3UYJA

Crystal structure of jmjd5 catalytic core domain in complex with nickle and alpha-kg
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
244
structure length
238
Chain Sequence
GLIPDVKLEKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of JMJD5 catalytic core domain in complex with nickle and alpha-KG
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific demethylase 8
total genus 60
structure length 238
sequence length 244
chains with identical sequence B
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2011-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13621 Cupin_8 Cupin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3uyjA00
5F3EA 4V2WA 4Y4RA 4DIQA 4UF0A 5F5IA 3KV9A 4CUGA 5FWJA 3KV5A 2OS2A 5IWFA 5FZGA 4QX7A 5ANQA 4BXFA 2WWJA 5FZ4A 5FZOB 5IVYA 3K3NA 5K4LA 2YU2A 3N9MA 3OPWA 5FYVA 4EYUA 2YBSA 5FZ9A 4C8DA 2GP5A 5A7WA 5FYHA 5FZ3A 4XDOA 4QWNA 5FXWA 5FZ0A 5FYZA 5FZLA 3LDBA 5FY9A 5FPLA 5FYTA 2OX0A 2GP3A 5LWBA 5FV3A 3PUAA 2YU1A 5FY7A 4NUBA 5FJHA 3NJYA 2VD7A 5FY1A 5KR7A 4CSWA 5F2WA 5FXZA 4URAA 3KV6A 3ZLIA 5A3WA 4D6RA 2OQ6A 5FY8A 4EZHA 3AVSA 4EZ4A 4CCLA 2XXZA 5FP8A 5FBJA 3AL6A 4UF0B 5F3GA 5IVFA 2OT7A 4GAZA 3PU8A 5F3CA 5FZEA 3RVHA 3U78A 5ISLA 4D6QA 2YBPA 5FZ7A 4D6SA 4CCOA 4AAPA 4GJZA 5F3IA 5A7NA 4AI9A 4LXLA 5FJKA 3PU3A 5E6HA 5FPBA 5FZ6A 4Y3OA 2YPDA 5A7QA 3PTRB 3PDQA 3U4SA 5A3NA 5LY1A 5IVBA 3PUQA 4E4HA 5F32A 5FXVA 5A1LA 5LW9A 5FZOA 5F39A 5FY5A 3N9LA 5F37A 5FYSA 4QX8A 1VRBA 5FYUA 3OPTA 2XMLA 2Q8EA 5CEHA 5FP4A 3K3OA 4CCJA 5FZAA 3K2OA 4LIVA 5A7SA 5FZFA 4QXCA 3KVAA 4BU2A 5IVJA 5FY0A 5FP7A 5IVEA 4V2VA 5FZMA 3DXTA 3UYJA 4XDPA 5FYBA 5F5CA 3N9QA 2OQ7A 4ASKA 5IVCA 4GJYA 4TN7A 5A7WB 5FUNA 4HONA 5FP3A 3KVBA 4CCMA 4CCNA 5FWEA 5FZ8A 4HOOA 5FZCA 4Y33A 5FYMA 4DO0A 2P5BA 3N9OA 4LITA 4QU1A 5FPUA 2PXJA 2YBKA 5FZDA 2Q8CA 5FZ1A 5FZKA 3ZPOA 3AVRA 5FZBA 5IVVA 5FY4A 5A1FA 5FP9A 4GD4A 5FPAA 2Q8DA 5FYIA 4BISA 3N9PA 5FYCA 4IGOA 5A3PA 5A7PA 4IGQA 5F2SA 5A7OA 2XUEA 5FYYA 5FXXA 2XDVA 4IGPA 3DXUA 5FUPA 5IW0A 4CCKA 5LY2A 3PUSA 3KV4A 5F5AA 4QXBA 2W2IA 4LIUA 3PURA 4QXHA 5A80A 5A3TA 5FZIA 2WWUA 5FPVA 3N9NA 3AL5A 3LD8A 5FZHA
chains in the Genus database with same CATH superfamily
1ZYBA 2XJRA 3JCIA 5JSPA 2Y6LA 3N7KA 4YW6A 1DCSA 3ABZA 3O0VA 4YW4A 3MLKA 4FT8A 4LJHA 3R05A 3OCPA 4NRMA 5C3SA 4ISQA 1NA1B 4YZ4A 1WW6A 1AUYA 4RL7A 1NLRA 3VBFA 1GZCA 3PMEA 2A6WA 4BXFA 1PGW1 5D8AC 2VQ0A 1FMD1 1GNYA 3CNAA 1F5JA 4COZA 2V5DA 1Q8VA 3D8CA 4XF0A 2WN2A 4A4AA 3ENRA 3KF5A 2JD9A 2WT1A 2VVEA 4QX1A 5FZ3A 4ZXKA 4AEDC 4M0HA 3ILFA 2FMYA 1URXA 5GKAC 3ZFEC 1W2UA 4LO4B 3ZKYA 1LHVA 4GKXA 1EAH2 1C8NA 3I2KA 4I3GA 1F8VA 5FY1A 4NHXA 3WUCA 1R081 5CG9A 4Q4X1 1IS4A 1UOBA 4HKWA 3VDBA 2NMNA 1N3QA 1LENA 2XGXA 1KDKA 2H6CA 1CR7A 2ZXQA 2ZOEB 1BEV1 3MFCA 4Q0PA 1OPOA 2IXHA 5DDJ2 3T2PA 4CCLA 1JUHA 5FQ0A 4ZZ8A 1MS9A 4PLOA 5C8CB 3KT4A 3POYA 4A44A 2W39A 1ENXA 2XOMA 3ZOIA 3NNGA 4A42A 2HLEA 4EWDA 3ALQA 2L9LA 2FZ1A 2YBPA 4XZPA 1BYHA 1DIWA 1UY0A 4CDQC 5A7QA 1AZDA 5LATA 2DU1A 2IXCA 2D3RA 2RS13 1AL21 4BQWA 3OY8B 3VKOA 5JMOA 1F4AA 1WLTA 4IV3C 1QOTA 4WVWA 1HXS2 2OPWA 2WZR1 4JVAA 3WP5A 3B7MA 3MW4A 3P3NA 4LHSA 2VUAA 4BPZA 1NAEA 1T6BX 1S0EA 1WMDA 2GMPA 1AR71 1KQRA 5A32B 4WM7C 1S0DA 3BIEA 4FPHA 2PN5A 1VBC2 3LEKA 3UGHA 5CAZA 5DABA 2A3WA 1YQ8A 1XNAA 1HQNA 3UT0A 1XU1A 3SCFA 4AVTA 4MUVA 1LR5A 4OZOA 5JPNB 3I2OA 2WO7A 4OMCA 1HRI3 4ASKA 4CYDA 4DNYA 1LULA 1YQ5A 3PVNA 3HQRA 4CP1A 2VMDA 4XFBA 1GP5A 1H4HA 1OKOA 4WV8A 1HB4A 2BFUL 4I09A 4MGIE 5SV5A 2X5IB 2XPJA 2BWCA 2C9AA 2P5BA 3I3QA 3O0WA 4UFJA 5FZDA 3BB6A 3T4HB 3X29B 1FOD1 2GNBA 2WN3A 1W9YA 1IQAA 3FZ3A 5FZKA 4AF9A 2LW8A 4XTPA 1M06G 3IB3A 1ZBA1 4BWOA 4LA2A 1BQPA 3F2ZA 5GJ6A 1QJX1 5F8PA 1EV11 1KGYA 3GJBA 4R9AA 1CONA 1POV1 4IE0A 3ZSKA 5C71A 1CX1A 1JYNA 5A33B 1QGLA 3EB7A 1DYKA 1AR62 2EIBA 5IFPA 3K48A 4D0QA 5JSOA 1NCRA 5FZIA 1JZ4A 1VMFA 1ZZ8A 3M3EA 4IXLA 4D94A 3VD5A 5F6KA 1UY2A 5BV6A 2ZX1A 3LE0A 3WXPA 2VBBA 4WZFA 4XMAA 1QJY2 2VNGA 3CQOA 3JBG1 4IEOA 4AHXA 3KV5A 5LB6A 4NHMA 2Y0OA 2Y6JA 3ZIXA 4Q4X3 1QWRA 3ACHA 3B3QE 4FPOB 2Y0IA 2D6MA 1RUC3 3QH6A 4YM0A 1ND2C 3LWCA 1U0AA 1K12A 4HG6B 4MADA 3IM0A 5TSWA 4AQTA 4RN5A 3T08A 2D97A 4Q0UA 5LK7B 3VBRB 5BNNC 2EIDA 5K0UC 1K3IA 4MGYE 3LB9A 3LDBA 1VALA 2A71A 4JGZC 3BI3A 5C8CA 2PHXA 3WF4A 1FAYA 2FQPA 1GBGA 4YVWB 3GBGA 1W9TA 1COV3 4IE5A 5FJHA 3U1XA 3WF1A 1ULDA 3DPRB 3MPPG 3M1HA 3T1MA 1VRH1 2A3XA 5LCWL 4LKSA 2LM3A 2CHHA 4A45A 3B00A 4C1XA 1EPWA 3I54A 1RVF2 3NJVA 4FPLA 4LBJA 1W6PB 4Q4V1 1WCKA 4PLMA 5IUQA 5LBFA 5EWSA 3CDZB 4BZ4A 2HWF1 1ONAA 2HWB2 3OY8A 5LBCA 1LHNA 2QQMA 3IDCB 4DRRA 1EV13 1RUF1 2B39A 4TTGA 4FTEA 4QDSA 5FBJA 4RGGA 3FUOA 1Y4WA 2VOKA 3FBYA 4Q4Y1 2ZGSA 1RXFA 2GZWA 1HX6A 5FZ7A 3ACGA 4D6SA 2E7AA 1MVQA 2YC4A 1AR81 1IS3A 1W8TA 5GZDA 1M4WA 4PQ9A 1CZTA 2VZ1A 3SITA 2MHFA 1YFXA 4JKKA 5A1LA 3VB9A 3MIHA 3RS6A 4CDXB 1JHJA 1GYKA 2ZAHA 1JZ5A 4IEPA 3E5XA 1YLLA 3TN91 3RZKA 1OLME 1LNSA 1UYXA 1MEC1 4FAGA 5JWPA 1VAVA 1W6MA 2X53S 2YFZA 3H8OA 1JHNA 1VMHA 1GANA 1DYOA 3IDBB 4KU7A 4ONUA 3RMYA 4CEWA 5J37A 1OLQA 4QM9A 5L9VA 2VG9A 3I2JA 3HBKA 1WMFA 4Q4Y3 5IVEA 4H2AA 1GP6A 4GWJA 2ZEZA 1QNWA 1R082 2WSVA 5FO9B 4E2QA 4AFMA 2ARAA 4HONA 3MGUA 4Y20A 4IV1B 4DUXA 4BCUA 1XSQA 4NIHA 1BEV2 1COV1 1NE6A 1W2TA 3V64A 4LE3A 1QOOA 3BPSA 2JJ6A 5JZGC 3NNJA 3MI8A 1ZRCA 4INDA 5GM0A 4HK9A 2ADEA 4ATEA 2QFEA 3AMQA 4MGZE 5E88A 5IK4A 2RV9A 1D0GA 3C7EA 5CU1A 2RS12 2VTXA 2VXJA 5EZWA 2BGOA 2ZMNA 1RHI3 4GMP3 2I45A 4KGGA 4XZUG 1MQTA 3SISA 3LPGA 1W8UA 2F4LA 4Y22B 1ZA4A 1NKGA 5FYYA 4K21A 2D6PA 2W3JA 1RUC1 1PGL2 2P6HA 2XDVA 4IGPA 2A6ZA 4XE9A 1JZ7A 3WNLA 1OUSA 4YM3A 1OVPA 3VKLA 2QQIA 1XXNA 5F5AA 2RDNA 4Y1VA 1UPSA 4I0BA 4QXHA 2V72A 4EE2A 3B94A 1TMF3 4B4PA 4BLIA 5IAXA 3GYDA 3M2MA 3VD4A 5DUWA 1XNKA 1PMHX 4YZ5A 5BNOA 1O5LA 1O91A 3WG3A 2ILMA 4XUPA 1VBD3 3VHOA 4Q27A 2Q0AA 4AFDA 4UAPA 1AYN3 1LTEA 4CEWB 4QQ2A 4NROA 3UL2A 4K8FA 2KM2A 2RS52 3O1OA 3O1VA 5CNAA 1CVNA 3OUHA 3QBQA 4Y1YA 5ABJA 5C4WC 3BOPA 1QJY3 4RA0A 5BXXA 2VOXA 2IXKA 4XDOA 4DXTA 2BFUS 2WL1A 3FLTA 1K42A 5FY9A 4IEUA 4GH4C 5I8TA 1IQDC 5CA6A 5FRAA 4BDVB 1AJKA 1STMA 1O8SA 2VTFA 2ZA9A 3PUAA 5FV3A 4CP9A 1RUH3 4YLZA 3IAPA 4OI4A 4QKDA 2A6XA 3VZNA 2RDQA 3CKHA 3ZN5A 4FP2A 5KR7A 3CHXA 5J09A 3WY6A 3WW1A 2RDRA 4WM8B 1J1LA 1O7FA 2R061 1KFUL 1RUJ3 1OUXA 5D8AA 1GU3A 3D6EA 4CP2A 5C70A 1U5XA 4NIDA 4WVMA 3GCXA 4F7ZA 3MW2A 3FUQA 5FZEA 5C3PA 4IV1C 4A2UA 4IEQA 4HLTA 2HWB3 5T50A 4XJWA 2RJLA 2R063 2BZDA 3KS7A 3OB8A 1EV12 1X9TA 5FJKA 2OYZA 3VDDB 3U4SA 1BK0A 4JKLA 2RG4A 2XVLA 5F32A 3VBOB 2VUJA 3LFMA 5KHJA 4LO8A 2X10A 3Q8BA 5SV8A 3H3UA 3ST7A 1GQHA 3IPVB 3IMMA 2HBUA 5F37A 3I49A 4GB33 3N4MA 2Q8EA 1DLLA 2Y64A 5FK8A 5GLWA 3SC7X 4OUMA 3POBA 4PF5A 3FC0A 5FZFA 4H3WA 2BOIA 1QJY1 5F6LB 4AQ2A 3AMHA 2QJVA 2R6QA 3BVCA 3UJOA 2FDKA 2J42A 4B7EA 1FT9A 3KB5A 3NQHA 2WRAA 2UYBA 3M7AA 4KWLA 4H7LA 1W03A 2D43A 4AI3A 5L7OA 3GBFA 5DUVA 2E7QA 4XVHA 1MZFA 1MS3A 1PHMA 2VTXJ 1R083 3B01A 4AVBA 1HXS1 2WZR2 1D4M2 2F6BA 1H9WA 2UU8A 2BBVA 1ZBE2 4I01A 2RS31 4IV3A 1RUI2 2ZGKA 2Q8DA 4NHLA 1UQXA 2ARXA 2XHNA 4OLLA 3OOXA 3N7LA 3IN9A 1H2LA 1F9KA 5HCBA 1UOJA 4Y5TA 3DN7A 4URTA 4HK8A 1XE8A 2DU0A 3K4AA 3OBRA 4YW7A 3ZN4A 5BNNA 5K0UA 1VBA1 1RVF1 4Q4V2 4K7JA 3AFGA 1PIV2 1UYPA 4JGZA 5DAPA 5IFTA 2CGOA 4E2GA 5FPVA 5CFDA 1YXWA 5C9AA 2RJ2A 2UYAA 4FOWA 2J7MA 4XPVA 3GZAA 3H9AA 1W6MB 1PVC1 1NY71 1FV2A 2D3PA 1JYCA 3RI8A 1LJ7A 3WQBA 3MLLA 5H9PA 1UXXX 1MR5A 3R0RA 1O3QA 3BODA 5EJ1B 4BIOA 2VOWA 1O4YA 3ACIA 3Q8FA 4WVVA 2B4KA 3JQWA 3W9AA 1AVBA 1NCQB 1DFQA 3B69A 2WNVB 2AC1A 5JR2A 1CZVA 1WLDA 4LA3A 1ZA7A 1ENSA 3HIFA 1JN2P 2JDAA 4COYA 1XNCA 1Z7S1 1TME2 2W91A 2RS53 2D98A 3FFZA 5FKCA 2ZPXA 3NAPC 5BY5A 2C5DA 3TN93 1RUJ1 1WMEA 3WOGA 1ZRRA 4K8RB 5BNPB 4Q1PA 4LBKA 5I93A 5IK5A 1V9U1 1WA4A 5IATA 4ZU4A 2Q30A 2VECA 2QCSB 4RHV2 1PVC3 4XF1A 1V6KA 2W1SA 1W6OA 3H3LA 2W1WA 2WFF2 5FQ0B 1CAVA 2G1MA 4QPGC 5A3WA 3ASIA 4AEMA 3C8XA 4C91A 5FO8B 4FTBA 4XBQA 1I5PA 1POV0 2BWAA 2P3IA 1HB3A 3NJXA 1WBFA 2ORZA 2DVGA 2J1SA 2QUOA 2VCCA 4BQ3A 1H2NA 1H6XA 1QQP3 4UF0B 1H4GA 2ZZQA 3DUIA 2OT7A 2AR6A 3O0XA 4FPFA 3GGLA 3N35A 1OMIA 5T52A 2D7FA 4CCOA 3BKZA 1K45A 3KQRA 4PBPA 4OMDA 4AOCA 4EQVA 3RMXA 4Y1ZA 4DY3A 2LALA 5JZGA 3RNSA 1QJZA 2BNOA 3O1SA 1MPXA 1YIPA 1R1ZA 2HWE1 2ATFA 1JUIA 3W5MA 2HWF2 5T5JA 3P6BA 1DQ0A 2YG0A 1LAJA 1WW7A 5FP4A 3Q8CA 3OSDA 4YNIA 5ANNA 4IE6A 4Y5SA 5FZAA 5A7SA 1AL0G 4PIZA 1VBE1 4QXCA 4YGBA 1H2MA 2VCMA 2BGPA 5C7GA 2WWSA 5FPXA 1NXD1 4PQQA 4ATFA 5F5CA 2RS51 1N3OA 3MF6A 1UIJA 2E31A 3VUOA 5BNOC 4XFIA 1AX0A 5JXJA 5LK5A 2XL9A 4RR3C 3RWNA 3WDYA 4LITA 3S5QA 1Z78A 2IVIB 4XILA 2WO3A 1YQ2A 3HBZA 1MQTB 1OPMA 2V4AA 5C5UA 4FPJA 4XQWA 2WNVC 2WS92 4ZS3A 3SKJE 1A3KA 5HCFA 1ULEA 2JEMA 4N7UA 5C3RA 2DTWA 3EBRA 2GH8A 3K77A 2ZGMA 4YGDA 1PX3A 1OFSA 4KMQA 1O5UA 3ZXDA 3KCYA 3BCWA 3KHCA 1YQ6A 1UY3A 5T3NA 3AB0A 3OG2A 1PNGA 3PURA 1ZBA3 2EA7A 4KG8A 4A7KA 1FNZA 1TQ5A 2FDGA 3I3MA 3FLPA 1JU4A 3O1MA 5HCHA 3S30A 4TYSA 1YHFA 4KGQA 1GZWA 1UYYA 3WNNA 1C8M3 2RMU2 2PAEA 1Q5OA 4FXKB 1RHI1 4GMP1 4AXOA 1I6XA 3B9IA 2WDBA 2OW4A 4W6XA 5A3UA 1J83A 2WUHA 3C2UA 3OPWA 5BNQA 1UU4A 1T2XA 3CJIA 4Q4W1 4A3ZA 1VMJA 3L2YA 4C8DA 3AP7A 1LOFA 2VO5A 2EXJA 1SMVA 2CY6A 4MXVA 2VR4A 4ORFA 5A7WA 1KRIA 4YGEA 3WLUA 2DBNA 3QACA 2G4IA 3RJRA 4DUVA 2XJPA 5FYZA 1J1TA 1S0FA 5J1XA 2WT0A 1PMJX 1XE0A 2W1UA 4TZDA 1NYWA 2LROA 2JE9A 3VN4A 3NVCA 3VHPA 2J1RA 2VD7A 3LAGA 2VZ3A 1IG0A 4F83A 2QQUA 3N36A 2ZZJA 4QDRA 2YC0A 2G9FA 3VBHA 3PIGA 5C5TA 1AR92 2VCBA 2CYFA 2VNOA 2Y6GA 5FY8A 3VGIA 4BH9A 4NHKA 4BLJA 3USSA 3ZM8A 2RM23 4HKOA 4CUAA 3AL6A 1UZZA 1W6NA 4G9SB 4MGSA 2J1EA 3DGTA 4Q26A 3IDEA 3EHKA 3TOJA 3ZR6A 1O3TA 4MGKE 4JCKA 1S55A 3VZJA 4GJZA 3NWKA 4CPBD 3VD9A 2A7AA 3NL1A 4LBOA 3PTRB 4DUWA 4GH4A 3S5AA 4CDQB 5I0DA 4AG4A 5FXVA 4N53A 4COUA 2O8OA 3LA2A 3MIEA 4HANA 4P9LA 3AP6A 1EP0A 3BTAA 2IVJA 3CJIB 3D0SA 2TNFA 3DYOA 1W2OA 4HVQA 4OUEA 2GC1A 1DF0A 1UF2C 3CIHA 1RUG1 1RJ8A 3WSOA 4FCAA 1RUJ2 3FHAA 4NWVA 2DFCA 4D69A 3K4ZA 4OQ8A 2RE9A 1NY72 4B1MA 1AYN1 4QB1A 5JIAA 1W8FA 1LHOA 2WC2A 4GWMA 4XDPA 1RUE1 4QKNA 3GHNA 3WEZA 5T54A 4IV1A 4LOSA 5IT6A 4JRAA 5C9AC 4W8JA 2HYKA 4CCNA 3D0JA 1E5SA 4UXAA 4E4SA 2Z79A 4Y33A 1MS0A 1Z7S2 1N3PA 2EXIA 3IIAA 4KI5M 5GLTA 1UU6A 3K75B 2IXJA 4LKFA 4Q2FA 1XNBA 2ZKNA 2VW2A 2D40A 3FMGA 2W52A 3DYPA 3S7EA 3CJIC 1H8VA 2W0XA 4BISA 2WJSA 1V9U2 4B29A 1JZ6A 4AVAA 1UYZA 1YIFA 4M4PA 4HN0A 3ZYHA 2PLV1 2ZTNA 3O5SA 4A6OA 4AGRA 1PK6B 4LR4A 4CCKA 5AFEA 2C4XA 2FDJA 4XC9A 2GN7A 1SLLA 2W68A 4AE2A 3ZFEA 4HZFA 4LIUA 2PHFA 3KSCA 2XJTA 3U37A 4DOUA 2ENRA 2WWUA 1GSLA 3JD72 3KT1A 1AR82 2ET1A 3U4XA 1JTZX 3M3OA 4DY5A 1BEV3 4N9HA 3U07A 2D5FA 2PLV3 3BN6A 3WNKA 2P34A 3WINE 3BYWA 2BVBA 4N8MA 5BPXA 2GSYA 2OS2A 3O1RA 3RQ0A 5FZGA 1LOBA 3I59A 3WG4A 5A32A 1GOHA 3VBOC 4YARA 2P17A 4LE4A 4AHWA 3OBZA 3Q8AA 5IK7A 1WLCA 2PHRA 1GUIA 3VBHB 5FYVA 4ZZ5A 4BQXA 3VDDA 3POFA 5JI7A 3LDKA 4CCCA 2WS93 4MSVA 3C7HA 4HVRA 2Q1MA 4Q4V3 4BM8A 2ZX3A 4JZRA 1FI2A 4XBLA 4YW2A 1CESA 2VQUA 2WT2A 4ES8A 4GZ9A 3TNPB 4D7TA 1AX2A 3WHTA 3NJYA 4BK5A 3B02A 4V1PA 1YQCA 1L7QA 4AFBA 4WM8A 4NPLA 2PELA 4N9IA 1UN1A 3INAA 1VBA3 2VBDA 4JHTA 3VZLA 3AKQA 4PI0A 1S2BA 5FPZA 4UFKA 4JDMA 3THCA 1A78A 3PJQA 1DG6A 2QQVA 4QGNA 3ZFGC 1UAIA 5LRSA 1SCRA 1SLTA 1GLHA 3VHNA 1B35C 1V6NA 5E16A 3JB8A 4UW6A 1AX1A 4XJZA 3MF9A 4PBOA 1UIKA 1ST8A 2QDRA 5DAWA 4C1WA 4ASMB 2WQZC 1MEC3 2Z5WA 5T5PA 1DGWA 1W9SA 1RUG3 2WZPP 1ULFA 4FFIA 4XFGA 1G9BA 4Q4W2 5K7PA 2A3YA 1F35A 2WFF1 4OHXA 3ZYJB 4AL9A 1D2QA 1W0NA 2VMIA 1LCLA 2R32A 4GKYA 3WF0A 5C8WA 1JYIA 2GNDA 2DDUA 2E7TA 2X8KA 5I0UA 2KXLA 2VMEA 1Y43B 4MH0E 1S2EA 1A34A 1YWKA 4CDUC 4M3CE 1LB2A 2CU5A 4P9GA 4EN8B 3GXUA 3LEGA 3L2HA 2OQ7A 4ZY9A 4NAOA 4TN7A 2HBTA 4CRQA 1U5YA 4CCMA 1BBT2 3PNAA 1XPWA 2R16A 1TNRA 1XOYA 4P9IA 2XBO1 4UWDA 4CDWB 2PXJA 2YBKA 4FPCA 1JXNA 3MFAA 4QHBA 4R9BA 1VP6A 3AYCA 1IG3A 2AENA 3RZHA 4L11A 4QPWA 5EFUA 4AR2A 1W39A 5FY4A 4GD4A 1NCQC 1RC6A 5GALA 1CAXB 4FP3A 5FMCA 5A3PA 4HKLA 3VDDC 5HV4A 3S0MA 3KD4A 5L19A 4YZ3A 2VU9A 2OA2A 4OI1A 3WDTA 4AFCA 3VDAA 1G8WA 3AZVA 2GC3A 4CCEA 5C8CC 1C1FA 3UGFA 1ZRFA 4IETA 5DQ0A 1HRV3 1WW4A 4CXXA 3J7LA 1E5RA 2C1FA 2YPJA 1DZRA 5AC92 3NO8A 4QPIC 4WM8C 4BMEA 2B8MA 3LKJA 4UF0A 4Y24A 4EJRA 2Q1ZB 4Z07A 3NNLA 1UO9A 3AX4A 1Q56A 4CEYC 2WWJA 5FZ4A 3EQEA 3ZN6A 1YFWA 2YGMA 2YYOA 5FOBB 1NZCA 5GZEA 1LHUA 1PO11 2HWC2 2QNKA 5JZGB 2QQWA 2FDFA 4NN0A 4Y1XA 4GH4B 2G9GA 1RMU2 1US3A 3ZIWA 1ZZ7A 3RRDA 1XQNA 4SLIA 1AF9A 3AYDA 5HPOA 1HV0A 5I0RA 5E89A 1NQDA 1HRI1 1SPPB 5DN2A 1A8MA 2P1BA 2HWD3 4OHWA 2VUDA 3M3IA 2LRPA 3AM2A 1KDMA 4N7IA 4XXAA 1QU0A 5LWBA 1T6GC 2ZACA 4CDUB 3ZMOA 1FYUA 5J7MA 1GFF2 1JU3A 3UKTA 1GQPA 1C4RA 2I07B 2X29A 3MUY1 3QH7A 1CWPA 2VZOA 1UX7A 2ZJCA 4QQLA 1PM4A 5A3OA 3IBMA 3S57A 1QJU1 4P5YA 2G9ZA 1ZZ6A 4JHZA 1H30A 5A70A 2BVVA 1RUI1 2PAMA 1XE7A 3DPRA 1RUH1 4PDWC 1F31A 1UW8A 3AYAA 3JZVA 4H55A 3M70A 2XXZA 4XIOA 5L9BA 3SH5A 4XFCA 3UGGA 4CDUA 4KWUA 1PO21 4E4ZA 4F8AA 2UY8A 1SBDA 1JW6A 5FTTC 3RVHA 1VBA2 3THTA 5C3QA 2IXLA 4R8HA 4HPKB 1PZ9A 2WYFA 1AYM3 2BU9A 1W9WA 1FNYA 3AJYA 3LFIA 2VOTA 4BQYA 3I4IA 1FX5A 3S6PA 3PUQA 2VULA 5FLJA 2WA3A 3LSEA 1S0IA 2GU9A 4NAMA 1LGBA 3FN9A 1OF3A 1DZTA 1TZOA 2RR11 3EJKA 4R52A 1D2SA 2W5FA 3VLBB 5JOWA 2WQ8A 1X8EA 2BGCA 4HL0A 4FFFA 2ET7A 5CBLA 1JYTA 3F95A 3OBAA 4Z92B 4YW3A 3DEMA 3PLQA 4QT6A 3WDUA 1BVP1 3OF1A 4FI9A 1OSGA 4PI2A 3E5QA 4AI2A 1R093 3C3VA 2JG9A 2K9ZA 2UY9A 1QHDA 3DXTA 4XFAA 2NZ9A 3WNMA 3SCHA 3L9JT 5KHKA 4LBMA 1VBB1 1CAWA 5K0UB 5EYYA 1OQDA 1ZRIA 2BYVE 1OLRA 4A3XA 4A7ZA 3A0NA 1W8NA 1YFUA 2RDSA 3SCGA 2ZEWA 4YW1A 3T0BA 4N53C 3HN3A 5EJZB 5FZ1A 4ZXEA 5T55A 2Q8CA 3RDIA 2YY1A 5LA0A 1RL3A 5H9QA 5KHHA 1MEC2 4X8NA 3V0AB 3I3DA 4ZKTB 3A22A 3H1MA 3MHZA 2FD8A 1RUG2 2HEVF 4LBNA 4META 2W87A 5ABJC 5C4WA 2QZ2A 2EF6A 4KBBA 2CV6A 2O14A 4MOAA 4OHYA 3KWVA 3T2QA 1SG3A 1J3RA 4AQ6A 3J8F2 1R1A2 4LK6A 2OXBA 4AI8A 3UNPA 1NLSA 5FLHA 1N1SA 5DZFA 5JOZA 4B8EA 4OYUA 3E97A 3VD7A 1WCDJ 5EYXA 3VBUC 2VNVA 4V2WA 2LUWA 1BHGA 4RYDA 5A1AA 1FV3A 3HAGA 5ACA1 5F5IA 4WZCA 1UOGA 3WCRA 1MZEA 4QX3A 4CUGA 2AH2A 2VW1A 4GXLA 2VNRA 1OOPC 5T5OA 4BOWA 3SMHA 5LZ6A 1BBT3 1FPN1 1S0JA 4XXPA 4CCDA 2R042 4UW5A 2NN8A 5LEKA 2X09A 2VJXA 1PGL1 1B35A 1BBT1 1VRH2 4XF3A 2XG3A 2AREA 1WCQA 2WLPA 3MYXA 3NV4A 1G86A 1RIRA 4G4FA 2B9VA 1VAMA 3APBA 3AXDA 1CIWA 2YDEA 2XLAA 1DQ4A 4UW3A 4Q8LA 3M4FA 2WFPA 1FMD2 5FY7A 1BK1A 4PT6A 1W3XA 2X05A 5JVVA 2E63A 4XFHA 4JGYA 1B09A 5GLVA 3RZZA 1GOGA 1NUKA 1QY4A 1OHFA 2XR4A 3WDXA 1PX4A 3UKNA 2R072 2QQKA 1RITA 2EXHA 3VBOA 5C33A 1Q8QA 2Y8KA 3KT7A 1QJX2 4LKDA 3M8LA 1EAH1 3GJAA 3ZXGA 5A6XA 4S2DA 5B2GB 1PM7A 1XU2A 4OI0A 2F4PA 2DCJA 2ZHNA 2PHDA 2CDPA 3WDVA 3ROUA 3PU8A 2YHJA 2DVBA 2W1QA 3MLJA 1XYPA 4SBVA 3SLIA 2FDHA 1AR61 3LA7A 3KQ4B 3OUIA 1HQLA 5L7OC 4I3PA 1ND3B 2ZCWA 2KR2A 1SLIA 2QQNA 1PO12 2HWC1 4C90A 1LEDA 3I2FA 4U36A 3CL1A 2R1BA 1JOJA 2BQPA 1NCQA 3ZMNA 2RMU1 2ZX4A 1RHI2 2DUQA 1HRI2 5FYUA 1AR93 5AC91 4CCJA 2JDPA 2P4EA 1GZTA 3BU7A 2GN3A 4HXCA 4AHYA 1AL22 1RUD3 2TBVA 1E5HA 4HMZA 4UYBA 4YVSB 1W6QB 2C26A 1XJAA 3AMMA 3T2OA 3VZMA 1APNA 5CFDC 3E6DA 4QGLA 2BBAA 3AK0A 5D1IA 3VBUA 3FLRA 4PF1A 2C0ZA 1WUVA 5KXEA 5D2AA 1VBD2 1DGRN 3ELNA 2NLRA 1RUC2 4FQ4A 3PUIA 4O61A 1DYPA 1DHKB 2E51A 4YGCA 2PTMA 5FKBA 2JB8A 3NSTA 3SHRA 3BTZA 3HOBA 2XQRA 1XNDA 1DLCA 2JIGA 1RYYA 2JECA 5A7PA 2RS33 3ETQA 2XJUA 4BE3A 2B9UA 5I91A 2XUEA 3NV2A 1TG7A 5HBAA 3DYMA 5EPAA 5FUPA 1TME3 3KCCA 1IKPA 1QXRA 2C6SA 3FL7A 3NAPA 2V73A 2AEZA 4QXBA 2VPVA 5F1RA 1J58A 4DFSA 4L2NA 1FATA 2HEYF 4RHV3 5F3EA 3KGLA 2Y6KA 4LBQB 4DIQA 2VGDA 2VW0A 3FE5A 1UKRA 2GALA 4QPGA 4ET7A 1IKQA 2WZEA 3ORJA 2EVXA 4F3JA 4L99A 2J1TA 5ANQA 5GLUA 3ZSLA 4CDXA 3GDBA 4EV0A 2YU2A 3U75A 3AP4A 1CAVB 4QHZA 3SXWA 2Q8OA 1ULOA 4CVUA 2OIIA 2ZMKA 3JBG3 4LKEA 3HD8B 2OVUA 4BXSV 1J3QA 4CE8A 4YVWA 4B1LA 1RUE2 3W21A 2Y38A 5FYTA 3NJZA 1QXJA 5JLVA 1GWLA 2YU1A 2DCZA 1DZQA 2ZX0A 1R1A3 5JXHA 1JI6A 3URFA 2BPA2 3NV1A 4QPIA 4CSWA 1OI6A 3MPBA 4D3WA 1AHSA 3OEAA 2Y34A 1KEXA 3R4SA 3C7OA 1QKQA 2OQ6A 3VBFB 2A75A 2OUJA 4LO5B 2DUOA 3PHMA 5FAXA 5KHIA 1H8TA 1CPMA 2KD7A 4QHOA 1GV9A 2RJKA 2JG9C 1PVXA 2VBPA 1D7PM 1PZ8A 2HWD1 2XH6A 2DYCA 5ISLA 4XAAA 4CZSA 4D6QA 3GZEA 4XYXA 3C7FA 4QX0A 4W6WA 1HW5A 2EIEA 1ODMA 3VD3A 5FPBA 1KS5A 2YB7A 4Y3OA 2WIIB 2R041 1EUUA 4N43B 4RHV1 3H3ZA 2D93A 2WZR3 4AVVA 2GH2A 4AFAA 4KG0A 4KQ7A 4Q4Y2 2WNVA 4FAHA 5C3OA 4BIFA 1OA3A 1UD1A 4XIKA 4KH9A 1HN1A 1REEA 1S0GA 3FFQA 1LODA 4L97A 5IHRA 2BOJA 4KNCA 3K3OA 1JH5A 2A70A 3BPZA 5BNOB 1PO22 4IEXA 1NXMA 4AYUA 4L92A 4RQPB 1ZZ9A 5T5LA 1VLNA 3AP9A 4R4ZA 3T0AA 4DXSA 5FZMA 2R073 1OQ1A 1YRZA 1QH7A 1ZBE1 5L7OB 1UX6A 4NMIA 5L9RA 2VZUA 3WR0A 1FPN2 2EALA 3H8UA 4FFHA 4KWJA 2BEOA 3ZSMA 4LHKA 3ATGA 3USUB 4XF9A 1AYM2 2IFRA 5FWEA 3ZFEB 4BK4A 5FZ8A 4CUCA 2WA4A 4FFGA 4CU9A 2R1DA 1XYNA 4RQPA 4YG3A 4K1YA 4AW7A 4Y22A 4U2AA 1ULPA 2CAUA 3D4KA 4H7MA 4M00A 5FPAA 5JOXA 1ASJ2 3LCPA 4NHYA 5JUVA 1POV3 5FYIA 3V65A 3A0KA 4B4RA 4LBQA 4ZS2A 2X5IA 4IV3B 5FYCA 5LBBA 2CGNA 3AZXA 5BYNA 3T3YA 3LSDA 1WLWA 4LBLA 1QQP1 1S0CA 1Z0HA 2Y26A 1R092 1VBB2 3ON7A 5E1RA 3JXSA 5KXCA 2GNTA 2DCKA 4OHVA 1WWYA 2HYXA 3DKQA 2TUNA 2JE7A 1X7NA 3MZHA 3VBSB 4JRLA 2WYSA 2YV8A 4JGYC 1SCSA 4YM1A 1LKNA 4M01A 2OKXA 4WVMB 3VBHC 1SACA 1BJQA 2GAUA 4XQDA 1VBE3 3GZUC 4LK7A 2E33A 2WS91 4A7YA 4EN9B 2QTWB 5H9RA 1HB1A 2ZGLA 2IUWA 3AKSA 3ACFA 1H8TC 3AYEA 4CU6A 3UETA 3NNMA 4GALA 4RD7A 4S2HA 2HWE3 4LOTA 1YC61 2ZGNA 2MEV2 1MZ6A 3POGA 4DEQA 4NRQA 4UW4A 4IQPA 4CXYA 4CXWA 4N43C 4W4ZA 4YZ2A 3LDRA 5FYSA 1PNFA 3I2GA 2WNUB 1K5MB 2Z2SB 1HQWA 1W06A 4YG0A 3WVJA 1RUNA 4X8PA 1U5IA 3CEWA 5EP9A 2WAAA 4IDZA 2JG8C 5AC93 5BUVA 1IOAA 4WM7B 5IAVA 1G6NA 3KV6A 2JD4A 4ZU7A 4AHZA 5A6ZA 1RUF3 4QGMA 2B45X 2BNNA 1IPJA 3PTYA 1OOPA 4LULA 3ES4A 4XW3A 5FO7B 3DV8A 2WLQA 4OI2A 5IJRA 4QM8A 3WP4A 3B9CA 4B3NA 2NP0A 2E32A 4Z2AA 1REDA 5FP8A 1YJLA 1G9DA 2XVKA 2PHTA 1BZWA 2WNUA 3GF6A 5LA1A 3ZO0B 4LNVA 1VRH3 2WR9A 2QQJA 5CYYA 4I2OA 4LLFA 2XLFA 5LRRA 1W28A 3AFKA 4CP9B 4P9XA 4AAPA 4AI9A 3BUCA 3BALA 2I2SA 4QAWA 3ZYIB 4COVA 2YPDA 2W46A 4DXZA 5GZCA 2Y60A 4MV2A 4LBQD 1DGRA 5IYYA 1RUE3 5GZFA 1NZIA 1OA4A 2R071 2XJSA 1WD3A 2VAUA 2IXIA 2ZGUA 1L3JA 1PGW2 1WA6X 3N9LA 4LORA 4QX8A 2X5IC 1ULGA 1N1VA 1PIV3 3ZFGB 3V0BB 4RSUA 4LTAA 4MXWB 5C9AB 3K2OA 3NW4A 4LO7A 1W0PA 4S2GA 3UJQA 3HR9A 3KVAA 4DMIA 1QJX3 3BIWE 5FY0A 3H7JA 5FP7A 1AXKA 3UYJA 1JS9A 1HJGA 4UT5A 1QJEA 1TEIA 2ZBJA 3WHUA 3ZXAC 2E53A 2P6CA 4BQ2A 3JD73 3FX3A 3ZDSA 1AR83 2CTVA 1B35B 4MGQA 4AZZA 5CFCB 2QKDA 1C8M2 1POQA 4H14A 1S1AA 4B7KA 4DEVA 5I0TA 1O4ZA 1DQ6A 2HJIA 4CDWC 1F2NA 2V09A 3T09A 3R4DB 4KWKA 5DDJ1 5HV0A 1YI7A 3OGRA 4R9DA 2VZPA 3CBNA 2JIJA 1I1EA 3BGAA 1XNTA 3OGVA 5A7OA 4N90A 5FXXA 1HXS3 1O6UA 4XMIA 5B4NA 4MLOA 4AEKA 1K5MC 4NPMA 5LY2A 3LF7A 3KV4A 1ASJ3 2XKPA 1LU1A 2Q4SA 5A80A 4NPRA 4YVSA 2DURA 1EUTA 4K9SA 3TWIA 1C3HA 3LD8A 4XACA 2JG8A 1H0BA 1Q8SA 2J1AA 5J96B 1MACA 5M0TA 4E8CA 2VQAA 3DECA 1W8ZA 1NE4A 1W6NB 3LOIA 4MVTA 4Y26A 3RWKX 1Q43A 1H9PA 4P08A 1DQ2A 4AWDA 4BA6A 1EY2A 3OUJA 2WO2A 4DPNA 1UL9A 3K3NA 5K4LA 2OUHA 3ZFGA 1QH6A 4O7XA 1JODA 5CKNA 3SH3A 1OA2A 1W0OA 2EIGA 3HN1A 1VBE2 3ZFFB 3MIDA 1PVC2 4NIAA 4IL7A 5LA2A 4EN0A 1LEMA 5A6QA 1BCXA 4AK3A 2WFF3 5FZ0A 5FZLA 4XURA 3MEPA 2LS6A 3JD71 3POSA 1VAKA 2R30A 2H6BA 2HWF3 4FOQA 3TEXA 1YFYA 2R7EB 4NUBA 1Y9GA 3VBRA 2A1XA 2VZSA 1N1YA 3VL9A 4XUQA 1W99A 1QQP2 2YMZA 3TAYA 3CLPA 2CAVA 5F2WA 4D8MA 2JDKA 1H8TB 3ZLIA 4QKBA 1TME1 5L73A 1S2KA 1C5HA 1QEXA 4D6RA 4PIXA 1AYM1 5FFOC 3B93A 3AVSA 4CDXC 2A6VA 1IPKA 1W6PA 4UI9L 1R64A 5JXGA 2ADDA 1SLCA 1N47A 1G9AA 4O65A 1ZX5A 4XCAA 5HXMA 4OVEA 1IZ3A 1JBCA 3KLSA 3IZOA 4XAEA 3J8F1 4Q4X2 1IGOA 2XUMA 4A41A 1AJOA 2PQSA 4W6YA 5JSRA 1GR3A 4AAXA 5KC5A 1W2NA 4ZU5A 5CG8A 2B7YA 3PDQA 1LOCA 5IVBA 4LMFA 2Q1FA 3JUUA 2XBO3 1X9PA 5FY5A 4O9EA 3WX5A 3J7NA 3P5BA 1W3VA 2R49A 3OPTA 2D44A 2GDFA 3WF3A 5C6CA 4XJAA 1MS5A 4KL1A 2ZHKA 4IERA 2O0OA 3D82A 4AVCA 1LOEA 1K5MA 3OTFA 5DDJ3 4BU2A 2FMDA 4V2VA 2PQQA 1QDCA 2WAOA 3KCXA 2B46X 2JDHA 4FPEA 3GCWA 4LUKA 3U10A 3N9QA 3VZKA 1JOPA 1F15A 2VM9A 3USUA 1HRV2 2XJQA 1I9RA 3W59A 4DS0A 1E5IA 2EAKA 3KVBA 3V56A 1SFNA 2PLV2 1PO13 4RFT0 2ARCA 1HKDA 1RUD1 5EIYB 3PMSA 3OD4A 2JX9A 3MUZ1 4JAAA 1UZ0A 5FZBA 2TEPA 5FP9A 1D4VB 4PJYA 4XEZA 3WQ7A 5HCAA 1H1AA 1E57A 3N9PA 1EYBA 5KXBA 2D5HA 4J6GA 4E2SA 5DAVA 1RMU3 3AZWA 3GALA 2XJVA 4DB5A 1VBC3 4XBNA 4UOJA 4OZXA 4YRDA 2ZHMA 3VBUB 1ACCA 2NQYA 5A3LA 4LUMA 2DVFA 3POIA 4M4RA 3ME2A 1W6QA 2ZX2A 5A3TA 3UK9A 3N9NA 4GMP0 3HQXA 3VBRC 3VKNA 4KU8A 1W04A 2EAAA 4ES9A 3N3HA 5E8AA 4K6BA 4OQ9A 1N1TA 3R4UA 1QF3A 3CF6E 4RQPC 2VQTA 4EN6B 3DPRC 4PDWA 2PHUA 3NMBA 5F7UA 3ZKUA 2KA3A 4YWAA 4N53B 1YNAA 3N9MA 4J1WA 3SNMA 1UY4A 2WNUC 5G04L 4QXKA 5FZ9A 2JXAA 3PVEA 1C8M1 2GP5A 1AYN2 1RTVA 4M3CB 2WKKA 4IE4A 3VBSC 4QWNA 4MGTA 1K5JA 3LEIA 3AXEA 1MS8A 3TRSB 3W20A 3A7QA 5CKMA 1L7RA 4C0BA 4UFHA 2XWBB 3OD0A 3T30A 5L36A 1BXHA 4XF4A 1MS1A 1V6OA 1DBNA 1QXPA 2D6LX 4Y1UA 1OFNA 1OOPB 1ZZBA 1HN0A 4Q8KA 5JI9A 1V6IA 1TMF2 2DWRA 5IK8A 3J4UH 3UESA 2B42B 2BJSA 4IEWA 1SFPA 1XB9A 4IEVA 2H0BA 4FBFA 1QMJA 4GWNA 4QQOA 5K8SA 2WBKA 5AVPA 1CQ9A 5F3GA 4XQ4A 1TNFA 1UMHA 2QZ3A 3MDPA 5DZEA 1KITA 4EROA 4D7SA 5JPMB 1OLMA 2DFBA 2AGSA 2B5HA 2QQOA 4L8QA 1RB8G 2VZVA 4JC1A 3K51A 4LHLA 2QQPA 4CPBA 3PU3A 4P9WA 5FZ6A 3J7MA 4CTEA 5A3NA 1WBLA 5EJ3A 4AQSA 2JE8A 2XL7A 1RXGA 2E9QA 3HT2A 5CISA 2PA7A 1XRUA 3ZXEA 4XJ9A 4M3CF 2E26A 1S4CA 4IEYA 2Y6FA 1PGSA 4OCTA 3OPZA 4QPIB 5LA9A 1MZ5A 4DZGA 4RS5C 1RUH2 4EWEA 1UZWA 3AJZA 4QPGB 4JQTA 4WVZA 2UWCA 3I2HA 4LO6B 4BHPA 1YUDA 3AC0A 2JG8B 1C1LA 4GB32 3TEYA 1GICA 3H1WA 4CU8A 3HMYA 5FUNA 2ORXA 1W9FA 1XSRA 3MIGA 3NAPB 4HSJA 1V9U3 4HOOA 5AFBA 3AP5A 3U11A 5FYMA 4LHNA 3O1UA 4QU1A 3NV3A 1PIV1 4NOTA 2GC0A 2R062 5HI0A 4YPJA 2NMOA 1HIXA 3T2TA 1OKQA 5ERLA 5J48A 1XC6A 4ZPIA 1BMV1 4Z1VA 2VMHA 1OQEA 3JB4C 2MPFA 1UOFA 1DP0A 1PO23 2D6NA 4NRPA 2ID4A 1OD5A 1QJU3 2JDYA 5LASA 4AI0A 1ZBE3 1G9FA 2I74A 2VZQA 1P8JA 3MO4A 1RUI3 1US2A 2OPKA 1ND3A 4GQ7A 4I0WB 3FHIB 1V00A 5CFCC 3JQXA 3H8XA 1ENRA 2VL4A 1QOSA 4X6RB 3GHMA 3IAQA 2VUCA 1SLBA 1X8MA 4ASLA 4Y4RA 1Q8OA 1DGLA 2BTVC 2MNGA 1NT0A 4R4XA 1GMMA 3LZZA 1LOGA 4Q0QA 4DXRA 4FXGB 2GMEA 2QQLA 2VMCA 3KV9A 3BTYA 5IWFA 4FPKA 5D8AB 1AXZA 1UZYA 3IWZA 1G9CA 4CDWA 4P9JA 2DV9A 1HV1A 3UKVA 3M3QA 2JWPA 2RM21 4Q29A 2YBSA 3OGGA 1D4M3 3J26N 3WG2A 3KM5A 3THPA 1R1A1 3HQUA 2P3KA 1WCSA 2A6YA 1UY1A 2Z69A 3WQ1A 2DUPA 4Q4W3 4XDQA 4BYYA 3AKPA 4P5HA 2W47A 5FK7A 4LQRA 2W9XA 4NVPA 4K40A 4NR1A 1W8HA 2GP3A 4P00B 4S2FA 2IC1A 3RZLA 1MS4A 3IKWA 4P02B 3QCWA 4XOGA 3RI9A 3E1F1 5DZGA 4Y4YA 1D4M1 1GKBA 2C9KA 2R0FA 3LA3A 4FTSA 2ERFA 3IIIA 5FXZA 3IPVA 4YZ1A 2A73B 4BQ5A 2ZAAA 5KC6A 1HRV1 4RS5A 2VCAA 1W6OB 3OJBA 2RR13 5D21A 4BQ1A 1ASJ1 1QIQA 2FCTA 3I59B 4RFRB 3ACLA 2CWMA 2YUEA 3RFRA 3C7GA 3IT8A 1U12A 1OURA 4JGYB 3ZX7A 2HWE2 4GAZA 5GLZA 2DF7A 4YFWA 2MEV3 2HH9A 4BB3A 3T0DA 2RHPA 4MG2A 5A7NA 3I7DA 1UNBA 4HVOA 1CJPA 5FBZA 1SPPA 4G3YC 5LY1A 2ZGOA 2JKXA 1HDKA 1V6JA 3ECQA 3MW3A 1COV2 1YCIA 1LU2A 2WZ8A 3A4UA 3O7OA 4PIYA 4CA9A 4XCBA 5JDBA 2LTNA 3E5UA 3POJA 3U0ZA 3QOPA 3TEWA 1DU3D 2ZABA 4J25A 1W05A 2XMLA 1KXGA 3T4VA 2VZTA 5EHDA 4XUTA 5FCCA 3HT1A 2VZRA 3J8F3 1DGWX 1NG0A 2SLIA 5IVJA 3TBDA 4GIQA 1I3HA 1UCXA 4XUOA 4P14A 1ND3C 5CFCA 4JKMA 4W65A 4HSLA 5FDBA 4GJYA 5FMBA 1PK6A 3OGJA 1VPHA 5DG2A 5CADA 2AZ5A 4GULA 4XJ8A 5EV7A 5FZCA 5KHGA 3RSJA 2YROA 3WZ1A 1DQ1A 2IFWA 2W08A 1CAXA 2IZWA 4AEDB 1XBFA 4XUNA 2JB4A 3SEEA 2VMFA 3RYPA 3P3PA 4MXWA 5F5QA 5A1FA 2RVAA 2XONA 4JV4A 3LIHA 3DF0A 3U14A 2DCYA 1CAUA 1IPSA 5DPNA 1VB2A 2ZGPA 3EO6A 5FR3A 3HPNA 4JTNA 5KWRA 3SEPA 2HEWF 2ZGQA 2CL2A 2JKBA 2JDNA 2ES3A 2W95A 4UFIA 2FCUA 4ISRA 4YVWC 3RPQA 3PUSA 4I02A 1UKGA 2VVDA 4I30A 4E27A 4UBGA 2VC9A 4QX2A 1FMD3 1H1MA 1ENQA 1VBD1 3MBWA 2V4VA 1U5ZA 5B4XA 2XWJB 2E6VA 2HWC3 4QMAA 1Y7BA 2WNOA 4I0AA 3UV9A 1V0AA 1H1IA 2BRTA 3A23A 3WQ0A 2W92A 1G7YA 1QJFA 3ZXFA 1ND2B 4QX5A 4UFLA 3RZGA 1Y9QA 1UMZA 1I5ZA 1SFYA 3RG0A 4D7YA 2XKOA 2YC2A 3ETPA 1AR72 4CUBA 2ZS6B 5FZOB 5IVYA 1YO8A 1YEWA 2CGPA 1KJLA 4JX0A 4BMBA 2AYHA 4LEJA 5I8SA 4K3UA 1ZNPA 2EXKA 1JZ3A 3HJRA 5HXVA 4XHXA 2N7GA 4NJ4A 3PL0A 3WNXA 2R0HA 5FYHA 4FVVA 5FMDA 5FXWA 1AR91 3I3BA 2AEYA 3ITQA 4OFGA 2VY0A 3RYKA 1ZREA 3LOBA 2J1UA 2D6KA 2Z4FA 3VV1A 4RGKA 1KJRA 3WG1A 1QDOA 2OZJA 2V5YA 1GWMA 2BERA 3P1IA 4JDNA 3WT3A 1H6YA 1ODNA 1CGPA 3ZVXA 2QBXA 1O3RA 5DG1A 1A8DA 5AVAA 3WP3A 2PHLA 3ZXKA 2IWGB 1ZBA2 2WINB 1LOAA 3LIGA 4A6SA 1ULCA 2YFUA 1NX9A 4NO4A 4O9GA 2DVAA 3ZN6B 5JIUA 1O8PA 3ZYGA 1GWKA 4IUGA 4Q5OA 1LGCA 5APAA 5FUIA 1JYWA 4YW5A 2C24A 4FSJA 4TLFA 3H1YA 4MZUA 4Q1RA 3PUHA 3WNOA 3AMPA 1NQJA 3IDAA 1PK6C 1LRHA 4HN1A 3VBSA 4MHRA 3ZPOA 1CPNA 1BMV2 1H2KA 2P3JA 1SBEA 3D5OA 3VKMA 3ZXLA 3EYPA 4IEZA 3ZDVA 2GMMA 2BUKA 2ZEYA 2J22A 5FZOA 3TYJA 5JXIA 1LESA 5F39A 5ACA2 4DINB 4IE7A 4FQZA 3ZYBA 3ZFFC 1W8OA 4YSFA 2WNEA 1VRBA 4B4QA 1ZRDA 2RS32 4YM2A 2PYTA 2ZEXA 5CEHA 5FOJB 4IW3A 2SBAA 4LIVA 3RZMA 1GOFA 1SLAA 4L0PA 4OULA 3K46A 4ARXA 4COWA 2FHRA 5G05L 4NIGA 3WP6A 3I97A 1LGNA 2FCVA 2NM1A 3RJ2X 1Y9MA 2PAKA 2QE3A 2RR12 5FYBA 3RZJA 2P3YA 4XETA 5J98B 3GM8A 4DQAA 1CD3G 2YGLA 3FHQA 3PJYA 2JDZA 1W8WA 3B5LB 3D3AA 4LLOA 2WSUA 4R9CA 1AXYA 3WDWA 3T1LA 1IS6A 3J9SA 2VH9A 3PVBB 3N9OA 4QKFA 1OXCA 3SQOA 4DO0A 5BNNB 5FPUA 4MHUA 4JDOA 1JMUB 3WNPA 4XJUA 1SHWB 1CIYA 2XHKA 5KBFA 1LHWA 3CJXA 3GNEA 1NA1C 2BW8A 3THDA 3ZYRA 5FLIA 2YZ4A 4PHZA 4IGOA 4IGQA 2P37A 2ZMLA 3O14A 5CFDB 1WGPA 4AEDA 1CAWB 1YYNA 1JZ8A 1UPIA 4GB31 4N43A 2K0GA 3WW2A 3WF2A 4XTMA 5CKQA 3DKWA 2W2IA 1NLQA 2JG9B 3MV11 2VXRA 3AL5A 4QDQA 4GA9A 3RGBA 3AKTA 5FZHA 4AVSA 1J59A 4MO3M 3TNQA 2R043 4PLNA 3K4DA 3EMRA 3O1PA 5FWJA 4NWWA 3AZZA 4CEYA 4QX7A 1WCUA 3R6SA 1VB4A 2ZGRA 1IS5A 5A6YA 3TB0A 3WW4A 4FOYA 4LPLA 2DTYA 1TVGA 2UWBA 3CZJA 4YG6A 2VOVA 3QLQA 4K20A 2BDRA 5DAQA 3WCSA 3CU7A 4ARYA 3ZYPA 1REFA 2XQXA 4ZHNA 4CDQA 5BNPA 1AR73 3TEZA 2JDUA 1WD4A 3A21A 1X82A 5FPLA 3VL8A 4XHBA 1CX4A 3NRUA 3H8RA 1CZSA 3O12A 2G19A 1J84A 4JQRA 1WMXA 4GWIA 4YYOA 1JYVA 1OF4A 1D0HA 1IHMA 1OC1A 3E6BA 4J1XA 4FO9A 1AL23 1RUD2 4RS5B 1JYXA 5DMYA 4WM7A 5JOYA 4AI1A 4TLGA 3I8TA 3LGRA 3OEBA 4E8DA 2CNAA 5LBEA 4Z2WA 3JU9A 4KBZA 5DUUA 2CSGA 2W94A 5CVRA 4M0NA 5F3CA 2JDMA 3U78A 1RJ7A 2UURA 1O59A 4BQ4A 4M3CA 5IVFA 2JENA 1C5IA 3I3EA 3POWA 4LXLA 5E6HA 1VJ2A 4OHZA 3E6CC 3EXUA 2BP6A 2WABA 3VDCA 4AGGA 4FOVA 1Q3EA 4JGZB 1XYOA 5JR7B 5LW9A 3KMHA 3HNYM 3WUDA 1J3PA 3VKFC 1HB2A 3N7JA 4CEYB 5ABJB 1FOD2 1CAUB 1VR3A 4OUSA 3Q9OA 1TE1B 2Y6HA 3I2DA 1GZWB 1RINA 4W50A 1ALYA 1CJDA 3HVDA 1F5FA 1NCRB 1AR63 1KFXL 2PHWA 1DQ5A 2PMWB 3GZTB 1BLZA 3H42B 4QQPA 4YVSC 5IVCA 2FBEA 3IMNA 4MYEA 4YFZA 3NKTA 2D6OX 3ZR5A 2QVSB 1O4TA 5CIRA 5FP3A 5CB7A 1OH4A 5EQUA 1SBFA 5DAXA 4C0HA 1GNZA 1SEFA 4L9BA 1V6MA 3ZXJA 3POEA 5I8YA 1SQ4A 3H50A 3JBG2 4HETA 4HT1T 1TMF1 2Q5TA 1W2AX 2A5ZA 1JZ2A 2ARBA 1UU5A 1KS4A 5DUXA 4AEJA 1Q8PA 4Z8BA 5F2SA 4EN7B 1OVSA 5ACA3 1LECA 3LQCA 5J3UA 1WW5A 3CO2A 4Q0SA 4TWTA 5BNPC 1OH3A 3OGSA 2HKXA 4Q0VA 2BV4A 3WV6A 5F9TA 5GZGA 4QU2A 3MICA 3KHBA 1C57A 3OYWA 3VZOA 3H7YA 5LEJA 2VVFA 3G7DA 2OZ6A 2FZ2A 1VBC1 2Z42A 3AKRA 3M3CA 2FDIA 1CN1A 4RR3A 4FPGA 4QPYA 3CMGA 1BKZA 1A6CA 2VE1A 1Z7S3 2J1VA 5JMCA 1WZXA 2UWAA 4P9YA 3BTXA 1S0BA 3AMNA 2NYYA 4ZONA 3BU0A 3AZYA 1GNHA 3KZ4C 2GNMA 2HWB1 3PIJA 5K9YA 5EXOA 4XABA 1EAH3 4ITCA 4EYUA 2VMGA 2DBIA 4UFMA 3HEIA 1X33A 3LPFA 2QDNA 1QJU2 1X36A 3ZSJA 1OT5A 2ZGTA 4RGAA 2XVGA 1EPZA 3G6JB 3ILRA 1PMIA 3N7MA 2OX0A 1UMIA 4FPYA 1F4HA 2F17A 1UWWA 3DL3A 1NCRC 4HPKA 3S7IA 4EWAA 2PFWA 3FBMA 4WBBA 4CP0A 4QB6A 2K46A 1JOBA 2XBO2 4AGVA 1FXZA 2ZHLA 3ILNA 4HFSA 3ZFFA 3NNFA 1BVVA 3PVOA 4URAA 5I0SA 5KXDA 3ES1A 1V6LA 2CDOA 2RMU3 4NIIA 1YJKA 4LT5A 3WD5A 1HJFA 4E4DX 5FMOL 3SH4A 4CEWC 4EZHA 3J7HA 4EZ4A 3VBFC 2XB6C 5CZKA 1ND2A 4Y5Z0 2AUYA 3HNBM 2K2SA 1LOFC 1L7LA 1ZZCA 3FJSA 1MVEA 4K1ZA 3H0OA 2BNMA 4JTOA 1R091 3OYWB 4UBHA 3Q8EA 2D3SA 5A3MA 3FWEA 3I2IA 4X6QB 1UZVA 3BOWA 3MIFA 3GBWA 4E4HA 1YI9A 1HLCA 4TXWA 2ETEA 3HWJA 1RGSA 2ZKLA 1UXZA 4PDWB 2HWD2 3SKVA 1W90A 3KGZA 5FIXA 4HBNA 1O3SA 2YXSA 5C4WB 1NA1A 4QB2A 3MIBA 4XFFA 2Y33A 1VBB3 1ZVFA 1OBNA 1FPN3 1MQTC 1Y3TA 2WO1A 3OBTA 1RUOA 2NPIA 1OD3A 2RS11 1SDDB 3V0AA 3ZPYA 1RMU1 4CU7A 2O8QA 4IESA 2RM22 1GZ9A 3HNMA 4PCRA 3RYRA 2O1QA 3CZUA 1PZ7A 2MEV1 4BJ0A 1NOVA 4QD2A 5H9SA 4MX3A 3QD6A 4Y20B 5A7WB 3W5NA 3ZSEA 1X50A 4Z82A 2CWSA 2AACA 4QQHA 3ZYFA 1KD7A 2DCTA 5FREA 5A33A 3VHRA 5JCTA 2XLGA 4DRVA 1DDLA 2GC2A 3KF3A 1ZM1A 1QNYA 3AVRA 5IVVA 4NE9A 5J36A 2DVDA 5JAXA 1GP4A 4RR3B 3V0BA 2EICA 3O1TA 1C28A 2P2KA 1V70A 5DXDA 3WW3A 1FOD3 3NKGA 1VIWB 2H0VA 3DXUA 1WKYA 5IW0A 1SZBA 2WQ4A 3LEMA 3MV01 2JICA 4TSVA 3DCQA 4E9KA 3TN92 1RVF3 1SDWA 5FMOS 3W58A 1VE0A 1RUF2 1GQGA 5F3IA
chains in the Genus database with same CATH topology
5F3EA 4V2WA 4Y4RA 4DIQA 4UF0A 5F5IA 3KV9A 4CUGA 5FWJA 3KV5A 2OS2A 5IWFA 5FZGA 4QX7A 5ANQA 4BXFA 2WWJA 5FZ4A 5FZOB 5IVYA 3K3NA 5K4LA 2YU2A 3N9MA 3OPWA 5FYVA 4EYUA 2YBSA 5FZ9A 4C8DA 2GP5A 5A7WA 5FYHA 5FZ3A 4XDOA 4QWNA 5FXWA 5FZ0A 5FYZA 5FZLA 3LDBA 5FY9A 5FPLA 5FYTA 2OX0A 2GP3A 5LWBA 5FV3A 3PUAA 2YU1A 5FY7A 4NUBA 5FJHA 3NJYA 2VD7A 5FY1A 5KR7A 4CSWA 5F2WA 5FXZA 4URAA 3KV6A 3ZLIA 5A3WA 4D6RA 2OQ6A 5FY8A 4EZHA 3AVSA 4EZ4A 4CCLA 2XXZA 5FP8A 5FBJA 3AL6A 4UF0B 5F3GA 5IVFA 2OT7A 4GAZA 3PU8A 5F3CA 5FZEA 3RVHA 3U78A 5ISLA 4D6QA 2YBPA 5FZ7A 4D6SA 4CCOA 4AAPA 4GJZA 5F3IA 5A7NA 4AI9A 4LXLA 5FJKA 3PU3A 5E6HA 5FPBA 5FZ6A 4Y3OA 2YPDA 5A7QA 3PTRB 3PDQA 3U4SA 5A3NA 5LY1A 5IVBA 3PUQA 4E4HA 5F32A 5FXVA 5A1LA 5LW9A 5FZOA 5F39A 5FY5A 3N9LA 5F37A 5FYSA 4QX8A 1VRBA 5FYUA 3OPTA 2XMLA 2Q8EA 5CEHA 5FP4A 3K3OA 4CCJA 5FZAA 3K2OA 4LIVA 5A7SA 5FZFA 4QXCA 3KVAA 4BU2A 5IVJA 5FY0A 5FP7A 5IVEA 4V2VA 5FZMA 3DXTA 3UYJA 4XDPA 5FYBA 5F5CA 3N9QA 2OQ7A 4ASKA 5IVCA 4GJYA 4TN7A 5A7WB 5FUNA 4HONA 5FP3A 3KVBA 4CCMA 4CCNA 5FWEA 5FZ8A 4HOOA 5FZCA 4Y33A 5FYMA 4DO0A 2P5BA 3N9OA 4LITA 4QU1A 5FPUA 2PXJA 2YBKA 5FZDA 2Q8CA 5FZ1A 5FZKA 3ZPOA 3AVRA 5FZBA 5IVVA 5FY4A 5A1FA 5FP9A 4GD4A 5FPAA 2Q8DA 5FYIA 4BISA 3N9PA 5FYCA 4IGOA 5A3PA 5A7PA 4IGQA 5F2SA 5A7OA 2XUEA 5FYYA 5FXXA 2XDVA 4IGPA 3DXUA 5FUPA 5IW0A 4CCKA 5LY2A 3PUSA 3KV4A 5F5AA 4QXBA 2W2IA 4LIUA 3PURA 4QXHA 5A80A 5A3TA 5FZIA 2WWUA 5FPVA 3N9NA 3AL5A 3LD8A 5FZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F3E A;  4V2W A;  4Y4R A;  4DIQ A;  4UF0 A;  5F5I A;  3KV9 A;  4CUG A;  5FWJ A;  3KV5 A;  2OS2 A;  5IWF A;  5FZG A;  4QX7 A;  5ANQ A;  4BXF A;  2WWJ A;  5FZ4 A;  5FZO B;  5IVY A;  3K3N A;  5K4L A;  2YU2 A;  3N9M A;  3OPW A;  5FYV A;  4EYU A;  2YBS A;  5FZ9 A;  4C8D A;  2GP5 A;  5A7W A;  5FYH A;  5FZ3 A;  4XDO A;  4QWN A;  5FXW A;  5FZ0 A;  5FYZ A;  5FZL A;  3LDB A;  5FY9 A;  5FPL A;  5FYT A;  2OX0 A;  2GP3 A;  5LWB A;  5FV3 A;  3PUA A;  2YU1 A;  5FY7 A;  4NUB A;  5FJH A;  3NJY A;  2VD7 A;  5FY1 A;  5KR7 A;  4CSW A;  5F2W A;  5FXZ A;  4URA A;  3KV6 A;  3ZLI A;  5A3W A;  4D6R A;  2OQ6 A;  5FY8 A;  4EZH A;  3AVS A;  4EZ4 A;  4CCL A;  2XXZ A;  5FP8 A;  5FBJ A;  3AL6 A;  4UF0 B;  5F3G A;  5IVF A;  2OT7 A;  4GAZ A;  3PU8 A;  5F3C A;  5FZE A;  3RVH A;  3U78 A;  5ISL A;  4D6Q A;  2YBP A;  5FZ7 A;  4D6S A;  4CCO A;  4AAP A;  4GJZ A;  5F3I A;  5A7N A;  4AI9 A;  4LXL A;  5FJK A;  3PU3 A;  5E6H A;  5FPB A;  5FZ6 A;  4Y3O A;  2YPD A;  5A7Q A;  3PTR B;  3PDQ A;  3U4S A;  5A3N A;  5LY1 A;  5IVB A;  3PUQ A;  4E4H A;  5F32 A;  5FXV A;  5A1L A;  5LW9 A;  5FZO A;  5F39 A;  5FY5 A;  3N9L A;  5F37 A;  5FYS A;  4QX8 A;  1VRB A;  5FYU A;  3OPT A;  2XML A;  2Q8E A;  5CEH A;  5FP4 A;  3K3O A;  4CCJ A;  5FZA A;  3K2O A;  4LIV A;  5A7S A;  5FZF A;  4QXC A;  3KVA A;  4BU2 A;  5IVJ A;  5FY0 A;  5FP7 A;  5IVE A;  4V2V A;  5FZM A;  3DXT A;  3UYJ A;  4XDP A;  5FYB A;  5F5C A;  3N9Q A;  2OQ7 A;  4ASK A;  5IVC A;  4GJY A;  4TN7 A;  5A7W B;  5FUN A;  4HON A;  5FP3 A;  3KVB A;  4CCM A;  4CCN A;  5FWE A;  5FZ8 A;  4HOO A;  5FZC A;  4Y33 A;  5FYM A;  4DO0 A;  2P5B A;  3N9O A;  4LIT A;  4QU1 A;  5FPU A;  2PXJ A;  2YBK A;  5FZD A;  2Q8C A;  5FZ1 A;  5FZK A;  3ZPO A;  3AVR A;  5FZB A;  5IVV A;  5FY4 A;  5A1F A;  5FP9 A;  4GD4 A;  5FPA A;  2Q8D A;  5FYI A;  4BIS A;  3N9P A;  5FYC A;  4IGO A;  5A3P A;  5A7P A;  4IGQ A;  5F2S A;  5A7O A;  2XUE A;  5FYY A;  5FXX A;  2XDV A;  4IGP A;  3DXU A;  5FUP A;  5IW0 A;  4CCK A;  5LY2 A;  3PUS A;  3KV4 A;  5F5A A;  4QXB A;  2W2I A;  4LIU A;  3PUR A;  4QXH A;  5A80 A;  5A3T A;  5FZI A;  2WWU A;  5FPV A;  3N9N A;  3AL5 A;  3LD8 A;  5FZH A; 
#chains in the Genus database with same CATH topology
 1ZYB A;  2XJR A;  3JCI A;  5JSP A;  2Y6L A;  3N7K A;  4YW6 A;  1DCS A;  3ABZ A;  3O0V A;  4YW4 A;  3MLK A;  4FT8 A;  4LJH A;  3R05 A;  3OCP A;  4NRM A;  5C3S A;  4ISQ A;  1NA1 B;  4YZ4 A;  1WW6 A;  1AUY A;  4RL7 A;  1NLR A;  3VBF A;  1GZC A;  3PME A;  2A6W A;  4BXF A;  1PGW 1;  5D8A C;  2VQ0 A;  1FMD 1;  1GNY A;  3CNA A;  1F5J A;  4COZ A;  2V5D A;  1Q8V A;  3D8C A;  4XF0 A;  2WN2 A;  4A4A A;  3ENR A;  3KF5 A;  2JD9 A;  2WT1 A;  2VVE A;  4QX1 A;  5FZ3 A;  4ZXK A;  4AED C;  4M0H A;  3ILF A;  2FMY A;  1URX A;  5GKA C;  3ZFE C;  1W2U A;  4LO4 B;  3ZKY A;  1LHV A;  4GKX A;  1EAH 2;  1C8N A;  3I2K A;  4I3G A;  1F8V A;  5FY1 A;  4NHX A;  3WUC A;  1R08 1;  5CG9 A;  4Q4X 1;  1IS4 A;  1UOB A;  4HKW A;  3VDB A;  2NMN A;  1N3Q A;  1LEN A;  2XGX A;  1KDK A;  2H6C A;  1CR7 A;  2ZXQ A;  2ZOE B;  1BEV 1;  3MFC A;  4Q0P A;  1OPO A;  2IXH A;  5DDJ 2;  3T2P A;  4CCL A;  1JUH A;  5FQ0 A;  4ZZ8 A;  1MS9 A;  4PLO A;  5C8C B;  3KT4 A;  3POY A;  4A44 A;  2W39 A;  1ENX A;  2XOM A;  3ZOI A;  3NNG A;  4A42 A;  2HLE A;  4EWD A;  3ALQ A;  2L9L A;  2FZ1 A;  2YBP A;  4XZP A;  1BYH A;  1DIW A;  1UY0 A;  4CDQ C;  5A7Q A;  1AZD A;  5LAT A;  2DU1 A;  2IXC A;  2D3R A;  2RS1 3;  1AL2 1;  4BQW A;  3OY8 B;  3VKO A;  5JMO A;  1F4A A;  1WLT A;  4IV3 C;  1QOT A;  4WVW A;  1HXS 2;  2OPW A;  2WZR 1;  4JVA A;  3WP5 A;  3B7M A;  3MW4 A;  3P3N A;  4LHS A;  2VUA A;  4BPZ A;  1NAE A;  1T6B X;  1S0E A;  1WMD A;  2GMP A;  1AR7 1;  1KQR A;  5A32 B;  4WM7 C;  1S0D A;  3BIE A;  4FPH A;  2PN5 A;  1VBC 2;  3LEK A;  3UGH A;  5CAZ A;  5DAB A;  2A3W A;  1YQ8 A;  1XNA A;  1HQN A;  3UT0 A;  1XU1 A;  3SCF A;  4AVT A;  4MUV A;  1LR5 A;  4OZO A;  5JPN B;  3I2O A;  2WO7 A;  4OMC A;  1HRI 3;  4ASK A;  4CYD A;  4DNY A;  1LUL A;  1YQ5 A;  3PVN A;  3HQR A;  4CP1 A;  2VMD A;  4XFB A;  1GP5 A;  1H4H A;  1OKO A;  4WV8 A;  1HB4 A;  2BFU L;  4I09 A;  4MGI E;  5SV5 A;  2X5I B;  2XPJ A;  2BWC A;  2C9A A;  2P5B A;  3I3Q A;  3O0W A;  4UFJ A;  5FZD A;  3BB6 A;  3T4H B;  3X29 B;  1FOD 1;  2GNB A;  2WN3 A;  1W9Y A;  1IQA A;  3FZ3 A;  5FZK A;  4AF9 A;  2LW8 A;  4XTP A;  1M06 G;  3IB3 A;  1ZBA 1;  4BWO A;  4LA2 A;  1BQP A;  3F2Z A;  5GJ6 A;  1QJX 1;  5F8P A;  1EV1 1;  1KGY A;  3GJB A;  4R9A A;  1CON A;  1POV 1;  4IE0 A;  3ZSK A;  5C71 A;  1CX1 A;  1JYN A;  5A33 B;  1QGL A;  3EB7 A;  1DYK A;  1AR6 2;  2EIB A;  5IFP A;  3K48 A;  4D0Q A;  5JSO A;  1NCR A;  5FZI A;  1JZ4 A;  1VMF A;  1ZZ8 A;  3M3E A;  4IXL A;  4D94 A;  3VD5 A;  5F6K A;  1UY2 A;  5BV6 A;  2ZX1 A;  3LE0 A;  3WXP A;  2VBB A;  4WZF A;  4XMA A;  1QJY 2;  2VNG A;  3CQO A;  3JBG 1;  4IEO A;  4AHX A;  3KV5 A;  5LB6 A;  4NHM A;  2Y0O A;  2Y6J A;  3ZIX A;  4Q4X 3;  1QWR A;  3ACH A;  3B3Q E;  4FPO B;  2Y0I A;  2D6M A;  1RUC 3;  3QH6 A;  4YM0 A;  1ND2 C;  3LWC A;  1U0A A;  1K12 A;  4HG6 B;  4MAD A;  3IM0 A;  5TSW A;  4AQT A;  4RN5 A;  3T08 A;  2D97 A;  4Q0U A;  5LK7 B;  3VBR B;  5BNN C;  2EID A;  5K0U C;  1K3I A;  4MGY E;  3LB9 A;  3LDB A;  1VAL A;  2A71 A;  4JGZ C;  3BI3 A;  5C8C A;  2PHX A;  3WF4 A;  1FAY A;  2FQP A;  1GBG A;  4YVW B;  3GBG A;  1W9T A;  1COV 3;  4IE5 A;  5FJH A;  3U1X A;  3WF1 A;  1ULD A;  3DPR B;  3MPP G;  3M1H A;  3T1M A;  1VRH 1;  2A3X A;  5LCW L;  4LKS A;  2LM3 A;  2CHH A;  4A45 A;  3B00 A;  4C1X A;  1EPW A;  3I54 A;  1RVF 2;  3NJV A;  4FPL A;  4LBJ A;  1W6P B;  4Q4V 1;  1WCK A;  4PLM A;  5IUQ A;  5LBF A;  5EWS A;  3CDZ B;  4BZ4 A;  2HWF 1;  1ONA A;  2HWB 2;  3OY8 A;  5LBC A;  1LHN A;  2QQM A;  3IDC B;  4DRR A;  1EV1 3;  1RUF 1;  2B39 A;  4TTG A;  4FTE A;  4QDS A;  5FBJ A;  4RGG A;  3FUO A;  1Y4W A;  2VOK A;  3FBY A;  4Q4Y 1;  2ZGS A;  1RXF A;  2GZW A;  1HX6 A;  5FZ7 A;  3ACG A;  4D6S A;  2E7A A;  1MVQ A;  2YC4 A;  1AR8 1;  1IS3 A;  1W8T A;  5GZD A;  1M4W A;  4PQ9 A;  1CZT A;  2VZ1 A;  3SIT A;  2MHF A;  1YFX A;  4JKK A;  5A1L A;  3VB9 A;  3MIH A;  3RS6 A;  4CDX B;  1JHJ A;  1GYK A;  2ZAH A;  1JZ5 A;  4IEP A;  3E5X A;  1YLL A;  3TN9 1;  3RZK A;  1OLM E;  1LNS A;  1UYX A;  1MEC 1;  4FAG A;  5JWP A;  1VAV A;  1W6M A;  2X53 S;  2YFZ A;  3H8O A;  1JHN A;  1VMH A;  1GAN A;  1DYO A;  3IDB B;  4KU7 A;  4ONU A;  3RMY A;  4CEW A;  5J37 A;  1OLQ A;  4QM9 A;  5L9V A;  2VG9 A;  3I2J A;  3HBK A;  1WMF A;  4Q4Y 3;  5IVE A;  4H2A A;  1GP6 A;  4GWJ A;  2ZEZ A;  1QNW A;  1R08 2;  2WSV A;  5FO9 B;  4E2Q A;  4AFM A;  2ARA A;  4HON A;  3MGU A;  4Y20 A;  4IV1 B;  4DUX A;  4BCU A;  1XSQ A;  4NIH A;  1BEV 2;  1COV 1;  1NE6 A;  1W2T A;  3V64 A;  4LE3 A;  1QOO A;  3BPS A;  2JJ6 A;  5JZG C;  3NNJ A;  3MI8 A;  1ZRC A;  4IND A;  5GM0 A;  4HK9 A;  2ADE A;  4ATE A;  2QFE A;  3AMQ A;  4MGZ E;  5E88 A;  5IK4 A;  2RV9 A;  1D0G A;  3C7E A;  5CU1 A;  2RS1 2;  2VTX A;  2VXJ A;  5EZW A;  2BGO A;  2ZMN A;  1RHI 3;  4GMP 3;  2I45 A;  4KGG A;  4XZU G;  1MQT A;  3SIS A;  3LPG A;  1W8U A;  2F4L A;  4Y22 B;  1ZA4 A;  1NKG A;  5FYY A;  4K21 A;  2D6P A;  2W3J A;  1RUC 1;  1PGL 2;  2P6H A;  2XDV A;  4IGP A;  2A6Z A;  4XE9 A;  1JZ7 A;  3WNL A;  1OUS A;  4YM3 A;  1OVP A;  3VKL A;  2QQI A;  1XXN A;  5F5A A;  2RDN A;  4Y1V A;  1UPS A;  4I0B A;  4QXH A;  2V72 A;  4EE2 A;  3B94 A;  1TMF 3;  4B4P A;  4BLI A;  5IAX A;  3GYD A;  3M2M A;  3VD4 A;  5DUW A;  1XNK A;  1PMH X;  4YZ5 A;  5BNO A;  1O5L A;  1O91 A;  3WG3 A;  2ILM A;  4XUP A;  1VBD 3;  3VHO A;  4Q27 A;  2Q0A A;  4AFD A;  4UAP A;  1AYN 3;  1LTE A;  4CEW B;  4QQ2 A;  4NRO A;  3UL2 A;  4K8F A;  2KM2 A;  2RS5 2;  3O1O A;  3O1V A;  5CNA A;  1CVN A;  3OUH A;  3QBQ A;  4Y1Y A;  5ABJ A;  5C4W C;  3BOP A;  1QJY 3;  4RA0 A;  5BXX A;  2VOX A;  2IXK A;  4XDO A;  4DXT A;  2BFU S;  2WL1 A;  3FLT A;  1K42 A;  5FY9 A;  4IEU A;  4GH4 C;  5I8T A;  1IQD C;  5CA6 A;  5FRA A;  4BDV B;  1AJK A;  1STM A;  1O8S A;  2VTF A;  2ZA9 A;  3PUA A;  5FV3 A;  4CP9 A;  1RUH 3;  4YLZ A;  3IAP A;  4OI4 A;  4QKD A;  2A6X A;  3VZN A;  2RDQ A;  3CKH A;  3ZN5 A;  4FP2 A;  5KR7 A;  3CHX A;  5J09 A;  3WY6 A;  3WW1 A;  2RDR A;  4WM8 B;  1J1L A;  1O7F A;  2R06 1;  1KFU L;  1RUJ 3;  1OUX A;  5D8A A;  1GU3 A;  3D6E A;  4CP2 A;  5C70 A;  1U5X A;  4NID A;  4WVM A;  3GCX A;  4F7Z A;  3MW2 A;  3FUQ A;  5FZE A;  5C3P A;  4IV1 C;  4A2U A;  4IEQ A;  4HLT A;  2HWB 3;  5T50 A;  4XJW A;  2RJL A;  2R06 3;  2BZD A;  3KS7 A;  3OB8 A;  1EV1 2;  1X9T A;  5FJK A;  2OYZ A;  3VDD B;  3U4S A;  1BK0 A;  4JKL A;  2RG4 A;  2XVL A;  5F32 A;  3VBO B;  2VUJ A;  3LFM A;  5KHJ A;  4LO8 A;  2X10 A;  3Q8B A;  5SV8 A;  3H3U A;  3ST7 A;  1GQH A;  3IPV B;  3IMM A;  2HBU A;  5F37 A;  3I49 A;  4GB3 3;  3N4M A;  2Q8E A;  1DLL A;  2Y64 A;  5FK8 A;  5GLW A;  3SC7 X;  4OUM A;  3POB A;  4PF5 A;  3FC0 A;  5FZF A;  4H3W A;  2BOI A;  1QJY 1;  5F6L B;  4AQ2 A;  3AMH A;  2QJV A;  2R6Q A;  3BVC A;  3UJO A;  2FDK A;  2J42 A;  4B7E A;  1FT9 A;  3KB5 A;  3NQH A;  2WRA A;  2UYB A;  3M7A A;  4KWL A;  4H7L A;  1W03 A;  2D43 A;  4AI3 A;  5L7O A;  3GBF A;  5DUV A;  2E7Q A;  4XVH A;  1MZF A;  1MS3 A;  1PHM A;  2VTX J;  1R08 3;  3B01 A;  4AVB A;  1HXS 1;  2WZR 2;  1D4M 2;  2F6B A;  1H9W A;  2UU8 A;  2BBV A;  1ZBE 2;  4I01 A;  2RS3 1;  4IV3 A;  1RUI 2;  2ZGK A;  2Q8D A;  4NHL A;  1UQX A;  2ARX A;  2XHN A;  4OLL A;  3OOX A;  3N7L A;  3IN9 A;  1H2L A;  1F9K A;  5HCB A;  1UOJ A;  4Y5T A;  3DN7 A;  4URT A;  4HK8 A;  1XE8 A;  2DU0 A;  3K4A A;  3OBR A;  4YW7 A;  3ZN4 A;  5BNN A;  5K0U A;  1VBA 1;  1RVF 1;  4Q4V 2;  4K7J A;  3AFG A;  1PIV 2;  1UYP A;  4JGZ A;  5DAP A;  5IFT A;  2CGO A;  4E2G A;  5FPV A;  5CFD A;  1YXW A;  5C9A A;  2RJ2 A;  2UYA A;  4FOW A;  2J7M A;  4XPV A;  3GZA A;  3H9A A;  1W6M B;  1PVC 1;  1NY7 1;  1FV2 A;  2D3P A;  1JYC A;  3RI8 A;  1LJ7 A;  3WQB A;  3MLL A;  5H9P A;  1UXX X;  1MR5 A;  3R0R A;  1O3Q A;  3BOD A;  5EJ1 B;  4BIO A;  2VOW A;  1O4Y A;  3ACI A;  3Q8F A;  4WVV A;  2B4K A;  3JQW A;  3W9A A;  1AVB A;  1NCQ B;  1DFQ A;  3B69 A;  2WNV B;  2AC1 A;  5JR2 A;  1CZV A;  1WLD A;  4LA3 A;  1ZA7 A;  1ENS A;  3HIF A;  1JN2 P;  2JDA A;  4COY A;  1XNC A;  1Z7S 1;  1TME 2;  2W91 A;  2RS5 3;  2D98 A;  3FFZ A;  5FKC A;  2ZPX A;  3NAP C;  5BY5 A;  2C5D A;  3TN9 3;  1RUJ 1;  1WME A;  3WOG A;  1ZRR A;  4K8R B;  5BNP B;  4Q1P A;  4LBK A;  5I93 A;  5IK5 A;  1V9U 1;  1WA4 A;  5IAT A;  4ZU4 A;  2Q30 A;  2VEC A;  2QCS B;  4RHV 2;  1PVC 3;  4XF1 A;  1V6K A;  2W1S A;  1W6O A;  3H3L A;  2W1W A;  2WFF 2;  5FQ0 B;  1CAV A;  2G1M A;  4QPG C;  5A3W A;  3ASI A;  4AEM A;  3C8X A;  4C91 A;  5FO8 B;  4FTB A;  4XBQ A;  1I5P A;  1POV 0;  2BWA A;  2P3I A;  1HB3 A;  3NJX A;  1WBF A;  2ORZ A;  2DVG A;  2J1S A;  2QUO A;  2VCC A;  4BQ3 A;  1H2N A;  1H6X A;  1QQP 3;  4UF0 B;  1H4G A;  2ZZQ A;  3DUI A;  2OT7 A;  2AR6 A;  3O0X A;  4FPF A;  3GGL A;  3N35 A;  1OMI A;  5T52 A;  2D7F A;  4CCO A;  3BKZ A;  1K45 A;  3KQR A;  4PBP A;  4OMD A;  4AOC A;  4EQV A;  3RMX A;  4Y1Z A;  4DY3 A;  2LAL A;  5JZG A;  3RNS A;  1QJZ A;  2BNO A;  3O1S A;  1MPX A;  1YIP A;  1R1Z A;  2HWE 1;  2ATF A;  1JUI A;  3W5M A;  2HWF 2;  5T5J A;  3P6B A;  1DQ0 A;  2YG0 A;  1LAJ A;  1WW7 A;  5FP4 A;  3Q8C A;  3OSD A;  4YNI A;  5ANN A;  4IE6 A;  4Y5S A;  5FZA A;  5A7S A;  1AL0 G;  4PIZ A;  1VBE 1;  4QXC A;  4YGB A;  1H2M A;  2VCM A;  2BGP A;  5C7G A;  2WWS A;  5FPX A;  1NXD 1;  4PQQ A;  4ATF A;  5F5C A;  2RS5 1;  1N3O A;  3MF6 A;  1UIJ A;  2E31 A;  3VUO A;  5BNO C;  4XFI A;  1AX0 A;  5JXJ A;  5LK5 A;  2XL9 A;  4RR3 C;  3RWN A;  3WDY A;  4LIT A;  3S5Q A;  1Z78 A;  2IVI B;  4XIL A;  2WO3 A;  1YQ2 A;  3HBZ A;  1MQT B;  1OPM A;  2V4A A;  5C5U A;  4FPJ A;  4XQW A;  2WNV C;  2WS9 2;  4ZS3 A;  3SKJ E;  1A3K A;  5HCF A;  1ULE A;  2JEM A;  4N7U A;  5C3R A;  2DTW A;  3EBR A;  2GH8 A;  3K77 A;  2ZGM A;  4YGD A;  1PX3 A;  1OFS A;  4KMQ A;  1O5U A;  3ZXD A;  3KCY A;  3BCW A;  3KHC A;  1YQ6 A;  1UY3 A;  5T3N A;  3AB0 A;  3OG2 A;  1PNG A;  3PUR A;  1ZBA 3;  2EA7 A;  4KG8 A;  4A7K A;  1FNZ A;  1TQ5 A;  2FDG A;  3I3M A;  3FLP A;  1JU4 A;  3O1M A;  5HCH A;  3S30 A;  4TYS A;  1YHF A;  4KGQ A;  1GZW A;  1UYY A;  3WNN A;  1C8M 3;  2RMU 2;  2PAE A;  1Q5O A;  4FXK B;  1RHI 1;  4GMP 1;  4AXO A;  1I6X A;  3B9I A;  2WDB A;  2OW4 A;  4W6X A;  5A3U A;  1J83 A;  2WUH A;  3C2U A;  3OPW A;  5BNQ A;  1UU4 A;  1T2X A;  3CJI A;  4Q4W 1;  4A3Z A;  1VMJ A;  3L2Y A;  4C8D A;  3AP7 A;  1LOF A;  2VO5 A;  2EXJ A;  1SMV A;  2CY6 A;  4MXV A;  2VR4 A;  4ORF A;  5A7W A;  1KRI A;  4YGE A;  3WLU A;  2DBN A;  3QAC A;  2G4I A;  3RJR A;  4DUV A;  2XJP A;  5FYZ A;  1J1T A;  1S0F A;  5J1X A;  2WT0 A;  1PMJ X;  1XE0 A;  2W1U A;  4TZD A;  1NYW A;  2LRO A;  2JE9 A;  3VN4 A;  3NVC A;  3VHP A;  2J1R A;  2VD7 A;  3LAG A;  2VZ3 A;  1IG0 A;  4F83 A;  2QQU A;  3N36 A;  2ZZJ A;  4QDR A;  2YC0 A;  2G9F A;  3VBH A;  3PIG A;  5C5T A;  1AR9 2;  2VCB A;  2CYF A;  2VNO A;  2Y6G A;  5FY8 A;  3VGI A;  4BH9 A;  4NHK A;  4BLJ A;  3USS A;  3ZM8 A;  2RM2 3;  4HKO A;  4CUA A;  3AL6 A;  1UZZ A;  1W6N A;  4G9S B;  4MGS A;  2J1E A;  3DGT A;  4Q26 A;  3IDE A;  3EHK A;  3TOJ A;  3ZR6 A;  1O3T A;  4MGK E;  4JCK A;  1S55 A;  3VZJ A;  4GJZ A;  3NWK A;  4CPB D;  3VD9 A;  2A7A A;  3NL1 A;  4LBO A;  3PTR B;  4DUW A;  4GH4 A;  3S5A A;  4CDQ B;  5I0D A;  4AG4 A;  5FXV A;  4N53 A;  4COU A;  2O8O A;  3LA2 A;  3MIE A;  4HAN A;  4P9L A;  3AP6 A;  1EP0 A;  3BTA A;  2IVJ A;  3CJI B;  3D0S A;  2TNF A;  3DYO A;  1W2O A;  4HVQ A;  4OUE A;  2GC1 A;  1DF0 A;  1UF2 C;  3CIH A;  1RUG 1;  1RJ8 A;  3WSO A;  4FCA A;  1RUJ 2;  3FHA A;  4NWV A;  2DFC A;  4D69 A;  3K4Z A;  4OQ8 A;  2RE9 A;  1NY7 2;  4B1M A;  1AYN 1;  4QB1 A;  5JIA A;  1W8F A;  1LHO A;  2WC2 A;  4GWM A;  4XDP A;  1RUE 1;  4QKN A;  3GHN A;  3WEZ A;  5T54 A;  4IV1 A;  4LOS A;  5IT6 A;  4JRA A;  5C9A C;  4W8J A;  2HYK A;  4CCN A;  3D0J A;  1E5S A;  4UXA A;  4E4S A;  2Z79 A;  4Y33 A;  1MS0 A;  1Z7S 2;  1N3P A;  2EXI A;  3IIA A;  4KI5 M;  5GLT A;  1UU6 A;  3K75 B;  2IXJ A;  4LKF A;  4Q2F A;  1XNB A;  2ZKN A;  2VW2 A;  2D40 A;  3FMG A;  2W52 A;  3DYP A;  3S7E A;  3CJI C;  1H8V A;  2W0X A;  4BIS A;  2WJS A;  1V9U 2;  4B29 A;  1JZ6 A;  4AVA A;  1UYZ A;  1YIF A;  4M4P A;  4HN0 A;  3ZYH A;  2PLV 1;  2ZTN A;  3O5S A;  4A6O A;  4AGR A;  1PK6 B;  4LR4 A;  4CCK A;  5AFE A;  2C4X A;  2FDJ A;  4XC9 A;  2GN7 A;  1SLL A;  2W68 A;  4AE2 A;  3ZFE A;  4HZF A;  4LIU A;  2PHF A;  3KSC A;  2XJT A;  3U37 A;  4DOU A;  2ENR A;  2WWU A;  1GSL A;  3JD7 2;  3KT1 A;  1AR8 2;  2ET1 A;  3U4X A;  1JTZ X;  3M3O A;  4DY5 A;  1BEV 3;  4N9H A;  3U07 A;  2D5F A;  2PLV 3;  3BN6 A;  3WNK A;  2P34 A;  3WIN E;  3BYW A;  2BVB A;  4N8M A;  5BPX A;  2GSY A;  2OS2 A;  3O1R A;  3RQ0 A;  5FZG A;  1LOB A;  3I59 A;  3WG4 A;  5A32 A;  1GOH A;  3VBO C;  4YAR A;  2P17 A;  4LE4 A;  4AHW A;  3OBZ A;  3Q8A A;  5IK7 A;  1WLC A;  2PHR A;  1GUI A;  3VBH B;  5FYV A;  4ZZ5 A;  4BQX A;  3VDD A;  3POF A;  5JI7 A;  3LDK A;  4CCC A;  2WS9 3;  4MSV A;  3C7H A;  4HVR A;  2Q1M A;  4Q4V 3;  4BM8 A;  2ZX3 A;  4JZR A;  1FI2 A;  4XBL A;  4YW2 A;  1CES A;  2VQU A;  2WT2 A;  4ES8 A;  4GZ9 A;  3TNP B;  4D7T A;  1AX2 A;  3WHT A;  3NJY A;  4BK5 A;  3B02 A;  4V1P A;  1YQC A;  1L7Q A;  4AFB A;  4WM8 A;  4NPL A;  2PEL A;  4N9I A;  1UN1 A;  3INA A;  1VBA 3;  2VBD A;  4JHT A;  3VZL A;  3AKQ A;  4PI0 A;  1S2B A;  5FPZ A;  4UFK A;  4JDM A;  3THC A;  1A78 A;  3PJQ A;  1DG6 A;  2QQV A;  4QGN A;  3ZFG C;  1UAI A;  5LRS A;  1SCR A;  1SLT A;  1GLH A;  3VHN A;  1B35 C;  1V6N A;  5E16 A;  3JB8 A;  4UW6 A;  1AX1 A;  4XJZ A;  3MF9 A;  4PBO A;  1UIK A;  1ST8 A;  2QDR A;  5DAW A;  4C1W A;  4ASM B;  2WQZ C;  1MEC 3;  2Z5W A;  5T5P A;  1DGW A;  1W9S A;  1RUG 3;  2WZP P;  1ULF A;  4FFI A;  4XFG A;  1G9B A;  4Q4W 2;  5K7P A;  2A3Y A;  1F35 A;  2WFF 1;  4OHX A;  3ZYJ B;  4AL9 A;  1D2Q A;  1W0N A;  2VMI A;  1LCL A;  2R32 A;  4GKY A;  3WF0 A;  5C8W A;  1JYI A;  2GND A;  2DDU A;  2E7T A;  2X8K A;  5I0U A;  2KXL A;  2VME A;  1Y43 B;  4MH0 E;  1S2E A;  1A34 A;  1YWK A;  4CDU C;  4M3C E;  1LB2 A;  2CU5 A;  4P9G A;  4EN8 B;  3GXU A;  3LEG A;  3L2H A;  2OQ7 A;  4ZY9 A;  4NAO A;  4TN7 A;  2HBT A;  4CRQ A;  1U5Y A;  4CCM A;  1BBT 2;  3PNA A;  1XPW A;  2R16 A;  1TNR A;  1XOY A;  4P9I A;  2XBO 1;  4UWD A;  4CDW B;  2PXJ A;  2YBK A;  4FPC A;  1JXN A;  3MFA A;  4QHB A;  4R9B A;  1VP6 A;  3AYC A;  1IG3 A;  2AEN A;  3RZH A;  4L11 A;  4QPW A;  5EFU A;  4AR2 A;  1W39 A;  5FY4 A;  4GD4 A;  1NCQ C;  1RC6 A;  5GAL A;  1CAX B;  4FP3 A;  5FMC A;  5A3P A;  4HKL A;  3VDD C;  5HV4 A;  3S0M A;  3KD4 A;  5L19 A;  4YZ3 A;  2VU9 A;  2OA2 A;  4OI1 A;  3WDT A;  4AFC A;  3VDA A;  1G8W A;  3AZV A;  2GC3 A;  4CCE A;  5C8C C;  1C1F A;  3UGF A;  1ZRF A;  4IET A;  5DQ0 A;  1HRV 3;  1WW4 A;  4CXX A;  3J7L A;  1E5R A;  2C1F A;  2YPJ A;  1DZR A;  5AC9 2;  3NO8 A;  4QPI C;  4WM8 C;  4BME A;  2B8M A;  3LKJ A;  4UF0 A;  4Y24 A;  4EJR A;  2Q1Z B;  4Z07 A;  3NNL A;  1UO9 A;  3AX4 A;  1Q56 A;  4CEY C;  2WWJ A;  5FZ4 A;  3EQE A;  3ZN6 A;  1YFW A;  2YGM A;  2YYO A;  5FOB B;  1NZC A;  5GZE A;  1LHU A;  1PO1 1;  2HWC 2;  2QNK A;  5JZG B;  2QQW A;  2FDF A;  4NN0 A;  4Y1X A;  4GH4 B;  2G9G A;  1RMU 2;  1US3 A;  3ZIW A;  1ZZ7 A;  3RRD A;  1XQN A;  4SLI A;  1AF9 A;  3AYD A;  5HPO A;  1HV0 A;  5I0R A;  5E89 A;  1NQD A;  1HRI 1;  1SPP B;  5DN2 A;  1A8M A;  2P1B A;  2HWD 3;  4OHW A;  2VUD A;  3M3I A;  2LRP A;  3AM2 A;  1KDM A;  4N7I A;  4XXA A;  1QU0 A;  5LWB A;  1T6G C;  2ZAC A;  4CDU B;  3ZMO A;  1FYU A;  5J7M A;  1GFF 2;  1JU3 A;  3UKT A;  1GQP A;  1C4R A;  2I07 B;  2X29 A;  3MUY 1;  3QH7 A;  1CWP A;  2VZO A;  1UX7 A;  2ZJC A;  4QQL A;  1PM4 A;  5A3O A;  3IBM A;  3S57 A;  1QJU 1;  4P5Y A;  2G9Z A;  1ZZ6 A;  4JHZ A;  1H30 A;  5A70 A;  2BVV A;  1RUI 1;  2PAM A;  1XE7 A;  3DPR A;  1RUH 1;  4PDW C;  1F31 A;  1UW8 A;  3AYA A;  3JZV A;  4H55 A;  3M70 A;  2XXZ A;  4XIO A;  5L9B A;  3SH5 A;  4XFC A;  3UGG A;  4CDU A;  4KWU A;  1PO2 1;  4E4Z A;  4F8A A;  2UY8 A;  1SBD A;  1JW6 A;  5FTT C;  3RVH A;  1VBA 2;  3THT A;  5C3Q A;  2IXL A;  4R8H A;  4HPK B;  1PZ9 A;  2WYF A;  1AYM 3;  2BU9 A;  1W9W A;  1FNY A;  3AJY A;  3LFI A;  2VOT A;  4BQY A;  3I4I A;  1FX5 A;  3S6P A;  3PUQ A;  2VUL A;  5FLJ A;  2WA3 A;  3LSE A;  1S0I A;  2GU9 A;  4NAM A;  1LGB A;  3FN9 A;  1OF3 A;  1DZT A;  1TZO A;  2RR1 1;  3EJK A;  4R52 A;  1D2S A;  2W5F A;  3VLB B;  5JOW A;  2WQ8 A;  1X8E A;  2BGC A;  4HL0 A;  4FFF A;  2ET7 A;  5CBL A;  1JYT A;  3F95 A;  3OBA A;  4Z92 B;  4YW3 A;  3DEM A;  3PLQ A;  4QT6 A;  3WDU A;  1BVP 1;  3OF1 A;  4FI9 A;  1OSG A;  4PI2 A;  3E5Q A;  4AI2 A;  1R09 3;  3C3V A;  2JG9 A;  2K9Z A;  2UY9 A;  1QHD A;  3DXT A;  4XFA A;  2NZ9 A;  3WNM A;  3SCH A;  3L9J T;  5KHK A;  4LBM A;  1VBB 1;  1CAW A;  5K0U B;  5EYY A;  1OQD A;  1ZRI A;  2BYV E;  1OLR A;  4A3X A;  4A7Z A;  3A0N A;  1W8N A;  1YFU A;  2RDS A;  3SCG A;  2ZEW A;  4YW1 A;  3T0B A;  4N53 C;  3HN3 A;  5EJZ B;  5FZ1 A;  4ZXE A;  5T55 A;  2Q8C A;  3RDI A;  2YY1 A;  5LA0 A;  1RL3 A;  5H9Q A;  5KHH A;  1MEC 2;  4X8N A;  3V0A B;  3I3D A;  4ZKT B;  3A22 A;  3H1M A;  3MHZ A;  2FD8 A;  1RUG 2;  2HEV F;  4LBN A;  4MET A;  2W87 A;  5ABJ C;  5C4W A;  2QZ2 A;  2EF6 A;  4KBB A;  2CV6 A;  2O14 A;  4MOA A;  4OHY A;  3KWV A;  3T2Q A;  1SG3 A;  1J3R A;  4AQ6 A;  3J8F 2;  1R1A 2;  4LK6 A;  2OXB A;  4AI8 A;  3UNP A;  1NLS A;  5FLH A;  1N1S A;  5DZF A;  5JOZ A;  4B8E A;  4OYU A;  3E97 A;  3VD7 A;  1WCD J;  5EYX A;  3VBU C;  2VNV A;  4V2W A;  2LUW A;  1BHG A;  4RYD A;  5A1A A;  1FV3 A;  3HAG A;  5ACA 1;  5F5I A;  4WZC A;  1UOG A;  3WCR A;  1MZE A;  4QX3 A;  4CUG A;  2AH2 A;  2VW1 A;  4GXL A;  2VNR A;  1OOP C;  5T5O A;  4BOW A;  3SMH A;  5LZ6 A;  1BBT 3;  1FPN 1;  1S0J A;  4XXP A;  4CCD A;  2R04 2;  4UW5 A;  2NN8 A;  5LEK A;  2X09 A;  2VJX A;  1PGL 1;  1B35 A;  1BBT 1;  1VRH 2;  4XF3 A;  2XG3 A;  2ARE A;  1WCQ A;  2WLP A;  3MYX A;  3NV4 A;  1G86 A;  1RIR A;  4G4F A;  2B9V A;  1VAM A;  3APB A;  3AXD A;  1CIW A;  2YDE A;  2XLA A;  1DQ4 A;  4UW3 A;  4Q8L A;  3M4F A;  2WFP A;  1FMD 2;  5FY7 A;  1BK1 A;  4PT6 A;  1W3X A;  2X05 A;  5JVV A;  2E63 A;  4XFH A;  4JGY A;  1B09 A;  5GLV A;  3RZZ A;  1GOG A;  1NUK A;  1QY4 A;  1OHF A;  2XR4 A;  3WDX A;  1PX4 A;  3UKN A;  2R07 2;  2QQK A;  1RIT A;  2EXH A;  3VBO A;  5C33 A;  1Q8Q A;  2Y8K A;  3KT7 A;  1QJX 2;  4LKD A;  3M8L A;  1EAH 1;  3GJA A;  3ZXG A;  5A6X A;  4S2D A;  5B2G B;  1PM7 A;  1XU2 A;  4OI0 A;  2F4P A;  2DCJ A;  2ZHN A;  2PHD A;  2CDP A;  3WDV A;  3ROU A;  3PU8 A;  2YHJ A;  2DVB A;  2W1Q A;  3MLJ A;  1XYP A;  4SBV A;  3SLI A;  2FDH A;  1AR6 1;  3LA7 A;  3KQ4 B;  3OUI A;  1HQL A;  5L7O C;  4I3P A;  1ND3 B;  2ZCW A;  2KR2 A;  1SLI A;  2QQN A;  1PO1 2;  2HWC 1;  4C90 A;  1LED A;  3I2F A;  4U36 A;  3CL1 A;  2R1B A;  1JOJ A;  2BQP A;  1NCQ A;  3ZMN A;  2RMU 1;  2ZX4 A;  1RHI 2;  2DUQ A;  1HRI 2;  5FYU A;  1AR9 3;  5AC9 1;  4CCJ A;  2JDP A;  2P4E A;  1GZT A;  3BU7 A;  2GN3 A;  4HXC A;  4AHY A;  1AL2 2;  1RUD 3;  2TBV A;  1E5H A;  4HMZ A;  4UYB A;  4YVS B;  1W6Q B;  2C26 A;  1XJA A;  3AMM A;  3T2O A;  3VZM A;  1APN A;  5CFD C;  3E6D A;  4QGL A;  2BBA A;  3AK0 A;  5D1I A;  3VBU A;  3FLR A;  4PF1 A;  2C0Z A;  1WUV A;  5KXE A;  5D2A A;  1VBD 2;  1DGR N;  3ELN A;  2NLR A;  1RUC 2;  4FQ4 A;  3PUI A;  4O61 A;  1DYP A;  1DHK B;  2E51 A;  4YGC A;  2PTM A;  5FKB A;  2JB8 A;  3NST A;  3SHR A;  3BTZ A;  3HOB A;  2XQR A;  1XND A;  1DLC A;  2JIG A;  1RYY A;  2JEC A;  5A7P A;  2RS3 3;  3ETQ A;  2XJU A;  4BE3 A;  2B9U A;  5I91 A;  2XUE A;  3NV2 A;  1TG7 A;  5HBA A;  3DYM A;  5EPA A;  5FUP A;  1TME 3;  3KCC A;  1IKP A;  1QXR A;  2C6S A;  3FL7 A;  3NAP A;  2V73 A;  2AEZ A;  4QXB A;  2VPV A;  5F1R A;  1J58 A;  4DFS A;  4L2N A;  1FAT A;  2HEY F;  4RHV 3;  5F3E A;  3KGL A;  2Y6K A;  4LBQ B;  4DIQ A;  2VGD A;  2VW0 A;  3FE5 A;  1UKR A;  2GAL A;  4QPG A;  4ET7 A;  1IKQ A;  2WZE A;  3ORJ A;  2EVX A;  4F3J A;  4L99 A;  2J1T A;  5ANQ A;  5GLU A;  3ZSL A;  4CDX A;  3GDB A;  4EV0 A;  2YU2 A;  3U75 A;  3AP4 A;  1CAV B;  4QHZ A;  3SXW A;  2Q8O A;  1ULO A;  4CVU A;  2OII A;  2ZMK A;  3JBG 3;  4LKE A;  3HD8 B;  2OVU A;  4BXS V;  1J3Q A;  4CE8 A;  4YVW A;  4B1L A;  1RUE 2;  3W21 A;  2Y38 A;  5FYT A;  3NJZ A;  1QXJ A;  5JLV A;  1GWL A;  2YU1 A;  2DCZ A;  1DZQ A;  2ZX0 A;  1R1A 3;  5JXH A;  1JI6 A;  3URF A;  2BPA 2;  3NV1 A;  4QPI A;  4CSW A;  1OI6 A;  3MPB A;  4D3W A;  1AHS A;  3OEA A;  2Y34 A;  1KEX A;  3R4S A;  3C7O A;  1QKQ A;  2OQ6 A;  3VBF B;  2A75 A;  2OUJ A;  4LO5 B;  2DUO A;  3PHM A;  5FAX A;  5KHI A;  1H8T A;  1CPM A;  2KD7 A;  4QHO A;  1GV9 A;  2RJK A;  2JG9 C;  1PVX A;  2VBP A;  1D7P M;  1PZ8 A;  2HWD 1;  2XH6 A;  2DYC A;  5ISL A;  4XAA A;  4CZS A;  4D6Q A;  3GZE A;  4XYX A;  3C7F A;  4QX0 A;  4W6W A;  1HW5 A;  2EIE A;  1ODM A;  3VD3 A;  5FPB A;  1KS5 A;  2YB7 A;  4Y3O A;  2WII B;  2R04 1;  1EUU A;  4N43 B;  4RHV 1;  3H3Z A;  2D93 A;  2WZR 3;  4AVV A;  2GH2 A;  4AFA A;  4KG0 A;  4KQ7 A;  4Q4Y 2;  2WNV A;  4FAH A;  5C3O A;  4BIF A;  1OA3 A;  1UD1 A;  4XIK A;  4KH9 A;  1HN1 A;  1REE A;  1S0G A;  3FFQ A;  1LOD A;  4L97 A;  5IHR A;  2BOJ A;  4KNC A;  3K3O A;  1JH5 A;  2A70 A;  3BPZ A;  5BNO B;  1PO2 2;  4IEX A;  1NXM A;  4AYU A;  4L92 A;  4RQP B;  1ZZ9 A;  5T5L A;  1VLN A;  3AP9 A;  4R4Z A;  3T0A A;  4DXS A;  5FZM A;  2R07 3;  1OQ1 A;  1YRZ A;  1QH7 A;  1ZBE 1;  5L7O B;  1UX6 A;  4NMI A;  5L9R A;  2VZU A;  3WR0 A;  1FPN 2;  2EAL A;  3H8U A;  4FFH A;  4KWJ A;  2BEO A;  3ZSM A;  4LHK A;  3ATG A;  3USU B;  4XF9 A;  1AYM 2;  2IFR A;  5FWE A;  3ZFE B;  4BK4 A;  5FZ8 A;  4CUC A;  2WA4 A;  4FFG A;  4CU9 A;  2R1D A;  1XYN A;  4RQP A;  4YG3 A;  4K1Y A;  4AW7 A;  4Y22 A;  4U2A A;  1ULP A;  2CAU A;  3D4K A;  4H7M A;  4M00 A;  5FPA A;  5JOX A;  1ASJ 2;  3LCP A;  4NHY A;  5JUV A;  1POV 3;  5FYI A;  3V65 A;  3A0K A;  4B4R A;  4LBQ A;  4ZS2 A;  2X5I A;  4IV3 B;  5FYC A;  5LBB A;  2CGN A;  3AZX A;  5BYN A;  3T3Y A;  3LSD A;  1WLW A;  4LBL A;  1QQP 1;  1S0C A;  1Z0H A;  2Y26 A;  1R09 2;  1VBB 2;  3ON7 A;  5E1R A;  3JXS A;  5KXC A;  2GNT A;  2DCK A;  4OHV A;  1WWY A;  2HYX A;  3DKQ A;  2TUN A;  2JE7 A;  1X7N A;  3MZH A;  3VBS B;  4JRL A;  2WYS A;  2YV8 A;  4JGY C;  1SCS A;  4YM1 A;  1LKN A;  4M01 A;  2OKX A;  4WVM B;  3VBH C;  1SAC A;  1BJQ A;  2GAU A;  4XQD A;  1VBE 3;  3GZU C;  4LK7 A;  2E33 A;  2WS9 1;  4A7Y A;  4EN9 B;  2QTW B;  5H9R A;  1HB1 A;  2ZGL A;  2IUW A;  3AKS A;  3ACF A;  1H8T C;  3AYE A;  4CU6 A;  3UET A;  3NNM A;  4GAL A;  4RD7 A;  4S2H A;  2HWE 3;  4LOT A;  1YC6 1;  2ZGN A;  2MEV 2;  1MZ6 A;  3POG A;  4DEQ A;  4NRQ A;  4UW4 A;  4IQP A;  4CXY A;  4CXW A;  4N43 C;  4W4Z A;  4YZ2 A;  3LDR A;  5FYS A;  1PNF A;  3I2G A;  2WNU B;  1K5M B;  2Z2S B;  1HQW A;  1W06 A;  4YG0 A;  3WVJ A;  1RUN A;  4X8P A;  1U5I A;  3CEW A;  5EP9 A;  2WAA A;  4IDZ A;  2JG8 C;  5AC9 3;  5BUV A;  1IOA A;  4WM7 B;  5IAV A;  1G6N A;  3KV6 A;  2JD4 A;  4ZU7 A;  4AHZ A;  5A6Z A;  1RUF 3;  4QGM A;  2B45 X;  2BNN A;  1IPJ A;  3PTY A;  1OOP A;  4LUL A;  3ES4 A;  4XW3 A;  5FO7 B;  3DV8 A;  2WLQ A;  4OI2 A;  5IJR A;  4QM8 A;  3WP4 A;  3B9C A;  4B3N A;  2NP0 A;  2E32 A;  4Z2A A;  1RED A;  5FP8 A;  1YJL A;  1G9D A;  2XVK A;  2PHT A;  1BZW A;  2WNU A;  3GF6 A;  5LA1 A;  3ZO0 B;  4LNV A;  1VRH 3;  2WR9 A;  2QQJ A;  5CYY A;  4I2O A;  4LLF A;  2XLF A;  5LRR A;  1W28 A;  3AFK A;  4CP9 B;  4P9X A;  4AAP A;  4AI9 A;  3BUC A;  3BAL A;  2I2S A;  4QAW A;  3ZYI B;  4COV A;  2YPD A;  2W46 A;  4DXZ A;  5GZC A;  2Y60 A;  4MV2 A;  4LBQ D;  1DGR A;  5IYY A;  1RUE 3;  5GZF A;  1NZI A;  1OA4 A;  2R07 1;  2XJS A;  1WD3 A;  2VAU A;  2IXI A;  2ZGU A;  1L3J A;  1PGW 2;  1WA6 X;  3N9L A;  4LOR A;  4QX8 A;  2X5I C;  1ULG A;  1N1V A;  1PIV 3;  3ZFG B;  3V0B B;  4RSU A;  4LTA A;  4MXW B;  5C9A B;  3K2O A;  3NW4 A;  4LO7 A;  1W0P A;  4S2G A;  3UJQ A;  3HR9 A;  3KVA A;  4DMI A;  1QJX 3;  3BIW E;  5FY0 A;  3H7J A;  5FP7 A;  1AXK A;  3UYJ A;  1JS9 A;  1HJG A;  4UT5 A;  1QJE A;  1TEI A;  2ZBJ A;  3WHU A;  3ZXA C;  2E53 A;  2P6C A;  4BQ2 A;  3JD7 3;  3FX3 A;  3ZDS A;  1AR8 3;  2CTV A;  1B35 B;  4MGQ A;  4AZZ A;  5CFC B;  2QKD A;  1C8M 2;  1POQ A;  4H14 A;  1S1A A;  4B7K A;  4DEV A;  5I0T A;  1O4Z A;  1DQ6 A;  2HJI A;  4CDW C;  1F2N A;  2V09 A;  3T09 A;  3R4D B;  4KWK A;  5DDJ 1;  5HV0 A;  1YI7 A;  3OGR A;  4R9D A;  2VZP A;  3CBN A;  2JIJ A;  1I1E A;  3BGA A;  1XNT A;  3OGV A;  5A7O A;  4N90 A;  5FXX A;  1HXS 3;  1O6U A;  4XMI A;  5B4N A;  4MLO A;  4AEK A;  1K5M C;  4NPM A;  5LY2 A;  3LF7 A;  3KV4 A;  1ASJ 3;  2XKP A;  1LU1 A;  2Q4S A;  5A80 A;  4NPR A;  4YVS A;  2DUR A;  1EUT A;  4K9S A;  3TWI A;  1C3H A;  3LD8 A;  4XAC A;  2JG8 A;  1H0B A;  1Q8S A;  2J1A A;  5J96 B;  1MAC A;  5M0T A;  4E8C A;  2VQA A;  3DEC A;  1W8Z A;  1NE4 A;  1W6N B;  3LOI A;  4MVT A;  4Y26 A;  3RWK X;  1Q43 A;  1H9P A;  4P08 A;  1DQ2 A;  4AWD A;  4BA6 A;  1EY2 A;  3OUJ A;  2WO2 A;  4DPN A;  1UL9 A;  3K3N A;  5K4L A;  2OUH A;  3ZFG A;  1QH6 A;  4O7X A;  1JOD A;  5CKN A;  3SH3 A;  1OA2 A;  1W0O A;  2EIG A;  3HN1 A;  1VBE 2;  3ZFF B;  3MID A;  1PVC 2;  4NIA A;  4IL7 A;  5LA2 A;  4EN0 A;  1LEM A;  5A6Q A;  1BCX A;  4AK3 A;  2WFF 3;  5FZ0 A;  5FZL A;  4XUR A;  3MEP A;  2LS6 A;  3JD7 1;  3POS A;  1VAK A;  2R30 A;  2H6B A;  2HWF 3;  4FOQ A;  3TEX A;  1YFY A;  2R7E B;  4NUB A;  1Y9G A;  3VBR A;  2A1X A;  2VZS A;  1N1Y A;  3VL9 A;  4XUQ A;  1W99 A;  1QQP 2;  2YMZ A;  3TAY A;  3CLP A;  2CAV A;  5F2W A;  4D8M A;  2JDK A;  1H8T B;  3ZLI A;  4QKB A;  1TME 1;  5L73 A;  1S2K A;  1C5H A;  1QEX A;  4D6R A;  4PIX A;  1AYM 1;  5FFO C;  3B93 A;  3AVS A;  4CDX C;  2A6V A;  1IPK A;  1W6P A;  4UI9 L;  1R64 A;  5JXG A;  2ADD A;  1SLC A;  1N47 A;  1G9A A;  4O65 A;  1ZX5 A;  4XCA A;  5HXM A;  4OVE A;  1IZ3 A;  1JBC A;  3KLS A;  3IZO A;  4XAE A;  3J8F 1;  4Q4X 2;  1IGO A;  2XUM A;  4A41 A;  1AJO A;  2PQS A;  4W6Y A;  5JSR A;  1GR3 A;  4AAX A;  5KC5 A;  1W2N A;  4ZU5 A;  5CG8 A;  2B7Y A;  3PDQ A;  1LOC A;  5IVB A;  4LMF A;  2Q1F A;  3JUU A;  2XBO 3;  1X9P A;  5FY5 A;  4O9E A;  3WX5 A;  3J7N A;  3P5B A;  1W3V A;  2R49 A;  3OPT A;  2D44 A;  2GDF A;  3WF3 A;  5C6C A;  4XJA A;  1MS5 A;  4KL1 A;  2ZHK A;  4IER A;  2O0O A;  3D82 A;  4AVC A;  1LOE A;  1K5M A;  3OTF A;  5DDJ 3;  4BU2 A;  2FMD A;  4V2V A;  2PQQ A;  1QDC A;  2WAO A;  3KCX A;  2B46 X;  2JDH A;  4FPE A;  3GCW A;  4LUK A;  3U10 A;  3N9Q A;  3VZK A;  1JOP A;  1F15 A;  2VM9 A;  3USU A;  1HRV 2;  2XJQ A;  1I9R A;  3W59 A;  4DS0 A;  1E5I A;  2EAK A;  3KVB A;  3V56 A;  1SFN A;  2PLV 2;  1PO1 3;  4RFT 0;  2ARC A;  1HKD A;  1RUD 1;  5EIY B;  3PMS A;  3OD4 A;  2JX9 A;  3MUZ 1;  4JAA A;  1UZ0 A;  5FZB A;  2TEP A;  5FP9 A;  1D4V B;  4PJY A;  4XEZ A;  3WQ7 A;  5HCA A;  1H1A A;  1E57 A;  3N9P A;  1EYB A;  5KXB A;  2D5H A;  4J6G A;  4E2S A;  5DAV A;  1RMU 3;  3AZW A;  3GAL A;  2XJV A;  4DB5 A;  1VBC 3;  4XBN A;  4UOJ A;  4OZX A;  4YRD A;  2ZHM A;  3VBU B;  1ACC A;  2NQY A;  5A3L A;  4LUM A;  2DVF A;  3POI A;  4M4R A;  3ME2 A;  1W6Q A;  2ZX2 A;  5A3T A;  3UK9 A;  3N9N A;  4GMP 0;  3HQX A;  3VBR C;  3VKN A;  4KU8 A;  1W04 A;  2EAA A;  4ES9 A;  3N3H A;  5E8A A;  4K6B A;  4OQ9 A;  1N1T A;  3R4U A;  1QF3 A;  3CF6 E;  4RQP C;  2VQT A;  4EN6 B;  3DPR C;  4PDW A;  2PHU A;  3NMB A;  5F7U A;  3ZKU A;  2KA3 A;  4YWA A;  4N53 B;  1YNA A;  3N9M A;  4J1W A;  3SNM A;  1UY4 A;  2WNU C;  5G04 L;  4QXK A;  5FZ9 A;  2JXA A;  3PVE A;  1C8M 1;  2GP5 A;  1AYN 2;  1RTV A;  4M3C B;  2WKK A;  4IE4 A;  3VBS C;  4QWN A;  4MGT A;  1K5J A;  3LEI A;  3AXE A;  1MS8 A;  3TRS B;  3W20 A;  3A7Q A;  5CKM A;  1L7R A;  4C0B A;  4UFH A;  2XWB B;  3OD0 A;  3T30 A;  5L36 A;  1BXH A;  4XF4 A;  1MS1 A;  1V6O A;  1DBN A;  1QXP A;  2D6L X;  4Y1U A;  1OFN A;  1OOP B;  1ZZB A;  1HN0 A;  4Q8K A;  5JI9 A;  1V6I A;  1TMF 2;  2DWR A;  5IK8 A;  3J4U H;  3UES A;  2B42 B;  2BJS A;  4IEW A;  1SFP A;  1XB9 A;  4IEV A;  2H0B A;  4FBF A;  1QMJ A;  4GWN A;  4QQO A;  5K8S A;  2WBK A;  5AVP A;  1CQ9 A;  5F3G A;  4XQ4 A;  1TNF A;  1UMH A;  2QZ3 A;  3MDP A;  5DZE A;  1KIT A;  4ERO A;  4D7S A;  5JPM B;  1OLM A;  2DFB A;  2AGS A;  2B5H A;  2QQO A;  4L8Q A;  1RB8 G;  2VZV A;  4JC1 A;  3K51 A;  4LHL A;  2QQP A;  4CPB A;  3PU3 A;  4P9W A;  5FZ6 A;  3J7M A;  4CTE A;  5A3N A;  1WBL A;  5EJ3 A;  4AQS A;  2JE8 A;  2XL7 A;  1RXG A;  2E9Q A;  3HT2 A;  5CIS A;  2PA7 A;  1XRU A;  3ZXE A;  4XJ9 A;  4M3C F;  2E26 A;  1S4C A;  4IEY A;  2Y6F A;  1PGS A;  4OCT A;  3OPZ A;  4QPI B;  5LA9 A;  1MZ5 A;  4DZG A;  4RS5 C;  1RUH 2;  4EWE A;  1UZW A;  3AJZ A;  4QPG B;  4JQT A;  4WVZ A;  2UWC A;  3I2H A;  4LO6 B;  4BHP A;  1YUD A;  3AC0 A;  2JG8 B;  1C1L A;  4GB3 2;  3TEY A;  1GIC A;  3H1W A;  4CU8 A;  3HMY A;  5FUN A;  2ORX A;  1W9F A;  1XSR A;  3MIG A;  3NAP B;  4HSJ A;  1V9U 3;  4HOO A;  5AFB A;  3AP5 A;  3U11 A;  5FYM A;  4LHN A;  3O1U A;  4QU1 A;  3NV3 A;  1PIV 1;  4NOT A;  2GC0 A;  2R06 2;  5HI0 A;  4YPJ A;  2NMO A;  1HIX A;  3T2T A;  1OKQ A;  5ERL A;  5J48 A;  1XC6 A;  4ZPI A;  1BMV 1;  4Z1V A;  2VMH A;  1OQE A;  3JB4 C;  2MPF A;  1UOF A;  1DP0 A;  1PO2 3;  2D6N A;  4NRP A;  2ID4 A;  1OD5 A;  1QJU 3;  2JDY A;  5LAS A;  4AI0 A;  1ZBE 3;  1G9F A;  2I74 A;  2VZQ A;  1P8J A;  3MO4 A;  1RUI 3;  1US2 A;  2OPK A;  1ND3 A;  4GQ7 A;  4I0W B;  3FHI B;  1V00 A;  5CFC C;  3JQX A;  3H8X A;  1ENR A;  2VL4 A;  1QOS A;  4X6R B;  3GHM A;  3IAQ A;  2VUC A;  1SLB A;  1X8M A;  4ASL A;  4Y4R A;  1Q8O A;  1DGL A;  2BTV C;  2MNG A;  1NT0 A;  4R4X A;  1GMM A;  3LZZ A;  1LOG A;  4Q0Q A;  4DXR A;  4FXG B;  2GME A;  2QQL A;  2VMC A;  3KV9 A;  3BTY A;  5IWF A;  4FPK A;  5D8A B;  1AXZ A;  1UZY A;  3IWZ A;  1G9C A;  4CDW A;  4P9J A;  2DV9 A;  1HV1 A;  3UKV A;  3M3Q A;  2JWP A;  2RM2 1;  4Q29 A;  2YBS A;  3OGG A;  1D4M 3;  3J26 N;  3WG2 A;  3KM5 A;  3THP A;  1R1A 1;  3HQU A;  2P3K A;  1WCS A;  2A6Y A;  1UY1 A;  2Z69 A;  3WQ1 A;  2DUP A;  4Q4W 3;  4XDQ A;  4BYY A;  3AKP A;  4P5H A;  2W47 A;  5FK7 A;  4LQR A;  2W9X A;  4NVP A;  4K40 A;  4NR1 A;  1W8H A;  2GP3 A;  4P00 B;  4S2F A;  2IC1 A;  3RZL A;  1MS4 A;  3IKW A;  4P02 B;  3QCW A;  4XOG A;  3RI9 A;  3E1F 1;  5DZG A;  4Y4Y A;  1D4M 1;  1GKB A;  2C9K A;  2R0F A;  3LA3 A;  4FTS A;  2ERF A;  3III A;  5FXZ A;  3IPV A;  4YZ1 A;  2A73 B;  4BQ5 A;  2ZAA A;  5KC6 A;  1HRV 1;  4RS5 A;  2VCA A;  1W6O B;  3OJB A;  2RR1 3;  5D21 A;  4BQ1 A;  1ASJ 1;  1QIQ A;  2FCT A;  3I59 B;  4RFR B;  3ACL A;  2CWM A;  2YUE A;  3RFR A;  3C7G A;  3IT8 A;  1U12 A;  1OUR A;  4JGY B;  3ZX7 A;  2HWE 2;  4GAZ A;  5GLZ A;  2DF7 A;  4YFW A;  2MEV 3;  2HH9 A;  4BB3 A;  3T0D A;  2RHP A;  4MG2 A;  5A7N A;  3I7D A;  1UNB A;  4HVO A;  1CJP A;  5FBZ A;  1SPP A;  4G3Y C;  5LY1 A;  2ZGO A;  2JKX A;  1HDK A;  1V6J A;  3ECQ A;  3MW3 A;  1COV 2;  1YCI A;  1LU2 A;  2WZ8 A;  3A4U A;  3O7O A;  4PIY A;  4CA9 A;  4XCB A;  5JDB A;  2LTN A;  3E5U A;  3POJ A;  3U0Z A;  3QOP A;  3TEW A;  1DU3 D;  2ZAB A;  4J25 A;  1W05 A;  2XML A;  1KXG A;  3T4V A;  2VZT A;  5EHD A;  4XUT A;  5FCC A;  3HT1 A;  2VZR A;  3J8F 3;  1DGW X;  1NG0 A;  2SLI A;  5IVJ A;  3TBD A;  4GIQ A;  1I3H A;  1UCX A;  4XUO A;  4P14 A;  1ND3 C;  5CFC A;  4JKM A;  4W65 A;  4HSL A;  5FDB A;  4GJY A;  5FMB A;  1PK6 A;  3OGJ A;  1VPH A;  5DG2 A;  5CAD A;  2AZ5 A;  4GUL A;  4XJ8 A;  5EV7 A;  5FZC A;  5KHG A;  3RSJ A;  2YRO A;  3WZ1 A;  1DQ1 A;  2IFW A;  2W08 A;  1CAX A;  2IZW A;  4AED B;  1XBF A;  4XUN A;  2JB4 A;  3SEE A;  2VMF A;  3RYP A;  3P3P A;  4MXW A;  5F5Q A;  5A1F A;  2RVA A;  2XON A;  4JV4 A;  3LIH A;  3DF0 A;  3U14 A;  2DCY A;  1CAU A;  1IPS A;  5DPN A;  1VB2 A;  2ZGP A;  3EO6 A;  5FR3 A;  3HPN A;  4JTN A;  5KWR A;  3SEP A;  2HEW F;  2ZGQ A;  2CL2 A;  2JKB A;  2JDN A;  2ES3 A;  2W95 A;  4UFI A;  2FCU A;  4ISR A;  4YVW C;  3RPQ A;  3PUS A;  4I02 A;  1UKG A;  2VVD A;  4I30 A;  4E27 A;  4UBG A;  2VC9 A;  4QX2 A;  1FMD 3;  1H1M A;  1ENQ A;  1VBD 1;  3MBW A;  2V4V A;  1U5Z A;  5B4X A;  2XWJ B;  2E6V A;  2HWC 3;  4QMA A;  1Y7B A;  2WNO A;  4I0A A;  3UV9 A;  1V0A A;  1H1I A;  2BRT A;  3A23 A;  3WQ0 A;  2W92 A;  1G7Y A;  1QJF A;  3ZXF A;  1ND2 B;  4QX5 A;  4UFL A;  3RZG A;  1Y9Q A;  1UMZ A;  1I5Z A;  1SFY A;  3RG0 A;  4D7Y A;  2XKO A;  2YC2 A;  3ETP A;  1AR7 2;  4CUB A;  2ZS6 B;  5FZO B;  5IVY A;  1YO8 A;  1YEW A;  2CGP A;  1KJL A;  4JX0 A;  4BMB A;  2AYH A;  4LEJ A;  5I8S A;  4K3U A;  1ZNP A;  2EXK A;  1JZ3 A;  3HJR A;  5HXV A;  4XHX A;  2N7G A;  4NJ4 A;  3PL0 A;  3WNX A;  2R0H A;  5FYH A;  4FVV A;  5FMD A;  5FXW A;  1AR9 1;  3I3B A;  2AEY A;  3ITQ A;  4OFG A;  2VY0 A;  3RYK A;  1ZRE A;  3LOB A;  2J1U A;  2D6K A;  2Z4F A;  3VV1 A;  4RGK A;  1KJR A;  3WG1 A;  1QDO A;  2OZJ A;  2V5Y A;  1GWM A;  2BER A;  3P1I A;  4JDN A;  3WT3 A;  1H6Y A;  1ODN A;  1CGP A;  3ZVX A;  2QBX A;  1O3R A;  5DG1 A;  1A8D A;  5AVA A;  3WP3 A;  2PHL A;  3ZXK A;  2IWG B;  1ZBA 2;  2WIN B;  1LOA A;  3LIG A;  4A6S A;  1ULC A;  2YFU A;  1NX9 A;  4NO4 A;  4O9G A;  2DVA A;  3ZN6 B;  5JIU A;  1O8P A;  3ZYG A;  1GWK A;  4IUG A;  4Q5O A;  1LGC A;  5APA A;  5FUI A;  1JYW A;  4YW5 A;  2C24 A;  4FSJ A;  4TLF A;  3H1Y A;  4MZU A;  4Q1R A;  3PUH A;  3WNO A;  3AMP A;  1NQJ A;  3IDA A;  1PK6 C;  1LRH A;  4HN1 A;  3VBS A;  4MHR A;  3ZPO A;  1CPN A;  1BMV 2;  1H2K A;  2P3J A;  1SBE A;  3D5O A;  3VKM A;  3ZXL A;  3EYP A;  4IEZ A;  3ZDV A;  2GMM A;  2BUK A;  2ZEY A;  2J22 A;  5FZO A;  3TYJ A;  5JXI A;  1LES A;  5F39 A;  5ACA 2;  4DIN B;  4IE7 A;  4FQZ A;  3ZYB A;  3ZFF C;  1W8O A;  4YSF A;  2WNE A;  1VRB A;  4B4Q A;  1ZRD A;  2RS3 2;  4YM2 A;  2PYT A;  2ZEX A;  5CEH A;  5FOJ B;  4IW3 A;  2SBA A;  4LIV A;  3RZM A;  1GOF A;  1SLA A;  4L0P A;  4OUL A;  3K46 A;  4ARX A;  4COW A;  2FHR A;  5G05 L;  4NIG A;  3WP6 A;  3I97 A;  1LGN A;  2FCV A;  2NM1 A;  3RJ2 X;  1Y9M A;  2PAK A;  2QE3 A;  2RR1 2;  5FYB A;  3RZJ A;  2P3Y A;  4XET A;  5J98 B;  3GM8 A;  4DQA A;  1CD3 G;  2YGL A;  3FHQ A;  3PJY A;  2JDZ A;  1W8W A;  3B5L B;  3D3A A;  4LLO A;  2WSU A;  4R9C A;  1AXY A;  3WDW A;  3T1L A;  1IS6 A;  3J9S A;  2VH9 A;  3PVB B;  3N9O A;  4QKF A;  1OXC A;  3SQO A;  4DO0 A;  5BNN B;  5FPU A;  4MHU A;  4JDO A;  1JMU B;  3WNP A;  4XJU A;  1SHW B;  1CIY A;  2XHK A;  5KBF A;  1LHW A;  3CJX A;  3GNE A;  1NA1 C;  2BW8 A;  3THD A;  3ZYR A;  5FLI A;  2YZ4 A;  4PHZ A;  4IGO A;  4IGQ A;  2P37 A;  2ZML A;  3O14 A;  5CFD B;  1WGP A;  4AED A;  1CAW B;  1YYN A;  1JZ8 A;  1UPI A;  4GB3 1;  4N43 A;  2K0G A;  3WW2 A;  3WF2 A;  4XTM A;  5CKQ A;  3DKW A;  2W2I A;  1NLQ A;  2JG9 B;  3MV1 1;  2VXR A;  3AL5 A;  4QDQ A;  4GA9 A;  3RGB A;  3AKT A;  5FZH A;  4AVS A;  1J59 A;  4MO3 M;  3TNQ A;  2R04 3;  4PLN A;  3K4D A;  3EMR A;  3O1P A;  5FWJ A;  4NWW A;  3AZZ A;  4CEY A;  4QX7 A;  1WCU A;  3R6S A;  1VB4 A;  2ZGR A;  1IS5 A;  5A6Y A;  3TB0 A;  3WW4 A;  4FOY A;  4LPL A;  2DTY A;  1TVG A;  2UWB A;  3CZJ A;  4YG6 A;  2VOV A;  3QLQ A;  4K20 A;  2BDR A;  5DAQ A;  3WCS A;  3CU7 A;  4ARY A;  3ZYP A;  1REF A;  2XQX A;  4ZHN A;  4CDQ A;  5BNP A;  1AR7 3;  3TEZ A;  2JDU A;  1WD4 A;  3A21 A;  1X82 A;  5FPL A;  3VL8 A;  4XHB A;  1CX4 A;  3NRU A;  3H8R A;  1CZS A;  3O12 A;  2G19 A;  1J84 A;  4JQR A;  1WMX A;  4GWI A;  4YYO A;  1JYV A;  1OF4 A;  1D0H A;  1IHM A;  1OC1 A;  3E6B A;  4J1X A;  4FO9 A;  1AL2 3;  1RUD 2;  4RS5 B;  1JYX A;  5DMY A;  4WM7 A;  5JOY A;  4AI1 A;  4TLG A;  3I8T A;  3LGR A;  3OEB A;  4E8D A;  2CNA A;  5LBE A;  4Z2W A;  3JU9 A;  4KBZ A;  5DUU A;  2CSG A;  2W94 A;  5CVR A;  4M0N A;  5F3C A;  2JDM A;  3U78 A;  1RJ7 A;  2UUR A;  1O59 A;  4BQ4 A;  4M3C A;  5IVF A;  2JEN A;  1C5I A;  3I3E A;  3POW A;  4LXL A;  5E6H A;  1VJ2 A;  4OHZ A;  3E6C C;  3EXU A;  2BP6 A;  2WAB A;  3VDC A;  4AGG A;  4FOV A;  1Q3E A;  4JGZ B;  1XYO A;  5JR7 B;  5LW9 A;  3KMH A;  3HNY M;  3WUD A;  1J3P A;  3VKF C;  1HB2 A;  3N7J A;  4CEY B;  5ABJ B;  1FOD 2;  1CAU B;  1VR3 A;  4OUS A;  3Q9O A;  1TE1 B;  2Y6H A;  3I2D A;  1GZW B;  1RIN A;  4W50 A;  1ALY A;  1CJD A;  3HVD A;  1F5F A;  1NCR B;  1AR6 3;  1KFX L;  2PHW A;  1DQ5 A;  2PMW B;  3GZT B;  1BLZ A;  3H42 B;  4QQP A;  4YVS C;  5IVC A;  2FBE A;  3IMN A;  4MYE A;  4YFZ A;  3NKT A;  2D6O X;  3ZR5 A;  2QVS B;  1O4T A;  5CIR A;  5FP3 A;  5CB7 A;  1OH4 A;  5EQU A;  1SBF A;  5DAX A;  4C0H A;  1GNZ A;  1SEF A;  4L9B A;  1V6M A;  3ZXJ A;  3POE A;  5I8Y A;  1SQ4 A;  3H50 A;  3JBG 2;  4HET A;  4HT1 T;  1TMF 1;  2Q5T A;  1W2A X;  2A5Z A;  1JZ2 A;  2ARB A;  1UU5 A;  1KS4 A;  5DUX A;  4AEJ A;  1Q8P A;  4Z8B A;  5F2S A;  4EN7 B;  1OVS A;  5ACA 3;  1LEC A;  3LQC A;  5J3U A;  1WW5 A;  3CO2 A;  4Q0S A;  4TWT A;  5BNP C;  1OH3 A;  3OGS A;  2HKX A;  4Q0V A;  2BV4 A;  3WV6 A;  5F9T A;  5GZG A;  4QU2 A;  3MIC A;  3KHB A;  1C57 A;  3OYW A;  3VZO A;  3H7Y A;  5LEJ A;  2VVF A;  3G7D A;  2OZ6 A;  2FZ2 A;  1VBC 1;  2Z42 A;  3AKR A;  3M3C A;  2FDI A;  1CN1 A;  4RR3 A;  4FPG A;  4QPY A;  3CMG A;  1BKZ A;  1A6C A;  2VE1 A;  1Z7S 3;  2J1V A;  5JMC A;  1WZX A;  2UWA A;  4P9Y A;  3BTX A;  1S0B A;  3AMN A;  2NYY A;  4ZON A;  3BU0 A;  3AZY A;  1GNH A;  3KZ4 C;  2GNM A;  2HWB 1;  3PIJ A;  5K9Y A;  5EXO A;  4XAB A;  1EAH 3;  4ITC A;  4EYU A;  2VMG A;  2DBI A;  4UFM A;  3HEI A;  1X33 A;  3LPF A;  2QDN A;  1QJU 2;  1X36 A;  3ZSJ A;  1OT5 A;  2ZGT A;  4RGA A;  2XVG A;  1EPZ A;  3G6J B;  3ILR A;  1PMI A;  3N7M A;  2OX0 A;  1UMI A;  4FPY A;  1F4H A;  2F17 A;  1UWW A;  3DL3 A;  1NCR C;  4HPK A;  3S7I A;  4EWA A;  2PFW A;  3FBM A;  4WBB A;  4CP0 A;  4QB6 A;  2K46 A;  1JOB A;  2XBO 2;  4AGV A;  1FXZ A;  2ZHL A;  3ILN A;  4HFS A;  3ZFF A;  3NNF A;  1BVV A;  3PVO A;  4URA A;  5I0S A;  5KXD A;  3ES1 A;  1V6L A;  2CDO A;  2RMU 3;  4NII A;  1YJK A;  4LT5 A;  3WD5 A;  1HJF A;  4E4D X;  5FMO L;  3SH4 A;  4CEW C;  4EZH A;  3J7H A;  4EZ4 A;  3VBF C;  2XB6 C;  5CZK A;  1ND2 A;  4Y5Z 0;  2AUY A;  3HNB M;  2K2S A;  1LOF C;  1L7L A;  1ZZC A;  3FJS A;  1MVE A;  4K1Z A;  3H0O A;  2BNM A;  4JTO A;  1R09 1;  3OYW B;  4UBH A;  3Q8E A;  2D3S A;  5A3M A;  3FWE A;  3I2I A;  4X6Q B;  1UZV A;  3BOW A;  3MIF A;  3GBW A;  4E4H A;  1YI9 A;  1HLC A;  4TXW A;  2ETE A;  3HWJ A;  1RGS A;  2ZKL A;  1UXZ A;  4PDW B;  2HWD 2;  3SKV A;  1W90 A;  3KGZ A;  5FIX A;  4HBN A;  1O3S A;  2YXS A;  5C4W B;  1NA1 A;  4QB2 A;  3MIB A;  4XFF A;  2Y33 A;  1VBB 3;  1ZVF A;  1OBN A;  1FPN 3;  1MQT C;  1Y3T A;  2WO1 A;  3OBT A;  1RUO A;  2NPI A;  1OD3 A;  2RS1 1;  1SDD B;  3V0A A;  3ZPY A;  1RMU 1;  4CU7 A;  2O8Q A;  4IES A;  2RM2 2;  1GZ9 A;  3HNM A;  4PCR A;  3RYR A;  2O1Q A;  3CZU A;  1PZ7 A;  2MEV 1;  4BJ0 A;  1NOV A;  4QD2 A;  5H9S A;  4MX3 A;  3QD6 A;  4Y20 B;  5A7W B;  3W5N A;  3ZSE A;  1X50 A;  4Z82 A;  2CWS A;  2AAC A;  4QQH A;  3ZYF A;  1KD7 A;  2DCT A;  5FRE A;  5A33 A;  3VHR A;  5JCT A;  2XLG A;  4DRV A;  1DDL A;  2GC2 A;  3KF3 A;  1ZM1 A;  1QNY A;  3AVR A;  5IVV A;  4NE9 A;  5J36 A;  2DVD A;  5JAX A;  1GP4 A;  4RR3 B;  3V0B A;  2EIC A;  3O1T A;  1C28 A;  2P2K A;  1V70 A;  5DXD A;  3WW3 A;  1FOD 3;  3NKG A;  1VIW B;  2H0V A;  3DXU A;  1WKY A;  5IW0 A;  1SZB A;  2WQ4 A;  3LEM A;  3MV0 1;  2JIC A;  4TSV A;  3DCQ A;  4E9K A;  3TN9 2;  1RVF 3;  1SDW A;  5FMO S;  3W58 A;  1VE0 A;  1RUF 2;  1GQG A;  5F3I A; 
#chains in the Genus database with same CATH homology
 5F3E A;  4V2W A;  4Y4R A;  4DIQ A;  4UF0 A;  5F5I A;  3KV9 A;  4CUG A;  5FWJ A;  3KV5 A;  2OS2 A;  5IWF A;  5FZG A;  4QX7 A;  5ANQ A;  4BXF A;  2WWJ A;  5FZ4 A;  5FZO B;  5IVY A;  3K3N A;  5K4L A;  2YU2 A;  3N9M A;  3OPW A;  5FYV A;  4EYU A;  2YBS A;  5FZ9 A;  4C8D A;  2GP5 A;  5A7W A;  5FYH A;  5FZ3 A;  4XDO A;  4QWN A;  5FXW A;  5FZ0 A;  5FYZ A;  5FZL A;  3LDB A;  5FY9 A;  5FPL A;  5FYT A;  2OX0 A;  2GP3 A;  5LWB A;  5FV3 A;  3PUA A;  2YU1 A;  5FY7 A;  4NUB A;  5FJH A;  3NJY A;  2VD7 A;  5FY1 A;  5KR7 A;  4CSW A;  5F2W A;  5FXZ A;  4URA A;  3KV6 A;  3ZLI A;  5A3W A;  4D6R A;  2OQ6 A;  5FY8 A;  4EZH A;  3AVS A;  4EZ4 A;  4CCL A;  2XXZ A;  5FP8 A;  5FBJ A;  3AL6 A;  4UF0 B;  5F3G A;  5IVF A;  2OT7 A;  4GAZ A;  3PU8 A;  5F3C A;  5FZE A;  3RVH A;  3U78 A;  5ISL A;  4D6Q A;  2YBP A;  5FZ7 A;  4D6S A;  4CCO A;  4AAP A;  4GJZ A;  5F3I A;  5A7N A;  4AI9 A;  4LXL A;  5FJK A;  3PU3 A;  5E6H A;  5FPB A;  5FZ6 A;  4Y3O A;  2YPD A;  5A7Q A;  3PTR B;  3PDQ A;  3U4S A;  5A3N A;  5LY1 A;  5IVB A;  3PUQ A;  4E4H A;  5F32 A;  5FXV A;  5A1L A;  5LW9 A;  5FZO A;  5F39 A;  5FY5 A;  3N9L A;  5F37 A;  5FYS A;  4QX8 A;  1VRB A;  5FYU A;  3OPT A;  2XML A;  2Q8E A;  5CEH A;  5FP4 A;  3K3O A;  4CCJ A;  5FZA A;  3K2O A;  4LIV A;  5A7S A;  5FZF A;  4QXC A;  3KVA A;  4BU2 A;  5IVJ A;  5FY0 A;  5FP7 A;  5IVE A;  4V2V A;  5FZM A;  3DXT A;  3UYJ A;  4XDP A;  5FYB A;  5F5C A;  3N9Q A;  2OQ7 A;  4ASK A;  5IVC A;  4GJY A;  4TN7 A;  5A7W B;  5FUN A;  4HON A;  5FP3 A;  3KVB A;  4CCM A;  4CCN A;  5FWE A;  5FZ8 A;  4HOO A;  5FZC A;  4Y33 A;  5FYM A;  4DO0 A;  2P5B A;  3N9O A;  4LIT A;  4QU1 A;  5FPU A;  2PXJ A;  2YBK A;  5FZD A;  2Q8C A;  5FZ1 A;  5FZK A;  3ZPO A;  3AVR A;  5FZB A;  5IVV A;  5FY4 A;  5A1F A;  5FP9 A;  4GD4 A;  5FPA A;  2Q8D A;  5FYI A;  4BIS A;  3N9P A;  5FYC A;  4IGO A;  5A3P A;  5A7P A;  4IGQ A;  5F2S A;  5A7O A;  2XUE A;  5FYY A;  5FXX A;  2XDV A;  4IGP A;  3DXU A;  5FUP A;  5IW0 A;  4CCK A;  5LY2 A;  3PUS A;  3KV4 A;  5F5A A;  4QXB A;  2W2I A;  4LIU A;  3PUR A;  4QXH A;  5A80 A;  5A3T A;  5FZI A;  2WWU A;  5FPV A;  3N9N A;  3AL5 A;  3LD8 A;  5FZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...