA 1QXSA 3Q3JB 4F92B 3ZDZB 4A0HA 4XUCA 4Q7QA 2Z08A 2O20A 1RDFA 3ZN2A 3N07A 1P62B 3QIVA 4IDFA 4M1EA 5BWOA 4BO8A 3EGXB 1EJBA 1MDBA 3MW8A 2E4YA 3E7XA 3GVPA 2OYCA 3TLCA 4ARBA 5I6DA 1CX9B 4E14A 3WJAA 1LK7A 1TGYA 1HMPA 1CFZA 2O2SA 4J9UE 1XKXA 1LNQA 4PG5A 5DXJA 4OKNA 4TYMA 4EAAA 1R4AA 2CXRA 1TJNA 2HNBA 2OV2A 3KKZA 3ROMA 3FH0A 5FADA 4BX0A 4DS3A 2GM9A 4F86A 3OQNA 3DL0A 4OGWA 2VDMB 4Y9SA 2WQ7A 2DTEA 2FRDC 3DVRX 4ZAGA 3GD5A 1VKNA 3PGKA 3QUQA 1AA6A 2ODAA 4FKZA 4JT8A 1QB7A 3JS5A 3AVWA 2D0IA 5FPPA 2PLFA 4XWAA 4AN0A 3EASA 5DN9A 1AB5A 1O6ZA 7MDHA 4OVKA 3DAOA 4HDRB 2CFOA 4URVR 5I7SA 1M2EA 1QDEA 4KPUB 1QGED 4ER5A 1YRAA 2WD7A 3I2FA 4XA8A 1UCFA 1NLYA 3KG2A 4LRQA 3WHIA 4AQYB 3CH4B 4HRVA 3RVBA 5LQAA 1JYSA 5AUQA 1DGQA 5HG0A 2QRVA 4QSMA 5KDLA 1NOJA 4EP1A 1KP3A 2KW5A 3EVGA 1GL7A 2X9QA 3ASUA 3FUVA 4WKBA 3O31A 4NR0A 1E7MA 5C8ZA 2X0NA 4OM7A 2WJPA 1US8B 5CW1A 3GIWA 2HV9A 5KNCD 2IP4A 3DR3A 1EVKA 5FHRA 1CXZA 3V9AA 1WSBA 4ZYZA 4ZTUB 1MFPA 3ZU5A 4DT1A 2R00A 4G1EB 3MBIA 4JUFA 4PNHA 1J24A 4ER6A 3SMVA 1LSUA 1B23P 4UNRA 1ZITA 4AJ1A 5A9SA 3BJEA 3V1KA 2G9ZA 1Z47A 4YBZA 2Z9BA 5IDWA 3THOA 2C5EA 3MFYA 3UT0A 1TVKA 4A2CA 1M6VB 4FCVA 4M83A 1YZLA 2LIVA 2QRQA 4G01B 1RCUA 1BWPA 4WK4B 4YRRA 3NFYA 3TEFA 1XDWA 4K0RA 2WPDA 3PRJA 5EJ9A 3ZIAA 1RRPA 1JMVA 2BSXA 1HEUA 3GVCA 4HMQA 4M1SA 5ALSA 3W8FA 2P68A 3EVCA 1H1TA 1OXKB 5BYJA 2UU9B 2VHQA 5FPHA 5IW8A 3A3NA 1XA0A 2ODPA 2N9UA 4I1YA 2B2CA 1EWQA 2QYHA 2YRFA 1Q6ZA 3T7EA 3K0AA 4CLOB 5FX2A 4CMIA 1FNDA 4HQOA 4YHHB 1VMEA 1JMKC 4R8MA 4D9GA 4L0QA 4NU0A 1VL6A 2HSWA 3GQBA 2XUQA 4LYJA 1BTOA 1GU0A 1W5AA 1DJQA 3FX2A 3I6YA 3NC1C 4KQ6A 4QUIA 1FVOA 1YIAA 2QZPA 4EHHA 4F96A 1NU6A 3GB9A 3NM5A 4ZDJA 1WXQA 4IHJF 1YZFA 3LUJA 2IHNA 4A7PA 2VH2A 3EDQA 1NBMD 5CT6A 3DXXA 3IQZA 2PANA 5A7HA 2NSYA 3ZHUA 5KYTA 3GP8A 4JXXA 4AWAA 2FFBA 1LVUA 4E5KA 2QZJA 4K40A 3T1OA 2B1GA 1SK8A 1KNQA 1UPUA 2F1HA 1ISHA 3BD8A 4WACA 5TSDA 2GD2A 3ISVA 4I1RA 3U3DA 2Z04A 2QWXA 2XMRA 3ZJ4A 3LT0A 2F8TA 1SEPA 1V8BA 1N7JA 4KQEA 4M1QA 3LKBA 4N5DA 4QYWA 3W90A 5BMVF 2CV2A 4ME6A 1YIOA 4WADA 2D2VA 5CVEA 1V5IA 2O0MA 3VTAA 4ZVMA 4FYKA 4J76A 4ZT2A 4I4NA 4CMHA 3ZWAA 3V4FA 4X91A 3ROZA 4ZI3A 1L5ZA 2BFAA 1U02A 3OJWA 4K81B 1DHTA 1DJMA 1KC1A 1P2FA 1NP7A 5AVKA 1V16A 1NUSA 4K9SA 3LUKA 4OLFA 4DMMA 4WCFA 4F4IA 1P4HA 3HN2A 2A9PA 3R40A 1KI6B 3H8WA 1IJEA 4NZOA 2GZAA 5DNUA 3K0EA 1QYXA 1TW3A 3T1QA 1GAXA 1Q1GA 2BHTA 2NU6B 1DKUA 4PYMA 2JVKA 5TB5A 1RI5A 1YK1A 2Q49A 4NAUA 3DVAA 3QBJA 4C3UA 3DVQX 1AQ6A 4KBGA 1VDZA 3PUKA 5BYAA 5DM70 1O8BA 3EDCA 4U7DA 2BHNA 5AUOB 4EJMA 4W1RA 2ATIA 4FJ1A 4WOCA 3KKLA 2YNMC 4UARA 2FSFA 2G67A 1EKXA 1X19A 1D4AA 3BX1A 3EAFA 3K5WA 4HNQA 4UEWA 2L18A 4AG3A 2IFTA 1E5LA 2XGSA 3KOZA 4I4LA 2QD5A 3FHOA 2ZB3A 3H1BA 4BUCA 1T0UA 2XYGA 3UJBA 1YFKA 3EEIA 3KEFA 1Y1SA 4HATA 5EESA 3ONEA 4HXGA 5A03A 4HB3A 1FW8A 2JLQA 3AJDA 4FONA 2WIAA 4LXYA 5JFTA 1T2EA 1YC2A 4MJ7A 2G07A 3CJRA 2PXHA 4PAOA 4BQSA 2NIPA 2CZQA 1MKYA 3F6SA 2H9AA 1HYGA 1QTRA 2A0WA 4J07A 5LZ7A 4D0GA 1SCKA 2Q2WA 4BJ3A 3WAJA 5B7NA 2JLWA 1SC6A 3K0FB 5ECGC 1LPNA 3KFXA 3DDSA 1XRRA 1JJBA 4RA9B 1DX9A 5CYPA 1ML4A 1M54A 1NUUA 4NBWA 1PD1A 1AJEA 1YK0A 2BOVA 3BH6A 2A5YB 4GO1A 1BXGA 3L06A 1P2VA 3OIWA 5K8IA 3M0EA 3Q7SA 3CZRA 2JS7A 1E7QA 2H2WA 2I9PA 2GFQA 4BVLA 1ADFA 2IT1A 1H23A 3BSFA 4RM3A 4RX1A 2Z3ZA 4B7CA 3OY2A 1IATA 4B48A 4TMWA 1ZH2A 4DUGA 1N2BA 2Y1OA 5G0SA 1Q0SA 2G04A 1TFUA 1O58A 3K1YA 5FYQA 1NJ5A 5T4BA 2QX9A 4LW8A 3RSHA 2Q3HA 3HLTA 3UMMA 3OZCA 4ANFA 4IJ6A 1QWOA 3DXZA 2G88A 5F3RA 4I14A 1VPLA 1H94A 1EWRA 3M2TA 4H31A 4D8WA 4KXVA 5KYKA 1DT5A 2Q8NA 3M4ZA 3AF6A 1MC5A 1GXSB 1GYRA 3G1TA 2XVMA 4MEAA 5FNVF 4BNYA 1AN0A 2B94A 2H1OA 2EZUA 4AJ9A 4R1NA 4EELA 3BYZA 4Q3AA 4GLBA 1XTKA 3F5QA 4TSKA 3U17A 5A7FA 3BULA 2B2NA 2KJQA 5K0LA 4DJEC 4Z54A 4YCMA 2XTZA 5EYPB 4PHHA 3JD3A 3AHHA 4U8HA 5JS6A 3B1WA 3A4IA 1M2VA 5BXQC 1I2AA 2FZLA 2ASVA 2P2GA 3EVFA 5K6AA 1UKVY 2WWVD 3OQ1A 2QLBA 1P7VA 3HGTA 4KFUA 3WWDA 1A9PA 3FPKA 1N9GA 2HCFA 3M6MD 2GZ3A 1P4RA 4WLEA 5FBVB 1V2HE 1J25A 4UE2A 5BRJA 3EG9A 1Z74A 1F9EA 5JZMA 1Z2DA 3LO5A 3H4TA 1FNMA 1J97A 3SQDA 1LKZA 1F5NA 4IV0A 1K7EB 5ALGA 1JFLA 3A58B 1F0KA 1Z0FA 2VJBA 3E6AA 4BMNA 4ND7A 4MEBA 1ADGA 3HVJA 4WPGA 1YCFA 4D46A 1T3TA 3UJ6A 1I9GA 3FAKA 2O8BB 4JITA 4QNNA 1RC0A 2DQZA 3I1IA 4ILKA 4D8UA 5CB6A 1N3BA 5LKRA 2WG2A 4MITA 1U0FA 1RXCA 2P2LA 1YS1X 3GR6A 1NLUA 4II2A 4QUDA 1UMBA 3TVTA 4EB6A 3HKBA 1A2BA 1FTYA 3HB9A 1MRNA 4N40A 4NAHA 5JZBA 1U2EA 1PR3A 5DNVA 4B6OA 4MGIR 4EKGA 2JGIA 4ZDKA 2RGYA 2C4VA 2EBUA 3T7SA 4IDHA 4B9EA 1XN1A 3Q0IA 1ECFA 2ECQA 1JZSA 1U0OC 4L57A 4LGYA 4EM6A 5BN3B 5K05A 3PLAE 1WHSB 2QVBA 3EODA 3TCNA 3WJ1A 2WF5A 4R3NA 3SZMA 1NMXA 3IERA 2F9MA 3IKTA 4KX5A 4HC4A 5T4FA 4RA6B 1MGPA 5JQGB 5KYUA 1GQOA 3ZQUA 1E2MA 2DMRA 3TLZA 3EQ7A 3OVMA 1N6NA 3PFBA 5CYOA 3DZFA 4YRGA 1DKNA 1REQB 2LDXA 4RE6A 3J81A 1G59A 4TL8A 1DCMA 5TR9A 2FK7A 4LOHA 2QLNA 3W8RA 1RYBA 5IN5A 4KB5A 1DI0A 4PVDA 3TF5A 3P0EA 4GMGA 5GOZA 3OPQA 1KDTA 3GJ5A 2OV8A 1N78A 4AJLA 3EMDA 5DTEA 3TSZA 1Z37A 5E1BA 4ENPA 4N01A 1G4AE 2XRFA 3VR5D 4YB8A 1RPNA 2YN2A 5JAMA 1M66A 1LLUA 1YVRA 1OX6A 2QTBA 3BIWA 1K2WA 1MC1A 3GV0A 3N59A 3QLVA 2V9PA 1BXRA 3AO0B 1JAHA 2AYXA 1W52X 3S1SA 2WUGA 2PLAA 4B45A 4YCNA 2JRCA 4R1QA 2EAUA 2FU5C 1MNQA 5CR9A 2Q7OE 4OOFA 4ZWNA 1H2RS 1MD9A 1QKJA 2ORVA 1XVVA 3W4JA 1KL7A 2QN6A 3ITKA 4WOKA 3TCKA 2GPJA 5DP1A 4F85A 1SEVA 2HW8A 2GK6A 1MV5A 3LHFA 2QVLA 1IEWA 2IVFA 4JROA 4WNYA 3TQSA 4ZZ1A 2Q2QA 2JIDA 2PK3A 3M6UA 4JI6B 3FOWA 3KJEA 3NVKI 1KU6A 1PZGA 4Y2HA 3QZUA 5KQLA 5J5CA 1ZOOA 1QGUB 1LB1B 3EGVA 1Q77A 2EFCB 3OEHA 2FZKA 5TPWA 2J41A 3GH1A 2BFDB 3PUWA 5IKPA 4KXNA 1NVKA 3BK2A 1C30A 2GCOA 2A88A 1CFJA 1D2RA 1E6MA 2CHQA 2RH5A 3Q7EA 3PFNA 4J0GA 2C99A 4F1WA 1NI3A 5LU9A 2UZ1A 3PDWA 4JT9A 3GJZA 2A9OA 5DW3A 2IZ5A 4D9BA 1E2FA 1CS0A 1XWFA 3QKRA 1P1RA 1AKVA 1MB4A 3NT4A 4CIAA 1HEIA 2WZDA 2WT9A 3USZA 3LGSA 4MKFA 1ZHFA 3PXAA 2Y68A 4M0MA 1RHQA 4RS3A 5J59A 421PA 1I14A 4ZYUA 5KOHA 2MR6A 4DSTA 1QH1B 5K7SA 2Q3BA 3CLKA 1E79D 2WOJA 3Q5DA 3SLGA 3DHVA 4CCAA 1D04A 1R8YA 4RHFA 1UM9A 3KEGA 5DNEA 2CNNA 4DPMA 2I29A 3OQMA 2B4TO 1HNWB 1OAAA 1KY3A 2WYUA 4TYYA 1GV0A 2GXQA 3DXFA 4NMLA 1PV4A 2HCJB 3O92A 4KSCA 2HR1A 4EARA 1SR8A 4FFSA 1TTHA 2HB6A 4OXRA 5BSVA 1QIGA 1FP4A 2Q3CA 3DZIA 5AOVA 3O0DA 2Y1DA 2R9VA 5F2KA 1U7ZA 2ETXA 5JJLA 1IN5A 4D9EA 2HCBA 4K03A 2PBFA 1O0CA 1BSVA 5TVGA 4A0GA 1PGQA 3GLSA 3GNSA 4RBNA 2VYCA 4QXMA 5EWLB 1Y1QA 3FBWA 3R09A 1W96A 2IZ1A 3L8ZA 3A3OA 3HCFA 4L9AA 1FE8A 3GN2A 4URWR 3V8VA 3FPCA 5CA0A 1ZI6A 4IWYA 5KHLB 3PRHA 5ALZA 5I8ZA 1URPA 4YROA 4NKRA 2ZQYA 1K08A 3JTEA 3T61A 2V3VA 2IA5A 5JCOA 4W5JA 4ESHA 1D6MA 4CIBA 1L4NA 2ZBFA 1UMKA 3NRBA 1KTVA 4HNGA 1ZC3A 4KMMA 4I8IA 4N7BA 4W5WA 1UBJS 3B48A 2D5BA 4WKNA 4Y0VA 3U4IA 3SM3A 1TU3A 4G0XA 1I94B 5HILA 1Q3HA 2A7XA 3OU7A 2VYVA 1BHSA 4L8FA 3U7HB 3VGJA 2I2WA 3KL4A 5FFFA 4BJ1A 5JD3A 3RJTA 1I7QB 4ZCQA 4MUFA 4JMLA 5EHXA 1UBUS 4RZ3A 2P2YA 5AVSA 4ID3A 2NZ2A 1DG9A 2I03A 2JZOA 2TMGA 2ZP1A 4GOOD 4QQNA 4RKQA 1JILA 5C5DA 3X2EA 2QTZA 3ETLA 4U3JB 3QNUA 2IYSA 2GBIA 3D4PA 4FU0A 3R6LA 4NULA 4C14A 1P1JA 2AN5A 3CUKA 3VYRB 3MWEB 2B83A 1LRLA 1FXWF 1ODLA 4EI7A 1YQDA 4AI6A 1WQ3A 2X9GA 2XTMA 1GNQA 2HI0A 3X3HA 2CXSA 2VYNA 1GLNA 3A1WA 1II8A 5IDQA 4JEIA 1KYTA 3P9QA 4GFDA 1KRWA 2VP6A 1CUJA 3PJFA 1XMJA 3GCDA 1M72A 1GFSA 1QE5A 5KU7A 1SC1A 1ILWA 2DULA 3A6HA 4DF3A 1Z6PA 5KWSA 2A0XA 2E18A 4C1BA 1VG1A 4BRUA 2AWNA 2R1TA 3KLBA 4I4TA 4O25A 4PRKA 4RKEA 3RT7A 2ARKA 5JMPA 5JS8A 5K3OA 1U0BB 1KPGA 2EDAA 1SQSA 1J42A 2YFQA 3GAAA 1P60A 3GL9A 3DO8A 2P3QA 4HDMA 1NQWA 5ALHA 5JE8A 3RVJA 4D2IA 3JZIA 3WYGA 1CQIA 2EJWA 4HZUB 2AFIE 1UANA 1Y7PA 5JS7A 1ZJ4A 4KAJA 2ATXA 4MA5A 2CMHA 5JAUA 2CKMA 2I2FA 4GM1A 4O4LB 4C6SA 2H92A 5AJWA 3V3KA 5BV0A 1NMQA 4G8JA 2BFPA 4Q48A 1T1IA 2PA3A 4I9HA 3SG0A 4FBMA 1SXJC 6REQB 2PZAA 3ES9A 1X70A 1J1IA 1G5TA 3QWHA 2ZPAA 1ZOPA 4HNSA 3GOHA 4EJSB 1INLA 3HWX1 3HPRA 3X1KA 3WNBA 1WETA 4Y67A 3OUTA 1WHTB 4FN4A 4NNOA 3X0DA 3I05A 3KJZA 4RU1A 4XAQA 2ZS7A 2E4WA 2AQHA 4Z4QA 3B13B 3ILXA 1SOWA 1P0FA 2H5LA 3NKLA 5CLLA 4DIFA 2IYRA 2C7PA 3SSAA 1H1DA 3AG6A 1QB8A 1N2CB 3DPUA 1BJTA 1XVTA 3ND8A 1Z0KA 3NNNA 1VPTA 3GPLA 2UYCA 3AEKA 2OKGA 4WK6A 2C2KA 3JQRA 4P5DA 1JYFA 1KAHA 1T1RA 3IVRA 4TQUS 1U8EA 1KIFA 2VRCD 3F47A 5BOSB 4I50B 1WV0A 2D1TA 3D3NA 4W5TA 2QOEA 1MO2A 4JLMA 4BO2A 1DB3A 4PAQA 4B6GA 3UAYA 1XZFA 4LJLA 4YEDA 1EUYA 1ZG3A 1UBGA 2G80A 3CW9A 3ICPA 4UXJA 2WZBA 1XTZA 1BW9A 3OJFA 2YN4A 3O9VA 1B16A 4KEAA 4N3BA 4MRPA 3TZKA 3BAZA 3ZTWA 3UUWA 2I66A 2R11A 2HU2A 3A6EA 1Z07A 4V0QA 3V1UA 3MJEA 4FNAA 1ZM7A 2RHGB 4UW9A 4MWGA 5CUQA 4GPZA 5F9HA 2I6XA 2RMKA 2Y0BA 3Q4GA 1IPHA 1GR1A 1VSQA 3AB7A 5DN6A 2H29A 3WLIA 4AW9A 16PKA 2IUYA 2DYKA 1RXSA 1AK1A 3GPBA 1UDXA 4CFSA 1L4EA 3WKBA 1SVMA 2PIAA 2QLMA 3LPDA 3RH0A 4K7JA 4M53A 4BO4A 4TS9A 4MVWA 3IV9A 3CF0A 4QO8A 4R81A 2DPMA 4I4IA 3R8XA 5HF9A 1JA0A 1WMFA 2MYUA 3NETA 3SOZA 3P45A 4BEJA 4EO7A 2Q45A 4OHVA 5CHEA 4B4DA 4ZEWA 4I50F 1KQPA 1F0YA 1FP1D 1W75A 4INAA 1XEXA 4NENA 3VU9A 4IKPA 3D43A 10MHA 5GAJA 3JQBC 1GQSA 2OAEA 1JL3A 3A3YA 4Y98A 1CIPA 3RBXA 3NKFA 2ZJ2A 3BK7A 1KWKA 2Z30A 4J0IA 1BVYF 3E23A 4ZCSA 3OE7D 4GP7A 3OMXA 1JLKA 1U4SA 4J0EA 2IRWA 1RADA 3K6JA 2C1EA 1QHIA 3HH8A 1YZQA 2QUBA 2NVWA 3OX2A 3Q3VA 3QOXA 2RARA 3ZTTA 4FT2A 5JIBA 3K1AB 2ENWA 2OAGA 3GLGB 1NIPA 2NZXA 3JATB 1BE1A 4HQKA 3ZGVA 1ZD2P 4AUNA 2OV4A 3EZFA 4N5IX 2EFDB 4HX5A 4P9NA 2W2TA 5ALVA 4M46A 2Q6OA 3MD9A 2D06A 2COEA 1R8JA 3V8NA 3Q9SA 2GTIA 3LW7A 1MJNA 4IIYA 4A6EA 2CJWA 4IFTA 4JHLA 1SVUA 3ZE1B 2VXBA 1P19A 5DTQA 1PX2A 3AERB 3NKVA 4UPDA 2JAUA 4LE2A 3SEZA 1GNTA 1UBHS 4Z5XA 1JHAA 2TMYA 1MX3A 5CVTA 2FG6C 3T4UA 4A8JB 2BSQA 3JQ7B 5E7IA 3TQCA 4F9TA 3AUJB 4KQ2A 2H2FA 3DMYA 1P8JA 3BMOB 1K5GA 1VBMA 4BUJA 4ZO4A 3BRSA 3C14C 4OPMA 3KYCA 5C8YA 1U3VA 4GPTA 3HFSA 4GR9A 2DERA 2NG1A 2G25A 3L1VA 4JT2A 2C0QA 2OBLA 4OI4A 3WYCA 3R6GA 5EXCA 4OLBA 4P08A 1G20B 2IXDA 3E7DA 1IHYA 2ON6A 4GWLA 4Y6QA 1G8KA 5A4KA 1E0JA 2RH4A 1ZZGA 2R86A 3FYDA 3GVHA 5ERGB 4LZOA 1DQPA 3UUFA 1B8NA 1D0SA 4XYLA 4MRAA 5MN6A 1QTQA 3TZHA 3WK8A 1ADCA 2IDMA 3LYLA 4UUOA 1WCV1 3LW8A 1QNFA 1R8XA 5SZHB 3IP8A 3G68A 2PMCA 3H13A 4MW0A 4DILA 3N8KA 4MVJI 4INPA 1OGYA 1G3RA 2OENG 1OLXB 1C2YA 1D0VA 1NVGA 3KHUA 3LBFA 5FXMA 3RRFA 2AR9A 3EQ2A 5TQ0A 2UUOA 5GGYA 3GO4A 1N32B 5L6LB 1J0DA 3P9RA 3A6FA 3RSOA 1FRFS 4G36A 1TW2A 2NZWA 4P33A 1K97A 4EG6A 2WP8J 3GLUA 3C98A 3JV7A 5BSHA 3H42B 4U7WA 4W9MC 2J9XB 1PG0A 3T3NA 5E6SA 3NORA 2I91A 1ZL2A 5U4QA 1JH9A 1FLAA 5HZGA 4YJ2F 5IT0A 5EJ5A 3BSWA 3K15A 5AKKA 5C5IA 3KCNA 4V24A 2AMLA 3L8DA 3CVXA 1ULAA 2B35A 3EPPA 2XE8A 5M3BA 4GI7A 9GPBA 1RQ7A 4ZVPA 4RK7A 3SQMA 5CXUA 2QI9F 2IOQA 2YWRA 1H6AA 2INGX 3PT5A 3PUJA 4MR8B 1H2BA 1U80A 4RQAA 5KTRA 3A9SA 1Z4NA 4UEQA 4QBKA 4QM7A 4CEIA 1L5RA 3E48A 4K9PA 4RFVA 2GKSA 4RHEA 2IYUA 3MRVA 2PWBA 4G0ZA 1QIEA 1QC5B 3DMHA 2VTDA 2YJ3A 2BLLA 1X80A 3S28A 4C43A 2DG2A 1U4NA 3WGTA 2W4MA 3JZAA 4LE0A 1XAIA 5IP5A 1A2OA 1PT9A 3AGQA 3FUTA 3ZOKA 3MGGA 4V1CA 2YJNA 3EWSA 3DGEC 3G2LA 1H85A 5K01A 4KOEC 4BGUA 1TZKA 1WP4A 1ACMA 5IASA 2EBFX 3NM4A 2PVPA 2ZWVA 4XB2A 5FOXA 3EMBA 4M9ZA 2X8LA 1JALA 4IJQA 4IDPA 3ESBA 4RPGA 4XE5A 1KZ1A 2PUJA 2BD0A 3N5KA 3UVEA 4ER3A 1ZHHA 3M4YA 5EGSA 3UHAA 3GEEA 1XXLA 2CFIA 4AS3A 4UOEA 4DR7B 2K2WA 1QP8A 1BS9A 1JPNA 3O03A 2PS3A 4JX8A 5DX0A 4JXJA 5JXWA 1PLKA 2L69A 3VZBA 4CV2A 3EEBA 4LI0A 3O75A 5F5XA 1LSJA 3R4CA 4D6YA 4Q02A 2WICA 3GMIA 3DOHA 2GEBA 4O4JB 4KR0A 4C3VA 4TRMA 4QQKA 2NXCA 3H2SA 3I4CA 3LY5A 5K8TA 1FVXA 1Q50A 1G291 1SU4A 2HZ7A 1TYDE 2X42A 4IIHA 3N2EA 1PLLA 5GONB 3C8ZA 1VC2A 1YGYA 1P0CA 2WJGA 3IB6A 1S2GA 1ETUA 3GY0A 2Q4BA 2I1WA 1NC3A 4XGIA 2ZSIA 2NO4A 4ZI5A 3OFKA 3MOSA 5SICE 4RTOA 3O93A 3FXAA 2R60A 4IG9A 1Z6ZA 3FWYA 4BVKA 1R0KA 4RK6A 3WHLA 1RRFA 1ORWA 2B9VA 3KPUA 4JOSA 3VDMA 4AXBA 3STUA 3ZLBA 4C7XA 3UCEA 2VK4A 3KSAC 2AFVA 2J9FA 1IK4A 3SIRA 2HJWA 1I3OA 3AF5A 1GT6A 3CNEA 3KDAA 4V0SA 1W8IA 1I2BA 1PFUA 2IY8A 4QGBA 5LBUA 2C9ZA 4LZZA 2UXBB 4EGJA 3KYDA 1TEVA 3ROFA 2IQ5A 5KWJA 4OX9Y 4RESA 4YMSA 1RRGA 2P6UA 4LC9A 4JA0A 3W8EA 3Q10A 4M8KA 3TTVA 4WXYB 4AJPA 5E4TA 3TGPA 4EQZA 1YZGA 2PMDA 2ST1A 1VM6A 2NU9A 4QYIB 5K8VA 4GBED 1DIRA 1Z3CA 1A5AB 3L1UA 4FVTA 4O4JF 2FX5A 2WF8A 1GKLA 1HE4A 1VRCA 3VVBA 2EFGA 2ZIVB 4Y6PA 4H4DA 1JEQA 3A05A 3F6BX 4N8DA 3VV2A 5MFZA 5D2CA 4QUGA 1PWZA 4A03A 1XNGA 2C20A 4KXXA 3PGJA 2HUPA 2VJYA 4GM0A 4MKHA 4XQ9A 3LC1O 5J1SB 2JD1A 4HD8A 1ZJYA 3IKMB 1IMOA 1UBSB 4IGFA 1DXHA 3GPDG 1A9TA 4ZARA 4CKEA 5BV7A 2N3ZA 1S8OA 3C8UA 3R76A 2ZUCA 1RQNA 4HWRA 5EOVA 4BNDA 2HJSA 3NX4A 1S6YA 3SY8A 4Z7NB 3CW2A 1YQ9A 2PX3A 4RJLA 1UF9A 2OBXA 2J46A 3MTBA 4QXQA 2GYWA 1G6OA 2OCAA 4HNAB 1QHEA 3K09C 3MTEA 3MWKA 4RD4A 3TZLA 2R6R1 2BEJA 3MB5A 1GVHA 4LRSB 2FQ1A 4C4SA 2YHBA 5IG2A 2CLEB 1G8YA 2V7TA 4Y2PA 3N87A 5JQWA 1RNLA 2HOQA 1I7SB 1SHKA 4NJEA 3U44B 2QY6A 1CETA 3RQSA 4IW3B 4BYGA 5G0TA 1POWA 2JVIA 2NSDA 1Q95A 4AWXA 3WZLA 5LL6P 4D25A 4E21A 1ZKMA 2V7VA 5E8RA 4EITA 1W76A 4LBYA 5JJBA 4HNHA 2Y76A 2MINB 1Y34E 1QRDA 1HQCA 3L18A 1WB9A 4CF6A 1IOZA 4P22A 5DPMA 1IY2A 1C0EA 2EGGA 5ELMA 2GXAA 3AVXA 4E2XA 3EHDA 1PS9A 1NBEA 2RAPA 4MRSA 3TB6A 4FHZA 1R0CA 4JYPA 4P3NA 2I7TA 4UDYX 3UMCA 1L4HA 1IXZA 3ZR4B 3WGYA 2EXXA 1IN6A 2RBGA 3DE0X 3NH6A 3KFVA 2C2XA 2C78A 3T9FA 3ZGOA 2GTHA 5DASA 2IPOA 4DWOA 2ZPUA 2Z9CA 5H59A 3TRHA 3OA0A 1QFXA 2C59A 5JSYA 1GTJ1 4D45A 3G82C 3HYLA 4BNKA 3OE4A 4YP6A 4B2PA 4OHPA 4BKQA 3UB3A 1RRCA 2UZ4A 2FHSA 1T9ZA 3G88A 3OO1A 4YAFA 1JEYA 2WDPA 1C0PA 3L0PA 3ZV4A 3P52A 2ORED 2I6SA 4F8JA 1H0KA 4XDHA 1HKHA 1U6IA 5DRTA 1MO4A 3IAAA 3QMWA 1GFIA 1QZ3A 3G0HA 3K5IA 3VUFA 1T4BA 3PXEA 4B6SA 2HF7A 1E6WA 4KWTA 2O23A 2NAPA 3NBXX 2Q5LA 5IDXA 4URFA 4AD8A 5LPNA 1SHJA 4OQYA 4LK2A 4E31A 4HR7A 3FVWA 3I2IA 3ADBA 1N3LA 1L5MA 1JQJC 1G0OA 2AYZA 4DSAA 1U6KA 5KC8A 1DC5A 3RT9A 2YVKA 2CNDA 4AVYA 4CTKA 1EK2A 1KQGA 4I3GA 1XMVA 4DG5A 2RGUA 1N1EA 3WB2A 1SULA 4FNGA 3FMPB 4RL6A 3JTMA 4BMPB 1OVGA 5DT9A 1JWLA 3KUXA 2WG1A 1WCYA 1KO1A 5AUPB 3C85A 4CUKA 3ER8A 4UDNA 5AI9A 5JNTA 1Z68A 2OCIA 1OKKA 2AJLI 2BMEA 1ECGA 2RG7A 2Y1GA 2Z4RA 3Q7QA 1SXJD 4QGGA 3QVJA 4PINA 5F35A 1M67A 5AO9A 4AULA 4PHTA 1GZUA 3D8BA 2FDRA 2D3TA 3OOHA 4C0JA 1CERA 1W49A 4FJ0A 2ZRBA 3DKKA 3TMAA 1I1OA 2Z5GA 4GD3Q 4TZKA 2AG0A 5LMUB 1CUHA 1XJ5A 1TEHA 3WYAA 1MJGA 5I9LA 1KP9A 4X95A 3IQGX 4UREA 2D8MA 1PQWA 1TQ4A 2IHYA 3K9LA 4XCXA 1LF0A 1I1HA 4QECA 3F8TA 4PPNA 3OT4A 2IS1A 2OQVA 4HB2A 4ITVA 4Y9UA 4C4XA 2F43B 3OJOA 1ZFNA 3M3DA 1QF7A 4Z49A 4BEVA 4KJZA 1K06A 4IJ5A 4GKKB 5K99A 1PUIA 4QT4A 1HDXA 1ZEMA 3CFHL 5ENVA 2QQEA 2W6NA 3GEBA 1XFAA 3B6KA 4Q1CA 3NBKA 2VJLA 1DIGA 3U7RA 2P2CA 1LWOA 4W8GA 5C4GB 1GSIA 1O97C 5KDDA 4UVHA 1ECJA 4JV5B 2HA0A 2NO9A 3B20A 4GBMA 3K0KA 1VIVA 5F7XA 1RTTA 1HT1E 2ECPA 4JB8A 4DRXA 5J4HA 1G6KA 3P9ZA 4LXXA 1FFCA 1UJ4A 1SRRA 4R0VA 3ZXSA 4KVAA 5G4KA 5FLYA 4TWZA 4D74A 4MUGA 3R75A 3GRRA 4JFAA 2O54A 2CDNA 4PLHA 1J23A 1NW3A 1U0EA 3BXGA 3WS7A 1UQTA 3AR3A 2DR0A 4AUEA 1P6XA 5KTSA 3L1IA 2RDMA 4XWYA 4PX5A 1MQAA 3SC2A 1CUBA 2YRWA 3BF8A 4DLWA 3G2OA 2WAMA 2IPAB 4IXWA 4TV9A 3HLKA 4CEHA 3RS3A 1JKFA 5HOQA 2GZMA 4NV3A 3OWOA 5LIPA 1SELA 4RVCA 3HACA 4DADA 1G2OA 3OZWA 1UEIA 1SIWA 2ZRFA 4NCAA 1JLSA 1VKZA 1VPEA 1NURA 2QN2A 3GGOA 4ITUA 2Q5QA 1BAPA 3L7JA 4MUBA 3OF2A 1C3XA 4EFLA 3EGWA 4TWBA 3DMFA 2DECA 2P7IA 4KYUA 2NX2A 4FDUA 4WAUA 4ZVUA 3RRYA 3BTOA 3NYQA 4Z0NA 2C4TA 3DFFA 5H5JA 3QNWA 2DHEA 3AZOA 2X0EA 2GXUA 4CGZA 2O50A 3ZCQA 4A3SA 5CW2A 1KJNA 2YJGA 1VCMA 3Q2IA 2IYZA 4YLGA 4DZTA 4WESB 3STWA 4FZ3A 2OP1A 3DEIA 3RRNA 2X2OA 3TOCA 2QL9A 2YMQA 3I39X 5JTUA 1PSDA 4OSPA 1OLSA 5G1NA 3ORFA 3W6PA 2QQ5A 3T6KA 1UOPA 5TMBA 3R74A 2XNDD 3OQBA 3L6DA 3E2MA 5D85A 1CULC 1ENYA 1JIKA 1IN7A 1WP9A 3GFQA 3KYJB 1XC7A 1YQWA 2XECA 4FHFA 3U19A 4H6PA 4GF5A 4PSDA 1KMQA 3AF2A 1BE6A 1BCSB 2CXTA 3SLRA 3I4LA 3ZWKA 1G1AA 1M1YB 3BFKA 5JS1A 5JCJD 3N2LA 2V6IA 3L92A 1G21B 2LPMA 1EGVB 5KOIA 3GYGA 3AVYA 4K86A 3BL8A 3O3NB 3ORRA 4LGMA 2ZWMA 2P2DA 1KFEB 4MVJG 3C3CA 1CKEA 1XA4A 3VKWA 4A0FA 4AROA 1AUQA 1GGVA 4XSGA 2O8VA 2WYIA 5FBLB 4EQ6B 1GJRA 3NP9A 4KDCA 4XUDA 2EZ9A 1NAHA 2V7GA 1XU9A 1ORTA 2I1VB 3E9NA 2VF4X 3EXG2 3SS8A 4TUYF 5HNKA 4CEJB 4DT1B 5FLEX 4LYDA 5JJIA 2Y1KA 2JNWA 2H11A 5HM8A 5EMJA 2IH2A 4HYEA 2A1TS 4DBZA 3QQ5A 3H6HA 3AIIA 4LC0A 1RPZA 4QTZA 2AUNA 2C96A 3GT4A 1PKEA 4HAWA 8OHMA 2IODA 3AEZA 1S2DA 4BATA 1AKWA 2C9MA 1MG0A 4QDZA 1EFRA 4WL0A 2QLJA 4DMFA 2GEUA 1UQUA 2XZPA 3GZ4A 4MZDA 3VKUA 1I5OA 1BMQA 2PZJA 1M2OB 2O2JA 2X23A 4FLEA 3DXYA 3DV2A 4ZDWA 1W25A 4L73A 5K4GA 1R3DA 1PK7A 3VNAA 4BGIA 4J8PA 1ZUIA 5D5HA 2OV3A 3JARB 1UODA 2CYBA 2GOYA 3BBPA 4ONEA 2DTXA 3CLHA 1ZR2A 4BPBA 2F3UA 1W7AA 2VDLB 4HN9A 1CP3A 2RONA 2YHUA 4PW0A 2ROQA 3GVXA 3LUAA 2YV1A 2YXBA 3EN0A 2VJDA 3QPCA 1T4CA 3MMXA 3OPYB 1DQRA 1X7HA 1BX3A 2RI0A 5ELXA 1NDHA 4JLWA 3GI1A 1EI9A 1V6CA 3EEYA 1NQTA 1E1QA 1DAEA 4RD1A 3B9RA 2OGFA 1K66A 3ZNOA 5CVDA 1PGOA 4YONB 1BEZA 1KAOA 1IE3A 3A4LA 3UMFA 1EHIA 1MENA 4J16C 3WGVA 3U3RA 1B2RA 1QYRA 1Y6GA 1DPGA 4TYQA 5AICA 2GK4A 4H27A 4FGLA 5D86A 4M9QA 2CE7A 5AJHA 4GRIA 4MJLA 2FSHA 4TMVA 1A77A 1O96A 4MYDA 4BVEA 3ACBA 4DLRA 3QX3A 3IQIX 3A28A 4JLUA 4PYNA 1KXJA 2XAAA 4RHUA 5HIMA 1ISPA 1Y7HA 4L08A 4L4YA 4R2JA 3PRYA 3WMFA 1AK9A 5B3KA 5KX5A 3UPTA 1NJSA 1TF5A 1KOGA 4ARZB 4Q24A 1XJ0A 2EGHA 3C5HA 3HVKA 5TDHA 2V0GA 4F6LA 3FPHA 3QEAZ 2C7OA 3L82B 2NYAA 2X4IA 2OBYA 4J0DA 3THYA 3K16A 1EM8B 1JDPA 2FJ0A 2Y2VA 2A50A 3HDJA 4CKCB 3W5BA 5CBKA 2KE5A 3A04A 3PQ7A 1LA2A 3MWJA 2WKPA 4W6ZA 4DJTA 5B1IA 5D6NA 3EW7A 3SBXA 4ZN6A 3R0XA 1H22A 4GU5A 2BM1A 2VNIA 2FXIA 3EIUA 4BMVA 1MHPA 1FJXA 3ILYA 1X87A 3SKVA 2AGVA 3C8MA 5A3QA 1XELA 2I5PO 3C2QA 4YRQA 5A0TA 4QRIA 1F51E 3O9ZA 4OYRA 7REQB 2FSSA 4F9FA 5BR4A 1EDBA 1ZKDA 1VOTA 3OTIA 3GWGA 2P4SA 4UASA 5CYGA 4TTQA 1I8TA 2PL9A 3NHWA 4E1AA 2A1UB 2I6UA 2BELA 2XMDA 3KBOA 4LSWA 3ZWMA 2FPPB 4IQ0A 4ZYTA 1F2TA 1JN0A 3HKCA 4LWQA 1ZOLA 2FEWB 2VJMB 4YY3B 1DDIA 3ZQ4A 1X9IA 5FBWB 3R3UA 5AVYA 1WL8A 3R0QA 3H97A 2QHXA 4MUYA 3Q41A 3U9LA 1E2DA 2JAXA 1S7CA 1YB1A 1T35A 2O2ZA 2IYNA 3NI2A 13PKA 3AXSA 4NIMA 4UNQA 3D5EA 1ADYA 2Q9BA 1XT6A 4I5DA 2VHXA 1FF9A 4KOAA 4CUZA 1DEKA 1QKKA 4ZJZA 4OMFG 4I1PA 3CCBA 3CUSA 5LD2B 3HB0A 3MVEA 1SUBA 1GLGA 2AZTA 3LBNA 2WU4A 3CONA 3VKFA 5LQNA 4Q1FA 1LPOA 4W8HA 5BXYA 1YV9A 4G07A 4YMHA 5IT4A 1Z56C 3P9SA 2B0JA 2P41A 5JXGA 2VSFA 5CCDA 1CVLA 2VZ8A 4C4OA 1W4CA 3LOUA 5B37A 3G5MA 4IRMA 2LDBA 3FUCA 5MDHA 1E3WB 4BY9E 5BP7A 3QI7A 3CFFL 2W6IA 1XGKA 1KJWA 1SG9A 2H4XA 1L7OA 2RGEA 2XAUA 3FYUA 3KFLA 3QBDA 4LAFA 2UKDA 3C3BA 3RF6A 1CV2A 2CN1A 3FJOA 3ZDQA 1BN7A 3HI4A 1TT5B 3V7YA 5KX5F 5EFOA 3BFPA 2Q46A 3DKIA 2O5RA 3MXOA 1B6GA 2OHGA 5HFAA 5EJ2A 1RPJA 2WHRA 5DTRA 3F1LA 2RC6A 2D7DA 2R47A 1VL5A 2HGZA 5AVJA 4O2BA 4U5QA 2DB3A 3Q0EA 1RCFA 4LEIA 2OCYC 4DYDA 4R41A 1V5GA 2ZWPA 3DZDA 5C31A 3RC9A 2D62A 3DZJA 3P9NA 3ZKWA 4S1VA 1W73A 3H11B 4UEJA 3HU5A 2ZB7A 5JSUA 3P26A 2JLCA 1TCUA 2ETVA 1U1IA 3A0RB 2CMKA 3KKMA 2HJGA 1W2WB 5I48A 1C1XB 1TEXA 2FEOA 1FLNA 2HV8A 2OHOA 2ZUFA 1RIFA 2HDWA 2XD9A 2Y27A 2QSUA 4AZSA 2XNSA 1BKDR 2OHJA 3QE2A 2UZ0A 4TKZA 5TMPA 1VJTA 3DE6X 4UUBA 4NBUA 3GRUA 5E8JA 1KR2A 1BGWA 2WF9A 3L6BA 4HTFA 2VHUA 1A2KC 1E2JA 2CLHB 2C9CA 5IBPA 5KI6A 3V2HA 3OLZA 4RLSA 3GG9A 3PFHA 3NQ41 4D99A 4QOJA 4UU7A 3A32A 3H2JA 3PIRA 4QODA 1F4PA 5JSKA 4AJ2A 2H2AA 4AJKA 3ZQJA 4PZUA 4BKPA 3D9QX 4A10A 5IT9A 1RYZA 1P5FA 5CA1B 2D54A 4FYWA 2QW8A 1OLUA 1ZN7A 3N53A 3B7PA 3PGMA 2POQX 4F9GA 1Z6XA 1CZNA 3HZZA 1E7YA 4XWTA 5CNIA 1NE2A 4O5OA 4YMWA 2GPAA 2W8BA 1AF7A 1GPUA 3AF4A 1XZLA 3K53A 4PLYA 5KYXA 5F3WB 1Z83A 3H9BA 3CNNA 1FMCA 5E1OA 3TTXA 4M0KA 1C9EA 4JJEA 1X2EA 2F2TA 5IAGA 1DTEA 1EG7A 1CW2B 2LKDA 3K32A 4NPHA 1V4VA 4Q01A 3WLAA 1R3UA 4HLCA 3LL7A 1RBMA 4MUKA 4N82A 2NU7B 2R8RA 2JIBA 1MPXA 5E6RB 4Q4LA 2O2DA 3WO0A 2BMVA 3VR4A 1SPXA 3SYTA 4EG1A 1N36B 2FWRA 1BWSA 3B5JA 4NABA 2JCGA 3HJGA 4QULA 3UK0A 4CCYB 3BWCA 3DB2A 5WRFA 2CVPA 3FLAA 5B6IA 4G0YA 3HDYA 3CLTD 3R5SA 4GYJA 2ORWA 4J6FA 4Q4DA 3IR5A 5DYGA 3I30X 4MS4A 2QNRA 3GDFA 4XDGA 3UHFA 1EVJA 3DOUA 3NBZC 4KQXA 4RXMA 5EMMA 4D6XA 4NYMQ 4ND1A 1PFYA 3B9BA 4HJRA 4QHSA 3RSZA 2ZJAA 2J6CA 1ULHA 1I0LA 3P2OA 4JOCA 4PX3A 4B82A 5HW0A 1YC5A 1P45A 2V54A 4RLHA 4YPFA 3UZUA 4QUBA 4KR3A 4YRNA 1HTBA 4G24A 3SQOA 1FRVA 4ETMA 5KJCA 1K8QA 1T2FA 1DZ3A 5PNTA 3BGIA 3JD2A 4MWDA 4ZICA 4AZ3B 2OO5C 1Z4QA 4M49A 2Q62A 3TMYA 1BOFA 4H77A 2VT7A 3PA8A 4GLFA 4N0EA 4AP6A 1J8YF 4M1WA 3DUFB 4M21A 3L49A 4M7OA 3TNFA 3PNQA 4Z99A 3UPUA 1EPUA 3RFFA 3T7IA 1HFWA 4QTYA 4C7OB 4BFWA 1XUOA 2DT5A 4AMZA 4DXHA 2FWMX 3DCNA 4C0XA 1YQXA 1ANKA 4DLTA 2FUEA 3ZZ1A 4E03A 1OI7A 2GWHA 2ZWIA 3NP7A 1YQTA 4XQ0A 5K3AA 2BDUA 1ZQ1A 2RK4A 5BN5A 1AZLA 3ECSA 4F91B 2PGAA 1J22A 3NHSA 1GZ7A 4J1NA 4QDTA 1XCJA 1XCPA 2PCLA 1DIAA 3CRVA 4MJXA 2EZ8A 4ND5A 1RPAA 4MRMB 4XVRA 5FPKA 4QKQA 2FR8A 1ND5A 3BDAA 3HVUA 4WI1A 4KKXB 3IIMA 1C9JA 4BJ5A 1PRYA 5BW0B 3PJDA 4Q47A 5FO0A 4RZXA 5HUQA 3LZDA 5DM4A 5IJZA 3LIIA 3EGCA 4FGWA 1LBHA 1L8XA 3HDTA 5AI5A 5THQA 5DHAA 4RGVA 1T5DX 1OREA 3MJTA 4I8XA 2IWRA 3S3TA 3B60A 1FFAA 3UUEA 4I8DA 4RPIA 3K71B 1E58A 4FQ7A 5H3LA 3CYFA 3TIVA 2C95A 4ZOAA 3QITA 4U2KA 4RTRA 3EQ6A 3B1JA 1ZGZA 2PRIA 1VE9A 4JDUA 2D1QA 4MVJP 3SGLA 4V3CA 1GNLA 2VHCA 2ZATA 3IAS6 3TAXA 1E2GA 3PNPA 3KSMA 4XD2A 3SJCA 1A95A 1GU7A 1XWIA 1F0PA 1FXSA 4JL8A 4NONA 5CRIA 2XDQA 5BWCA 1DWQA 1NX9A 3CH7A 3E9EA 4EGAA 3VZCA 3OC0A 3AHGA 3P2KA 4TT3A 2QX6A 3ZWVA 3VDRA 2CDBA 5EJIA 1AS2A 2YHIA 4HFRA 1KI4A 1NYLA 1RHJA 2X4GA 3BJIC 1P77A 5IC4A 3QX7A 4MYCA 2G76A 1QWSA 2RGXA 5I3CA 4LF4B 1V6AA 1XNJA 3E0QA 1F5SA 1OBCA 2I22A 4EJ6A 3AOEC 2BV3A 4POAA 2FW9A 5DHUA 1NMZA 3SQLA 4DA7A 5K8CA 1W2HA 3SK0A 5KTKA 4Y2TA 5LLSA 1Y4DE 2NO7A 4NZNA 4NYMR 3U81A 1Q0RA 3OA2A 4UVGA 4URXR 1WF3A 1IY8A 4A5SA 2FQXA 2AKEA 2IKSA 1OWNA 3HZHA 3IV6A 2XMPA 3UBMA 1G8HA 2QRVB 3ZV7A 4JOBA 3B38A 4F56A 3I1JA 1C8LA 3ND7A 2Q1UA 4BHRA 1G5RA 3ED1A 4MB0A 2AN1A 4JBWA 4L5BA 4WUTA 1ID8A 3OQPA 1EVLA 4TWRA 2JIQA 1E96A 1L2TA 3Q7TA 3KEMA 4FQ8A 2CFTA 2PH3A 2OHIA 2AEJA 1JDSA 1GIAA 3LS2A 4DLUA 2ZQZA 3VI3B 4J43A 2HK6A 3K09A 2C4NA 2IQIA 3HWWA 4ASUD 1VKRA 5KBYA 1F2VA 5A9SB 4JBIA 3GFGA 5KINB 1JSRA 2C54A 2EIHA 2IXGA 2YWFA 3MLBA 5B1EA 2VJOA 4OQDA 1NN5A 3TE7A 5ETJA 1TVKB 5IAJA 4S1TA 4LY6A 1V1MA 4UFOA 4G1BA 1U8AA 1KQ3A 3NBYC 2WWXA 2AD1A 2RGGA 2VWPA 3FETA 3LP6A 1M75A 1XR3A 4QUJA 4BC0A 4M1MA 2IS4A 2DHRA 4QDKA 4B3CA 3HXLA 3B6EA 2ZE8A 3CZQA 3A1DA 4GXTA 2YW2A 3I42A 4NU8X 4BQNA 2W4IA 5IANA 1WMEA 1U6JA 3I28A 5IZ4A 2F9LA 4RTPA 1OH8A 1VCHA 2YIJA 2V58A 2VPPA 4QBFA 3C7TA 1DC4A 1X9GA 3K0AB 1ISRA 3I0ZA 1VJGA 2G2SA 3WSTA 4OU4A 4CMIB 1IUPA 4I36A 4NSNA 2AJTA 4RFSA 4D0LB 1Q6YA 2F64A 4JFRA 4NC9A 3IPRA 4CLXA 5JYEA 2O2XA 3RS8A 4M36A 3I45A 1ZWKA 2PUAA 4FMBB 2I6FA 3E3OA 2ZSHA 1H0RA 2H48A 4PZDA 5AOAA 1IXYA 4JWKA 2BFBB 4FHGA 1FCJA 3M7IA 3EYAA 4LF7B 4UATA 2ABWA 1A82A 1OC4A 1MIOA 4EHJA 4ZT5A 1HYBA 4D9CA 3BMQA 4KLAA 3I9OA 3D3KA 5C46F 4TL7A 1B3RA 1XF1A 2HMUA 1AA9A 5CNJA 3T3DA 4E4RA 1VE1A 7YASA 3THXA 4PLWA 4Q21A 4K6CA 4B2LA 1QH0A 3C70A 4QG3A 1E3SA 3ONWA 1KBZA 2QDXA 3BH0A 3IPYA 4EABA 3U56A 2IBSA 4LKOA 4OKIA 2P4HX 1H2AS 2WWRA 4L4RA 1WMAA 5JATA 3DEFA 3QYFA 4OUDA 1BKYA 1C9DB 5DI9A 4JGBA 3T35A 5F2OA 4CI0B 1S2NA 3QELB 1P4AA 1MQSA 4RO0A 3FFWA 4AZWA 4PS1A 2VTKA 2R25B 1V16B 3G6KA 2GBFA 2J87A 1EIWA 4EKEA 4WCFB 4CM4A 4J0CA 3VYTB 2D2FA 2EKLA 4LFCB 5H02A 4QD3A 4CL0A 1DEAA 3RODA 2VKTA 5LB4A 1HE5A 2HQBA 4JP1A 3GUUA 3C15C 4KQ1A 5FOWA 3NBUA 4IGAA 4ZODA 1T8UA 5DGXA 5FWXA 1SKBA 2R7NA 4XZ3A 1R6TA 4ER7A 3JVEA 1V71A 3DVAB 1MJGM 2PRJA 2H4ZA 2XSZD 3BD6A 1SC3A 3FROA 3FFXA 4M6WA 4DTCA 5JHGB 1IBKB 5C7IO 1ADJA 1GY8A 1UKZA 4U9UA 3U4QA 3DC7A 1T3GA 3EGEA 4LNAA 4GVLA 2ZYUX 3VYUB 4BRWA 3A25A 4JR1A 1V0JA 1OFTA 3UY4A 3V7FA 2BHLA 5K0SA 1JHPA 1WB4A 3RWBA 4UBJA 1TCCA 3KUDA 3FHJA 4J2OA 5AM0A 1AUOA 4YT2A 4FP9A 4R16A 4UDOA 1ZA2A 3QPBA 2JG3A 2ERYA 2V97A 1RWMA 2ZSJA 1SQ0A 3OZRA 1RI4A 4N5LA 4YCLA 3ODGA 1GPYA 1DNPA 1LLFA 4G4SP 3Q3EA 2Q07A 3D6UA 3LV8A 4OYYA 3BSSA 4D4IA 4P0QB 2C3OA 3LVBA 3VPGA 2F62A 2Q3LA 2PQ0A 1A9OA 1QGAA 1X3SA 2ERXA 1VDMA 3BGOS 4CF5A 3VU1A 1KGSA 1WCXA 4I19A 3A11A 4L1KA 5IMBA 3H2HA 1S2IA 4QO7A 1QGYA 1ZPDA 1YHNA 4DJAA 2NV6A 4IEEA 2B7CA 5P21A 3AR7A 1BXZA 2BZ0A 2FXVA 3DZ8A 3E1KA 1KJJA 3LCVB 3L7LA 3DDHA 3UPDA 2NV2B 4P1ZA 2X9VA 3KVVA 1SKYE 3PNLA 4ZO7A 5AJZA 2Q29A 3ST7A 2WJ6A 2HO4A 3MJDA 5LMNB 5ARCA 4RTQA 3K9WA 1EVEA 5HCNA 2WI8A 4PG8A 2O1SA 3EXEA 3G49A 3SC3A 2IEYA 4ZVRA 3HM9A 4D8YA 4Z7JA 5IAKA 1CC1S 1L5GB 1X1BA 1J0EA 2HWWA 1G2QA 1VA5A 2B1IA 1TJ3A 2UYQA 3L0DA 4RHCA 4DM7A 1F48A 4LUCA 5BWBA 5JG7A 3V8PA 2WR8A 4KE8A 2XOEA 1KVRA 3GDWA 4E32A 5E7MA 1DVRA 1WAMA 3OAAD 4XXHA 1CUYA 2ORYA 5ESRA 2I6QA 5CAEA 1GQ2A 5JY1A 3ZCRA 1KH1A 1M8PA 1ULBA 4PM4A 2PGLA 4ZTBA 4CM9D 1YFJA 1BHO1 1N2ZA 1WVGA 1N4DA 3GDGA 3QEMA 2X6RA 3V4PB 2JK1A 1HE2A 3LC7O 4BAZA 1XZHA 3BA1A 4PNZA 4R2KA 4X8HA 3PF9A 3VM6A 1M2VB 1SHLA 1RLJA 2O8NA 1ODTC 4OD0A 1D2MA 4J4BA 4E33A 3STVA 4DY4A 2XPCA 2EATA 2ZI7A 3EK2A 3GP5A 1DIBA 3MOIA 3LPAA 1P6UA 4R1TA 1YU9A 2HM7A 2XNHA 4YBRA 3AVUA 3U16A 2WT4A 4IXNA 3UTDA 1S8NA 4ALIA 1OFIA 1MOZA 2IYWA 2PZ8A 1CY1A 3ETGA 3OZBA 4QATA 4ATNA 2RKOA 3IP1A 4LDAA 1N0UA 4QUKA 1G2IA 4E2WA 4ZZIA 5CVCA 1E9RA 3NATA 1FTNA 2X0RA 4RSGA 3FBTA 4M8NE 3T3EA 3OIVA 4LJKA 1BMFA 1HFKA 2XYRA 3PXDA 4MIYA 2Q1TA 5DCLA 4K87A 4EB6B 4IJUA 3ASYA 1HMYA 1UMBB 1X86B 1YQEA 3AI7A 3HM2A 3PFCA 3PNSA 1YR9A 3QRWA 5FQOA 3D31A 2PZFA 1OXTA 1PJSA 4RJ2A 1DCFA 2G8LA 1VG9B 4B7AA 1U1CA 1Z8HA 3R8CA 3CZ5A 5KSOA 2GLTA 3R7DA 3VBCA 3R3SA 5CPFA 1H8HA 1S7GA 2GD6A 1BXKA 2DT8A 4D41A 4QTXA 2YC4C 3CI0K 1X3LA 2CC2A 3IBFA 3WL4A 3QTTA 1L8OA 3U7EB 1J6UA 5KYUB 1OJLA 4F84A 4ZVVA 1N5RA 4DLAA 3LVRE 1EXVA 3BA6A 3KLPX 4D44A 2GRUA 1CZUA 1AX9A 5DRYA 3CVWA 5IXSA 1AD2A 4LWZA 4MJ3A 3S8MA 4PYIA 1OIWA 3O8RA 1WW8A 4B3GA 2FDCA 2CV0A 2H4FA 2WHYA 5DLPA 4PLGA 1YRHA 3HJHA 3RFXA 3WP1B 2IEAA 3CEMA 3L6OO 1NVDA 5TGZA 3WRVA 2NUAA 3BJRA 1Q11A 1ARZA 1HYHA 3H0CA 3Q88A 4OY3A 2ALJA 4QQRA 3SIWA 3I6IA 5IABA 3S55A 2CD7A 2NQ2C 3A36A 2HY7A 3KT0A 5KHAA 4WXHA 3RFTA 5AM3A 6YASA 3LECA 2GA8A 3DMNA 4J7XA 4CQMA 5KYNA 1GTSA 3ROGA 2JFHA 4NCNA 3MINA 3FOBA 4KAAA 1ULZA 4RZQA 3IAHA 5T3YA 3K2IA 3RO7A 1XAGA 4Q03A 4WASA 1U3TA 5EIHA 1NBIA 1U81A 2QRHA 3NJ4A 3Q3CA 5A2GA 8LDHA 1QE3A 2AG8A 5EP4A 4M8IA 1DJLA 4GZ6A 2ZAMA 3R2JA 2L17A 3TR6A 4CLRB 2X1LA 1RYNA 4MVJD 3KOWA 1VGQA 4FQ5A 1VSBA 5JR3A 3AVPA 4ZREA 1E2BA 3ZZNA 2QEQA 4EG0A 3GJRA 4K2AA 3LBIA 1UMCA 2ZTSA 3AVOA 4J16A 4GPIB 2YHSA 1VLJA 3HXPA 3IBYA 4BVAA 1RHKA 1EG2A 2HRZA 1RFLA 2DY0A 2Y3IA 5ULLA 1W36D 1GCUA 2LCFA 5TPWB 1ZD4A 4BQOA 5L7WA 4G85A 1C30B 2GCOB 3GGJA 3QVSA 2YKGA 3RAJA 1KMHA 5K51A 1PDOA 1X15A 3S7TA 4BNVA 4CMEA 3P9XA 1JLHA 3F3YA 2HCTA 2UZ1B 4P2GA 4F1KA 3SWWA 4HTAA 3WOVA 1PKXA 4MUHA 3M3HA 1RYFA 4L74A 3QKRB 1CS0B 1PYGA 1OTXA 4PIPA 4V2IA 1Y3BE 4O2AF 3R3WA 4CJXA 2JKVA 4J1QA 5K8UA 5KOHB 2J4FA 3CUUA 3VAAA 3E5NA 3R9WA 5KJEA 3V6LA 1UM9B 4ABYA 3BORA 4ESVA 1E2EA 1TU0A 5ALMA 3WL8A 1JZQA 2OZLA 3WOHA 3JQ6A 3E4DA 1CZLA 3RUAA 1F7UA 1FP4B 2QRGA 4UHCA 2AKYA 4K9OA 3ZWWA 1F8XA 3O26A 2HAEA 4JLJA 3RIHA 5DHQA 1UPFA 4F6CA 3IO3A 2ZJOA 3KQNA 5BYKA 3IUMA 4BO7A 2LVBA 4QJ3A 4QUEA 1R4MA 4DJDC 1YF3A 1P44A 4QQ8A 5CA0B 1HH4A 2AZXA 3EIEA 2H2IA 3EIQA 2ZSUA 4X97A 2BKUA 4HT3B 1JNYA 1TYBE 2B8EA 2D0OB 4WN3A 1G60A 2NUTA 2OLKA 4RMNA 4BLOA 1OI4A 1A9ZA 1P5RA 1TZJA 3D8UA 3AUUA 3OTHA 4XGKA 2ZAGA 1QOZA 1V39A 1XK6A 3WQBA 3UK7A 1SBQA 1DRJA 5JADA 3K7EA 2P6NA 4P93A 2PS0A 3CZPA 2REXB 4GECA 5BQ3A 3QVGA 2CXXA 1P1IA 3NAZA 4UM5A 6AT1A 2PSHA 3S44A 4D5EA 4AJIA 2VATA 3PFKA 1D5WA 1K8RA 4X8OA 3RUEA 3KK0A 3LQQA 3LRPA 1Y3HA 4LOIA 3H8VA 5DMXA 2V7BA 1XU4A 1YZHA 4DSNA 5D3QA 1U63A 1C7FA 4PVCA 1L5HA 2MSWA 1C4WA 1N2JA 2WJVA 3M34A 3DFZA 3K30A 1PUJA 2ZBVA 3E8MA 3IILA 4TLDA 4Z9AA 4YJGA 3PHLA 2CMDA 2ZIXA 4NZ9A 2X86A 4X5OA 2PKYX 5ICMA 4FDTA 4C88A 4OQMA 1U7OA 3T12A 1M2KA 2BL4A 3HUFA 1E6CA 2J30A 4G9BA 4URZR 5JO9A 5HHTA 2E6UX 4LF9B 5A7GA 1VKHA 1YDFA 4R6XA 4YNBA 2N1BA 4OHBA 1ZNQO 3PQDA 4AYXA 1P9RA 1LDNA 3HO1A 3UCFA 2NXWA 3QU9A 2I52A 3HJRA 3V42A 1HR0B 1I6LA 2EOAA 4QASA 5DI3A 3K8OE 1IZ0A 3E5RA 3W5DA 3P1JA 2CUTA 4BHTA 3VR4H 4DXAA 4FMDF 1ODIA 4I4TB 3UOAB 7GPBA 3QW4B 3LOPA 4G5OA 3PDIA 1U1GA 1JKJB 1PZMA 3E1SA 4HDMB 2D5AA 3WP0A 3DWFA 4R98A 1WXWA 1CQIB 1ZD5A 3CHYA 3OPYI 3DPIA 3KLNA 1C3LA 3P2JA 4HUQA 5BO5A 4Q9JA 1PSWA 3FHTA 4OXXA 1SQFA 3UYKA 4OXKA 4RCYA 4FCWA 3SLKA 2ACEA 4NQRA 3A70A 4R83A 5AW3A 3TWOA 1NHWA 4H0FA 2OD2A 3QVOA 3TM5A 4FCTA 2C2BA 1PCXA 2DFDA 2CCKA 3ADOA 1E60A 2G8NA 3PKIA 2DRIA 4HWSA 4AX4A 2WNHA 1GEGA 2YBEA 3QPUA 5D5PA 5KB3A 1ZJ5A 1M0SA 3OEEA 2XIQA 3KT3A 3CZMA 4DVJA 1JHYA 1W4AA 1PVDA 3L8EA 4XJXA 3SXJA 1V9LA 2DHCA 2RAFA 1ZH6A 2J9GA 1WUYA 2C5LA 4OEHA 4UPEA 1SBTA 3JASA 1MX1A 4RY8A 3W5SA 4Z4CA 1EXDA 4U5XA 3AYXB 2VBIA 1HZZA 5C3UA 2W0SA 3PUYA 3AEKB 4J4TA 1E69A 5JSQA 4XTRA 1VB3A 4BC1A 1R6VA 5H4GA 2PE5A 1YJCA 1FNSA 3B6MA 4NMHA 4HB0A 3S7ZA 1YWGO 2F3TA 2ODEA 1Z2NX 3KJXA 4OB6A 4PBSA 3L8YA 1QOQB 2H85A 3ESQA 2QTTA 1MEJA 1A0OA 1MCZA 1UXKA 1BW9B 1TMOA 3F6YA 2I9KA 1IXSB 2QTHA 5FNZA 3OG9A 3SU8A 3FFTA 2RIRA 2VAMA 1XQYA 4JVOA 5KQSA