3UZWA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzwA00
2CLPA 5AZ1A 4MHBA 2PDJA 2I17A 1M9HA 2ACSA 2IKGA 4G5DA 3DN5A 2PDLA 2PDKA 4DBWA 3LQGA 4WGHA 4XZNX 2FZ9A 2INZA 5M2FX 2HEJA 3GHSA 3H7UA 2IQDA 1EL3A 2IS7A 1ZSXA 3FX4A 1EKOA 2A79A 3Q65A 1T41A 1Z89A 4OTKA 1R38A 4JQAA 4DZ5A 3WBYA 4JIHA 1US0A 1MZRA 2HVOA 3RX4A 5C7HA 1IHIA 3UYIA 5DANA 1AH4A 2J8TA 1S2AA 4DBSA 3LZ5A 2PDUA 3LENA 1S2CA 5KETA 4PUWA 3LD5A 3V35A 1HQTA 4JTRA 2PDXA 3N6QA 4LB4A 3R43A 3U2CA 3S3GA 2R9RA 3M0IA 4XO6A 3G1RA 3UZXA 3COTA 4YVVA 2C91A 4JQ1A 1XGDA 4HMNA 2PFHA 2PDIA 3UG8A 2HDJA 1ZQ5A 2IPGA 4JTQA 4H8NA 2PD5A 1A80A 4JTAA 4WDWA 2QXWA 4LBRA 3O0KA 4XVDA 2HE8A 3EB4A 2HE5A 3V0TA 1LWIA 4XK2A 4RPQA 4XAPA 2FZBA 2FZDA 1YE4A 3R8GA 1VP5A 2PD9A 3GHRA 4WEVX 4FALA 1MI3A 4GACA 4L1XA 5HA7A 3RX3A 1LQAA 5LIKX 2IKHA 1X98A 2BGSA 3ONBA 4F40A 3CAVA 4YVXA 1VBJA 3LEPA 4R9OA 3CAQA 2IPFA 3MC5A 4XZLX 1J96A 2BGQA 4XZHA 3R58A 4LAUA 4L1WA 2ACUA 4JIRA 3G5EA 1IEIA 4EXAA 2PDWA 3O3RA 4H7CA 4JQ2A 3EB3A 4LB3A 3CV6A 4FZIA 3KRBA 3UGRA 3R94A 3C3UA 4YU1A 3H4GA 1RY8A 3DOPA 1ZGDA 4NKCA 3EAUA 3LBOA 1PZ1A 1AZ1A 1ZUAX 4XZMX 2IKIA 1Q5MA 1QRQA 2P5NA 5JH2A 4LBSA 4GCAA 3UZWA 4GIEA 1Z8AA 3GHTA 4GQGA 5LIYX 3UFYA 3UP8A 1YE6A 3GHUA 3V0SA 4PUUA 3WCZA 1S1PA 2F2KA 2NVDA 5LIWX 2IPWA 2ALRA 3R7MA 1PZ0A 5LIUX 3V0UA 2PDMA 4QBXA 2ACQA 3CV7A 2HVNA 4PRTA 4QXIA 4LAZA 5JH1A 1FRBA 2DV0A 2PDCA 2ACRA 2DUZA 4EXBA 4XZIA 2PDNA 4WDUA 2FGBA 2ISFA 3WBXA 3LUTA 4YS1A 3VXGA 3RX2A 3H7RA 3LQLA 2WZTA 1AFSA 2NVCA 3WG6A 4JTDA 4ICCX 4GABA 1YNQA 3LZ3A 2FZ8A 2PDPA 2PDYA 1SM9A 4QX4A 4DBUA 4FAMA 2R24A 3M4HA 5HNTA 2HV5A 4IJCA 3D3FA 3LN3A 3QKZA 3B3DA 4PMJA 1PYFA 4WDTA 1JEZA 1RY0A 3N2TA 3UZZA 3NTYA 1YNPA 3BURA 4PRRA 4Q3MA 3ONCA 1X96A 4ZFCA 3R6IA 4I5XA 4AUBA 2PF8A 3MB9A 3V36A 4Q7BA 3BCJA 3CASA 3M64A 2PDFA 1AH0A 1RALA 1K8CA 4YVPA 3FJNA 1EXBA 2F38A 4PR4A 4ASTA 3Q67A 2BP1A 2VDGA 5HNUA 4IJRA 2PDBA 3BUVA 1Z3NA 2IPJA 4JIIX 4XO7A 4QR6A 1OG6A 3UZYA 2I16A 1ADSA 4JTCA 2WZMA 4WDXA 1PWLA 1UR3M 2FVLA 2PZNA 1Q13A 1XF0A 1QWKA 3WBWA 1XJBA 2INEA 2PDHA 3UWEA 1AH3A 1GVEA 2DUXA 3P2VA 4JQ3A 4GA8A 2PEVA 4HBKA 1S1RA 1EF3A 5AZ0A 4IGSA 3F7JA 4FA3A 4JQ4A 3GUGA 1Z9AA 2IQ0A 1T40A 4XVEA 4WRHA 3CMFA 5LIXX 3T42A 4GQ0A 3R8HA 1C9WA 2AGTA 2PDGA 2IKJA 1HW6A 1MRQA 3ERPA 2PDQA 1AZ2A 1PWMA 1X97A 3LNMA 3BV7A
chains in the Genus database with same CATH superfamily
2CLPA 4AFYA 4BY3A 4MLRA 4QGCA 3PWIA 4LPCA 4J3UA 4FR6A 4EK7A 4G5DA 3URBA 5GPRA 2AMGA 2GQ3A 1OX5A 3PB2A 3W2MA 2CESA 5A94A 3QGAC 1B0IA 2V5JA 8RUCA 1JRCA 3P61A 5M2FX 4FLQA 1OBAA 1AMYA 2NWRA 1YPIA 3WELA 4U3CA 1EKOA 4EPBC 4EF8A 4OTKA 5MHBA 1Q65A 1O6IA 4FI4A 4NQ1A 4FOKA 2Z7KA 3WBYA 2YBTA 4GYPA 3MSYA 2V3DA 4WK9A 7ENLA 1J0HA 2Y62A 1MYRA 2PLMA 3FYYA 3N2XA 1G5AA 1T8QA 2BHZA 2C0AA 2VKZG 5CLTA 4G1KA 1W2VA 3V16A 1R9YA 1PO9A 4JR5A 2WW5A 3BAWA 1WKEA 3VDCA 3KBMA 5HAOA 3K4DA 4EIVA 4JN8A 4EAYA 1KCKA 2XTKA 1QMLA 3I3BA 3VO0A 3G1XA 3ZLFA 4QE5A 1QCWA 1AQMA 3CPGA 1OIMA 1KRAC 3GKFA 5G1MA 4DO7A 1Q45A 4QG8A 3UCQA 4O28A 4IQEA 3TQVA 2XSBA 3O0FA 3AALA 3UPMA 3THCA 3UA3A 3RU6A 3FGCA 1DXIA 3EB2A 3DFNA 4MF4A 2GJXA 3WJXA 3ARTA 2J77A 5IXEA 1AK5A 2BBFA 1TREA 3NQFA 3RCNA 3DFQA 4NZJA 5BW6A 1VRXA 2W9MA 3QQ0A 3S6DA 4W7UA 4CQ9A 4M1BA 5A6BD 3BSGA 4A4AA 3CZEA 5E6YA 3TYCA 3V5FA 4UR9A 1HKJA 4DIAA 1QAPA 1Q6FA 2Y5JA 1Y65A 5FF7A 3IUHA 3E2QA 4JIEA 4PEKA 4A8IA 1BXBA 4RLIA 4HYVA 4RDWA 1G6CA 1BVNP 2VOTA 5GJPA 1E1FA 3G1DA 4M8UA 3IGUA 3DECA 2JE8A 4A3QA 2CLIA 3EWZA 3NYZA 4PH6A 4ATDA 5LGXA 3WLTA 1WO2A 3FV9A 3GH7A 3ZO9A 4RDYA 2WNNA 3DFSA 2OSYA 4IMFA 1JPIA 4OIFA 2A2IA 3LXCA 1Z32X 4ZSTA 5DT7A 2ZA2A 3L5LA 1V3LA 1KFEA 3PPHA 1BXCA 5LA2A 1WUEA 1WDPA 4AHOA 3SCQA 3LCWA 1JCTA 4IP5A 4DZHA 4AMAA 3GC2A 4ZOEA 1EUAA 1OYAA 4PB5A 4G56A 3W2LA 3H4GA 1E55A 3VDHA 3AMLA 4U28A 3WK1A 4MG4A 3S83A 4QTGA 1TPDA 5AN7A 2H8ZA 3F4CA 2Y8KA 2ZRVA 1US2A 1UWSA 1FBAA 3CL6A 3MCMA 5DMYA 1RPKA 4DJDA 3II1A 3ICJA 4K1GA 3W72A 4OGZA 2GQAA 5I6SA 4BA0A 3MSGA 3GG1A 4H7ZA 3VGHA 1B57A 2ANUA 1E9IA 4E3TA 4F0KA 3TAOA 4Q4KA 4J3VA 2YX0A 4DF1A 5TAOA 1ADOA 1RXOB 1D2KA 2ALRA 2DW7A 1HL8A 4M1RA 3MCNA 1YXDA 2JEQA 2BXVA 2MUCA 5LXXA 1ITQA 3WDQA 2OODA 4QBXA 3STGA 2C7FA 5HDRA 4DO4A 1PVNA 3EOUA 4LSBA 1E9ZB 1FRBA 2VT0A 2PDNA 3AQUA 4MUPA 4WGXA 4WJEA 1JDFA 1OGSA 3GBEA 4Z1BA 3IUIA 4JTIA 1LTDA 1ZY9A 2BXYA 3VZYA 3SSJA 1SM9A 3HG5A 1HL2A 3CAWA 1KFKA 4AWEA 2VEPA 2AAMA 4H19A 1UR0A 2BHUA 1F3XA 1GQIA 1PYFA 2ZWZA 1V5XA 3RN6A 3NTYA 3TFXA 3QQ1A 4J3SA 3S47A 3WH7A 1GVRA 4K38A 3W7EA 3TW6A 4AISA 1JNEA 1GVOA 3RFAA 3BO9A 3G1VA 4P7RA 1XQKA 3W1TA 1EX5A 1HGYA 3U5YA 3WUEA 1GORA 2ON3A 4PCTA 1JI1A 1R0MA 2Y88A 1RA0A 5E93A 1Q2SA 3TA6A 4Q4MA 4JY9A 5AYXA 4N2YA 3JUGA 3E0FA 1NDWA 1IIGA 3ITOA 3L2LA 1ZNNA 4DXVA 4S3FA 1F5ZA 2FKPA 4WR3A 3VNMA 1UMYA 3FA5A 1GJPA 3GFXA 1KM0A 1TIMA 3GC4A 1S46A 3M07A 2DIEA 1GVEA 3H4WA 3VAVA 1JJKA 1B9BA 1K7FA 2QCDA 3GVGA 3DHPA 4Q22A 4GYPC 4QJ4B 4M82A 3ZJ6A 3HG4A 4O13A 4LEFA 2JKEA 4AHPA 3T4WA 2CLLA 4DYJA 4M6VA 4B5UA 4QIUA 3FIGA 4GNJA 1WUFA 4EPDC 4XIAA 4I8YA 4LQ1A 5LIXX 1XIDA 3R8HA 1UD4A 3TWBA 2Y24A 1E0UA 3UA4A 3ZR6A 2CERA 1W6TA 1K77A 1B3OA 5D09A 3G1FA 3URQA 3HMCA 3QXBA 3LLDA 3VNYA 4BF7A 1MW1A 3PS7A 3WJZA 4JICA 1EPXA 1E6RA 5JIPA 3UXIA 2V3EA 1IV8A 4YCPA 1IXOA 3DN5A 1DWAM 2OLAA 2XSAA 1WX0A 2C0HA 4ICNA 2V69A 2I1OA 4US6A 3M0MA 3HURA 1KM5A 3FX4A 2OMAA 4KWVA 3KEHA 4WY0F 1XM3A 2D2GA 1R47A 1PHWA 4P7OA 4WVXA 5I23A 3VFCA 4IQJA 3M6DA 1XSIA 2ZE0A 1SFTA 2JGYA 4BI6A 3WLPA 3ANYA 3AICA 3VA8A 1G9HA 1U33A 4ES4A 3MI3A 3N2BA 2FFCA 1MMFA 3T2OA 5DRIA 5HNRA 3B9EA 3ITTA 4PUWA 3KOYA 3INPA 4BR1A 1QPKA 4J2MA 1SYTA 2R6OA 1OCQA 3QYSA 4UWMA 1IEXA 1CXHA 4DWSA 1MFUA 4JTHA 4UTUA 2B0MA 3WO8A 4H4IA 1XIMA 3FLUA 5BWAA 2OQYA 2DT0A 4ZOAA 4YXGA 2VXNA 3GIQA 2ZZ5A 3L0NA 3AJ7A 3A13A 2W62A 4RX0A 2E5DA 5DX7A 4N6EA 1W1YA 3SZ8A 3M0IA 1RH9A 3DKLA 1VPQA 3MANA 2WK2A 2CBUA 2YIHA 1XGDA 2DY3A 2FB2A 3SDOA 2VRJA 4YYFA 1GEQA 3UR7A 4D6FA 4NI8A 4L4LA 4AXNA 1XDMA 1OG0A 3SGUA 4IX0A 4TUFA 3P3BA 1FA2A 1Y8BA 3FGCB 1RVGA 1QPOA 2YPIA 3W53A 2HBXA 3TONA 3R4IA 2GJXB 2GZXA 1ISYA 3BXWA 3AMCA 4MM1A 4RKAA 4MIMA 2YLAA 4KEUA 3PULA 3S1XA 1XC4A 3UWUA 4Q33A 1ZFJA 4ZO9A 3OZPA 4NUWA 2NXIA 3S46A 1EFZA 3W6YA 4DBDA 4I5UA 3KCLA 3A4AA 3B05A 2VFHA 4QISA 4IOTA 3K30A 3K8MA 5A6KA 3FW6A 2BY2A 3VIJA 3SQLA 3V3WA 4N9EA 2J78A 1O5XA 1KCZA 3N17A 1L9WA 5T91A 3MBDA 2CNCA 5A2AA 2FGLA 1VHNA 3W01A 4FS9A 1UKSA 2PWFA 1PIFA 4HPXA 3O7UA 3UETA 2PTYA 4XZHA 1O5RA 1E3XA 4CQ8A 2BMBA 4TIMA 2WKJA 5H1WA 2CLEA 3EB3A 4LB3A 4HMDA 5I78A 5FEZA 4C6IA 2BS9A 4QLJA 2XN2A 5XIAA 2ZIDA 4NAFA 2EPOA 3AHVA 3SRHA 2DZVA 1HO4A 4KEZA 4WKAA 4E2DA 3AXHA 4TQTA 2XVGA 1RLDA 1DTNA 3WQOA 4H6KA 3UP8A 1LZOA 3MP3A 1TZ9A 3GHUA 1EJUC 1VJSA 4Q4RA 3K8KA 2QDEA 3NUKA 1BD0A 3VNIA 1KM4A 5F4XA 1V0LA 3FOKA 4FF5A 1LDCA 3PZTA 5LNSA 3TN5A 2PDMA 2F6KA 2ZXAA 4LUIA 1R9XA 3KBJA 2ALDA 1MDLA 1TZ7A 2VGGA 5FCZA 2DUZA 1KM2A 5EPDA 4UTKA 2X1UA 4DNMA 4PMOA 2YB1A 5EMYA 5KSWA 1OK4A 4Y9AA 2WM0A 4E38A 3PNUA 4HPHA 1JZ8A 1CXIA 1XYBA 3LBMA 1IZCA 4F66A 1XFBA 2YA2A 5HK4A 5J5DA 4IZGA 4X0VA 2X41A 3A21A 3PUOA 3BG9A 4BF5A 1R6WA 5HNTA 2R1MA 4OT7A 1Q6OA 2YXOA 4V2XA 4IP7A 1CXFA 2E1DA 2PF0A 2OGYA 1EP1A 2TODA 3UZZA 4U2ZA 2VOMA 4IUGA 5I3DA 3SR7A 1J93A 3UY8A 3MSRA 1EXPA 4KCWA 1N8IA 5A8GA 1KBJA 1PKMA 2BVWA 4BQ4A 1RALA 1EC8A 1EZWA 3BJTA 5AYYA 4Q8UA 3A12A 1AQFA 5BYWA 4XD5A 1HP5A 3WK2A 1BKHA 1B1YA 3E6EA 4QJ1A 4OVXA 2O7SA 3SIZA 2QIIA 3G6MA 3V4BA 4FF7A 3KVKA 4MB4A 1HO1A 2I16A 3SCOA 3LMZA 2Q3OA 2PURA 4NSBA 5DQPA 3D5HA 3FAWA 5FI8A 1DP0A 4KGLA 3UZ5A 1OJXA 2XGIA 2PDHA 4C6PA 2CLFA 3QW3A 4H9VA 2G96A 4DYEA 2DIJA 2C15A 2F7FA 4GYJA 4FXJA 1NTHA 4YTUA 1S1RA 4GFSA 1XUUA 3B4YA 1G1YA 3W2NA 4HZMA 3UBPC 1RSCA 4RNIA 4EWJA 3B9AA 3GD6A 4ZA0A 2ZE3A 5GVJA 2IUZA 2AGTA 3BMVA 4B4HA 4XKYB 4C5YA 1TTIA 5D04C 1V7YA 4PTVA 2OEMA 2VNCA 1G4PA 1M65A 4LAMA 2BFGA 3I4KA 1C8VA 4DWSC 2GFTA 2D3NA 3ORWA 1EOMA 4CQDA 1NM9A 2ACSA 3ISIX 2OCZA 1F2JA 4PMNA 4NYYA 1E73M 1F76A 3VKKA 3NQCA 1T8XA 1WDQA 1IWBA 3QZAA 1UJPA 3K5XA 3ZM8A 3GU9A 1GQKA 3ES7A 2IXVA 5I5RA 3VM5A 3UJFA 1XIHA 4Z1AA 1G4TA 1ZAHA 3I10A 4W88A 3WX7A 3JZUA 1U83A 4QDWA 1IT8A 3NEHA 4PCPA 1FHDA 4IMGA 2GSJA 5LXEA 1UOKA 3LM7A 4NG3A 4JXCA 3TTOA 2HVOA 2BY1A 2G8ZA 5C7HA 3IK2A 3UYIA 4P8XA 5HOSA 4TOQA 4RK8A 1YBQA 1DWIM 3PSVA 4HNVA 2CBJA 5ABHA 4L61A 2J7GA 1G94A 1C7TA 1B4KA 3SY5A 3HIJA 3ZMRA 3CWNA 2YXGA 2FH6A 2ZZ7A 4EACA 4ZQNA 2HPIA 1ME8A 4MDOA 3AS0A 4NRSA 3U2CA 4ZENA 1LBLA 3IWPA 2Y0FA 3QRHA 2YGYA 4ZGYA 4AZ5A 4KBXA 4DWSB 1Q63A 1TPUA 3LRKA 3S5ZA 5TQLA 4RPPA 1U1HA 1SVDA 3COTA 8CGTA 3MJYA 2VX4A 2WCGA 4UTLA 3LXBA 1B90A 1OIFA 3LV5A 5CSYA 4FB7A 3BAYA 2G4FA 3LRLA 1UWIA 4AC1X 4GPNA 3IVTA 3REQA 4Z1YA 2J9ZA 1RBLA 2NT1A 1IXQA 1XV8A 3EKZA 5L9FA 1ECEA 4EPKA 5CPTA 2NSXA 3LNPA 1E6ZA 3AIQA 3VDAA 5CC6A 1TE6A 1PDYA 2X2YA 4E8CA 4UQBA 3WF3A 3RX3A 4IMDA 2D24A 3GYEA 3FDGA 5F4SA 2DEPA 4REQB 4Q8NA 4GVGA 3MYPA 4HTYA 3W1AA 3CYJA 3ECQA 2PC4A 3O6DA 4FK9A 3ZT7A 4ZO8A 4LRSA 3QZEA 5CZTA 5I3JA 2WLYA 1MZHA 1AL8A 3W27A 3PZOA 2WHKA 4RXGA 5HJYA 4I3GA 4FNTA 2OYMA 2H3BA 3NZGA 4US5A 3N9KA 1QW9A 3ID7A 4ZQMA 2VDIA 1ZZMA 2QPXA 3GY1A 3FFSA 3R94A 2QW5A 2A6NA 5DMLA 3PFRA 5KINA 4BF9A 2Q09A 4NKCA 1W3HA 2WQDA 4IMAA 3WMLA 3LBOA 2XVNA 2GJNA 1F6PA 4NAFB 1FY6A 2E67A 3W1NA 3TXVA 1Y0EA 3FVMA 2DVTA 2CWNA 3BLDA 3JW7A 1V6XA 3CUHA 2QCGA 5HJXA 3OODA 5BMXA 3LERA 3VOJA 3R2GA 3PNZA 3TSBA 1KRMA 1Q7ZA 4GINA 1ICSA 4LAKA 4Q4QA 4L5ZA 4H3DA 3LLXA 1PKYA 1H1YA 4PMDA 3E5PA 2VFEA 2GQ8A 2WNQA 4WD0A 4KIRA 3V0UA 3C0SA 2GSEA 2A7NA 1CB7B 4BK9A 4PRTA 4A3RA 3PTQA 3ABZA 2VQTA 1IT0A 1X6NA 2DZBA 5AYIA 2DV0A 1FHVA 1PHQA 4D6HA 2VVSA 3BICA 1E51A 1PIIA 4S3DA 2GWNA 2G95A 1WZKA 3M0JA 3CLWA 4IIGA 4URIA 7CGTA 1H7XA 4GX9A 3DIPA 1CBGA 3MZNA 2D3LA 4P8VA 4XUGA 3BL3A 4ML9A 1WDRA 4G8TA 4IFKA 3GDLA 2R24A 1TKKA 4HA1A 4JOMA 5AVHA 4QQUA 3EWDA 4U4MA 4HU4A 1OFRA 2KZHA 1UR8A 1E6SM 3AROA 4G1NA 1EQPA 1QNSA 2H90A 1XYMA 3CUJA 4ADUA 2QCNA 3CASA 5M17A 1BYAA 2EPMX 3GRIA 2X42A 1TVPA 3M64A 1S3HA 2R1NA 1NDVA 1SZGA 4JL2A 5CJMA 2Z7GA 4LUYA 3EDEA 5JQ9A 3RU8X 5I24A 3GVRA 3B8IA 4YWSA 3C2OA 2CPUA 2PDBA 3H22A 3BUVA 5CAHA 1ZJAA 2GGHA 2HCVA 4B5TA 4JIIX 3ZVIA 4XO7A 1H7PA 3KOZA 1KRCC 4PMUA 3LTSA 3TJIA 5BU6A 2DW6A 4PBFA 4CD6A 4OUEA 4XD4A 1KXQA 2PTZA 4D72A 4BWLA 3MKCA 3B8TA 2YLLA 3WDIA 3UCCA 3IK4A 4FIQA 1RCXB 1GONA 4B3KA 3L4XA 3KHJA 5E6ZA 4CQBA 3CHVA 4Z08A 4LH8A 9XIAA 5AZ0A 3XIMA 3KRSA 1MDRA 3NPVA 3OVGA 1NWRA 2OSWA 3T9PA 4GFIA 5FACA 7TAAA 2PDGA 3NM1A 1M3UA 1UQZA 1UR4A 2NUXA 4PTWA 3RUBL 5HBFA 3PZGA 3BOFA 1X97A 1ZBKA 3GNNA 3VCRA 1O1ZA 1ZAIA 3F4NA 3F4WA 3UYCA 3LG3A 3PUGA 3FJ6A 4B16A 1UWQA 1JDAA 4DBWA 3CU2A 1TMLA 1QI4A 1KM1A 4H01A 4GZJA 2Z1BA 1POJA 1EJSC 3K1GA 2W27A 1Z41A 4Q8TA 4WIWA 1K7XA 3AHYA 3KWXA 1QBBA 4OU1A 1H61A 1ZL1A 1MW0A 3S1GA 2VGBA 2VZUA 4LNYA 3SUWA 4XSLA 4XTDA 1RBAA 1DL3A 3H2FA 5IBXA 1XICA 3GH4A 1FDZA 3FYOA 1IHIA 1PS9A 3PK7A 3SIMA 4UFMA 2ZX5A 1DXFA 2XGZA 2FMOA 3WLLA 1UCWA 1FHLA 1MVYA 3GS6A 1EYWA 1EJVC 5D9OA 3CBWA 2DZPA 4AWTA 3DFHA 1HQTA 3N4FA 1YBQB 1NY1A 2X7WA 4NXKA 3FXGA 1OVDA 5F2GA 1NEYA 4LB4A 2V82A 4AZIA 3UJRA 2AKMA 5H6HA 1C92A 1YQ2A 3XINA 2A85A 4WXYA 1NF7A 3PN8A 5E9AA 4EAMA 3WQ4A 2Z27A 1NWTA 2JF7A 4CQCA 2J13A 1O95A 3VOIA 3GH5A 3MBFA 3U4AA 2EPNA 3P0WA 4LYRA 5CPQA 3MU7A 2WMIA 4AC7C 4H8NA 1JZ5A 3VK5A 2DZUA 1UIPA 2QUNA 3ZWSA 3UXAA 3NO1A 2HNEA 1WKYA 4TX8A 4XD6A 4AYSA 3OLEA 1NVMA 1NIUA 4U5IA 5CKSA 2Z6JA 3ARSA 3FVDA 1JF5A 3LHYA 3VGFA 5M3WA 2Q8ZA 1ZCCA 4QCFA 2PD9A 3CHEA 3GHRA 5DY3A 3UXLA 3REQB 3A23A 4GACA 1L6FA 3W24A 3QGKC 4L7ZA 4WLCA 4AVFA 3OLGA 5K7JA 1I60A 4WUIA 3CB3A 5BNKA 2WLZA 2D2HA 3N6HA 3PBMA 3D0CA 5D37A 4CGTA 1RR2A 4CCDA 4QNWA 3AXKA 3OG2A 2GJLA 5SWUA 1ITXA 4Y90A 3I3DA 2XZ7A 3NSMA 4P7LA 4UTTA 1FXPA 4HNTA 3KOWA 3N73A 3O3RA 3W7DA 2JKAA 3CQHA 3BQ6A 1JXJA 4RW5A 4MTVA 4K3ZA 2JK2A 4BQ3A 2ZVIA 3TZFA 4Y8FA 1D7FA 1TVNA 2AOSA 3DFPA 1GYMA 1XINA 2QGYA 1PZ1A 2EBNA 2EJ1A 2CU0A 3HPZA 2HISA 2FTWA 4JCMA 1QJWA 1B2YA 4NX0A 2E28A 5A6BA 1EOKA 3U7BA 4AXKA 4C7DA 5C5YA 3AHXA 3I3EA 3W6LA 2YCKX 1BF2A 4ZCWA 1PKLA 2ZX9A 4ZQRA 3A4JA 3QR1A 3KZSA 4ORMA 1VBHA 1KR0A 3G2GA 2HWGA 3W2JA 3GW3A 1VRDA 4M81A 1AJ0A 4AZ6A 1C7SA 3ZJ7A 5D8ZA 2ACRA 1I1WA 3GVQA 1Z7AA 2BGNE 5F2LA 3ZVHA 4NZ5A 2JGQA 1CLXA 2NV9A 1BG4A 4IFOA 4R7OA 3KE0A 3TU9A 1NP0A 4GQBA 5FOOA 6CGTA 2UBPC 3UG4A 3U9IA 3CXOA 1YNQA 4RE4A 2DZXA 1WPCA 5CZSA 2PDPA 3B0UX 1RA5A 2OWWA 3VIGA 3RR4A 4NT0A 3TR9A 3TDFA 4Y96A 3IEBA 3KHDA 5D9MA 3VZZA 5T9CE 3GXMA 5B7YA 2VUYA 3NSXA 3B0XA 3TE9A 1FUYA 1YTDA 2A0NA 3QTPA 2ONEA 3VI2A 3AMKA 4HCHA 2QCHA 4M6QA 4LCSA 3LSBA 1B54A 2G97A 2BZNA 1TV7A 1PTGA 3K4AA 1PPIA 3KWSA 1KFCA 1H50A 3CUZA 4IT1A 4F4RA 2ZX6A 4AD5A 3H8AA 2IMRA 1QVBA 2RDUA 3H23A 1F73A 3VGEA 3TV8A 2PUZA 2OX1A 3QN3A 4C7GA 4AIUA 1AW1A 5F2MA 3WDRA 1VBRA 1A0DA 4N9BA 3MP4A 4O1EA 1Z3NA 2J24A 1GPWA 2BXZA 1RAKA 1VEMA 4HHMA 4Z2GA 3P8JA 5HQLA 4KW2A 2JEPA 1ZP3A 1UR3M 4PZVA 4E8GA 3IARA 2WC4A 2FYMA 4LV9A 3ZWTA 5IDZA 1A47A 1J0IA 4ZL1A 2BDQA 3CH9A 4O16A 2DUXA 3KBVA 1HKVA 4KEMA 2ATSA 2RGMA 1F74A 2DDXA 3MMTA 4IGHA 1EF3A 4A05A 3VGBA 4O14A 5IBXC 2QKFA 4MB5A 3BC9A 4MZ8A 3VD5A 2OQHA 4OKDA 1DQUA 4FR1A 1T40A 3LYEA 2AL1A 4WRHA 4WF7A 3AUOA 1KQYA 3T42A 2VUNA 3VOGA 3CIVA 3ENLA 5H8UA 1MRQA 4A29A 4AZCA 3DERA 5AC7A 4D71A 4GBDA 3EXSA 2PDQA 3A4WA 1LYXA 4JYEA 3TSDA 3LNMA 3F5KA 2XH2A 5EFDA 4DWDA 2D0HA 4W5UA 4UNIA 3NOEA 4K7VA 3RDKA 4M0XA 1QI0A 3RLGA 2INZA 4JX6A 4G6CA 1DBTA 2XFFA 3QW4B 1E0XA 1DWHM 2GSHA 3EXRA 1S5TA 1SSGA 1IGSA 4Z1CA 2FVMA 3QVQA 4NYUA 3SJNA 3KBSA 4GXWA 5DCBA 3VNZA 1H49A 4IGNA 2PMQA 2V3GA 1XSKA 3ANVA 3WH5A 4CN4A 2G3JA 3TUUA 4DZ5A 5FF3A 1XWYA 5KEZA 3M0LA 1VEOA 4K8HA 4HNCA 4N9DA 1GOXA 1UUMA 2OG9A 2XIQA 2PSNA 1M7XA 1VC4A 2VZTA 1DJWA 2VZSA 1P0KA 2J8TA 2NQZA 4DBSA 2ATMA 1M7PA 2PWGA 4ADTA 1L6YA 1R87A 2WHMA 4MKVA 4K37A 3HJZA 3FDKA 3VOHA 2GDVA 4DI9A 1FFQA 3MO4A 4G7FA 1GZJA 4X3ZA 1PBGA 3BG5A 1F3WA 1LT8A 3GTIA 4NVTA 1JNDA 2X0HA 1JCYA 1H60A 3EOSA 3D3AA 1V8EA 1XKJA 1UZ1A 1K9FA 5LKYA 3NL2A 3PTDA 3UZXA 1LL6A 3QMSA 3CZLA 3TYAA 4FLSA 2OKTA 4X22A 4UTTC 3W7KA 4W8AA 2PDIA 2BVDA 4AY8A 4KIEA 2ZTKA 3ARQA 1A0CA 3NYDA 2G3FA 2J4GA 3ITLA 1Q6LA 5ECVA 3DHFA 4C6JA 3WQDA 3QY6A 2OEJA 3L21A 3M5YA 3HZ3A 1Z69A 3NG3A 1TPEA 4PUJA 1AODA 1QT1A 1QHPA 1VS1A 3UG3A 4N02A 2D73A 3BARA 4FALA 2VENA 3WLOA 1WBHA 3FKRA 2BG5A 3W7PA 5HA7A 3CEUA 1ADDA 5BWFA 1MFVA 4LUSA 4C6MA 2VFIA 2BGSA 4MY8A 1CXKA 1JULA 3A5VA 2F6XA 1W9XA 2WAGA 1Q7MA 3LEPA 5LZLA 4KGJA 2I9EA 1WBJA 4DJEA 3L23A 4V27A 1ZCOA 2V5BA 4NZ4A 3GUWA 1UWUA 3GDBA 4KS0A 1CW2A 2WSKA 4JIRA 1IEIA 4LOCA 4CUCA 3OQ8A 1E15A 1F05A 1HTIA 3NL3A 4UFKA 4KWUA 3R79A 1EJ7L 1ZGDA 1ESWA 2NVAA 2XYLA 1EBHA 3GFZA 3MDWA 4F0LA 1TJRA 4J3ZA 6ALDA 1UKTA 4GCAA 2CW6A 4O18A 3RMEA 2XU2A 1KV5A 4CN6A 4H9UA 5FIPA 2XUCA 4D8LA 5E09A 1XCWA 4DN1A 4B92A 3MA8A 1S5MA 3MMWA 3O06A 3ATZA 1YDVA 3L2IA 1LP6A 4LVFA 4C6DA 4O4VA 2H6RA 3BLOA 4UCFA 1GQNA 5I77A 4QXIA 4KMQA 3SCSA 4HCLA 3CJPA 4HB7A 5ABTA 5HJLA 2Z2UA 3HGRA 2PC8A 1YPFA 6TAAA 1RQHA 1U5HA 3A6OA 3NQAA 2PLKA 4RW3A 1CEOA 2V5CA 4ZVJA 2HNHA 5AYZA 6REQA 4HP5A 4NJJA 3LZ3A 3P6LA 4QSFA 3ZVHB 4GGBA 1FWBC 3EWBX 4DRSA 4D1IA 1XG4A 1ZPTA 4PB4A 5FKYA 3BVJA 4LC6A 4I9MA 2NLIA 1Y5VA 2V6AA 1JAEA 1Q6DA 2Y61A 1CGVA 3UJSA 4GQRA 2B7NA 4CCCA 4PYSA 3JS3A 2FHFA 1UP2A 3AIUA 1SJDA 3E2RA 1WYIA 3ABOA 1G7VA 3EOOA 2O92A 1MEIA 3R25A 4R53A 1IWPA 4I7WA 4S2BA 1PX3A 3EPOA 1LT7A 3CUFA 4LW7A 1UOZA 1IZKA 4WQ6A 1W17A 2XIBA 1JDCA 1ODZA 4JFVA 4DAIA 1D7KA 4FX7A 3WQWA 2QUVA 2VQUA 4FX8A 3TCSA 1WDWA 3KVJA 4PTNA 4Q8MA 4N4QA 3NDYA 3KCJA 3B8WA 3HN3A 3MI6A 3O8AA 2WZMA 4HU8A 4LS0A 4A2SA 4R7JA 3TR2A 2QLYA 1QO5A 2NZLA 2H9AA 4IPNB 4DZAA 5E1QA 2VDHA 3HPFA 1W8SA 3E2SA 2GVYA 2O9OA 3QZ6A 4IGSA 1C3FA 2Z25A 3CZJA 1GOQA 2Y6ZA 3NQ8A 1ML1A 3SBFA 1W3TA 3L4YA 3GXFA 3RPTA 3CYVA 2RHGA 2GK1A 3NZRA 1VKFA 2D0GA 1RQEA 4KH2A 3SO7A 1LLWA 1W9PA 5M03A 5CZ0A 1U1UA 4OOUA 4IICA 3WSUA 1HW6A 4Q6JA 3RNDA 4GY1A 4TTUA 3W28A 3NR0A 5D2VA 3RLUA 1AL7A 3B03A 3DFYA 4GWEA 1LBMA 4O1CA 1W32A 3KTSA 2JALA 3ITYA 3WNMA 5BU9A 4FMVA 4HZ6A 2IKGA 2BWGA 2E4TA 1W1ZA 1P1XA 1WB0A 1RPXA 2PDKA 4XAZA 3P74A 2J27A 2WV8A 5A6LA 3UG5A 3M6YA 2QEZA 3H7UA 1UBSA 1NH6A 2A3BA 3IAPA 1I8JA 3NJ3A 2VCCA 4Q8WA 1H2JA 1DORA 2X40A 3CPRA 3TMQA 2DIKA 5D2TA 3SECA 4ATLA 4DF0A 2FIQA 4JTTA 3DBPA 1VLIA 2CLKA 1KFJA 3WNPA 4HMEA 1B30A 3BE7A 3HJEA 4IIDA 4M51A 1BSLA 3WDPP 4JTJA 4CD7A 1EGVA 1DPMA 4PODA 5FAGA 1MZRA 1QBAA 1B31A 4MVAA 3GIYA 1EBGA 1TYGA 4AEOA 3U4FA 4IXHA 2X30A 3STPA 2NW0A 3DCPA 2ZRXA 3S5NA 4WHBA 2XISA 4FNPA 3MMUA 2MNRA 1WXZA 2X1RA 1JYNA 1OCJA 4PMVA 3OG3A 1XIJA 2ISSA 3LX9A 2E3ZA 1V6UA 3LV6A 3ME3A 4AD4A 2QMKA 2J66A 3ABQA 1VIZA 3VFLA 1XYAA 2VFDA 5DXYA 3GR8A 4J7RA 3GNOA 5I02A 1FWCC 1QK2A 1FWEC 3PBWA 2DGAA 2Z00A 4D1JA 1EP3A 4JDYA 3RRAA 3ARRA 1ZENA 3B0PA 5CG7A 4DJEC 1W1TA 4CNNA 3FJLA 3LB0A 4FPSA 2GOUA 3T4CA 4GUHA 4GKLA 4IGMA 4HMNA 2HDJA 2W3ZA 5D2YA 1K4HA 4JTQA 5IHRA 1OFAA 3DG7A 3I4EA 2DORA 1UH3A 4LBRA 5KTLA 3T05A 3WBAA 3ELFA 3O0KA 3GBDA 1G7UA 3GNPA 1MO0A 3LA4A 2AMXA 2G41A 1A50A 4DXXA 1IYXA 4DUVA 1YDNA 3W1QA 3W88A 5C54A 2DT2A 4J28A 2AL2A 4HNUA 1CIUA 1YE4A 3S5OA 1HXJA 1X1NA 1B9ZA 1D3HA 1LUCB 1H41A 1FCBA 3BCDA 3LCGA 3VNLA 2J7FA 3WLSA 1HVXA 3CK5A 4I5RA 4E4PA 2QNEA 1J10A 3I65A 3BLEA 3CL7A 4S23A 4YTTA 3SSZA 1EH9A 2X7VA 2P53A 3ITVA 3THUA 4LXFA 3O6YX 3HPAA 1VFLA 4LUSB 4B3LA 5H8PA 1GOMA 3IJ6A 1KV8A 1UR1A 2H3DA 1FOBA 3AIRA 3ARUA 2D20A 4Z42C 3EX4A 1A53A 2ZX7A 3R58A 4LS2A 4LVAA 1BTCA 1K8XA 5A6JA 1GVYA 4JQ2A 1TPB1 2EG8A 5XINA 3R89A 2JQXA 2YDAA 2J47A 2B7PA 3GZ3A 4PTMA 3IS4A 4GO9A 4MB1A 3NSNA 1EWDA 4HK6A 5HWNA 4A8NA 2QDDA 5I3GA 4GI8A 1Q4WA 3C2FA 2FVKA 3BOXA 4J27A 3B0VC 4C60A 3UZWA 5JU6A 3I7SA 1E1CA 1Q6CA 1ONXA 1JYWA 1UR2A 3AXXA 2RFGA 5KZEA 3ZJKA 1TSIA 2I57A 5TF0A 3UVIA 3EA1A 4ATWA 3AZRA 1XLKA 3PF3A 4JTFA 4LANA 5CPMA 3MI2A 3HOJA 1PZ0A 1QPNA 3N4EA 3CL8A 3ZR5A 2OO0A 1JPMA 4WSHA 3NCOA 3RM9A 1GZGA 5J8LA 1CWYA 3CV7A 4AIBA 1ICPA 1QATA 4GX8A 1TCDA 4LEQA 1XSJA 4UQDA 4H41A 2WZHA 4YCOA 1F8IA 3N11A 5A1AA 4DUOA 1TTQA 5AB3A 5IRPA 4WSKA 1KWKA 1XLAA 3N3TA 4H6RA 3MMDA 4NU7A 3ZT5A 4RR4A 3D6NA 1XLGA 3DUGA 1P7TB 6REQB 1IF2A 4HD5A 3TC3A 2HXTA 2FMNA 2E77A 2KX9A 1DYSA 4D9PA 4F0HA 4Q3MA 1NQKA 2BY3A 5EY5A 3TYEA 3QQWA 2C1IA 4KCVA 5HULA 2X0YA 5E9XA 3U2OA 1DWJM 3WF0A 3QPYA 3TKFA 2HROA 2P0OA 1W1B1 3RITA 3P93A 4LV4A 5FA5A 2VEMA 1NOFA 3IVSA 4IJRA 1FWSA 3W81A 2QUTA 4CEUC 1PSCA 3P81A 4I6VA 4L4OA 3TK7A 1XLHA 4L65A 3AHZA 3LXAA 2O4QA 4M6PA 4IIFA 1XG3A 3N9SA 1RCQA 3WEOA 1KCLA 3LHVA 3CO4A 3LGDA 2Y7DA 4QAIA 1DV7A 1AQHA 1EB3A 3EKGA 2GWGA 3R13A 1DKWA 3I6TA 2GJPA 2CZDA 2Y8UA 8XIAA 2H9AB 1R2TA 3F03K 3CMFA 4PMYA 3W7MA 1C9WA 3C8FA 3W74A 3L12A 3E1F1 4GUFA 2PP3A 2GK1B 3ZJ8A 1EEXA 2VCBA 4UXDA 2IXUA 1XBVA 5J5RA 3LTPA 2J6VA 3N3MA 3NIYA 4DUXA 1KTBA 1EJXC 3VKDA 1M9HA 3UR8A 2ZYFA 3S6OA 2FDSA 5M5DA 2YZ5A 4RZBA 4PMXA 4KEVA 4LJ3A 2I9UA 4IMCA 3HB9A 5T26A 3S2JA 2NX1A 3WLNA 3ALGA 8TIMA 1EL3A 3QV7A 1PV8A 3VX1A 2QULA 3FSTA 1H11A 1F8MA 1K1DA 3ZT6A 1A49A 4HNOA 2OELA 1HL9A 2GL5A 1HJWA 4HN8A 3BWWA 2NQLA 1HKKA 3BZGA 4JQAA 5DCEA 2XJ7A 1KRBC 4K2SA 3DHUA 1TWDA 1P43A 1W31A 1DIDA 1SZEA 3NO5A 1Q4NX 1C90A 1XQLA 5C71A 3EA2A 3QOKA 4JKMA 3PAOA 1XIFA 1ONRA 2PRLA 2GYIA 3NQ2A 1A5SA 5CQ1A 4CKQA 2CKSA 2PDUA 3GNDA 2X8RA 4PUMA 4CLMA 1SW3A 1A5BA 3BTNA 1DE6A 4XZBA 3VINA 2YJQA 3LCLA 1MEHA 3C86A 5CCZA 4MJZA 2OYLA 2XINA 3LOTA 4P7QA 1BWVA 1VYRA 3AXMA 2SFPA 3E12A 2V2DA 1QNRA 3LSCA 3OQEA 1MXDA 4F2TA 2RKXA 2WWCA 1Q6RA 1SGJA 4UMAA 4PB3A 3TQPA 1YEYA 4BHYA 1OZQA 5EYWA 3UPWA 1CX9A 2YDQA 3IJ8A 3RLVA 4DXKA 1GUVA 2XWEA 5C6MA 3NQGA 3UGVA 3O6AA 3W7HA 1J6OA 1L2UA 4CCZA 1H1ZA 3PSWA 3CNYA 4U33A 1KFWA 4WKHA 2HE8A 5DRCA 3EB4A 5AC5A 2GVEA 1JZ3A 2HE5A 1Z48A 1RZMA 4GZEA 5FEXA 5LHFA 2E68A 4MKNA 4L4MA 2X0SA 3HMJG 1PL9A 1XL9A 1AVAA 1DJNA 2HK1A 3QGVA 3R8GA 1KNWA 5JXQA 1I9CB 1UWAA 3WUFA 3WJSA 1CECA 1IGWA 1CLVA 4RCXA 2AL2B 1E40A 3WD1A 1TFVA 1X8FA 1CLKA 1QR7A 3RM8A 5B7ZA 4UTWC 3BMWA 2PGRA 4GE8A 2J62A 5AC4A 4UMBA 4K1WA 1OEPA 2ZXQA 3LPFA 3LY0A 3GQYA 1OD8A 4B3ZA 1YMYA 4EX4A 1HUVA 4L6DA 3MC5A 1J96A 1LOQA 3MVIA 4ORIA 2OTDA 3K8LA 4C6QA 3T6CA 4LBUA 3SUSA 3P7YA 3KP0A 4WSJA 2FLIA 1P5BA 2QV4A 1V79A 2F8QA 2Q02A 4YTSA 1H3GA 4MAVA 3WFAA 4GCXA 3FYPA 4I7VA 1XDJA 2FDMA 2RUSA 4OUIA 5GNXA 1KGUA 1H5VA 1KB3A 4C6OA 1XLCA 5FEPA 3GTXA 2G3NA 1E4IA 4CNOA 1IE7C 4MNJA 5FESA 1A3WA 1I75A 4O12A 5AY7A 3SM0A 2EEXA 2E6YA 1GKQA 3KDOA 3PHAA 4Q4OA 1K9EA 1HJXA 4AU0A 3JU2A 1AJZA 3IPWA 2X2GA 2PBGA 2QMJA 3MUIA 1WOAA 5EA9A 1BVWA 3IIZA 4BQ5A 2HVNA 3TLQA 4C6KA 3BCFA 3GZAA 1W5QA 2ZX8A 4Z2IA 4O8AA 3EKLA 1LRNA 1J2BA 4GVFA 2WZTA 4NJGA 3TYUA 5K2ZA 3OJGA 3WQGA 3HQNA 3SCUA 1V0MA 1IEVA 4LYQA 4Q4PA 1CNVA 5LGZA 1YKWA 2J88A 2FTPA 4CU6A 5A8QA 4IJCA 1OQFA 1XXXA 5L6UA 3UY7A 2HRWA 4PMJA 1XH0A 4Z0JA 4D8AA 1X96A 1KC7A 4TVDA 1PEZA 3WD3A 4XIMA 4PL2A 2J9XA 3WUBA 4W87A 3WY1A 4F48A 4KERA 1LL7A 4UQCA 4XWUA 2OWXA 3Q67A 3O63A 1XGZA 1JCXA 4ACYA 2BP1A 4O1BA 5C2GA 2VDGA 5HNUA 2V8ZA 4HPNA 3AO0A 3CT2A 4N0RA 1XUZA 3HGSA 3T8LA 2XDFA 3DG3A 3KBWA 3RG6A 3EX2A 5C9WA 4UFHA 4XX6A 2PWDA 4LFYA 3APYA 2CFFA 1OX6A 3GIPA 5IHSA 4WDXA 1DQXA 2V38A 3WQEA 5JBEA 1E6XM 2I56A 3M47A 3TWAA 1GHRA 1VBGA 4JQ3A 1UMLA 2EJAA 1L6WA 3C4UA 2ZXBA 5EMUA 4TR9A 3QC3A 1U1JA 2RJGA 3CZGA 2PGWA 4JQ4A 2BB0A 1UQYA 1W2PA 1DOSA 1Z9AA 4FP1A 3V7PA 5CEWA 4FOUA 2WCSA 3TCEA 3F5LA 1ISVA 3MPGA 2CHRA 2IQTA 2Y70A 4GJJA 4O0QA 2BASA 2FPYA 1V3MA 3VOCA 1TJ2A 4AZ7A 4X63A 4S3EA 4KFPA 3MUCA 4B2DD 1J79A 2Y1HA 3LU2A 4W9TA 4MHBA 2GLKA 3KTCA 5FJPA 3NPXA 4Z0SA 4U5KA 1SO6A 3AISA 3BLIA 1BF6A 4WGHA 1Q6QA 5GJNA 4ADSA 1Q2RA 1M1BA 4R7WA 1VCFA 4LVGA 2VC6A 3UXKA 1XYFA 4A22A 3HFTA 2YW4A 2IQDA 1TR1A 3C56A 3U0HA 3E9AA 3ITGA 3H21A 2CCRA 3VC5A 1GPFA 1X8CA 1TV3A 4LYPA 4A8RA 1ZLPA 3EDFA 2BVYA 3MHGA 4PL1A 1CPUA 2VMFA 3QFEA 2L5HA 4AQLA 1OADA 3SUTA 4JTGA 1A5CA 2B4GA 1JR1A 2P8BA 4GC3A 5I07A 1KKRA 2PWVA 4LS1A 4IG2A 4RZ5A 3NFUA 4YHEA 4EPEC 3S1WA 1S2CA 4LUTB 4XAFA 3C0LA 1TO3A 3S8HA 1NFBA 4PULA 3AZSA 5ECUA 5G4HC 4D8ZA 3THDA 1E5JA 3H12A 4ICMA 4RNHA 2WHJA 1NFGA 3AOFA 3CM4A 2CXGA 3UESA 3R43A 3SJ3A 5CLWA 3FAXA 3M5XA 2KAUC 1THFD 5A6SA 2V5DA 3SEPA 3ABSA 3MYOA 1SZFA 2ZQ0A 2QCLA 4XO6A 2OZ3A 1VHCA 1SJBA 3GU1A 2DJXA 3LGGA 2ABAA 3QV9A 1FH8A 1QXLA 2VFFA 2XPKA 3OYZA 1GVFA 3TNBA 4DLMA 3E96A 2J8FA 1Q66A 1ZQ5A 1T0OA 3QF0A 2ISDA 1DE5A 4DWSD 4JTAA 4NY2A 2WMGA 2WVTA 3FS2A 1R2RA 5AHMA 2VEFA 3TYZA 3CUGA 4TXEA 4EOUA 4S2CA 2P10A 1FCQA 2NLYA 1LWIA 2UWFA 1YADA 3LRMA 4RPQA 5F1UA 4ZB0A 5HXMA 2F6UA 1O66A 4TX6A 4XAPA 4PUKA 1GGOA 3IANA 3PZVA 1D3CA 2OEKA 3B8DA 2QGHA 4Q4SA 2J7BA 4QS5A 3M7WA 3MJMA 4MGGA 2Z29A 4GYKA 4V15A 4LVBA 4J35A 1XD1A 3OHMB 2Z4GA 2DSZA 4KWOA 1ZB5A 2QT3A 3OBEA 2OLHA 1JVNA 4JHMA 3VDBA 3A64A 1KTNA 4MSSA 3QR3A 3ZLGA 5GQBA 5BMWA 2C79A 2RJHA 4TVCA 4S38A 2VZOA 1JPKA 2FPVA 3O15A 3O2LA 2CXEA 2WJFA 2WMFA 1DTUA 3KBNA 1V02A 1TPC1 2UY5A 5D03A 3KVLA 1CXLA 1VCVA 2RH9A 4H83A 1FWGC 3SCRA 3CIWA 3NWRA 3PPCA 2B7OA 2CWXA 1BTMA 4OHQA 3PFMA 2VELA 1I2QA 4K8EA 3VCCA 5BZAA 3L5AA 2O0TA 2TPSA 1XDLA 2P5NA 3DH7A 4N6FA 4GIEA 3VIIA 1U30A 1GW9A 4D6CA 1Z8AA 1UB3A 3E49A 3M0KA 1OSEA 4PUUA 2ISVA 3SCVA 3SRKA 2NVDA 4XKYA 3T07A 1X1ZA 4JS3A 1DVJA 1VFOA 2R1LA 3UPBA 3IGXA 4W8BA 1NAL1 4LGXA 4KFOA 4LNCA 3TYDA 4EXBA 4Y8EA 3CQJA 3QJAA 3T1GA 2FGBA 2QJNA 1DXEA 4XV0A 3AHTA 2XGBA 2D2OA 2WOQA 3H55A 2D22A 2XH7A 3GXDA 2G3MA 4HNNA 2OZ8A 3N04A 3OIHA 1FP8A 5J04A 4XAGA 5KITA 1S2TA 3M16A 1EC7A 4E6MA 1XPGA 3O9NA 3VGGA 5D05A 3F4VA 4V1YA 8A3HA 1MNZA 3IIPA 3AUJA 3QHOA 3SN1A 3RGTA 2ZA3A 3L0KA 4P2VA 4GZ7A 4FIRA 5CPLA 1T99A 2VI0A 2VRKA 4WJ8A 1XLBA 1SR0A 2GGEA 3MB9A 3V36A 4TVUA 2XWDA 3WMCA 4AWSA 1DJQA 1VFSA 1B3XA 4Q8QA 4UR8A 1W9VA 2XFRA 4CU8A 2E6DA 3TIMA 2YCIX 4UCGA 5CJNA 4DJFD 3LPOA 4C6EA 2W67A 4MAZA 3T0AA 3GO2A 1BQGA 1ZBWA 1OM0A 1FWRA 3SAZA 1BFNA 4NI3A 1B3ZA 2Z1XA 4AZBA 3BMXA 4JTEA 1PWLA 1F7BA 3KZPA 5DFAA 1VFMA 1QWKA 3WBWA 5U4NA 1J0KA 1J0ZA 1EA9C 3CIXA 4PC8A 1M03A 1M7JA 3P2VA 5D30A 3B8SA 1QU4A 1DJXA 1CZ1A 1JQVA 1ZHAA 5FJUA 4L1GA 4ECLA 1V7AA 1X6UA 3JRKA 4GH3A 1N55A 3QBUA 2HS8A 2FHBA 4AX6A 1DQWA 4WOQA 1Q85A 4NASA 2X16A 5FL0A 5MKGA 4JIPA 1PZ2A 3O07A 4K68A 1A5MC 4IM4A 2E7FA 2E1WA 3FJ4A 4IMEA 1XH1A 2C18A 4Q7NA 5JIWA 2C8NA 4C1NB 2Y7FA 3OZYA 3ERPA 1R3RA 2D1ZA 1QFEA 3C3NA 3KRZA 3MO7A 5I3KA 1SZRA 2PBOA 3NQBA 3N2MA 2DJLA 4W93A 3S9IA 4OOZA 4QFUA 3QY7A 2WB5A 1U5JA 2CHOA 1ZALA 3QR0A 1TX0A 3KXQA 1QI2A 2JBMA 1A4LA 3U2ZA 2CITA 4F2BA 2ASHA 3H26A 2DT3A 4PFMA 3H4XA 4XG1A 2Y7EA 4DJDC 4IPIA 3NXLA 3N14A 4REQA 1V77A 3P82A 1KM3A 3DYPA 2IS7A 4H8VA 2QDGA 3CAKA 4CNSA 1ZSXA 4PTXA 4K39A 1P4CA 3BZJA 3WL1A 1GYNA 1U22A 1H09A 1ZTVA 4JFTA 2WO5A 4JX4A 3M5ZA 1P6WA 3AIBA 5ENLA 2VCAA 3RRXA 3CT7A 3CZ8A 4ONVA 1S5NA 4GUJA 3S4TA 1WAWA 1HKMA 3Q58A 3I6RA 2O9PA 3HO8A 1TWZA 3GVVA 5U7SA 3CGTA 4UTFA 3CH0A 2A5HA 2J75A 4ML4A 1XLEA 2HTMA 2WBKA 3IV3A 4S39A 4DY1A 4MPKA 3V35A 2YYTA 1SO4A 4LU0A 4ZR8A 3W37A 4IG2B 3QEZA 2W6RA 4AB4A 1KR1A 3HG2A 3YPIA 1OWQA 1KBKA 1JQXA 1P0NA 1N2VA 3WQPA 1O60A 3S1VA 4PBEA 1C8XA 3DKJA 4K36A 4MY9A 1TV4A 4I7UA 3TSMA 3M0YA 4H6QA 4W5ZA 1H7OA 3CQ0A 4K8GA 4YVVA 4JTUA 3W84A 1E6PA 1TVLA 3TTQA 5CC7A 3AIWA 4KRZA 1SMDA 3C0QA 4FXRA 3R1ZA 1BGGA 4GIYA 2ZRWA 3EMZA 1ME9A 2A3EA 4M7SA 4D2JA 4LF1A 1QK0A 3MW7A 2PLCA 4LC8A 2BOEX 4XK2A 2FZBA 2HPMA 3WQFA 1R86A 1WZLA 5KZ6A 1LRTA 2W79A 4P7NA 3TN6A 1V6WA 3OYXA 1L8NA 2OSXA 3T55A 2PA6A 1W3KA 5A2BA 2DT1A 1J0JA 1OFDA 3V1HA 1HN1A 4I8DA 1LQAA 2E6AA 2WC3A 1J2WA 3IRSA 1D8WA 4A3YA 4M7TA 4TV6A 2C16A 3TJ4A 4OE7A 4U31A 1OINA 2PU1A 1E9LA 3GE7A 3PZQA 1JZ4A 3CAVA 2OZ0A 3APTA 5CJ5A 1VJIA 4R9OA 3W7LA 2A1YA 3G8RA 2CIPA 3DGBA 4WX2A 4K7YA 2ZKMX 1Z44A 3P67A 1W3LA 3VIHA 3XISA 3G5EA 4EXAA 4RZ6A 2EAWA 1G4EA 3PBGA 5G5IA 3UGRA 4JKKA 3LBCA 4UR7A 4UTMA 4F9JA 2DQWA 2VX5A 1F61A 1RY8A 5DMMA 4PE8A 1UKQA 1EA0A 2HJPA 4PGLA 3UR5A 4EE9A 3BSMA 2A3CA 2BODX 5T9BG 3JZEA 1XBXA 1Q5MA 1Q8AA 3C52A 1FH9A 4UOZA 3EA3A 3VOFA 3T44A 1YTKA 3A3WA 1FVPA 2PE4A 4MADA 1EGZA 2XSXA 1R3VA 2QIWA 3VNDA 3W76A 1FH7A 2Z0IA 3OBKA 3AMGA 1S3TC 2G37A 3VYLA 2D0FA 1XFCA 1RJRA 4G7EA 5IOBA 3IVUA 3STEA 5FSDC 2QHAA 1S39A 2J74A 1J4EA 2PDCA 1RP8A 2TRSA 4C6LA 1NU5A 3DFTA 1UD3A 1YRRA 3B06A 1E4NA 5C9RA 1B5TA 4MNLA 4WXZA 5CBBA 1NOWA 1Q6GA 3RILA 4JDBA 4U10A 6XIMA 4ZOCA 3CWHA 4ALDA 1FDYA 4MWAD 1NDZA 3FY1A 4KFNA 3SADA 3VIMA 1CGYA 1RV8A 3SCPA 2G4JA 3R10A 5HQMA 4ZO7A 1R7OA 4PCSA 1WOBA 3APGA 3A9BA 4FO4A 3N34A 2TSYA 3T0CA 4A35A 3HFYA 2V0TA 5AC8A 3PBVA 2VO5A 3WNLA 2FZNA 1E0TA 5F4WA 5D4YA 4KF1A 2E25A 4IL0A 3FHQA 1VLWA 1AH0A 4L56A 4LALA 4EWND 1GK8A 3A4XA 3MY9A 2QJMA 4QM1A 2OLSA 3RXZA 1FKWA 2FFIA 3TC6A 2I7GA 2QDHA 1HIZA 1N82A 3TH6A 1R5YA 1W0MA 3ARZA 3GK0A 2NQ5A 2I5GA 2A6LA 4H00A 1Q6EA 1SU5A 2GVJA 4GKTA 1OX4A 5CPNA 1VJZA 3PC0A 2FVLA 2PZNA 3TTEA 4O53A 4J3TA 2YKKA 5D38A 3MV01 5ABEA 4NJHA 2ZA1A 1PX8A 1I6NA 5HQEA 2FH8A 4OJYA 3PUEA 3RO8A 1O4UA 1G4SA 3CC1A 3U8GA 1W1A1 4NHVA 1J5SA 2NV1A 3CTTA 4H9MA 2P50A 1FHUA 5CH9A 9CGTA 3V18A 3ZYZA 1EF2A 3UR2A 4V33A 3PZMA 3KLKA 3MUXA 3URAA 1TQXA 1ZBVA 2DQXA 5MKGB 1KW1A 2VX6A 3EGJA 3T2PA 5CSSA 3W1UA 1DWGM 3S2CA 4HN4A 1T6MA 1UG6A 1T7LA 5MF5A 2EXOA 4F9DA 1O1HA 3G22A 2I17A 3JVAA 5AYBA 3RHGA 1I0BA 1E5NA 3MUY1 1R3YA 2DFAA 3HQPA 3DFOA 1EX1A 1YDOA 1GJWA 3W70A 3Q65A 5BOFA 1KXHA 3N1AA 1UD5A 2WVVA 3SCWA 7REQA 4H9ZA 3PTKA 4IUOA 1NSJA 1AG1O 3TA9A 1C29A 1US0A 2ZZ1A 5D8WA 3W7RA 4GJIA 4QE1A 1JCNA 1B3VA 2REQA 3RO6A 3RX4A 4Y9PA 2P8CA 1VEPA 5DANA 4KESA 2P88A 4XD3A 4YHGA 4B91A 1YPXA 3CPUA 4KQNA 3LCIA 3N13A 4PMZA 1JUKA 4UTHA 3POHA 2YA0A 4QQ3A 1JPHA 4EVZA 4XB3A 2PDXA 4QEHA 3TVAA 1OT2A 3H2MA 4Y6GA 1C8YA 1UPMB 3UW6A 4FXFA 1QOQA 3GB6A 2EG7A 4IIHA 3L68A 1SW0A 4YTQA 3LCHA 3KAOA 4DPPA 5ABFA 2C91A 4ZO6A 3U57A 2PFHA 4UTJA 4S3CA 1OC7A 2PD5A 1KKOA 1YDYA 2BHYA 3UXDA 4C6CA 4KCUA 1EPVA 4XVDA 4H9XA 3GW0A 3UEQA 1FWJC 2NQHA 5C8BB 1X39A 1BYBA 3SGGA 2QCCA 4IFRA 3TQKA 1TV2A 1W56A 1OGBA 5CBJA 1MUMA 3WKZA 2VX7A 1VFTA 4M6UA 2B31A 1EZ2A 2A4AA 2G3IA 1VP5A 2QR6A 2XHYA 3T09A 2EF9A 1YX1A 3MT1A 1M01A 1W5NA 1PCWA 3WK3A 2CZFA 4NZ3A 2Z1SA 5LNVA 1R3QA 3O1NA 4FOJA 4IP4A 1UUQA 3M46A 3EWCA 2YDRA 3PTMA 1GG0A 4FLRA 4RDZA 4P8UA 1GVQA 4NNCA 1MWOA 4FNSA 4GVIA 3VX0A 1P0DA 2WKGA 3LHUA 4AZGA 4PUNA 1CYGA 3AJXA 1L6GA 3LPGA 2AQOA 3GNXA 1HJUA 3L4WA 3NQVA 4UMCA 3EOLA 3KP1A 4XQ6A 2WJDA 4H9YA 4NNBA 4AVOA 1GQJA 4RE0A 4X60A 4H7CA 2IW0A 1BWLA 2V30A 5AECA 4HZ7A 2NWSA 3W1PA 5H2ZA 3IJ9A 3MV11 4YU1A 2E9MA 1YW1A 4N42A 4XSMA 5AVNA 2ZZ2A 2ZRUA 2ZRYA 5BXPA 1ME7A 3CUXA 3UJEA 3V75A 3CWOX 2NXGA 4XZMX 3VCNA 4KKXA 3W2UA 1UP0A 1P6BA 4GIAA 1FCVA 5LIYX 1A5OC 3WIJA 3SRDA 1GG1A 3WH8A 5LHEA 1XLLA 2F2KA 3BJFA 4B5VA 1N7KA 1HKIA 4GIRA 3R7MA 3WLQA 4AEFA 1H7NA 4MYXA 1R3SA 4AIOA 3WLKX 5TNVA 2PODA 4JYFA 3EX6A 4HVXA 4HSHA 1XGEA 3MSDA 4XUYA 4QP0A 1VAHA 1XD0A 1B3WA 1ELSA 4WDUA 1TMHA 1M6JA 1S38A 3AS1A 3HA1A 4L80A 3LMYA 4G7EB 2WPGA 1WE5A 4J2PA 4I9AA 1AW5A 2XM1A 1LF1A 3PM6A 4NAEA 3GXIA 4QX4A 1KCXA 3W0KA 4GMEA 2YCLB 1EO5A 1PE1A 3NURA 3EWXA 4XAYA 1TPFA 3N15A 2V2HA 2EPHA 4UOQA 2G50A 1ZP4A 3GR7A 1RY0A 3NOYA 4AHQA 1REQB 1KXVA 5D02A 1E6NA 1JI2A 4V1XA 1VPXA 3OVPA 1CENA 5A3HA 1LWJA 3FXYA 1ITCA 3L2MA 4QG6A 3KRUA 1TTPA 4KCTA 3W73A 2VC7A 1SFLA 7XIMA 3NL6A 1K8CA 4ACZB 2O4MA 2DUAA 1Z42A 1QNVA 3FJNA 3T08A 4QJ3B 3MCOA 2XIMA 1KGWA 5TIMA 1A5AA 3PVFA 2CZEA 1KM6A 2CYGA 2WWDA 3WNNA 3VGDA 1BVZA 4LCRA 1EIXA 5B80A 1Q13A 1BEUA 3G77A 4DPQA 4EF9A 1KBLA 4DBEA 2INEA 2GQ9A 1FFRA 3UWQA 3BGAA 1OX4B 2G5WA 2PEVA 3EPMA 3EBVA 3OVQA 3NL5A 2C71A 1LOLA 3I68A 4MOZA 5JBDA 1TQJA 3VIFA 1RUSA 3GDRA 1H7RA 4QNEA 1CT5A 4MWAE 1G0CA 4GUGA 3TJXA 2IKJA 4DVOA 3W07A 4NXSA 2HSAA 1MNSA 3UNDA 2YZRA 1SJAA 2QF8A 1QOPA 1WV2A 2OOFA 3ES8A 3BV7A 1NARA 3VZXA 3KL5A 3MKVA 3WDJA 2Z1KA 4HNLA 4AD3A 3AWNA 3I7RA 1EHAA 4O57A 2ABBA 3H7VA 4XZNX 3URNA 3O6CA 4BEQA 3GFYA 5LSMA 4HSOA 3A22A 3L5MA 3IIVA 3BGGA 3SCNA 3GG8A 4JIQA 3C2EA 5CGMA 3ZOAA 2QS8A 3E74A 1U5VA 1Z89A 3OO2A 4CNUA 1JGIA 4I6KA 3UVAA 1KWGA 2NSOA 2H8XA 4RXFA 1K3UA 5FEWA 3LM3A 1M5WA 5D32A 5FSEC 1P6CA 1TTJA 2FB3A 2ZUWA 1TPWA 4UZUA 5FJIA 3NA8A 1QPRA 2HZGA 2A7RA 2WVVB 2CZ5A 2ZUVA 1JFHA 1EHNA 7REQB 3U5UA 1XRSA 4XISA 4EP8C 1JPDX 2REQB 4LY4A 1NOUA 5K4ZA 3W7OA 2XH4A 4MFEA 5EMLA 3KTXA 1GKPA 5KZDA 3H70A 4UTIA 1XI3A 4ZODA 4C1KA 1TRIA 3KL3A 1JFXA 3IGHX 2OGJA 4AAJA 2V68A 2Q8XA 2YCEA 4B2DA 2QPSA 4GI9A 4H04A 3PWAA 2DP3A 2R9RA 3R0KA 4L9YA 3WL0A 1DIOA 4NJIA 4QE4A 3AWOA 1LQ0A 4YPJA 4GH1A 1BAGA 4FNUA 1ISWA 4O17A 5EMMA 4RNFA 3TTYA 1VF8A 2XVLA 4ROQA 4UFJA 2ZICA 5FJTA 3ZFHA 3PZUA 4GZIA 2ZRZA 3FHAA 4TV5A 5HPOA 1FKXA 1JDDA 2X05A 5ABFB 3PWGA 2OFJA 3D46A 4AD2A 4CNPA 1F3EA 2WMKA 1JZ6A 2CEQA 1BYCA 5K4XA 3KM8A 2VR5A 1H51A 2O9TA 2WNWA 5AHLA 3W1LA 1P0EA 3BSHA 4BWLC 1LOSA 3CTLA 1OK6A 2Q71A 1GT8A 4TO8A 4ZTXA 2E9LA 3B04A 4XBSA 2IKHA 2WXDM 1AJ2A 3EMQA 1X98A 2P3ZA 7TIMA 2VD9A 2PWUA 1FWIC 4C5ZA 2VFGA 4HIBA 3W1XA 4EANA 3TEVA 4HU0A 2FHCA 1XIGA 4GXPA 5ABGA 5I06A 1GVSA 2CLHA 4XZLX 4IH3A 2VM8A 1RLCL 2QF7A 4F8XA 4HOWA 4LAUA 1UYQA 3W38A 2EG6A 3VU2A 3W1RA 1RQBA 3O05A 3KRBA 3SURA 3C3UA 1TELA 1L8PA 1ZJBA 3NZPA 5A6MA 2DZTA 1W1IE 2EPKX 2FZMA 1V3KA 3NQDA 3MS8A 4DYKA 1WZAA 3EYPA 1XCXA 1FX6A 1BWKA 1EC9A 4CVWA 4DJED 3DESA 1UP3A 1DJZA 2GDUA 2J7EA 1HT6A 3PZ9A 5HR7A 1QOXA 3W7IA 2GGIA 2PTDA 3V5OA 3WCZA 4PSPA 4Q6XA 4ZE5A 4NX5A 1EJRC 3L67A 3ZSSA 1JUBA 4DEFA 1OABA 3N6JA 1GTHA 1RHCA 4UUIA 1OF6A 2PCQA 4O54A 2R94A 3GSMA 4NL1A 4OBSA 3C8NA 4LAOA 2QAPA 5C9ZA 2WANA 3H54A 4N4PA 4BFAA 4ZSUA 4HK7A 4TU1A 1S5WA 1US3A 4GGHA 3GG7A 2QJIA 1FDJA 4PN2A 3WG6A 3HV8A 4C1LA 2UV8G 2ZWYA 3DEQA 4ICCX 1ONWA 1JDEA 3TLLA 3EWUA 5DLCA 4L9XA 1W5MA 3O16A 4ZQPA 3M4HA 2HV5A 1MUCA 3B40A 1BKSA 1MXSA 4NAEB 1XBYA 4F2UA 2J25A 1K6AA 4N9CA 3AU2A 1AUSL 1DIEA 3QMTA 2P3EA 3PBYA 1HZYA 4Q7BA 4BJHA 3EWYA 1VFUA 1HKWA 1OHLA 3T40A 1E0WA 2E8YA 4UQ9A 4L4PA 1J11A 3K1DA 3RMJA 1W54A 3RCMA 4W7VA 1I45A 3W87A 1A3XA 1RJQA 5DEZA 1WKDA 3MZ2A 1UKPA 3QOMA 2TMDA 2VVNA 4DZIA 4W7WA 1W3JA 1LL4A 5K9DA 1ADSA 1GOWA 3PJXA 1D9EA 3PJWA 3H2EA 3WLIA 3AIEA 5GJMA 4H8UA 1RD5A 4YYCA 3CMGA 3EDJA 5AHFA 3AU6A 1BQCA 4JKLA 2A3HA 2E09A 3I7QA 1TX2A 3GLCA 1V3JA 1XP3A 3UWWA 1XW8A 1ZU8A 3F2BA 1JUEA 3ARWA 3AI0A 4NILA 2WZEA 4L9ZA 5E0FA 5BXSA 3P60A 5I00A 4Z1DA 2P76A 1LLZA 5C2CA 5A6TC 1PWMA 3M44A 4JGDA 1JCLA 2NT0A 4D6IA 1TJPA 1LUCA 5HUPA 1WA3A 3N25A 1R46A 3FKKA 4ZEPA 1O7AA 3QFWA 3HPXA 4WCJA 4DJFA 1NWUA 2FZ9A 1FWWA 1IIHA 2HXUA 4GVHA 3CUIA 1RP9A 4GI6A 4PUEA 3AYTA 4PCFA 3A24A 1B4EA 1MQRA 1ZJHA 4R9XA 4HOXA 3R12A 1JGMA 3W22A 5A8PA 3F2DA 3VNKA 1TZZA 3OB8A 4TMCA 2A79A 1VB9A 1F07A 2VEIA 1MUWA 5JBFA 2OB3A 4Q7IA 1XKYA 3QHNA 1V3HA 3M0XA 3WLJA 4M3PA 2YFNA 4ZXLA 3UT0A 1NJJA 2PRHA 4M56A 2BOFX 1JAKA 2I14A 3OZMA 4QCEA 3B8VA 3G1AA 1LM1A 3LTYA 2Z28A 2XFWA 3BJSA 4B15A 3WH9A 4ZQCA 2RDXA 2GUUA 3AC0A 2RDTA 1PXGA 3CHCA 4IJBA 5I79A 3MKKA 5A6AA 1ECQA 3DU0A 2CHNA 1OYBA 4R5EA 4JFWA 1O5KA 2ODOA 4KRTA 5I3IA 3BG3A 1A4MA 1NQ6A 5BOEA 1E70M 2POZA 1WDDA 3S3GA 3WJWA 4PA8A 4UQEA 2V3FA 3S5YA 1JXKA 1DIKA 4A21A 2WMHA 2QCDB 3F2CA 2Y63A 3SUUA 1BYDA 3LLFA 3THAA 1J12A 1XRFA 2INFA 1WXYA 4AY1A 4MLJA 1HF6A 1TR9A 3B0YA 3MUZ1 5TD4A 1HJQA 3WF2A 3SFKA 5LA0A 3LK6A 1U2YA 2OQLA 1JYXA 4GNVA 1F4AA 4O4WA 4OECA 1IR2A 1C9DA 3W75A 4NF7A 5I2UA 3E0LA 1BRLA 3C0JA 4BS0A 5BRBA 3MDUA 3WUGA 2FZDA 2WCAA 1UA3A 1P7TA 3VDGA 3SN0A 1D3GA 1K8YA 4B5NA 4C91A 1XLDA 2I5QA 1CI1A 1UUOA 2RAGA 1IEWA 3POCA 4FNQA 4CN1A 2VTFA 2J7CA 1VFFA 4MJMA 1R8LA 4AWUA 2A3AA 2R8WA 3T0TA 1UROA 1HVQA 2PGEA 2PS2A 4PUDA 2AQVA 2XZ9A 3OEXA 3M1ZA 4Z17A 3FN9A 4B5WA 4RV3A 5RUBA 5HATA 3P0XA 3TW9A 4GNKB 3M0HA 4OQVA 1QWGA 4PMQA 3OU8A 1OB0A 4JTKA 3PZIA 3CV6A 1NP2A 3GU2A 1SZNA 3K4WA 1IXNA 2VRQA 5A8MA 2ZBTA 3U3HA 1E0VA 1XS2A 3A9IA 4JX5A 3DOPA 3UWYA 2FTYA 4IPPA 4NZ1A 5FAJA 1IZJA 5AHEA 2WSQA 1ZUAX 4P61A 3HGJA 5JH2A 4M80A 3EOEA 3GVWA 2WZIA 2WM1A 2DSWA 2ZCGA 3AYSA 3BGJA 1O94A 2RGLA 3RLHA 4D6DA 3VVGA 4OFCA 4DNHA 2ZVRA 1OFEA 1YE6A 3BANA 4R27A 3TN3A 2UZ9A 5EMKA 4E3VA 4WOZA 4OBTA 3U7VA 2HK0A 1K4GA 3W7QA 3DC8A 4B5XA 1XLIA 4JZ5A 1XCFA 1M68A 1E1EA 1W9DM 1UD8A 4FHAA 2XIIA 2WVSA 3IACA 2V5LA 2P1FA 5CGTA 4DAFA 1HX0A 2GVLA 3FNDA 2XVKA 3STCA 1GCYA 3WBXA 3MVTA 1GZ1A 2FGZA 3H7RA 3BK0A 4UFLA 1RK6A 3SQSA 3MWAA 1ZAJA 5D2WA 2YSWA 1TPVA 3BAKA 3E0VA 2FZ8A 3AYRA 2E40A 2PDYA 2TAAA 3TW7A 3EDKA 2HS6A 3QMRA 5EGRA 1O68A 2WJEA 1E71M 3EWWA 4JN6A 3IGSA 4WY0A 1FWDC 1CTNA 1TA3A 2V63A 2ZUMA 3WLHA 1W5PA 1CXEA 3ITCA 5E0KA 2F84A 3D47A 2EO7A 4DO6A 3PB0A 1ZRQA 5C70A 2XIOA 4HGXA 3BCJA 4R85A 4BQ2A 1R3TA 3SB0A 1UC4A 4CD4A 1S2VA 4LY8A 2PRMA 3TN4A 4QLKA 1TWSA 3WMSA 1EXBA 2ZFAA 3KLLA 5BOOA 1XISA 2F2HA 2VP8A 3TP4A 1PZ3A 2O7QA 1JZ2A 3ARVA 2BV9A 3GAKA 2IPJA 3T78A 4DJFC 4S3KA 3Q2DA 2OZTA 1OG6A 3OTRA 3UZYA 1QO2A 1C93A 2Q8LA 1UBPC 4AF0A 3SRFA 2WNZA 1JF6A 3L9CA 2C6QA 2WPBA 4J3WA 1AH3A 4ZTYA 4O1DA 4MJ4A 5C7VA 3R8RA 4Q32A 3P8IA 1LORA 4J3XA 3TYBA 4DM1A 4L6OA 2VD8A 5HUOA 5K3VA 5AHNA 2YR1A 3A3HA 4P8WA 1AA1B 4KPLA 3GUGA 4JNYA 3E0IA 1XH2A 4MWAA 2IQ0A 3BLLA 2EGZA 4UC5A 4HA4A 4QROA 3U6WA 3PR2A 1HGWA 3DYOA 2PWEA 4M24A 3OBAA 3UWVA 3SN4A 1FWHC 2Y89A 4EKJA 2YL8A 1EDQA 5DMNA 2Y85A 3G24A 3QPZA 3TQ0A 1Y7VA 4UFIA 3L0GA 4V28A 4NIRA 2YYUA 4GYFA 2GGGA 4ZFMA 4ENLA 4XZWA 4AIEA 5EBUA 2ZZ6A 3NZQA 5I0DA 2ISWA 4HYWA 3TXZA 4CD8A 3LQGA 1DJGA 2QVHA 3L4TA 3TX9A 3OW1A 5G2IA 1W8GA 1LJYA 2DSVA 5EBAA 3SCTA 2HVMA 2QJHA 1AQ0A 4AVNA 1GEHA 3WQCA 4RZ4A 4NRRA 4RJEA 4N7QA 3CB8A 3UD6A 1DJYA 1TIWA 2BTMA 4A3UA 2E6FA 1IWAA 3NEVA 4C65A 5FF4A 1L6SA 2J8GA 4L6HA 3C2VA 3M0ZA 1X7IA 1JG9A 4RE2A 5LNWA 3KVMA 3NPWA 5IDIA 3U48A 4HU3A 4IX2A 4KRUA 4G9PA 4NZCA 3PG9A 3K2GA 3H24A 4GK8A 1W1VA 1F6KA 1SQ7A 4RNJA 3IV8A 3W7NA 1NF0A 3OLIA 2QAFA 3PJUA 5REQA 5HR6A 3VIKA 4YL2A 4BI5A 3TROA 1PTDA 3N6QA 3PP7A 2YCJA 1X1OA 4PEEA 3EXTA 2X1IA 2CLOA 4E2OA 3E38A 3P5YA 3ZS4A 5LNUA 4IQDA 1CDGA 4JEQA 4DHGA 3G0UA 3R5EA 3C2RA 4E5TA 3S1UA 3AYVA 1IQ8A 2P0IA 1B3YA 4H8HA 1PB0A 5IFPA 1H63A 4AH7A 1K70A 4F79A 1R3WA 1A80A 2Q3RA 4WDWA 3QV8A 2QXWA 3G3MA 2R82A 1ISXA 2ZDRA 3WBEA 1LQ2A 3GTHA 3W6MA 2PAJA 1VZWA 3MQTA 3W29A 1V4YA 1QASA 3N2OA 2VR2A 3GAYA 3ZR4A 1QW8A 3NVTA 2Z1WA 3UERA 4QDPA 4UB9A 1MI3A 3N19B 4BI7A 1BRLB 1KD0A 4U2YA 3HQOA 3S2MA 3KW3A 4I90A 3PUDA 1SJCA 5LIKX 3WD0A 3A3XA 2NV2A 2AKZA 2VC5A 3KL0A 1H62A 2J79A 3ONBA 3RF9A 3QH2A 1UZ4A 1QNQA 3MHUA 1J8VA 4UOJA 3A47A 4X0NA 1VR6A 3TAKA 4A2RA 2C14A 3VPLA 3B9NA 1VCGA 4GQQA 2BGQA 4DF2A 2YW3A 4Y7EA 1XR2A 1TWWA 2GJRA 3TOPA 3CV1A 2ACUA 3M9YA 2C1GA 2B81A 1XLMA 3C61A 3MP5A 4LTSA 4HHHA 4FZIA 2BX7A 2VWTA 4HJWA 4DM2A 2Y5EA 3VIOA 3CHFA 3CS2A 1BG9A 2DSKA 1ZS2A 2O56A 2BY0A 3VM7A 4O1AA 4UZSA 4C7FA 1GNXA 4GQGA 4GHRA 1VQTA 3GDKA 3UFYA 1KQZA 2UY2A 5DY2A 3H6OA 3W86A 1JYVA 1CGUA 5K9CA 5CGQA 5DBTA 1K9TA 2R14A 4W85A 1TWIA 2NXHA 3VTRA 4I9TA 2OT1A 4JL1A 5LIUX 2VYOA 1FWAC 3VD9A 4QG9A 3T2QA 5I7GA 3NQEA 4PTDA 3U2EA 1KLZA 4CQAA 2A7PA 1FWNA 4GRSA 5KZMA 1V6TA 6TIMA 1QNOA 1F3TA 1TPH1 2YA1A 4Q8OA 3E5BA 3R0DA 4YS1A 1A5UA 1V08A 1CGXA 3SY1A 1UPPA 1QW7A 2J7DA 1A5KC 1JCJA 3QSRA 2OT0A 7PTDA 1HJSA 4ERIA 1GOOA 1M53A 4TX9A 1BHGA 4AD1A 2AAAA 4FAMA 1RD6A 2CETA 2XFYA 4JCLA 1NDYA 1WNOA 3D3FA 4GI4A 2BLEA 2QV5A 2ZZ3A 4Q8VA 1H5YA 4D6JA 3L65A 4KWSA 3HTWA 6XIAA 1JEZA 5T8GA 1KLYA 1GQLA 3DDMA 4GBUA 1RK5A 2E0PA 1OCNA 4MWAC 4PRRA 3BW3A 4YMZA 4WY0B 3WF1A 1J9YA 1HJVA 1FP9A 1W91A 1M04A 2PLJA 1TA3B 4FNRA 3UJ2A 1JD9A 3STFA 1WCGA 2Z26A 4HCDA 4IPLA 3G3DA 2Z2AA 1OFQA 2WSPA 1TUFA 5CZJA 3W23A 3ZSTA 5CC5A 6ENLA 1YXCA 4PR4A 1E43A 1OY0A 3M5VA 1F9CA 3P14A 4QRNA 4LUTA 1K7EA 4HTBA 1FWTA 5CSRA 3S0CA 5HMFA 1RJPA 5HMDA 2DZSA 2ZADA 1EDTA 1SUXA 5AKQA 4GG9A 3ZLHA 5CZKA 4X9YA 2DZAA 3UWEA 1PUDA 2PP0A 3SY8A 1KBBA 1V0NA 5CPOA 4AF0B 4GJ1A 4HBKA 3H2OA 1LCOA 3T7VA 1E4LA 4MNKA 3DI1A 5G2HA 5FL1A 2FJUB 2FQIA 1TB3A 2O9RA 4M5PA 3CLMA 1AW2A 1PTAA 3BW2A 1TJ1A 1S5VA 1POKA 3ZIZA 1XYZA 5G1TA 3RCYA 1C8QA 5C0QA 3MUAA 4MWAB 2OOGA 2YFOA 4O19A 5H91A 3ARYA 4IIBA 4FSAA 1X38A 1I2RA 4MKSA 1I4NA 2E8ZA 3B97A 1W1PA 4S1FA 5HMSA 3BAJA 2VHLA 3W4RA 3VC6A 1TMQA 3QYQA 2YDSA 2NUWA 5DN1A 4XBKA 2HEJA 3GHSA 1ZJIA 4IFKB 3VMPA 4H2CA 1P48A 3L7RA 5BCAA 6PTDA 3TNOA 3CEPA 3WQVA 1BGAA 3L66A 3PG8A 1UHVA 2BSLA 1HFBA 3S5SA 4FX6M 1XC6A 1QPQA 2CZVA 2W92A 5FJRA 2AQWA 2VGIA 3VIPA 4Z2HA 2PCEA 2XM2A 4RL3A 1MRAA 4JD4A 1FXQA 1NFPA 4INFA 1MEWA 1EYEA 1LROA 1WAUA 3AMDA 4DB7A 1QDSA 3IIXA 2W66A 2EQDA 5DBUA 1S2AA 4F0SA 3WN6A 4JNZA 1XRVA 5EMJA 3N4AA 1UH2A 5A8OA 3WQ8A 1UA7A 4ZE4A 1IR1A 3LENA 1E56A 2DU2A 9XIMA 5AC6A 4BEUA 4Y9NA 3TTSA 4UNLA 4H7VA 2DPEA 1G69A 3GXTA 3DZ1A 2OWCA 3G18A 3CO8A 1HG3A 1QI3A 2C1HA 4AG0A 4JTSA 5CBIA 2VEKA 5I09A 1WKFA 2YL5A 1Y5WA 1BXNA 3T8QA 2GUBA 3FK4A 1XLJA 4JTLA 5PTDA 5REQB 2OPJA 5LYRA 4FLOA 4G2DA 3OPSA 1UR9A 3G1SA 5I03A 2GDQA 5IFTA 3Q37A 3UU0A 5A95A 3NGJA 4JN7A 3HV9A 3DBNA 4JEJA 3VKCA 4YLWA 1IT7A 1UW9A 3OA3A 3WZ0E 2NX3A 4DJDD 3PJTA 3HPSA 2Y2WA 3V0TA 4L64A 2JF6A 5A8NA 3ZZ1A 3NXFA 1XPYA 1VBUA 3AS2A 2VJXA 3HQ1A 4J4KA 2OJPA 4WEVX 1KXTA 1EP2A 5BXRA 3IJIA 5CSUA 2QCEA 4IL2A 4U3AA 4XTIA 3KDNA 4LUJA 4GISA 2DH2A 3WNOA 1MW2A 3EEZA 1CGTA 1OF8A 3VUSA 4MYAA 4JHOA 2VR4A 1EGMA 2W5FA 3G0SA 3CMJA 1VBJA 2A21A 1QHOA 2QPUA 2JFEX 3S2LA 3CAQA 4ERGA 2R91A 3DG6A 3B9DA 3PBUA 3N29A 3Q45A 1ODUA 5JVLA 3VE7A 4L1WA 1S2WA 4HMCA 4ZBCA 4KT2A 1PKNA 3GYCA 4Z2KA 4PBGA 2VURA 2OKOA 4HSNA 2GGJA 2ZUTA 4B9ZA 3LCFA 1QUMA 4H1ZA 1E3ZA 3OA5A 1HP4A 3ABXA 3NQ6A 3RJYA 1TCMA 4DO5A 2IKIA 3MWCA 5DO8A 4ROPA 1W9BM 3W7GA 3S2NA 4ZXOA 4S3BA 1TV8A 2DH3A 2MANA 3V0SA 4LF2A 3G1YA 1V51A 5I3HA 4WJXA 3BQ5A 2Y8VA 1S1PA 1M7OA 3NVDA 1KFLA 4TMBA 2OO6A 3IJ7A 2I5IA 4KWWA 2EKGA 3DC0A 4C1NA 2ACQA 4IPJA 1QTWA 3WD4A 1QI5A 4MMWA 1UC5A 4E4FA 3NQMA 5EKYA 1X6LA 1R30A 2WMIB 3RJXA 4XZIA 5FF2A 3UCDA 3UWZA 2QYGA 4B5SA 1I1XA 2ISFA 3LQLA 2ZUNA 1IEQA 3USZA 3NO3A 3DAQA 4JTDA 4BZYA 3ARPA 3NQ7A 4MJ2A 3F5JA 4A6GA 5E5CA 3LS9A 5F1VA 1XIIA 5HANA 4DBUA 1EEPA 1UWTA 3TC7A 2XN0A 3OGVA 3N9RA 3WF4A 1XLFA 3GTNA 3V1PA 1XIBA 4AY7A 3PZNA 3RR1A 4H2HA 2BVTA 3W26A 2HQAA 2POTA 1J18A 3R6IA 2Z24A 5F7UA 3JR2A 4I5XA 3WMBA 3GXNA 4IXXA 3SFWA 2PF8A 1K02A 3ANUA 4QITA 2OYKA 5HINA 2C3ZA 1GKRA 1PIGA 1GJUA 3NDOA 2PDFA 1SW7A 4PRWA 2VGFA 4YVPA 1AD4A 4JFSA 2V81A 1VPYA 2W91A 4DELA 3QLLA 1K03A 2B7QA 2YXXA 2Y7GA 4HHPA 3VD3A 5EL1A 5XIMA 3ZXWA 2ZC1A 1TE1A 3M7SA 1GHSA 3RYSA 3BPWA 4UQAA 2ZOXA 1S2UA 4HJFA 1JZ7A 3LHZA 4X2RA 1UIOA 4CCEA 4AW7A 4UNKA 2F61A 2PPGA 2QZRA 3UZJA 1ONEA 1P0BA 2D2JA 1EO7A 3LGEA 3C2YA 3WQ5A 1UJQA 3NNTA 3CHDA 4GA8A 4LX4A 3PAJA 3VNJA 1QNPA 3BH4A 3F7JA 4UIOA 3C6CA 4QHRA 2JIWA 3H2NA 5EB8A 2Z1VA 1O5QA 3WNKA 1GWJA 4LT9A 5AHIA 4CEXC 4A8LA 4Q8PA 3WDHA 1SSDA 3DGRA 4O11A 4F0RA 4C6FA 2QQ6A 2DVXA 3MTWA 2XVPA 1VGAA 2PDJA 2WBGA 3WEMA 3OVRA 1YXYA 4GC4A 2V67A 2PDLA 3QKEA 3VKBA 5E0CA 2WQPA 3ATYA 4ZB2A 3GDMA 4IWWA 2HBVA</