3UYPB

Crystal structure of the dengue virus serotype 4 envelope protein domain iii in complex with the variable domains of mab 4e11
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
96
structure length
96
Chain Sequence
YTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKVVGRIISSTPFAENTNSVTNIELEPPFGDSYIVIGVGDSALTLHWFRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-dengue Mab 4E11
publication title Mechanism of dengue virus broad cross-neutralization by a monoclonal antibody.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 96
sequence length 96
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2011-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uypB00
4UTBA 5JHLA 2H0PA 2HG0A 5AAMC 1OK8A 3N44F 5LCVA 3C6EA 3N42F 1Z66A 1RERA 3C5XA 5AAWC 4GSXA 4BZ2A 4UTCA 3MUUA 3J2PA 2R29A 1SVBA 4X42A 3VTTA 5KVEE 1Z3RA 5H37A 2GG1A 4BZ1A 1URZA 1TG8A 2I69A 4ALAC 5KVDE 5GZNA 5IREA 3UZEC 3WE1A 3UAJA 5KVGE 1PJWA 4UT9A 3G7TA 5B1CA 5LBVA 3J27A 4AL8C 2JSFA 5GZOA 4FG0A 1ZTXE 1OANA 2JV6A 1OKEA 2R69A 4UT6A 4GT0A 3IRCA 1S6NA 4AM0Q 3UZVA 3N43F 2ALAA 1UZGA 2JQMA 4FFZA 5KVFE 5JHMA 4L5FE 3UYPB 5LBSA 3UZQB 5IZ7A 3N40F 2P5PA 4UTAA 2V33A 4FFYA 3P54A 3N41F
chains in the Genus database with same CATH superfamily
3PL6A 1KTRL 1AG6A 2NZIA 5IV2B 5IFJA 3QCTH 1OTSC 4N1EA 3NK3A 4XNZC 2ZSWA 2YA1A 3OZ9H 2LU4A 2ZXWB 1DJZA 1QNZH 4X6EA 4QD2E 1AGEB 1GGTA 3U9PL 3PJSA 1BBJA 2R2EB 4L1HA 1HKLH 3QI9C 4MLIA 3CSPA 1RHHB 1AKJB 1VFBA 4YDVB 2VLLA 3LZFL 1LE9A 2E4TA 3HFMH 1B0GA 1U93A 4IU2B 4PIBA 2FX7L 2MSPA 4WUUA 4A6YA 1SVCP 1A14L 1I1AD 1FIEA 4ICXA 4XZ4A 3RVXC 1T4WA 3EYQC 3CJJA 5J1TC 1K4CB 3RILA 1IM3D 1R3KA 5AVQB 2VERN 3DMMC 5EPMB 4UOZA 4JFED 5DHEA 3TN0D 1GRWA 2KQMA 3QQDA 4PW9A 3ZIMA 3CFBA 5EOCJ 4DF9A 4CU7A 2NY5C 1YJDL 1KJ2B 1T0OA 1AR1C 1VJSA 3AFLA 4PWEA 2BOLA 2QPEB 3U4BH 1EDHA 2IALB 1FFRA 4LEXH 5C7ZA 2IAAC 5K9JH 4P3DB 4UDTA 2VJXA 3FO9A 4AVHA 2NPLX 4G6ML 3S5LA 5IEKA 1MQKL 5F1NA 4S1SH 3VFSA 4E41D 2PO6B 3FSOA 3VXTA 4LHUG 2UZXA 3T77A 3CDZB 1SEBB 3GSXA 3V8OA 1HCFX 3T0EE 2LLNA 5B7EA 3RURA 1CL7H 3BQUD 2YN3A 2DQDL 3PQYE 3FB8B 1UZ8B 4K4KA 1ZDQA 4MXVE 2X4SA 3T0BA 4MCZB 3CXHJ 4O9HH 4OV5A 2YBRA 4KTYA 3QZWB 5JIQA 1XIWC 3UAEA 1MKFA 5E1HB 5TDNA 4PJGA 5CIPA 2BVUA 4GG6A 4A7GF 2WVVB 3L5HA 4FTVA 5DXWA 4N8UA 2CLRA 3IFPB 2O6FA 1I1YB 4KKBC 4AIOA 4PYGA 1YEJL 1JZ7A 1KYDA 4Z0XA 2EZ0D 3VACA 1HL8A 3KEHA 3DX7B 5LO7A 2YLHA 3QFJE 2OMXA 1ZHBB 1FNGB 4XNQB 3RZCC 5I8OH 4AQZA 3KPOA 4HT1L 2ZKMX 5I1CH 1PQZB 2LLLA 3H56A 4F8TA 3DHPA 5I8CA 4HWBA 3W3BA 2DI7A 4X4MA 3CK0L 4I18A 4U6YA 5LKNA 4I85A 3V55A 4GI6A 1LO5A 2E47A 4DH2A 5HHPA 3EGSA 1CE6B 1C1EL 4ZW5A 2O5XL 4IHOA 1A22B 4ZW6A 3DVNB 2CKBH 5BZWB 1J7VR 3FQNB 1KTKE 2G3ZA 3AY4C 4ANUA 2H32H 3I02B 5JQIB 5I30L 2Z7UA 5IR1B 3QZOA 5DK3A 3WFBH 2WLLB 4JFOA 2WAHA 2HTLD 5I23A 3DO3A 2CRMA 4PRAA 2XZQL 2ZOWA 3HS9A 1DQVA 4KFZC 5CD5D 4TUJA 4ZTPH 4F3FA 4A7VA 1E4XH 3QISA 2AHIA 4FQIH 5SWQA 4IBVA 3IKKA 2ALWA 5HJGA 3JWOC 1T2QL 1GS8A 3TZVD 4LSQL 4PWIA 4PGEB 5TE4H 5JO5B 3FAXA 1DVFA 3KPLA 4PJIF 3LMJL 4HFWA 1T7ZA 3TJPA 5D2LF 2Z91A 4MMYA 1XD1A 4POZC 4YHNB 3NEOA 1A9VA 1U91B 5IGXH 5D1QB 4OLYL 3VI3F 2AJXH 2XFGB 1FYTE 2YC1A 5E9NA 1LP9A 1YEHL 5FV1L 3N1MC 2XN9D 3FMGL 5C0CE 1V7ML 5AW3B 3G5XA 4XNUL 1UWYA 4Y2DB 3T09A 5I6PA 3ARBB 5H2BA 2ITDB 1MUJA 2BINA 3QEUA 4YO0B 5JPNC 3THMH 4HSAC 1EJ8A 3QO1A 3UTTB 1EMTH 1S7XA 1T83A 3UBXB 2A6IA 1JMZA 1KT2A 4FFVC 1NBZB 5HHOE 3D0LB 1YC7A 4PJIE 3MRFA 5HXMA 5HGAB 3Q6FB 3BKCH 5D2LE 1AHWB 3EYOB 2HTKD 5JOFA 1BX2A 3VI3E 2AITA 2WHVA 4MSWA 4V2BA 5B39A 4FQQB 1TF4A 4B60A 2F7PA 2EDWA 1N4XL 4OFVA 2CRIA 1G7JB 3C6SB 3MUGA 3FN9A 4P06A 4NZRL 5IB4A 1P53A 3UZVA 2J2ZA 4I1NB 4PLNC 4IRJA 4XBMA 1UM5L 5EWIH 1N26A 1JHLL 1RK0A 4X5QA 3PG2A 2ADYA 5DVOA 4L2YA 4DGIL 4M8QB 1CQKA 5DSCA 1RIHH 3RTQC 3T4AA 3NUKA 3TBWA 1O5PA 5IB2B 5T1LB 1F45A 1FNSL 1MCBA 2E5EA 5D7LA 3RI5F 2P42B 1Z9MA 4I5BB 4N2KA 2GBVA 1KG0A 2Y5QA 5IUSA 3VQ1C 5I0YA 1Z3GH 2I9LA 3AREB 4JRXE 4NXSA 4YFLF 2BCMA 3QUZC 4NI6A 3WEBA 1N8ZA 1U41A 4P46D 4PJ6A 1O75A 4M7KL 3IU3A 3R7QA 3R0NA 5FWQA 5GGRY 2XWBB 4ZBJA 2XG4B 4JUTA 3EBGA 1FVEA 4GW5A 3DGDA 4B3EA 4UQIM 1GKEA 3BZDA 4KOCA 1ZVYA 4LVHB 4HKJB 3QP3A 1SFHA 5HHMD 4NWTL 4FQJL 4LXFA 1O7DE 4X8CA 4JL2A 3N85L 1UUNA 2YD4A 4RMBA 3M86A 4N0UE 1HHIB 4HPYH 4RGNC 5C7XL 4LLDB 1QSED 3HVDA 2QGEA 1P7KA 3RVUD 1CPUA 5F9WB 2AV7B 5F0LB 1DQQB 1U9KA 4MD5A 4TOYH 1UG9A 4J4PC 1J12A 1WK0A 3KEDA 1OHQA 2GUYA 1T04B 4UYQA 5KN5A 2F58L 3RY4A 2BOCB 3FT4B 3ET9F 4KJYB 3MRJA 4KH2A 1F4XH 1I8KA 1AGFB 2I5YH 2JCCA 4GP4B 2WXJA 1OT2A 2YGVA 1O5DT 5FHAL 1A4BA 1LJMA 3X3FH 3B4NA 4JGNA 4G80A 1JZ5A 1S4IA 3A4DA 5C92A 3VD4A 3BPCA 5HGBA 5L0QB 2QMJA 2VXQL 1MF2L 4XPFL 1GR7A 2NY0B 3EZ8A 5GGUA 1KELL 1YYCA 5DHVH 4NUMA 3TPUB 3L9RA 1W8OA 3B9DA 3LS5L 4OGZA 5DVLA 4EI6A 2NLJB 1NA8A 2Z4QA 4M5SA 2V2XB 2IAMB 2CA3A 4LSUH 2EKSA 2Z8SA 5GRVK 3V5HB 1MCLA 5DYOA 3FU7B 5CP3A 4UINL 3H4HA 3AT0A 3PWJA 4XBPB 5E8PB 1MG2C 1BVLB 4QTHA 2H26A 3KXFE 5DEZA 2VDOB 1H9VA 3WI9A 3CX2A 5JHMA 1IMHC 2MTPA 3BIKA 4X98B 5C0BA 3WEAA 3MREA 2DM7A 4U2ZA 5DD5L 5CSZB 4PHXA 5AKTA 4LVOB 4Z78A 3TEYA 1QWHA 2FD6L 4JFSA 2WBJD 1IAII 2BSBA 2CSPA 5AVXB 1KEGL 3OWEA 1OO2A 3GMLB 3SPJA 2BCKB 2DLIA 1DFBL 2EXSA 5E51A 5I75B 5EZIL 2EADA 2PN5A 4Y4KB 4DTGH 4OZHB 5D2NA 5AL8A 3NTCH 2KPWA 1T5XB 3L4TA 1UJTA 3C08H 1T2XA 5H37G 3BZ4B 2D3LA 4BD4A 4AGQA 4GUOA 4Y4HC 5IVZB 1JZGA 1ZHKB 1ORSA 3HI5H 3NACL 4MA7L 4NHUB 4GRLD 1AY1H 4ZMLA 4JO5A 1NMAL 3IJYB 4HC1H 4YZFE 4L3CA 4FLOA 4BZ1A 5DT1H 2GITB 2I69A 2RH0A 4JG1L 3NFNB 4R2GB 4XO3A 5AALA 4L2LA 4APQD 4NQXA 3MO1A 4P2QA 3CSYB 3I3DA 4OJCA 3ZZ1A 3K2UH 1BVNP 1S3KL 1JK9A 2J57A 3VVWA 4TN9A 1BCIA 2OSLA 1I3GH 3TBSA 3HI6L 2YD2A 4ZAKC 5TDPA 1OGAA 4FABL 3FU0A 4Y16C 1USQA 5L4FA 1VA9A 5KYUB 4K7FA 1KY6A 5KG9A 4NPYB 1E4HA 1U36A 2R0KL 5CEZE 1KV3A 3N41B 3IDGA 3EYSL 1XZ0A 3DOHA 4X7EC 3QDJD 3D05A 4BH7A 1RPKA 3WJJA 2DLFH 4JG0L 2DDQL 3GGWA 4I1RA 3QHTC 3QUYB 4J27A 4Y5VB 2CPCA 4D0CB 5JPMB 4TSAH 3QCTL 4FFZH 1I3RB 4OI7A 5CZXD 3OZ9L 3U4KA 5C3LD 4U1LB 1YPZA 5A2CA 3A4EA 1WJ3A 3ZTJH 2VL5B 4ZO6A 2G0KA 5DZNA 4M00A 3HFML 4DQOH 1VZIA 1LMIA 3ZDYB 3WIHA 3OKNA 4IKJA 4H1LH 2D7OA 1A6ZB 4L0PB 4DP4X 5AENA 3BZEA 2CR3A 3TBYB 3ABZA 4U1HB 3E1ZA 1IJNA 4Y2NA 4OKDA 3LRHA 1N19A 4DIXA 3V4PH 3VTMA 2LLGA 5K69A 5F9JA 5KS9A 2QQLH 3QWOB 4IIZA 3U4BL 1II4E 4LEXL 4OF3A 4WDIB 3PGFH 3QJHB 4PLKC 2NUPB 4Q9CA 3T4YB 3O9WA 1J8HE 1RD6A 2MKLC 5DJCB 4JFPA 3L81A 3TWYA 4D8PB 2EDJA 3IU4H 4ZODA 3HZKA 5KVEH 1IVTA 3CHRA 1V3LA 2CJTA 1FP5A 2OTUA 2OL3B 2APVA 4KROD 4O58H 4L29B 3IGLA 1TTFA 4WW2A 2A74B 5L4IA 3ZYOA 3S5ZA 4O2EB 1FJ1B 2VZ1A 4XMWA 4GW4A 5ELIA 4O9HL 4MJHA 5KVDH 1CUOA 5G5DB 1BQLL 1S7VA 3B83A 4I88A 1RJLB 3B9KC 2QR0B 4OSUH 4AYEC 5CAYB 1SVBA 3DRQA 3U6RB 5MEND 1IBBA 3AWEA 4NUJA 4KXDA 3KH3A 5AUMB 3RB5A 2DQHL 2UVFA 2VMCA 3M45A 1E9OB 5E6IA 4Q52A 3RWIB 3P0VL 3VXSD 1I4FB 4P5SA 3INUL 1WZLA 3OKOB 4BH8A 1WWWX 3VXSE 2DMGA 3MYJB 4KTDL 3IDIA 3KBFA 1J1OH 3WE6B 3W11D 4RGOH 2Y2WA 4ANXA 3H55A 1JGVH 3RX8A 1MH5B 3U82B 3QUXA 2YUWA 3WSQH 1JV2A 4PVLA 1BFOA 1U4EA 3W81A 4YPJA 3C6LD 5I1CL 1XGTB 3RWGB 1RSFA 1S5IH 1OQXA 3QW9A 2MMXA 1WG3A 1EEQA 5MEOB 1U3ZA 4IK7A 2A9NH 4WU7B 4LRIA 1ZY9A 3T9WA 3LPPA 2K4AA 5IQ9B 1R47A 4HEPG 2IDQA 3RNKB 1OP3H 4DN4L 3BVUA 3P30H 1U6AH 2YD0A 2AABL 2F53B 4TSBL 1ZT1A 1IM9B 2CKBL 3KPMA 5CEYB 5D7JD 5KSBF 1XSIA 2OTWB 1YRKA 1TYJA 4WU5A 2DOCA 1UWEH 2FJUB 1S5HA 3FQUA 4TPRL 1VB9A 5JMOC 2UV3A 2OMBA 4ISVB 1TNNA 4YSSA 2G5BB 2NY7H 4YEEA 2NZ9D 2EDDA 4L5FH 2XG5B 4HZAA 4MA1C 2IBZX 4ZTPL 5AVVB 5EH1A 1ETZB 1OM9A 4FQIL 4TUUA 2DS4A 3TEUA 4K8RD 2BY1A 4AYID 1WICA 3HE7C 1BJ1H 4Y7MA 5E8OB 1KCKA 3T0AA 4EPSA 4MVBC 3ABGA 4O2CA 1PPIA 5TE4L 3MRRB 1ZHNB 3RGVB 1FG2B 1J5HA 1OF2A 2ZJSH 3JZ7A 4G8GA 2BW5A 5DRNA 3W0WA 5CBEB 5KSBE 2GEQA 3KWTA 2MPVA 2BERA 5KOVC 3LV3B 2ZE0A 1H15B 3GBMH 4FYTA 4J28A 1YO4A 4WNQA 1E7UA 2AJXL 1HSBA 4PJHB 5JMRA 2JI2A 4LSTH 4JZOA 2JI3A 3TFKD 4OGAD 3T8XB 2GJRA 1OOAA 1U8OA 4EXPX 3MNVA 1H5BB 4OM1H 4Z77B 1JF1B 3L4YA 5HPOA 4A2DA 5I1AA 4BEIA 4ODVH 5GRVL 4L8DA 4JPKH 3P73A 1NCTA 3FO1A 1JSYA 4PG9A 3THML 1EO7A 4IRZA 3EJCA 1QW8A 2EIBA 4QRUB 2DQFA 1YMHB 4M6NH 1U92B 3KBPA 3GUFA 3T4AC 3W9EB 2H3KA 4AYBA 4F9LA 1WP6A 4BSVB 4P23D 5D1XC 2OYKA 3ROOA 2YQGA 3D12B 4IOSD 4P5RA 2FJGA 2HPOA 43C9B 1E65A 2WGXA 2HFEA 4P5MA 1RJZB 2CLVA 4Y4FD 1ET7A 4GXFA 5B8CA 5I76A 1NEZA 3IAPA 4NJAL 3BP4A 4ELME 2VLME 4Z7NB 1LEGA 1MHPH 3VD1A 4KZEL 4HS6B 2ZXAA 2IH9A 3VWJB 5ENWA 4B9KC 1P4IH 1G9MC 4CRPA 4D9RE 1CYXA 4QRBA 1J05B 3FRUB 1QTPA 1RIHL 3MA7A 2BIHA 1MLBB 2O4EA 2Y2YA 5C71A 3LXCA 5FGBC 1G7MA 2GHZA 2JQAA 3K71A 1CD0A 3ARDB 6CGTA 4WWPA 15C8L 1MVYA 2RALA 1NBCA 1QAWA 3AY2A 4R7NA 2YPLD 4CSTA 4ZS7L 3DROB 5B4MC 1XEUA 4JY4B 2XQBH 4OFKA 3BJ91 4HGMA 2NSXA 3KG5A 1V5JA 1Z3GL 4ZNEE 2UXGA 3LAFA 2W9EL 2BC4B 43CAB 1A5FL 3QO0B 4HDIB 5GS0H 5ITBH 1OP9A 4OD1H 3HUJF 5E2WL 4LEEA 4ODXA 3LIZH 4GQZA 5EBLA 1ECYA 2ITCB 3QIWA 4UM9D 4KXBA 2DQCH 5T3ZH 1GSKA 4HXBH 4M4RB 2ATAA 2Q2EB 1SMOA 1MI5A 2DQGH 3S3DB 1DDTA 1KB3A 1P4UA 1N5YH 5L2KB 3BAWA 4O2FB 1OAUH 3DHMA 3QIBC 4IS6A 3I9IA 4TMPA 2Q6WA 3LKSA 4WKZA 3PIQA 3LD8C 2M2DA 5DI8B 5LGYA 1AXIB 5DMIL 4Z3GA 1KB5H 4HPYL 2FWOB 3HAEH 1AGBA 4TQEH 5EU4B 2B20A 2BXYA 1LD9B 1D6VL 3MOAL 4GMSL 3HUJE 3JV4B 2X6MA 3NK4A 4TOYL 3TNMB 1T5WB 4NZFA 1D5BA 2GTZB 5LGHH 3P54A 4KXAA 4Q9QH 2F7OA 1UD8A 2IWEA 1KY7A 1GOGA 1S9XB 2I5YL 4BQBA 4QGTA 4EN3C 1CLZL 2RA1A 1PU0A 3X3FL 1IGYB 1IC5L 4AEHH 2EUWA 2YGPA 1VFAB 3O6FA 1OLLA 1OGSA 1E5CA 4XHJD 3SBRA 1NGWA 4I0PB 1U8IA 1P6FA 4FXGC 3QXWA 2QVIA 4L4JA 5HTSA 4AWJC 5EC1A 4DKAA 1P1ZA 1Q9WB 4EE2A 5KVMC 2GJPA 5KVEE 2H6PA 1QRND 3KPNB 1QRNE 4PG2A 1VEMA 2YS4A 4OCWH 3VD3A 5IF0A 1N7ML 2PTTB 3HTLX 3QJTB 4ABWA 1MCCA 2R59A 2P8MB 5E5MB 3L9EA 4OBSA 4JPIB 2DEWX 3V2AR 4LSUL 3SDDD 5KVDE 3GI8H 5F7EH 3SYCA 5MHSD 5D2NC 5MHSE 4O5LH 3U83A 3FFDA 1I9EA 4DETA 4OZFA 5A1AA 2D0HA 1I82A 3TT3H 2OBGA 1C8PA 1GH7A 2P5ED 3ILDA 1JP5A 2XIIA 2WKOF 4Z7OF 1G1OA 2BPBA 1TZIB 4FZEH 3LSOA 4N9OB 2F8OA 3ASNB 1IE4A 2N4IA 4D0BB 4IQHA 4UTAH 2WSDA 4P2OC 1S46A 4ZMNA 2E8YA 1TKWB 1JGLL 1KLFA 1ACCA 4YBQD 4Z7AA 5IM7A 5B39G 3HHSA 1I9RH 3GRGA 4JFHE 5GS1B 1YEIH 2G2RA 2VDLB 3EO0A 4OJFH 3U1SH 1Q0EA 3NA9H 2X4NB 1D9KD 3JV0A 4QCIB 3QG7H 3WAKA 3CFQA 4Y2OA 3NTCL 3N9GL 3VI4F 1KYFA 4XE5B 5ADOH 3X1BA 1CGSH 1AHKA 2EDKA 1IVLA 4N0CD 1XGUB 3CUPA 3K72A 4Z7OE 4ZOBA 1UT1A 3C8KA 4NKOA 3U1QA 1EAPB 1NDTA 2GTQA 4M8VA 5IFHL 4XB3A 3HI5L 1MNUH 3PWUA 4DW2H 5FDWB 4GW1B 4HC1L 5B1JA 4B50A 4QR7A 3X13B 1YDPB 5DT1L 4L5FE 5B22A 2Y1VA 4QRRB 1OM3H 4L37B 5JDJA 4OAWB 2AXGB 4KK5C 2BIOA 2DWDA 3VI4E 4DOHE 1I3UA 3V6BR 4IRSC 2VC2B 4L4TB 2J73A 4EBQH 3EOBB 3BIBX 2V7HB 2DD8H 3BZFA 3BDYH 4L1SA 5C0RH 3US0A 1XR9B 1XZWA 2ICEC 1N70A 2ZOKB 2V2WB 4AJYV 3C5JA 3GMQA 3MLPA 2VDNH 1XBRA 3PWLA 3LB6D 4YSAA 2FEJA 2J8UA 3OB0H 3CTTA 1X5GA 2JKNA 2XXCB 2WWNA 1O6SA 3QORD 3QJFA 1G6RA 1HL9A 3FFCB 3TA3D 1FL3A 1BZDA 2K6YA 4YDJB 4MNGE 4KK9D 5JHLL 1CI5A 1YNTB 2DLFL 1BOGB 2GUOA 4XPTL 1FGVH 4LCWB 5TFSH 4QO1B 4CVZB 4TSAL 1TJIH 2WBWB 4JN2A 3RNQA 5BV7B 3ZX1A 4R90H 3CQQA 3CXFA 1QD0A 4DCQA 1S2EA 3MRQA 2V0AA 1BJ8A 3O9WC 4P2RB 1NC2B 4CMMA 4EI5B 2WQ8A 4RFNB 4DSYA 1X7TA 4CGTA 2YAPA 1ILSA 2HJLB 3CDFA 3ZHKA 2OW6A 1G7PA 4Z95L 4O02A 3PWVA 4WW2C 3QUGA 3NJHA 3T1FB 1XL4A 2EO7A 5CN3A 5I0ZA 2ZYIA 3D4CA 5JDSA 4BUGA 2ZF9A 3V4PL 1FV1B 2VDMH 4KK8C 4J39A 3RU8H 2EXYD 4PJEF 2XRAH 3GT6A 3ZKMC 1S7QA 2CUAA 1W8NA 4NUGL 3PGFL 2VITB 3G5WA 2JSFA 2I9TB 3U0TB 2Y5EA 1TQBC 4Y9EA 3BRDA 1QMUA 1DANT 1SJXA 4ZUUB 1DJYA 3MCKA 4HJ0C 4D9LH 1U8QB 2W9LA 3ARFA 3OSKA 5IKCB 4KI5F 1XB6A 4ZO9A 1G7LA 5D71H 2WQUA 4PM1A 1IKFL 3QUXC 4HETA 4AH2A 2ZX7A 3UG3A 5J56B 3F6JA 3UMNA 4X5PA 1WDAA 1DJXA 1QO3A 1G1KA 4Q56A 2VLKE 3V95A 2AK4E 4POYA 3FSZA 1HHJA 5KVDL 1TQCB 5C0AD 3U46B 4JHUA 3S98A 4OSUL 1QVOB 1L4IA 5GGVH 4WY7H 4H8PA 4KX7A 3ESOA 3T2NL 3HCVA 4CC4C 4WLCA 2DL9A 5T3ZE 3TURA 2J88H 1OL0A 3PNWA 5JA9A 3AGWA 1C12B 4P4RA 1M1SA 3QSKB 1MWAA 2B5IB 2YPKB 4HA1A 4QY8A 3SDAD 4QHNB 3K0YA 4KI5E 1J1OL 4DJMA 4F9PC 4MXQC 4RGOL 4WWNA 2Q5BA 2WOYA 2ICWB 1JGVL 1XMWA 3BXNA 4CVUA 1GVIA 5FA4A 4D7BA 3MNWB 2R56H 3WSQL 2GIXA 5KYWB 4TNVF 2B8OT 1QFWM 3CZUB 4V33A 2J43A 1AGDB 1S5IL 1AYRA 1JNLH 1LDPH 3B56A 2ZSVA 2VDQB 5HGHA 2A9NL 4Y2LA 1BG9A 1I9JL 2CBQA 4MYPA 2NXZB 2F6AA 3VSUA 2D4FA 3UBFA 2MHAA 2CHXA 1URLA 5FYJH 3S34H 2O6CA 2DYSB 1FFTB 1GYVA 1WHPA 2BLFA 3P30L 4IM8A 5BQ7A 2H1PH 1ZE3C 3L3GB 5MEQB 3BWAB 4UTBL 1MJ8L 4XBEL 5HSFA 5KSAB 4JMNA 3LKPA 1UOKA 3L3HA 1UWEL 4LKXA 3RVVD 1NGZB 2GG1A 1ZT7B 2X4QB 3NSYA 5JXAL 1A6TB 4LMQI 5B3JF 3I84A 1X6NA 3IDMB 4UAOC 3IWUA 4LCYB 4HAFA 3G5VA 4M61A 4GOSA 5HHXH 4OZIB 4U7KA 2CHWA 3DYOA 2F8VA 4UMSA 3UERA 3QR0A 3FT1A 5BZZA 2GABA 3B2PA 2UVEA 1I9IH 5DUPH 2ZJSL 4ONOA 4MD4B 1SEQH 4XMVA 1S7RA 4Z23A 4K94C 5LAXA 1PDKA 2VRKA 3VD0A 3ZIYA 5MI0B 4FJZA 3OD3A 4KHXL 1WA0X 2ENQA 4PJ7F 4U1KB 4LSTL 5B3JE 2NY1B 1U33A 3MTRA 3MXVH 2IPKA 5DJAB 1F58L 4CBPA 3B2UC 3PABB 4PRIE 5E94A 3VWKA 5EG6C 4OM1L 3DC0A 4RAUB 3OAZK 1XF5B 1SVZA 5JHDD 3T3PB 1Z6JT 4ODVL 3TO2A 5EO9B 1EFXD 4ZYKA 4JPKL 5D9SA 2BNUA 3FOLA 1NBVH 3M8OH 1PIFA 2P28B 2NX5A 1PLBA 3JWOH 4KMQA 1OAXH 1P5VA 2YAOA 4X6FA 4KDTA 2JLLA 4NQVB 1ZA3A 4N2OA 1HOCB 3TH4T 1JD9A 2YMXL 4KJWC 4KAQL 2Y0SA 4PJ7E 5E0QA 5KVFE 3ETTA 5GZOD 2VQUA 1FZOA 1MREH 4OKVA 1X4ZA 1LXMA 2VLRB 1H3TA 2X4PA 5DS2A 1TO5A 1GZQB 1U8JB 2IJ0C 2Y22A 3V6OA 3CH1A 3BWSA 3NJFA 4NCC2 4JRYE 5KSUA 1RUPH 3L1OH 3CLEH 1B4RA 1YMMB 2B3IA 1NAML 1P4IL 1A02N 1F02I 1MCHA 1NIAA 3NRQA 4XC1L 3PFQA 1FLRL 3GMOA 2UY7A 4QOKA 2NY3B 5H37H 1ZHLB 2Q8BH 1HS6A 1CD1A 3VH8A 4OR1A 1EEYB 1Y07A 4XO4A 3O4LA 5D1QC 4QRQA 2GFBB 1G5AA 3ZTCC 5IB3B 2MRYA 4X6CB 2HRPH 5D7IF 5EZJA 2Y06H 3BP6B 2HUEA 3IM1A 4JJ5A 4WO4A 4M6AA 2QQNH 2XSKA 3IRZA 3VA2C 3DJRA 1MVUB 2XQBL 4CVXA 4FADA 1BIIB 3ARBC 3VO0A 3DX1A 4HIJA 3IWVA 5GS0L 5L88H 3KPSD 4IOFC 5ITBL 2VNCA 3BMWA 3VXUE 5T33H 3TXAA 1RAMA 4I7ZC 3LIZL 1BF5A 5FF6A 1LWHA 4N28A 5DGQA 5T3ZL 1N6QH 1OVZA 4HXBL 3VFMB 1I53A 3UADA 3WHE1 1QEWA 2W59A 2R8SH 1AHWC 3BPNB 5JZ7D 5EF1A 1N5YL 3FRPB 5J6GB 1OAUL 5D7IE 3MYZA 3HG1E 1SDDA 3AMKA 4NN7B 2X2IA 1CLOH 4X0NA 3HZ3A 4JY5H 4MDRA 5HJ3A 1ZKAA 2YEZB 1EXGA 4BKLA 1UYWH 3H0TA 4UNTA 4BELD 4NZUH 2OMYA 3MJ9A 4EIZC 4EIGB 1ONQB 1QPKA 2G9HB 1G9EA 1XWVA 3PGCA 3BWZA 3MKGA 3TYFA 3S88H 5CCHE 5LGHL 1IM3B 4Q9QL 4YHZH 1BVNT 3TVMA 3DO7B 3FZUC 1PZBA 1DN0B 3CZFB 5E4OA 5KJRH 4QRTA 1TJMA 3F3HA 3P40A 3L6FA 4WI6A 2YD3A 2R69A 4AEHL 4FKHA 3OKDA 4JREB 3HVNA 4YEFA 2ZOTA 2WSPA 5DJ0A 5FUCE 1RJCA 2BIIA 2C9PA 1A3LL 2B59B 3AREC 1X5XA 2D7MA 5DA4A 1Z5YD 3FSVA 5E2UH 1IEAB 1ETJA 5F9AC 4OLUH 5C09D 3T0EB 1IAOA 3FQTA 4W81A 1EERB 1CN4A 1BAFH 3PQYB 2NOYA 1NCHA 5JW5A 4XTRD 3BX7C 3QEQD 4U1JA 5DFAA 3HB3D 3VYNA 3A6BH 2Q8AH 3RWJB 4X99A 3UYRL 3CPUA 3SGEI 3UYPB 3WY4A 4UOQA 1G7QB 5A16A 5IZ7A 4LVHC 3SGJA 2CBOA 3GI8L 5F7EL 4ZSOE 1G9NC 1QKZH 3P02A 4BDVA 4PTTB 4AY0A 5IB1A 4O5LL 3IMSA 4J6IA 3B3IB 2CUHA 1IGFL 1PNCA 3GINA 3TT3L 4NOFA 1VEOA 1EH9A 3JWDC 1WCBA 1CXEA 4HHAA 1Z5HA 4J3OD 4FZEL 5F9WC 2WZ0A 3G5YA 1YEFH 1O6VA 1BEYH 4KX8A 3QFJB 2UWEF 4UTAL 2WY3B 4F37K 5C07E 5HJDA 3GMMB 3ULUC 2GSGA 4PJDA 4WEBH 3QULB 4UM8B 2XQYK 4MYWB 2W1NA 1YEIL 2QBWA 3PWNB 5K33A 1DVXA 1SXSA 1NEZG 4OJFL 3U1SL 3NA9L 3UTOA 3OKMB 3WJLC 4F15C 5D1ZB 3QG7L 4NBYB 1OCRB 3SE4C 2WXNA 4JGJA 4ES8A 1ND0B 4J3XA 3ZYIA 2AQ2A 3JV6B 5FYJE 5ADOL 3S6CA 3A6OA 1F5WA 1YC8A 4PMEA 5L0QC 1UA6L 2W80C 5C0FA 1JPTL 4TVPD 5AB2A 1EXHA 5F0PB 3TBVA 1L9RA 1WIOA 4YHIA 1V3JA 1KCSH 5GGQH 1D6EA 2NY0C 4QRPA 2UWEE 3FU9A 2BRRH 4ZPTA 3V7AG 4AEFA 4JPWH 5F70A 2JMRA 3GFUA 3H9SA 5DF0A 3PHQB 3MRDB 3FBKA 1TTUA 4M48H 2IAMC 4XAKD 2HT2C 3IJSA 3IKCA 4F2FA 4BSWB 2DTSA 3VTAA 2QDVA 3EH1A 3A47A 3NJJA 1MCSA 1NPNA 3O11B 4K23H 4ZX5A 5LBVA 1PZ5B 4ODTL 5G55A 4AKPA 4EBQL 2PETA 4LLVB 3OLEA 3PF2A 2IDUA 4NENB 5AYUH 3ZKXC 5A2BA 3ESPA 4CILA 5C0RL 4H25A 5CJBA 2X2JA 3KCPA 1E30A 5DR5H 1X44A 3ZTDC 3PHOB 1FYTB 5EV7A 1HE8A 2F5BH 4UT6A 4G6AD 4ODWB 4KQ4H 4OQTL 5C0CB 3D3VA 4AGPA 1K72A 3UXFA 4NB7A 3P9MA 4PJAF 1XVSA 4K3GA 2FATH 4Z0BH 5IT2L 4LSRL 1TJGH 2VE6B 4IGBA 4RA0C 2QGDA 4NLAA 5I75C 1FGVL 5TFSL 4Y4KC 4R90L 3N0AA 2FBJH 3BVTA 5HHOB 4PJIB 3ZDZF 2E9IA 1LM8V 3DYMA 1BEXA 4ZFOB 3BLPX 3CFIC 5D2LB 4LOFA 1Z32X 4WHTB 1KXQA 2BS71 1SJEB 3VI3B 5JIPA 3L4VA 3V0GA 4JFDE 1A3RH 2OM5A 2VERA 2XZAH 5LG1A 3VYPA 4A6YH 3K2IA 4L4VD 1WIUA 4PBXA 4AT6A 1BVKA 2BJML 2E7MA 3CQPA 3BESR 2W0KA 3QT2A 4FQXA 5FYLL 5HHNB 4R2GC 3UABA 1MLCB 2ZG2A 3QDGD 5E1AA 2VDML 1C9SA 1NKRA 1RK1B 1W0VA 2EYTA 4HUUA 3RU8L 4YDLB 4C59B 2XRAL 3CDGB 4ZT1A 3PXHA 5BRZA 3UFIA 3SDXA 1MWOA 3ALWA 3QQ3A 3ZDZE 1XF2B 1NBYA 1N3NA 3EFOB 4DEWA 1Z5LA 5EU6E 1AE6L 3QAQA 1DQLH 2ZXDA 1IQWH 2X2HA 4OFYD 2R23A 5AB1A 1ZS8A 5CMAA 3UIZA 5IVOA 3V4LA 5DVPA 2D31A 5IMKA 4JO4H 4HU2A 1QSFD 3VB9A 5D71L 3OXSB 2YSTA 5LCVL 3R4DA 5FECA 5I1EH 4GXUM 2P5WD 4MA8H 1URZA 4XN8A 4OZFG 3HZYA 4JRXB 1JERA 1HESA 4F2ME 2VQTA 5FX3A 2OSXA 1QZNA 3LDBB 1X5IA 4XWOC 3RFZA 3QUYC 4NKDA 4Y5VC 3SY0B 1CVSC 3C5ZA 5JPMC 1HXMB 2WOBA 4HKXA 3C5SA 2NTFA 4WY7L 5GGVL 3RWFB 1KBGH 4JN1L 4UQ2B 2ICWJ 4HKZB 2NY5L 4N0YL 2BVYA 3RIAK 4RH4A 3HC0B 5KTEH 3AADB 1MPAH 4FERA 1L9SA 1A6AB 4UCFA 4U1SA 3Q43A 2WIMA 4LAJH 5DJXA 4LT7A 1HH9A 3EJPA 3DUUA 3P4MB 1HH6B 4JCLA 4N0UB 1RUKH 5DFVC 1NFIA 1OEZW 2R56L 1NL0H 3BWUF 3FONA 3MV8D 4N8VA 3X12B 3MV8E 4HS8H 2ZPKH 5JOPE 3KPPA 4P5KA 1UTDA 3SCMB 5K9KB 4AZUA 1EBAA 2OCJA 3STZB 1P2CA 2A9DA 1TLKA 4TUKH 2VM9A 2EEDA 3S34L 4AVJA 1UWXH 2BVOB 2BZDA 2H1PL 1B88A 4AM0Q 2WLIA 4LCUA 1GYAA 4FQCL 1M3IA 1H3GA 3V0WH 3S8GB 4FL4B 2KLTA 3EIFA 3QWQB 4JJHA 2F0CA 4QWWC 1UXSB 3GHEH 4PRNA 3L3JA 1MFEL 5DJZB 4WJG3 5EBGA 2A74C 2ZQKA 2BVTA 1JIBA 3SQRA 1ROCA 4IMKC 3OGCB 2QSCH 3D25A 3DETC 2G2NA 4G70B 4M8RA 4PUBH 5DD1H 3TLRA 2HT3C 2Q1EA 3VWKC 3VXRD 1RZKH 2OMVB 4MQ7B 4MJIE 1JXFA 3VXRE 3MQIA 5HHXL 5I16A 1AJ7H 1E27A 1RZJC 4PCSA 4GXUN 1XCTA 2FZ3B 2ZT9C 5DTFB 3SDCA 2UY6A 4Z8FH 1Z1WA 4G59C 2Z8VC 1HXKA 1I9IL 4RGMB 5DUPL 5KYNA 4JLRB 1IBZA 4KXZH 3X2QB 1SEQL 5E4AA 1LEIB 4MQTB 2M26A 1FCGA 2NY6B 3BO8A 4V11A 4Z76B 3COOA 1MRFL 2NTSP 4P9HH 3GXPA 5ESAA 1BMZA 1J11A 3KXFB 1UD6A 4HEME 4UTCA 1WT5C 3MXVL 3T6XA 4ABUA 4BFEA 4HUVA 3HC4H 4LU5H 1N2RB 2GIYA 3V6OC 5BS0E 3OZLA 1E5UI 2ESVA 5CEXA 1Q72L 1UD3A 1WS8A 1RUAH 3T3MF 4PGBA 2IOOA 5PAZA 3TOPA 3B1TA 3CBKB 5BRQA 2ZXCA 4R4FH 2EABA 1XGYL 4XH2A 3QRGH 5CINL 3T71A 2BNRA 4R7DB 2ED6A 3JWOL 3CXDH 1OAXL 5DD6B 2EDQA 2NCEA 4N2AA 1U8KA 2COQA 4PLJC 4ACPA 3NSCA 3NABH 4K3EH 2FJSA 3FTGA 4WGKA 3BP7B 4GFXA 4XO9A 5DMKA 4AMXA 3EO1B 4PJ5E 3MJ6A 2PPEA 1U2YA 4A55A 5SX5K 4ZPVB 1R24A 4X7CC 2A9BA 5HPMA 1EVUA 4BWWA 2BSED 1R5IB 2FK9A 3L13A 3VFUB 4MQXD 3O6KH 2H0EA 4MCYB 1F3DH 3T3ME 5EB9A 3HG3A 3L1OL 3DSNB 3CLEL 3QK0A 4G6KH 2LE9A 4ZX3A 3VJ6B 4QRFA 4K3JH 4LLYA 3RGVC 4H8VA 3NEEA 4F8OA 2GQHA 4F7PB 5I8KH 2XWXA 4IBUA 2EIDA 5SWSA 4P3CL 2Z0UA 1EHKB 1Q9LA 2HLFC 2JV6A 4IOIA 1H3WM 2Q8BL 2JVUA 3GEWB 3RUGA 1SY6A 1U8PA 3T2OA 2Q76A 2GY5A 4LPXA 2C4XA 2AQSA 1HC1A 2GJ6D 3PWPA 2K0RA 2J44A 4F7MB 5K1NA 2Y06L 3VMNA 4Q89A 4L8BA 3O3BA 2QQNL 4Y5XA 1H5BC 1SJVA 2Y5TB 3HE6D 1T6VN 4HUNB 1AQDB 4X7SH 3WY2A 3K6IA 3QDMA 1BZ7A 2Z92B 2EDTA 1AGCB 4NQCD 3WN5B 5TQ2L 3WFEL 5E6ZA 2IMMA 4J3SA 1K5NA 4LSPL 5FK9A 5JYLA 4R9HA 3OXRB 2Y69B 3MV01 2R8SL 1CJYA 2YZ8A 3IVKA 1G9MH 2Y7MA 2FWUA 2EDBA 4HLEA 5KOMC 3I9GH 4NQDE 3B6SB 1AXSB 4R83A 1G87A 1TIUA 4JANB 3A6CH 4GAYA 1UJ3A 2Z6FA 1CLOL 3FQXA 3U30C 3OMZA 4JY5L 3WLBB 5I1LA 2YKLH 2Z64C 2VR9A 3MLSL 4CBZA 3TT1H 2QZ5A 2WXGA 1TZOA 3VGHA 3QA3A 4EIUA 3AQXA 1GS7A 1T89A 5I26A 2ZUYA 4GKSA 1AMYA 1M57B 4WTWA 4XNXH 4XXWA 4KKAC 3SJVA 5AYTA 3VWJC 3V5KB 1FI8C 5FKAB 2GB2A 3MSPA 3E9UA 3GHBH 3C9NA 3D2TA 4WUUE 4XI5D 4YHZL 1GPOH 4PJFF 4QAMB 5TTRA 3LEVL 5DO8A 3OGOE 2CAKA 3JYCA 5EBWB 2E6JA 2YK1H 2I27N 1X9QA 5L8KB 3IN0A 3LQAC 5D4HA 3RAJH 1PS3A 3NCWA 1D5XA 1NGYA 4KZDH 4M6ML 7FABH 4DO6A 1AD0A 1J8HB 3DJSA 3UPRB 4PJGF 4GG6F 1TYRA 2UYLA 2ZWSA 5E2UL 3BHBB 5F7AA 4LF3A 4A2HA 3EJYC 1F11B 3QR1A 1HDMB 1U8LB 1UB5B 3NBNA 2AEIT 2CPUA 4KROB 4JDEA 5E23A 1FZJA 3MR9B 4L3ED 1TVBA 4APXA 2Q8AL 4NUPA 2PCPA 3QS3A 1H0DA 1E43A 2F18A 3OJDB 4MJ6A 5C0JA 1WBXA 2GKIA 3F7PC 4OI9A 5EZLA 2MQCA 1PTZA 2A1WL 5KUKA 4F1ZA 1P4LA 1KXVA 3NFPA 3Q5YA 1DUYA 4KVNH 3PHAA 1T7VA 1Z9SB 3U0WH 4JCMA 3NN8B 4J23A 1FBIL 5CP3H 1K3IA 3AU1A 1J1XH 4PJGE 3WELA 1FORH 3BW9B 4GG6E 3MBEA 1E8YA 4XCFL 5C08A 4FTVE 4HKBB 1YEFL 5ISZA 1BEYL 1GZPA 2IH3B 3O45B 1FPTH 4A7SA 2X44D 2QKIB 4LO9A 1SOSA 4BZ2H 1RZGA 3QXDA 4IEFA 4X5WB 5LDSA 4OIBA 4ABVA 1MOEA 4WEBL 5T1JA 2OMTA 1FUNA 2HJFB 3GBNL 4DPCX 1HEZA 3BN9D 2HJKB 3JWNC 2Q0ZX 1CT8B 3OHXB 1IQDB 1XGRB 1IL1B 2K3HA 3AB0B 1HWWA 1D5IL 3EYVA 1KACB 1CFNA 4I0PC 2UXFA 4MZ3A 4W4OA 4X4ME 3ZYZA 4N8PA 4PRBA 2FEDD 1PVHA 5C0EB 4J5VA 1A4KB 1S9WB 2YRZA 4H44C 3SDYL 1L0QA 3FT2B 1KMGA 3ARVA 5IIEA 5HI5D 3ES6A 3QC5X 1KCSL 5BPPA 1ZA6B 3Q9QA 4EMZA 3FQWB 2BK8A 1I1AA 2BRRL 4IW4C 5JOEA 3VH8G 5C0IA 5TDOB 2XWTB 3OKKA 4N1CA 4FQHA 4I3RL 3VD9A 2AMUA 2HFFB 3OR7B 1C5DB 3K6FA 4JFEA 4JM2D 5DJ2A 3TN0A 2PMZA 3KLKA 7PAZA 1LP9F 1CFSA 2EIMB 4Z7VA 4BZ1H 2BWQA 5DHVB 1B9ZA 1CG9A 3S7GA 4MNHB 4OF7A 3D0VA 3UBGA 4OCYL 4K23L 4GLRH 2BO0A 1ORQA 2DQUH 3Q44A 5KSBB 2AEQL 5AYUL 1CVRA 4J3BA 3OAYH 1JPGB 2F7IA 3P4NB 4LPVA 5GGSA 4E41A 4XXCA 3CMGA 2JJSC 5DQDH 5A43C 5AQ0A 2IO5A 2R4SL 1HU8A 1QASA 1XR8A 4YPGB 3QWNA 5GIRB 2F5BL 1JGEA 3BQUA 1ZANH 3O2VH 4KQ4L 1LNUB 5G4NA 4GINA 1O9WA 1KPVA 2V6HA 2WCPA 5GHWH 1QZ1A 2AQRA 3MRCB 1E9QA 4Z0BL 4E5XB 4YHYB 5HYEA 1LP9E 3MRMA 2HX8A 4QUOA 1YAIA 4GEIA 4K3HA 1AAJA 3R4RA 2W0FB 5EO0A 3V0VB 3HMWL 3OG4B 3U4AA 1AR2A 2FBJL 3PY9A 1KTDB 1RFDH 5FV2A 3WTTA 1AG0A 5E7FA 5H4YA 3B8SA 1USZA 2CO6A 4P2AA 4P23B 2VJ8A 3GSQB 5CJOH 2VDPH 1ED3A 1JK8A 1NFDA 2JTDA 5JR1L 4ELKA 4E9XA 2AI0L 3EFDH 3GZOA 1KXTB 2XZAL 3LNFA 3WIHH 4A6YL 4LCVA 1JDDA 2DTMH 4FAAB 1T80A 4GRMB 1YEDA 3GO1L 4TF4A 3G9VA 4GEJA 1UHVA 1E2ZA 3SSGA 2RCSH 4IKLA 4RLDA 4BFJA 1J1PL 3I75A 1TQVA 1OIOA 2DQMA 3D5OF 1FFPA 4JHAL 4G2AA 4LLAA 4NYLB 3VAEA 5BVJA 4MB3A 2CXGA 4GQ9L 3SYAA 1DQLL 4ZD3H 1HSAB 1Q0XH 2KZKA 4XCEB 3F5WA 1ITCA 2P24A 4JO4L 4DEPB 3Q9PA 4OLWH 1L6ZA 1D5MB 3OMNB 2Y6SD 3GSUB 4PY7B 5GS3A 4EDXA 5D7LD 3K81A 5D7LE 3SN6N 3FU6A 1HQRA 1ZGLA 4OV6F 4MAZA 3L1GA 3JUZA 3FUDA 1WZKA 2CO4A 4XXDB 2B0SH 2J25A 4XNMA 3TZVA 5BV7C 5ICZB 4S1DD 5IQNA 4G11A 2Y2TA 3MJ8B 3LYRA 1CGXA 3DBXB 3HN8A 3BKYH 3G5ZA 2GK0B 4EI5C 4ZUVB 2DQ6A 5IP4A 3CZJA 5AAMC 1A9BB 5KTEL 4RFNC 5C8JB 1MPAL 1YEGH 4LEOB 3K74B 5BZDA 1PEWA 4YL9A 5DHMC 1A4CA 2GAZA 3IDNB 3IGAA 2JCCF 1QSZA 3HPJA 4ZFFB 5TD4A 1RUKL 4N5ED 2XN9A 1BQHA 3WIFB 4XPAH 1EPFA 2X0WA 2ADGA 3KR3H 3RHWK 5FGCE 2IQAB 2ZPKL 2F74A 1QBML 3WV0A 1R46A 3HUJB 4JZJA 1Y18B 2GCYA 4N2FA 2O72A 4K2UH 1PD6A 1A7RH 3T04D 2KHAA 1HN1A 4TUKL 3II1A 3GSWB 3VGFA 3H54A 3V4PB 3M1BA 4KK6D 4XCCH 2FO4A 3KJ4B 3RFRA 3Q2VA 2NR6A 4NDMA 5FGSA 3ZKND 4MCMA 1OP5H 3ARPA 3HMXH 4L0ZA 2JCCE 3BKJH 2I07B 2PO6A 3GHEL 5EBMA 2X1PA 1EEZB 4M7LT 3GPSA 1FWXA 1MFBH 2QSCL 5DD1L 3D2UB 2BHYA 4GKNB 5K93A 2P45B 1JZHA 3APNA 3UTSD 1JBJA 4F2EA 2CD0A 2X70A 2Q20A 1XAKA 1JDCA 3FTVA 2UZYB 3RWCB 4UB0H 4MD0A 4DKFH 4GUPB 3T1WA 4OH2A 4S2SB 1KJ2H 4WWKD 2FH8A 3CAFA 3LN5A 4MTMA 3L95B 1I8MB 4K7PX 2B5IC 2A73A 1LHZA 3VSQA 3OKEB 4JQXA 3V0FA 2XC8A 4K15A 3M7OA 1ZE3H 1U3HD 5AOIA 3EJJX 4QYAA 3WIIH 3SQOH 4QHMB 4ZFQA 3HLAB 2OMUB 4OW6A 2XACC 1TMCB 4LU5L 1KGCD 4UV4H 1BQSA 3VFRA 4C4UA 4LLMB 1A4JA 4P46A 1QUNB 1WD8A 4XCYA 5C0BE 1F6AB 4S1QH 3CVHA 3QRGL 4UUJA 1RU9H 3DI3B 4KJQD 4WUKH 4IRZH 3P1VA 3VXOB 1ZT4A 4W9DC 5KSAC 4X7TA 2Q3XA 3H6AA 3ZZSA 3NABL 4K3EL 3MRBB 1D9KB 3HKFA 5J1AB 2FGWH 2OXHA 3B7SA 2OTPA 3NT0A 4KKCC 3ARYA 2CBTA 2QHRH 2A5UA 2VOTA 3EBIA 4K94H 3LZNA 4AIZA 4Z7OB 4PY8J 4W9IC 4Y5XC 1D7DA 1QSEA 5D2NE 2D3NA 2R0WH 5JW4R 4JS7A 1SLWA 4S0SD 4G71B 2EIZB 1HZHH 2NUTB 5F7MC 4XCNB 4WWID 2CBPA 2NW2A 3KYKH 1LMKA 1PY4A 3NRFA 5BVPH 1FIGL 3RDTD 2XICA 1MIMH 4OF5A 4I1PA 3H9HB 4K3JL 2GVYA 1MCFA 3RX5A 5I8KL 1JN6B 2L7JA 4N0FB 4P3WA 4HZLA 1PJ9A 4Q14A 1CYWA 1XBDA 3D9AH 4Z3HA 5MI0C 3VI4B 4DOHB 1YN7B 1NCCH 5FHBH 5I82A 4P2QD 4MA3B 2NY1C 2VZUA 4P2QE 3WL9A 1YYLH 3WUWB 3QUKA 3DURB 1S7TB 3QJXA 2CR0A 3LIUA 2OJZL 3QIUB 3P4OA 3K5RA 2LU5A 2X6VA 2ATPB 1WSST 3D18A 4NZTH 1YPZF 5IMMB 5EEXA 4HISA 2VMFA 1OGAD 3LHPH 5A2FA 1CO1A 3UZEC 1SF5A 4KRMB 1ZVHA 1OGAE 4ZUTB 3QORB 2VH5L 1XF4B 2VMEA 3TA3B 1BF8A 4MNGB 3WKMH 1CXHA 4NEHB 5C0GB 1P7BA 4QGYA 5E8EB 4N8VG 3HG4A 1G9ML 4U1NB 1E4JA 1WAEA 2F1BA 2BVPA 3I9GL 1NCUA 1LL1A 4LPTA 3ZPDA 1JVOA 4N86A 4TNWK 3QFDA 5DA0B 4LCCB 3A6CL 2C7UB 3ZSSA 4UOW1 4PJ9D 4U33A 3CDYA 1GIGH 4ZK8A 2YKLL 5IVXA 5KS9F 2ZNWA 3L3KA 4FXLA 3TT1L 1P69B 2PW2A 5E4IA 1KYOK 2VDRB 3NJKA 4FDWA 3UAJD 1YPZE 5E99H 3MLUH 5FA3A 4XNXL 2WBJA 1SYSB 2QMKA 1NCAL 3WY3A 3H2PA 4MAYB 1A1MB 3C8HA 3GHBL 5DZ9A 2F54A 3U4EB 2VMDA 3TO4B 1GPOL 4Y9GA 3L7FA 3N43F 2JQMA 4NC1C 4WW2F 2W65B 4XPHH 1LO3H 2APWA 5DHYA 1D5ZA 2OSYA 3RAJL 1CB4A 3NP4A 3MGAA 2QQKH 5I6KA 2WSKA 3CG8A 3DX4A 5M94B 2FO1A 4C58B 7FABL 2P7TB 5KS9E 2CIIB 4JO1H 1IGJA 4ONGH 1MFDH 4I9WE 1N59B 2YAQA 4AQ1A 5IJDC 1JI1A 3LH9A 3ARGD 3ZHLA 4EO5A 5ANHA 3DX6A 5FYKH 4BSJA 3F7YA 3NZ8A 4R96A 2AFNA 3TGXA 1MCPH 4GRLA 3GZKA 2PP8A 2VLKB 5CGMA 4Z7QF 2AK4B 3DIDA 4W6YB 3MKKA 3BPNC 2Q7YA 1CFQA 4RIRB 2PPDA 4APQA 1DQIA 4F24A 4WI9A 3VCLA 2ZAHA 2WM0A 1VAHA 4PJ8A 2PF6A 2MKWA 5F0MB 3LZRA 3EXLA 1XF1A 2WD0A 1U2CA 1J1XL 4PTUA 4OZFH 5FOBB 1FORL 5E6ID 4ZXBB 3SDAB 4X4XA 3HC2A 3M07A 1B4TA 1DJHA 1N5AA 2OP4H 1FPTL 3WDIA 3RY6A 2IDSA 3ULVD 4YHPA 1YYMH 4KFMA 4BFIA 4BZ2L 3ULVE 1KB5B 3GC3A 2BRQA 2C9XA 4NUQA 4X9HA 2NDGA 2QPUA 1VGKA 1NGQH 3CVBA 4XO5A 5E6UB 4BZYA 3QDJA 1GMEA 3KLAA 4CADB 3GBLA 1NC4B 3KPRD 4FA8A 2ZCLH 2NY4D 4E36A 2K6WA 4JREC 3W9DA 4HWEL 1KJ3H 4P4KB 1YY9D 4C54A 1JHTB 1U3YA 5EEWA 4YC2C 3T6VA 4HV8A 1G9NH 4PWJA 5EU7E 3P4LA 1QHQA 3NQKA 4YDZA 4XXCC 1C5BH 1EZVX 1RSYA 3RVWC 3T0EC 1R5WA 1IRAY 1EJFA 2ZOLA 3WXWL 3A22A 2WXFA 5HHQB 5KSVB 3BKML 1KIRA 3JWDH 4ZDHB 3O2DH 1TJHH 2R83A 4AL8C 4M3HA 2D7PA 5E2VH 4ETQA 1U8MB 2DWEA 1OTTC 3WFZA 4DNLA 5DD3H 5B3NA 4QEGA 4ZMOA 2WZAA 5JW3H 1N64H 4HD5A 3ULUH 2YUVA 3QPQD 2P44B 5HY9A 5CWSA 3RKDD 1H8SA 4ZW3A 4C83B 3U48A 2EJ1A 3K4DA 4U6VH 5C9JB 2H2SD 2DJ4A 3SKNB 5ID1B 1F4AA 2DIJA 2VZVA 2DQUL 4J3VA 1IAIH 3FU7A 4HIHB 3QRBA 2IXQA 3H4FA 3BN3B 1XXDC 4R5VA 2QADD 3NJGA 2EZ0C 3MROA 5L8JB 1L3WA 4J1UB 1QHOA 3OL2A 2AQNA 4G8GE 3W0WE 4OJYA 4LPYA 4PRIB 1U8NB 4HD9A 1JRHI 1G0XA 2E7DA 5GHWL 4WEMB 4FFWD 4PN6A 3BD3A 2DI9A 4I87A 1QACA 1JGDA 1FVCB 2N59A 1G6RH 2DW5A 2VCOA 5D1ZC 3Q05A 3V0JA 5MENA 3ARQA 2F9BT 3WS3A 4HIIB 1THCA 4KU1A 3CCHB 3TTYA 5D4QA 1FL5B 3ARTA 4PB0H 1RP9A 1S9VA 4PJ7B 5AVSB 5CJOL 3D52A 4N26A 1EDQA 2VDPL 3RVTD 3KPQB 3AXLA 1L3NA 3MNZA 3DXAA 4A66A 1Z2KA 4LGSB 1P84K 2IBZY 4HIEB 3I3BA 5I6MA 3LOWA 2DTML 3VTTA 3C6LA 5E1IA 2I7OA 1B2WH 3OX8A 4NNPH 4ODHH 5HYJD 4O02H 3K6OA 4JRYB 3R06A 4RCAA 2FJFB 2R2CA 3MUY1 3TZVC 1SXBA 4BE5A 4NQSB 3FB6A 3S3JA 3OLIA 2VDKL 1AQKH 3SPVB 2ZUQB 1UXLA 1EHLH 5F2FA 5BO1H 5DEFB 3VW3L 2BP3A 2GTWA 5D7JA 1HILA 2WB1A 1U58A 5C1MB 2X9ZA 1Q0XL 2XVBA 4ONHB 3VQLA 1UXWA 3BP5A 3LHAA 4I4WB 4X83A 3G6AB 2AEOA 3V7AE 2FUTA 1CICB 4NKQB 3RWEB 4X4YA 1A7QL 3MLTB 4A2EA 5BXFB 1VCAA 5H94B 4FCAA 3X1GA 3KYNB 4YHLH 5I1JL 3ZMNA 4U49A 3AG4B 2WO2B 3VXUB 2VDNB 3CC5A 1CGWA 2EH7L 2GBTA 2KERA 4GSDL 4RETB 1DBJL 3SGDI 3G6JA 4DK3A 1UVQA 3GXNA 3NCYS 3ZT5A 1K8IA 3ZE2F 4N2BA 3BKYL 1FO0A 5AW6B 3VSVA 2X89D 3QIWD 1R0AL 2AJSL 3W5NA 4ES9A 4GY4A 1N12A 5D7IB 3V9EA 3ZO0A 1MCOH 3N50A 4L9LB 2K78A 3HG1B 1MI5E 2X3CA 3WAJA 2N0MA 2N3JA 3QCUH 4OJDH 4XPAL 1RIVH 3X14B 3KR3L 5I0WA 5I71B 1AS7A 1AIFB 3QG6B 1W9XA 4YAQA 3QNXA 2MOGA 4GUCA 5TPWH 3ELAT 2ISDA 3RL1B 3DK0A 4YDLC 3ENEA 4U1GB 4CVWA 4K2UL 1EJOH 1CTNA 2FLMA 1TENA 1A7RL 2CBMA 2XXMB 4RFEA 1DSFL 2OI9B 4U7MA 3WOVA 3IJ8A 2OZNA 1LEKA 1E3ZA 3ZE2E 3DBSA 1E28B 4RQQA 1A1NA 5CILL 3VE0B 2P5PA 1AP2A 1BAWA 3NG5A 2J21A 3IDJB 2F7RA 4JQXC 1MY5A 5F7DB 4I8DA 3HMXL 5DJCA 3P2TA 2A6KB 2ARJA 4JFYA 5JORB 4Y4FA 1COBA 1FAKT 2J5LC 1A4AA 2ZX9A 4XNZB 3S4SA 3PDGA 4KPHH 4K55A 5DRXB 3RIFF 3SO3B 2CDEA 2R4RL 2QV4A 3TIDA 1BBDH 4BWTA 1Z66A 1B3IA 3T0VA 5FYKE 5LXVA 3NSXA 2WQSA 3PS6A 5G5DA 4UB0L 5CJ8A 3OJMB 1KJ2L 3MUZ1 3SGKA 3MGTB 3ZTNH 1TCRA 1G5GA 2JELH 2W0LA 4M62H 5I1KH 1F6FB 3OKLA 1FC1A 5DC4B 2CUMA 4ZSOB 3BPOC 2JWYA 3NSJA 1O7DC 5CBAA 1QLRB 1NH6A 1YUHB 2V9TA 2WMPB 4ZTEA 5T5FA 2RB8A 4JFQA 2YPLA 3WIIL 3V10A 3RP1A 3N5AA 3VXQB 2JKXA 4EDWH 1RJYA 4R97B 4JBSA 3RVUC 4NP9A 4ZMXA 4DVBB 3VGGA 3WFCH 1BQ5A 3Q6GH 2MEJB 1T66D 4H26B 4GSUA 5C07B 2JB6B 2ZWNA 3KWWB 3GI9H 4S1QL 4U1MB 4UM9A 1OAJA 4Y5YB 4PP2A 1F4HA 2GSIB 1GOHA 4OZGA 5LQBH 1EANA 1RU9L 2E0PA 3REWA 2K45A 4WUKL 4GFTB 2PYFA 3PCYA 4LFHD 1JGIA 4DK5A 2WLYA 3S36H 8FABA 4FL4C 5T1KD 2FGWL 4R4ND 1IM9A 3FSAA 3RWHA 1MZYA 1MFVA 3VDAA 1RKRA 3DTXA 1K4DA 1XIWB 5EOTB 4K94L 2EDLA 4F7KA 5KAQG 2CKNA 4XO8A 1TO4A 4XC3L 3NIDF 1XX9C 5ESQB 4NM8L 4QTIL 2VIRA 5IB5B 4UBDD 4ZUSB 3GMRB 3CN0A 3U7YH 4DVRH 4X6BA 5I5MA 1BJ1J 2AJUH 2UWEB 1HZHL 5J3HC 4TQIA 3CFJA 2ZKHH 2WYZA 2YQ2A 3KYKL 5IK3B 5BVPL 2QL1A 4DZBA 4GQQA 2BMKA 5IHZB 1MIML 1IC0A 4RGMC 3GJFB 4FLSA 3DK2A 4YR6B 2J1KA 2NY6C 4FG6D 3RZCB 4KHTL 1VHPA 3ULUE 3TBTA 1XXFC 1NGXA 3D9AL 3LRSA 1RZ8A 3FQRA 5KBNC 4XX5A 2R1XA 1NCCL 4WQOA 4QXTA 2XVLA 3ZHNA 5C2UB 3MLZL 3NIDE 4G42B 5CHNA 1EHAA 2NY2D 5E8DH 1CFVH 5ACLA 3TNNB 2X1XR 3VRLF 4ADGA 5MERA 3QEHA 3D0AA 4LSDA 3V52H 4GJTB 1OAQL 3KDPB 3VFPA 4OLEA 3DYPA 5MEPA 3R19A 3LHPL 1IAKB 2A6DA 4LE8A 5IHHA 2EC8A 4EUPA 4ODBD 3WKML 4HQQL 4BQ6A 2HVJA 1BQHG 2J8UE 3SDDA 5DK0A 5FYLD 4MDIA 1MFUA 3QQ4A 2IH1B 4LOEA 1RPQA 3DX0A 4UQ3B 1XHHA 3BVDB 4TTDD 2DBJA 2H3XC 5ERWB 5E9DD 4AGOA 2HRHA 5CJXC 5J5EA 2R29A 1O7VA 2P5EA 3BEVB 5DS8B 1GIGL 2A6JB 3KL5A 3VRLE 1WAPA 1U30A 2XETA 3MV7A 4UZGA 5F7YC 3G9AB 4KUCD 3W37A 2VXSH 1OTSD 3P11L 3NAAH 4MBRA 1OWRM 1CTMA 2OR8A 4JFDB 3TYGH 5E99L 4Q6KA 4PLOB 3MJ9H 4F58H 3QI9D 1IGTA 3GSOB 3O0RL 5F7KC 4WW1A 4YFDB 5DRZA 5K39A 4DAGL 3TTSA 3RJQB 4IJTA 5DURD 5F89A 5KBDA 2A77H 4M43L 2AJ3A 3IJEB 4XPHL 3ROLA 1S7WB 1XF3B 3RVXD 1R19A 1J05A 3GRWA 3ZDZB 1F42A 5FW8A 4BK8A 2EICA 3CVCA 5JPNB 3LRMA 2QQKL 3DMMD 1OW0A 2R69H 5EU6B 1P5UA 4JO1L 4XP9L 3HN3A 4ONGL 4OD2A 1AR1D 4GS7B 1MFDL 5AL0A 3PJNA 5SV3A 2ZG1A 3ECUA 1RP8A 3D4YA 4WSGA 4U4IA 4JY4A 4PV9B 5CP7A 4YNYB 5DQJB 1HJCA 2FQFA 1T1ZB 3RY6C 4H13C 1UFUA 3P3TA 1MCPL 2K6ZA 4LSSH 3RIKA 2EYRA 3WN5C 2E7BA 4HCRA 1X5ZA 5IJBC 2VR6A 5DJYA 4XVTL 4Z18A 4F2MB 1RZIB 4RZKA 2C9RA 4GPVA 4PP1D 4Z7WA 2HUHA 3GEFA 4Y0GA 1H6TA 5INCA 1P9MC 3D85D 4HF5H 1PIGA 3SKJH 3UO8B 2X1QA 3ESUF 5CKGA 1JCKA 1YZZA 2X4TB 5HGDB 2J7LA 5CZXC 4D94A 1BAGA 3LKNB 2X7LB 2APTA 3NQIA 4H0HB 4TKWA 5L2KA 3UBHA 4I48B 3E80A 2JIXD 2XXFA 3I6GB 4JY6A 4LLQB 4PGCA 1OGPA 5IHLB 2OP4L 3PJLA 1LK3L 1BZ9A 1NCWH 1ITBB 4HU8A 1Q9KA 1YYML 1A7PH 2H3NB 4HUXB 3BUYA 1PYWB 3EDEA 3O3DA 3CZKA 5E6RB 2PXYB 1JYVA 1T5WA 1N9PA 1NGQL 1JNHA 2D7TH 2V33A 4PREB 5IWLC 2X87A 4GQPH 4WFFE 3LY6A 5E7BA 2ZCLL 1XTLA 1WO2A 4LESA 3GB7B 4GBXA 4CL7A 2WNXA 1TU2A 3PU7A 3QUZB 2CNYA 2ZWZA 1KJ3L 2BSTB 3PAVA 2MTAA 1IGYA 5E8NA 5GGSY 4KC3B 3ZE0F 3V79C 3KH4A 1G9NL 4R84A 1GW0A 4LP5A 1CXLA 2C1PA 4HJIA 4ODSH 1B4JH 2VJ0A 4XNYL 3RRQA 3FCTA 4ETYA 1FH5L 4EF3A 1K2DB 3NCJH 2Z31B 3JWDL 3DUSB 2P26A 3IMUA 3O2DL 4KROC 1CD9B 3NCEB 1BREA 3L4CA 2ZTBA 1X5MA 4PRDB 1ZLWH 1IBGH 3EH3B 5E2VL 4U6HB 2I60L 1G1YA 2F5AL 2YLKA 1C8QA 5DD3L 5DJDB 4B9CA 2EE3A 1VERA 4MJIB 1CE1L 5JW3L 3EJQA 4PR5B 3ULUL 2EEBA 1L7IL 3OV6A 2X4OA 4Q97A 1Q1JH 4JPIA 1J5DA 5LGJA 2JKRM 4S0HA 3EG9B 4NJ9L 4JKNA 4U6VL 2J4WH 3ZE0E 1JPEA 4KUZL 3FH8A 3G04A 2FYYB 2H4EA 2VABB 2B1HH 1CDHA 1T3FB 4J2XA 4TRPH 1XH3B 1XT5A 3U9UA 3W11C 2QKIC 3BC9A 5I8EB 2JJTA 2R39A 3EYUH 4UIMB 1K5WA 2B4CH 1YUKB 2NYKA 3DECA 1B6UA 1PGRB 1W0WB 4PGZA 4HWUA 3C6LC 4G3YL 5BS0B 4KBPA 1BYNA 2YEVB 4IBWA 5C0AA 3BUDA 3OHXC 4NKMB 1HHGA 4LL1A 3AB0C 2DQEH 3CZEA 1M2VA 3LN4A 4G83A 1JMXA 3CIQA 1JV5A 1C16B 2KMWA 1ASOA 1T7XA 1JPFB 1SJHA 2EDHA 1IILE 3U0PB 4JKMA 4JKWA 1I1FA 4PB0L 3KDMA 4C56D 3ETSA 2WW8A 3T5WA 3TASA 3VRIB 2NX5E 4PJ5B 5KYXA 3SZ6A 3T6QC 4YUEL 4QHKI 1EAJA 2J12B 5F7BA 1WBZB 4JHVA 2VR4A 1MHHB 2GJZA 1FVDA 4ODHL 1B2WL 1LWRA 3JVGC 3NVQA 2FECL 1NANI 2YFOA 4RAVB 3T65A 3CDCA 3QJSB 2YPVA 4K8RC 4MRBA 3T3MB 5JUEH 3ALPA 3ZZQA 3PV6B 4LGRB 1DQJA 3EGDB 1ZWIA 4MMZA 2OS7A 2NW3A 2ODIA 4YLBA 2H9GB 4AQOA 3ECWA 3EOAB 1W2KT 2PCFA 2VDLH 1SMAA 5EO1A 2HFTA 2O6DA 2VLJD 5BO1L 3UCRA 3I6KA 5JIKA 3VXNB 4HH8A 5GGRA 4DP0X 4LLWB 5IG7A 1MEXH 3F7KA 3OAWA 1OSZA 4QOKE 4FQLL 3HG5A 3UJIH 4OGAC 3APDA 3VA6A 2EC9U 5LBSL 3O4LD 5J9PA 4XP4H 3O4LE 4NO2B 4PI2A 3EXJA 3A21A 3CZGA 4YHYC 4NRXB 4WO4D 1RUMH 3S9DB 4G43B 1I7RA 4ZUWA 1BW8A 5F72S 5JW4M 1H8OA 5GRXG 2CO7B 5DLLA 3SYOA 3GXFA 1PCXA 2ZOOA 4RZCB 4W70A 1TZHA 4Y4HB 4WJ5B 3F12B 3MRHB 2XX1A 3IFLH 5IEHB 5JQHC 1MJ7H 3JT0A 4AE0A 3IJHB 5EDSA 4YGVA 1KTJA 1YSOA 3F7QA 4NQDB 2KLSA 4P23C 1ACYH 3WHXA 1NWOA 4TVUA 1HFUA 4Q0XL 1NC2A 3TFBA 3ZJAA 1MCOL 3HJ0A 4G8IB 1IGIH 3PL6B 4TXVB 4Z5RA 1JVLA 1VFUA 1VLXA 5ACZA 4U2YA 5IFJB 5IHUH 3FH5A 5KVGH 1L9MA 2J1ZA 2ZSWB 3QCUL 4X6EB 1RIVL 1KPUA 1N18A 4Z3FA 4NSKA 3VFOA 3PJSB 1BBJB 5JHDA 2ZZUT 1Q1PA 1VFBB 2VLLB 4DPRA 1EFXA 3WE1A 4K73A 1EJOL 4XRCA 1B0GB 1FV1A 1I8LA 5BUAA 3ZT7A 4WUUB 2FB4L 2HRGA 4A6YB 1R34A 3M7FB 2RJMA 3QUMH 3SOBH 1OB0A 1TZGH 2DBLH 4YSDA 3GHPA 4HALA 5ETUA 3NCXA 5BV7H 1HT6A 5FUOH 4K7PH 1R3KB 4AMWA 2L7EA 1GGCH 3IMTA 5ESVA 5IW6A 3QQDB 4DEPC 2R1YA 4JUSA 1NCIA 4Y1SA 2FHBA 2VO8A 1GHFH 5GZOA 1PLGH 4E68A 4RMRA 3WFDH 3ZL4L 4TL4A 1CMOA 2JXMA 2LW3A 5IROD 4UDTB 5EOCH 2BOBA 4E9LA 3FO9B 5IHWA 1CU4H 2EE2A 3BEWA 3S5LB 5IEKB 1PX3A 5F1NB 4P04A 1BBDL 1OCZB 3VFSB 4NRYA 3RKPA 3VXTB 2UZXB 1CXIA 1F1DA 3T77B 3GSXB 4P5TD 4JHWL 4AJWA 4PJFB 3HRZA 1A7NH 3CMOH 1KGUA 3B9VA 3EOTH 3F58H 4OVUA 3ZTNL 2JELL 2LQRA 5I1KL 4XGZA 4M62L 4MJ5A 4JX0A 3NA4A 5EUKA 2PTUA 2X4SB 2WYTA 1PG7X 3VMPA 4OV5B 2YBRB 4GO8A 5TDNB 2PP9A 4PJGB 5F3BA 4P2YA 2ADFL 4GG6B 3WXVH 3H3KA 3NH7L 4FTVB 4EDWL 2WXRA 5AB0A 1M3JA 2VN7A 2CLRB 3GBDA 1K85A 3K6SA 1FFNA 1FNEA 4F80A 3KPSA 1INQA 3CBJB 4BE6A 1KPRA 3OLGA 1SM3H 5C6TH 3F05A 3B34A 4FHKA 5T3XD 2OMXB 1RZJL 1LGVA 2KT6A 3P2DA 5KW9H 1T0MA 1OGTA 3KJ4C 4LVNB 3L45A 4PJDE 3S36L 4R0LA 4S0TD 2NNRA 3H7LA 5EEVA 3WHE0 5I8CB 2CRZA 4XHJC 4JZNA 3OR6A 4I18B 4U6YB 3J07A 5HVFB 1LO5B 2D73A 1NGZA 5HHPB 3EGSB 3ETBF 2WZ5A 3E6FA 4HOWA 1A6TA 2V3DA 4NIKB 4IHOB 4NO0D 3U7YL 4DVRL 4FXKA 3SKOA 1VEPA 3KL3A 1KC5H 1W0YT 2WLMA 3DRTA 2QJDA 5KBMA 4QRPD 1QFWL 4QRPE 1YN6A 3WNNA 4C4KT 3NJLA 4JFOB 4PJXA 1J9RA 4HWZA 3H9SE 3SBWA 3SDDC 1WFJA 2VTFA 1NAKH 3TJEH 4PRAB 3ZT6A 5DD0H 2QTVA 1ZLVH 4TNGA 4TUJB 4F3FB 4OIIH 4NN5B 5SWQB 1YQ2A 4JHBA 4P59H 2OAAA 2JI1A 2XWJA 4KRPB 3Q2LA 1HI6A 3QNFA 1CFVL 1MAKA 1XEDA 2AQ1A 3H9ZA 5DJAA 1CWVA 1T6WA 1DBMH 1J88A 1DVFB 3KPLB 5C09A 3V52L 4AYFA 4HFWB 5D72H 1G43A 4PY8I 2Z91B 4YSOA 5FCUH 2EKJA 3CBRA 2O30A 3DTDA 3QEQA 3E6HA 2Q7AA 3PAZA 3H85A 4NQEA 4ZAKD 4AK1A 4WSJA 2YC1B 1LP9B 4GKOA 3R8BB 3D3VE 4GG8A 1JUFA 5C0DA 3G5XB 1YNLH 2ZG3A 1D9KC 5H2BB 4MDJA 4IGBD 1MUJB 1VACA 1JFHA 3WGUB 1NM9A 3KGUA 3B2DC 4N0CC 5CCJA 4W6WB 3QO1B 1W72A 1TYEB 1S7XB 3HNTL 5JTWA 2A6IB 5F9OL 1KT2B 3Q2CA 4PJBA 5GJTH 3SDXF 3MRFB 2VXSL 3WD5L 3HJEA 3NAAL 3AAZA 1N0LA 2QPFA 3DA0A 4MNQD 1KXQE 1UQSA 3MRKA 5JOFB 2XOTA 4C55A 1BX2B 3MJ9L 1GZHC 3ATDA 5FKPA 3Q01A 4MSWB 2AP2A 5B39B 3GLEA 3S4SG 3B2MA 2A77L 1C08A 3B7TA 2G2PA 4AG4H 3MUGB 3K1KC 4OCSH 3UZVB 5IB4B 1P1VA 2FBRA 2OZ4A 5KEZA 2J2ZB 3OSVA 2LFGA 4HPOL 3O41A 4IRJB 4OJAA 4HULB 5BRZE 4JFFA 3SDXE 1RK0B 3QIUC 1RERA 4OCLC 4I3GA 2M83A 5DSCB 3T4AB 4AE1A 3PUUA 5DCCA 3VM5A 3TBWB 4A2FA 2R1WA 1IE5A 3QORC 2VWEE 3ILPA 5D7LB 3JTSA 5CLXA 3TA3C 3EADA 4DP9X 1KG0B 1LK2A 4KK9C 3GPEA 1SN0A 1UA3A 4FJ6A 2I9LB 4HF5L 3SKJL 1JZEA 4JR9L 2CE6A 1J0HA 4WGVB 5BZXA 2O6PA 1N8ZB 2K70A 2UZPA 3QZBA 4LCCC 2LHAA 2WKGA 1BGXH 4WVRA 4G7YL 5GRZA 3IU3B 3DV4A 3JVFC 1DDHA 4V1DA 5F1OB 3ML9A 2IQ9L 4FQ2L 3LQAL 3B9KD 3E3QE 4OM0L 2BZCA 3MZTA 4F57H 1FVEB 1CDGA 2QLVB 3RGBA 4GW5B 3HS0A 2YEZA 3U25A 3Q5TA 1L0PA 1NCWL 1AD9A 4P49A 4MAYC 1M9SA 1A7PL 5LGKA 5KVGE 2C3WA 4OUUA 1Y1DA 5DO2D 5FGCB 3CGTA 3GMNA 2UUDH 3TO4C 5FB8B 2D7TL 1WVZA 1QTSA 4ZMTA 4FF9A 2WAQA 4P07A 2PWGA 1A6PA 2ROYA 4LRNH 5JLZA 2EIKB 3F6LA 3AQYA 1YEEH 4FC3E 4MD5B 3S48A 3Q8CA 3SKMA 1F1GA 1T20A 2DWTA 2HKAA 5KN5B 4K5MA 3CFEA 4HH9A 3WO4C 4ODSL 4PS3A 5B3SB 3MRJB 1F2QA 3O8XA 3SGEH 3WFHA 1I8KB 2JCCB 3ZGIA 4AC2A 1H6FA 2YQBA 2L0DA 3F01A 32C2A 1UD2A 4MJJA 1OB1A 1CFTA 1XL6A 3PDOA 1DLFH 4I2XA 1B0RA 3NIGF 2LVEA 5IQOA 1FGNL 4L4VA 4MS8D 1FC2D 2MCMA 3GSRA 3BH9A 4X80H 1PX4A 5D6CA 4ZO8A 3BPCB 3LNGA 3QDGA 5HGBB 3UGUA 3DX9A 1TFPA 3QZMA 2W38A 1AXTH 5GGUB 3DJTA 2E9BA 5K1VA 5JIHA 4UYPA 3L9RB 1OP4A 3SDCD 1IT9L 4EI6B 4B9ZA 2P49B 1HCZA 4GSQA 3EDDA 4PGJA 4U6TA 4EUPG 4OFYA 2Z4QB 4KI5C 3SDAC 1HJBC 3EUUA 2Z7WA 1G4MA 2JH2A 4MVBD 1QSFA 5IQLA 3BGMA 4GAJH 2EKSB 4L1LA 2J20A 1OCWH 3EYUL 3ZXAC 4NKIH 2WXLA 2P5WA 3NIGE 5DYOB 3WBDA 5HYQA 5E9AA 1BQUA 3PWJB 5I73C 1MHEA 4JVWA 3PYCA 4QTHB 4HWNA 2H26B 5AVZB 4AL8H 3LS4H 1E6OH 1FA4A 4MMXA 2XNAA 1I8IB 3ABLB 1T1WA 3BIKB 5C0BB 2CMRH 3MREB 4OF0A 2DQEL 2QQQA 2K7PA 3L3DA 4JFZL 5F88A 4P4KC 3ELQA 3ZTEA 3PWNA 4Z78B 4QDGA 3E2HB 5AZ2H 2ESVE 2XVKA 2B08A 2YAMA 2P8LA 1V7NH 3FK3A 1MRDH 1B6DA 1JCVA 2BNRD 4ZTOH 4YXLL 3B1UA 1CK0H 2CLZA 2BNRE 4JKKA 3UDWA 3LXUX 3LNEA 3X3GH 1CF1A 3L4UA 2JNZA 4DN3H 3B2VH 4GYBA 3FQ4A 4J6RH 4N8CH 2D2OA 4AYMC 2BP5M 3SE3C 2Z65C 4Q58C 5D2NB 5AWNL 3RUGF 1TSRA 4PRPA 4FI7A 4IIQC 5TF1L 2VXQA 3UJTH 4EI0A 5JUEL 2V3FA 5D93B 2VR3A 1FFOA 4QLWA 5IJCC 2AGJH 4Z3EA 2AW2A 2MFNA 3DPBA 1JNNH 1M2OA 1QI4A 1RIUH 1ORSB 1CFMA 2NNXA 2VDLL 1SHXA 2APBA 3QNZA 4XP1L 3SPCA 3U6XS 1H3VA 5HVGB 1QPPA 2H6UA 3BCDA 4L3CB 3CFKA 3MLVH 1YLBB 1KN4H 2K8QA 3BI9X 4F33A 1GMIA 2QDWA 3RA7H 5DK2A 3BH8A 5C2BH 5SWSE 3CN3A 4NQXB 3MO1B 4P2QB 3UJIL 1OSEA 5F3HA 2N56A 5TQ0H 3RUGE 1NICA 4N68A 1HQ4A 1JK9B 1OXYA 5GRJL 1N0XH 3PWPE 5I15L 2OSLB 1RUML 3GJEA 5CN2A 3TBSB 5CF3A 5T1DH 1WA2X 5AZEH 5C6PB 5TDPB 1I8LC 1OGAB 2UXVA 5B4MD 1NIEA 3MJ7B 3QDME 5KYYA 4LIQH 4K7FB 5KG9B 3S96A 3GD1C 3MOBH 1MJ7L 2UUDK 1AYOA 2M8XA 3FF8A 5FO7A 3IDGB 5J6SA 2ORBL 2AXFA 1XZ0B 2E9JA 1ACYL 2WXQA 3L2NA 2G3XA 4BH7B 1IC4L 4N87A 1IGIL 3GGWB 3MACH 3GMPA 3TJHD 3KMDA 1L5GB 1IO4C 5IHUL 4YOKA 3IYLW 5KVGL 3AXIA 4ATTA 4BGLA 5DVKA 1E8ZA 1HNYA 4B7IA 2JQZA 2CDGB 1NLDL 4WIQA 3UO1L 1INEH 1YPZB 2VDPB 3QIBD 3TBCA 3ZR5A 1R3JA 5HDBF 3E7JA 4QXUH 1W16A 1MXDA 3UC0L 2BHUA 2PLTA 3OC8A 2ZUQC 3H2WA 3QUML 2OMZA 2NXYB 1MFCH 1TZGL 2DBLL 2DRUA 4WK4B 3CDGA 3LPWA 3BZEB 3SJVE 5BV7L 2IG2H 2PKDA 4POUB 5FUOL 3O6ML 4K7PL 3HRPA 1DO6A 3C5XA 1GGCL 3MUUA 5L2JA 3S2AA 2L7UA 4JCWA 4YXHL 1R3HA 4WFHD 1ZAGA 1NCJA 5F9JB 1YA5A 1GHFL 2RFXA 5KS9B 1GAFH 2XKNA 3C60D 4EN3D 3NCYP 4G7RB 3IFNH 3O2WL 4WFED 3C75A 1JWUA 4K07A 1CU4L 4WFEE 1JFQH 5HDBE 3ERXA 2C34A 3O9WB 5IMLA 1OALA 4JFPB 1G7HA 3ESVF 5E70A 3HZKB 4N2NA 1NCDH 4KITB 5A2LH 1FYHB 1A7NL 1J9QA 3N43B 2OTUB 3CMOL 2V3EA 3EOTL 3F58L 1HCYA 4WW2B 2IOMA 3IEAA 5D6DA 2WQRA 3I9AA 1U8HA 4N85A 5JZ7C 4K9EC 3PP4H 4GW4B 3OTTA 4L9LC 5EZOH 1S7VB 4KRLB 2GJ6A 2XKUA 3DX8A 3L3IA 2DB8A 5AW9B 2VW6A 3DRQB 5I71C 3WXVL 4NUJB 2K4WA 3HE6A 1HH6A 1UH3A 1T1XA 2L4OA 3L7EA 3HOGA 4U1GC 4BH8B 3MBED 2Q7NA 1LO4H 1TQBB 5C08D 2IV9A 5IJVA 1SM3L 4NQCA 3IDIB 5C08E 5C6TL 4Z7QB 5ISZE 3CU1A 1OKEA 2FNBA 3LRGA 2Q86A 4JO3L 2YGOA 3QUXB 1DQDH 4OBRA 3RX7A 1JV2B 3IXTA 1BFOB 1GL4B 1H6EA 3CVHH 2WLJA 3M46A 2H0FA 5KW9L 2DQTL 1F8TH 2NNFA 1ESOA 2AJVL 4GAGH 5FUCC 1WZAA 1WGVA 5FFOA 3HR5A 1ODAA 1HHKA 2WUBH 4Z7VF 4E0RA 3SO3C 2HKHL 3Q3GA 3QQNA 1JZ2A 4NT6A 1ZT1B 1OCOB 3V9FA 1AZRA 4WU5B 4XTRC 2QPDB 1SQMA 3LKOB 1S5HB 3FQUB 3VGDA 1V27A 3KLHC 2VDQL 2EEXA 3BSZA 5AVUB 4BFGA 3SE8H 1DBAL 1T21A 2OX5B 3EAKA 5I0DA 1WFUA 4MXVF 3FTSA 3QEGH 5DD0L 5BQDA 4JFEE 4OIIL 4JQVA 1ZK5A 3BVXA 4P59L 5LB1A 5C0NC 2L8AA 4Z7VE 3IXAA 4U0QB 4UT9H 4O2CB 4J3OC 1B4LA 4R97C 3VXMD 1J8RA 4MWFA 1BM7A 2YD7A 1I85C 2IDTA 2A38A 4NPKA 5E2JA 1OF2B 4MKTA 4ZQKA 2EVHA 1YAZA 4G8GB 1UM6H 3MHZA 3PFUA 5DRNB 3W0WB 4IRSD 1NUDA 3FPYA 7TAAA 4UQ9A 1M6OA 4E41E 5FO9B 5I6OA 4L3EA 1QEXA 4Y5YC 1ZLEA 4WNQB 3VXPA 1HSBB 4JZOB 1SPDA 1TJXA 2TRYA 2XBTA 1NFDF 1LILA 5ID0A 5FPIA 3MC0A 1U8OB 3O3EB 4UAOB 2X2UA 2XWCA 1YNLL 3OQRA 2MH4A 4W9KC 4ALAC 5I1AB 2XWEA 4L8DB 3HEIB 3P73B 3FO1B 4PG9B 4Y1AD 1K6QL 5K5YA 3HPLA 4H0LC 5KAQF 4XP5L 5GJTL 2DQFB 1F3DJ 2CKBA 3MXWL 4DT2A 5EFIB 5IBTH 2CH8A 4LARH 2H32A 4YHOH 3VFGH 3ROOB 1HKFA 1PJWA 2H8PA 1NFDE 2FJGB 3APMA 3ATBA 4KY1H 4RWYL 4KNUA 2HFEB 4P5MB 2CLVB 2YD8A 2EXTA 3BAJA 3LPFA 1A21A 3UP1A 5B8CB 5DLML 1NEZB 5I17A 4AG4L 3BP4B 5I66A 2COVD 5I76B 1LEGB 4YSTA 1KFAH 4Y19D 3K0WA 3T0XA 4E9SA 4XN5A 2RHEA 3B3BA 5ENWB 4EJ1C 2KBGA 1CGYA 1FL6A 2OXGA 1NOFA 5CU9A 4N6RA 3ZKMD 1AFVH 4J8QA 3MV9D 1DL7L 1XCWA 4KO7A 3D7PA 4XPGH 3SPGA 3MA7B 4FNPA 1WISA 2DIEA 4G6AC 5GRUH 3K71B 1E4WH 1G7MB 5E1QA 2W07A 3TBBA 4HUMB 4GO6B 4JM2A 1DUZB 4R7NB 3ABKB 4HJ0D 3D39D 2AAAA 1W15A 1QLEB 1R3LA 2OR9L 2EECA 4LIQE 4ODXB 1AXSA 2X42A 5IUCA 4QHUA 5EBLB 2F8IA 2UXTA 4U4BA 1G84A 3MODH 4EZLA 2WXPA 1MI5B 3UH8A 1N6UA 1H8LA 3ZQXA 1D7BA 2HG0A 1JXDA 2Q6WB 4IS6B 3RI5K 3LKSB 3B8YA 3KWVA 4QXGH 3D08A 4WI4A 4WKZB 1IIKA 2YR3A 2ZCKL 3PIQB 5CEZH 4MXQD 1KENL 2XN9E 1AGBB 1OTUC 3OJVC 2ZKYA 4TNFA 4Y7OC 2D0FA 2X2YA 4LPUA 3ZE2B 1TNMA 1MW2A 5E6YA 4E9RA 1M71B 5BRPA 1D5BB 5C3TA 5CD3A 2PWFA 4GS7C 2FEEL 2E59A 1SGKA 3TWCL 3BYTA 3FF7A 4ODUA 1QSVA 4KQ3H