3UZWA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
325
structure length
325
Chain Sequence
b'DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 115
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzwA00
3EB3A 3CV6A 5C7HA 4JQ1A 4GQGA 1PZ0A 4JTRA 4YVPA 4LBSA 3V0SA 2AGTA 2IS7A 3MC5A 3H7UA 3GUGA 3G1RA 2F2KA 1LWIA 1EKOA 3GHTA 2HDJA 2HE8A 2IPWA 4L1WA 3RX4A 2BP1A 3M0IA 5AZ0A 3UZZA 3B3DA 4JQ2A 4QX4A 3LZ3A 2NVDA 2FVLA 1ZQ5A 2J8TA 1AH4A 4XAPA 2PFHA 3R7MA 4GA8A 2PD9A 3R6IA 3CAQA 3LNMA 4YVXA 4XK2A 4AUBA 4MHBA 1T40A 2FZ9A 3UWEA 2IKGA 1EXBA 4GIEA 2FGBA 1FRBA 2PDQA 2R9RA 2HVNA 1PYFA 3N6QA 4FZIA 3WBWA 3BUVA 4WDTA 3EAUA 3DOPA 2PDYA 2WZTA 4YS1A 4IJCA 5AZ1A 2PDNA 3N2TA 4FALA 5JH1A 2IKHA 2PDMA 4WGHA 4DBWA 1M9HA 5JH2A 3R8GA 4XZHA 3S3GA 5LIYX 1R38A 1S1RA 1IHIA 3C3UA 4DBUA 4Q7BA 3R8HA 1ZUAX 4PUWA 2PDGA 1HW6A 4JIRA 1Q5MA 4XO6A 2HEJA 2PDCA 1PWLA 2HV5A 3BURA 5LIWX 3UZYA 1XF0A 2FZBA 4XVDA 2CLPA 4WDUA 3V35A 1X96A 1RY8A 5LIXX 2IKIA 4PMJA 1Z8AA 1US0A 2ALRA 2IQDA 4LBRA 3UFYA 1AH3A 4ASTA 4I5XA 3UG8A 1ADSA 2NVCA 5KETA 4WDWA 2BGSA 4ZFCA 1JEZA 3RX2A 3ONCA 4PR4A 1RALA 1MRQA 1K8CA 3GHUA 4HMNA 2HVOA 4QBXA 2PDJA 2PDKA 2QXWA 3V36A 1PWMA 2P5NA 1A80A 3H7RA 1S2CA 1X97A 3ONBA 1SM9A 4GACA 2PDUA 2VDGA 4XVEA 3CMFA 3V0TA 4QR6A 2A79A 2FZDA 3LQLA 3LD5A 4G5DA 1EF3A 2ACUA 3WCZA 1YNPA 2IQ0A 3VXGA 2R24A 2DV0A 3UYIA 3EB4A 1QRQA 3O3RA 2C91A 5HNUA 3RX3A 4XZNX 1GVEA 3G5EA 2PZNA 1PZ1A 1UR3M 4R9OA 4XZIA 1MI3A 1YE6A 3CAVA 5DANA 4PUUA 2ACQA 5LIUX 4JTDA 4JTAA 3UZXA 4PRRA 1Z9AA 3KRBA 4JTCA 4JIHA 4JQAA 1AFSA 2BGQA 4XO7A 5M2FX 2IPJA 4XZLX 1C9WA 3FJNA 2I17A 2I16A 1AZ1A 3BV7A 4FA3A 4LAUA 2ACRA 4JIIX 5LIKX 2IKJA 3DN5A 1OG6A 1S1PA 3LEPA 2PEVA 4LB4A 3WBYA 1MZRA 4JTQA 2DUZA 3LBOA 4ICCX 1AH0A 3ERPA 2FZ8A 4FAMA 2INZA 2IPGA 4PRTA 4JQ4A 2PDLA 1J96A 1VP5A 4Q3MA 3CV7A 4EXAA 1HQTA 2INEA 3LUTA 1ZSXA 4WDXA 3UGRA 4GABA 4EXBA 3UP8A 2PF8A 3T42A 3COTA 2PD5A 3H4GA 4YU1A 3P2VA 4JQ3A 3WBXA 4RPQA 3GHSA 2F38A 5HNTA 3BCJA 1Z3NA 2ISFA 1VBJA 4DBSA 2ACSA 1X98A 3LQGA 3R94A 4WRHA 2PDFA 3M64A 3LN3A 1QWKA 2WZMA 4IGSA 4NKCA 2IPFA 4H8NA 3NTYA 3R58A 4F40A 1S2AA 3V0UA 3UZWA 3O0KA 3R43A 3M4HA 1YE4A 2DUXA 4LAZA 3F7JA 1Q13A 3GHRA 4GQ0A 3U2CA 3FX4A 5HA7A 4GCAA 2PDIA 2PDWA 4OTKA 4WEVX 4HBKA 3MB9A 4YVVA 1RY0A 4IJRA 3QKZA 2HE5A 3Q67A 3Q65A 3LENA 2PDHA 1XJBA 4DZ5A 1IEIA 2PDBA 3WG6A 3LZ5A 4L1XA 4QXIA 2PDPA 3CASA 1Z89A 1LQAA 1XGDA 1AZ2A 4XZMX 3D3FA 1YNQA 4LB3A 2PDXA 1T41A 1ZGDA 1EL3A 4H7CA
chains in the Genus database with same CATH superfamily
3D3AA 1OD0A 4J1OA 5AC7A 4IPLA 3F2CA 3QR1A 1XLMA 5AC8A 3GWQA 1UWAA 3JRKA 2W67A 4HK6A 4F0KA 4ZO8A 4U3AA 2J25A 2Z1KA 3TA9A 2Z0IA 3I10A 1RQHA 2WMJA 4HPHA 3BH4A 3CAWA 3K30A 5D9PA 3VCCA 1G67A 2Y0FA 4RE4A 3FGCA 3F5JA 1NVMA 1IXPA 2C13A 1RVGA 3P81A 3ABQA 5AZ0A 4US6A 1W5MA 3GKFA 3K2GA 4B5UA 2TYSA 4J3SA 1K8YA 3ZXWA 2DZWA 4CN4A 2MUCA 4XV0A 4PTVA 4NJHA 3U4AA 1B30A 3NSXA 3E0FA 2PFHA 3ZWTA 3GDLA 1KXVA 2Y7DA 4Z0JA 1B3OA 3G1YA 9XIAA 4PA8A 1L2UA 4ZQMA 3DFSA 1QFEA 2RDUA 3O8AA 2ZA1A 1MNSA 1R9ZA 2GUBA 2ZDRA 4MPQA 1A5AA 4NXSA 2ESCA 4I9MA 2NWRA 2PCEA 4H8VA 3N6QA 2RH9A 4TOQA 1C29A 3B9DA 4FZIA 3TSMA 2OX1A 4QJ1A 2GVLA 1J5TA 4KIRA 4O1EA 3DOPA 2PDYA 1FWCC 4MB1A 2XWEA 3RYSA 4JTTA 1JCJA 3MCMA 1J93A 1QNQA 4PZVA 4M80A 4WXZA 2YA2A 3P3BA 3RN6A 3E74A 2DDXA 2E9BA 5T9CE 4C5YA 2WC7A 1ZUAX 4PUWA 2J9ZA 1E1CB 1KM3A 3W29A 1PKLA 2V67A 3BO9A 1BF6A 4WR3A 4AZ6A 3NYDA 2NXHA 4Z1BA 5IM51 4GIYA 5C2CA 4Y8EA 3KOYA 2BXVA 3DKJA 3EXSA 3ZR4A 3ZLHA 2FB2A 4XSLA 2A0NA 1UR4A 2YL9A 4H9XA 2W91A 2R94A 3V5CA 4WY0A 3K8KA 3MU7A 3GG1A 3TFXA 4ATWA 1GTEA 4B91A 5IDZA 5B80A 4I5XA 3BQ5A 1ADSA 2NVCA 3AOFA 4WDWA 1O12A 3CWOX 1MQPA 3BSGA 2QMKA 4XAYA 3C52A 2PTWA 3R13A 3W1NA 1DEDA 3QYQA 2ZZ1A 1VCFA 1QI3A 2X8RA 1FKXA 3N13A 1BVWA 3U4FA 5CC3A 2GGIA 1R2SA 1E71M 1C9DA 3EKZA 4XVEA 4JPGA 3R0KA 2DH3A 3VIHA 3T2QA 2QPXA 3OLGA 1W3LA 2XISA 5K7JA 3IGHX 1QI4A 3LXCA 1ZNNA 4OV9A 4QLKA 1JZ8A 3VD7A 3RRAA 1ZB5A 1G1YA 1V0KA 3ZYZA 2YYUA 1VBRA 4UFIA 3WH9A 4LVFA 4L65A 1JFXA 1R3QA 3G1XA 5CC5A 4BF9A 5C9XA 4S3AA 2BNJA 4PUUA 1SVDA 3LCFA 2XIQA 2ACQA 3CV1A 5XINA 2BSLA 1SFSA 3NXFA 4JHMA 2EEXA 3N12A 3I6TA 3N29A 2X2YA 3KRBA 4JTCA 1EWEA 5FJOA 2WMGA 4WK9A 1XPGA 3ZT7A 1VRXA 5CZTA 4AFYA 1KXQA 3AHTA 3P6LA 5CAKA 3HPFA 5DQPA 2H3BA 2HMCA 1TA3B 3RR4A 1K1DA 1XRTA 1FTXA 4O1BA 4XG1A 4YXGA 1XDLA 4PMDA 1HT6A 2GQAA 2YX0A 4S3EA 1UPPA 3T81A 5CJ5A 2XSBA 4F3HA 3F4NA 3POHA 1XLAA 4QLLA 3KBMA 1UR1A 3KOFA 1HQTA 2IUZA 2Y7EA 1ZZMA 4IL2A 4DJFD 3K1GA 3H4GA 3KLLA 2XFRA 5CSRA 1A47A 3W74A 1H11A 2YL8A 4W7VA 1UYQA 4LRSA 3EX3A 3C8FA 4E38A 1PCKA 1P0EA 1HVQA 2VQTA 3PPGA 1WPCA 1Z32X 3E0VA 1I45A 3QPZA 3I7SA 3VKKA 2ISFA 2FTPA 4O17A 3KCOA 3N17A 3I7RA 2ODOA 1MUMA 2YW4A 4NU7A 3CQJA 4IP4A 3TYAA 1RQBA 1YDOA 3VNIA 1MMFA 4C7GA 4Y8FA 2EPHA 4JCMA 4HU8A 5C9RA 4U10A 3T6CA 3MZNA 3CU2A 2WSYA 3HPXA 4L4OA 4LUSB 4IICA 3T55A 1IZKA 2P76A 3OGSA 1C8XA 1RZMA 5EGRA 3UZWA 2B7NA 1XYLA 3GIQA 1XD0A 2QUNA 1VR6A 3CZ8A 1FX6A 3DIPA 4QSFA 1ZAIA 2QR6A 4HN8A 2GGJA 2CZDA 1SQ7A 3HPSA 1BAGA 2ZUVA 6REQA 4ICMA 3WH8A 5IRPA 1W56A 4EXQA 4GYPC 1C8VA 4U3CA 1B90A 1MDRA 3CNYA 4BCEA 1KRBC 4D6HA 3P8JA 1V93A 4QFUA 3B03A 4ZE5A 4EF8A 3DG3A 2MNRA 4AHQA 1REQA 4GQRA 3DFHA 1YPIA 1XRVA 5CGTA 2J78A 3S47A 4LNYA 5HOSA 1JJKA 3CASA 1Z89A 1JF5A 3QQ0A 2WNQA 4ZGYA 3D3FA 2E8ZA 3K4DA 4CQBA 1Q6RA 3HFTA 4W84A 1T41A 2HTMA 4RZ4A 4UTFA 3WQWA 4TTGA 3CB8A 3SY1A 4GQGA 3G6MA 3VZYA 2EBNA 1U1JA 6A3HA 1NFPA 1V0MA 3QZEA 4LS1A 1GEHA 4IHCA 3L0GA 2IS7A 1PXGA 1P7TA 3II1A 3W7RA 3AMLA 4C1NB 4NAEA 4JIPA 1WUFA 3R8RA 3NGJA 3RMJA 1X6NA 4L1WA 2C0HA 3ARWA 1H3GA 3EMCA 3DX5A 3M0IA 3DFQA 2WJDA 4NJGA 5XIMA 4AW7A 3H23A 2AAAA 2O4MA 1HTIA 1T96A 1Y0EA 3VKJA 3WNNA 1XIMA 1LZOA 4DO4A 4CEXC 5D2XA 3FV9A 4HT3A 1V6VA 3WFLA 4MWAB 1FQ0A 5CJNA 4ADTA 5F2IA 3GC2A 4J3WA 2CZEA 3ECQA 3VNYA 2YZ5A 4W8LA 2H9AB 3HPZA 1VC4A 4DUVA 4JHOA 4IUOA 2QLYA 4B2DD 2GLKA 1I1WA 3VGFA 3IJ6A 1QW7A 4GIAA 3EAUA 5CAHA 5T9BG 4LAMA 4FMVA 1Q6FA 1JCYA 3FA5A 1XIJA 1QOQA 4G56A 4RDVA 2UBPC 4CD8A 4TX9A 4P8UA 1P0BA 2WLYA 3URAA 5HULA 3W1AA 1TV3A 4HA1A 4WX2A 4XZHA 3WSUA 5JIWA 2AAMA 4UTTA 1PAMA 2WPBA 1K03A 4K1GA 4K1WA 5HQLA 1DORA 3SADA 3NQ7A 5LHEA 1SZRA 1HL2A 1TTJA 3BG5A 1PL9A 4R85A 2Y2WA 3SZ8A 3T40A 1AQHA 2PGWA 1EO7A 3U6WA 3LHVA 2IKIA 3JS3A 3NFUA 2W4XA 3ZVIA 1F8IA 2NSXA 4LBRA 1E1FA 1XCXA 2ZOXA 4OECA 4Q4KA 4HNCA 3RRXA 4LOCA 3E02A 4FXRA 4QNWA 1DJQA 4GWEA 1X1OA 2DORA 3GW0A 1HKMA 3EDFA 3UD6A 4WQ6A 5CBBA 4GPNA 1LRQA 3UG5A 2A21A 3KLKA 1FWIC 2PDUA 3B4UA 4CUCA 3NDYA 1XYBA 1Y5WA 3OU8A 1VGAA 4V1YA 2R1NA 1PB0A 1FHVA 1V8EA 2ZYFA 3TFCA 3NDZA 3FA4A 5ECVA 2CLOA 4FNRA 1JZ7A 5D30A 4YWIA 3QTPA 3UR2A 3B9OA 3FGCB 3WD1A 1FOBA 3AMKA 5EU9A 1AG1O 4HSOA 3W1PA 3K5XA 3F03K 2NWSA 8XIMA 1WDSA 1VBHA 4JTDA 1EUAA 4HYWA 1JXJA 4UMBA 5A8MA 1ITQA 1WDRA 2AGKA 3GNXA 3H70A 3W7PA 1DQUA 1OK4A 2I17A 2CZFA 3AIUA 4US5A 3M0YA 1E4IA 2JGYA 1NM9A 3NYZA 3LOTA 4OE7A 3GXPA 3TC6A 1GOIA 3WDJA 3NG3A 2DQWA 4ZXOA 1XLDA 3WLPA 3KM8A 2G4JA 1QNVA 1WKYA 1GVFA 3NGFA 4F0RA 3CQKA 4QDMA 1LDCA 3TAOA 2XGIA 3MO4A 4GABA 3DESA 1J0HA 1EC7A 1ZU8A 2WSKA 3C0LA 1UWUA 3QY6A 2OYMA 1FWTA 5CG0A 3W86A 3GHSA 5AYYA 2F38A 5CQ1A 3W0KA 5D4YA 1W91A 4LQ1A 2P10A 3SCVA 1EO5A 1LQ0A 5KZ6A 4WGXA 4GRSA 4CCDA 2GUYA 2BHYA 2OLAA 2YA1A 4GVGA 4LAKA 3CYVA 4ZE4A 3EXRA 4A4AA 1Q8JA 3TVAA 4H9ZA 4NX5A 4WY0B 1FKWA 5EL1A 4OKDA 1JGIA 5DMLA 3R58A 4MYXA 4YTTA 1CX9A 4AD1A 4XWUA 2DY3A 1V0LA 1ISXA 3S2LA 3M4HA 3F1QA 3WQ4A 1BG9A 4LAZA 1TVNA 1Y65A 2VZVA 2P0OA 5CKSA 3DI0A 3UY8A 1UWIA 1IEWA 1TCMA 1E6NA 3U2CA 5LZLA 3I3BA 3VDCA 3GLCA 3U5UA 4OOZA 2A3EA 5DF0A 3THDA 1VFSA 3CO8A 4F0SA 2DZBA 1R86A 3LERA 4AYSA 3SRFA 4AVNA 3QKZA 4DJED 3STPA 2QCHA 3QRHA 3AMGA 1KRMA 4Y9NA 1J0ZA 4DZ5A 3OVQA 4HOXA 2XVGA 3AXMA 5I06A 1FDZA 1KM5A 3GNDA 1SJBA 2VTFA 4UZUA 4XAGA 3F5LA 3UCQA 3FEMA 1FWJC 3OZMA 5ABHA 3O1NA 3EB3A 3G6LA 3WUEA 1F4HA 3UGVA 5CZKA 1YX1A 4UOQA 2NLIA 3MCOA 4ACZA 1IIHA 4YVPA 1OHLA 3PANA 3ORWA 4GCXA 3DBPA 3RLUA 2FVKA 4PFHA 4KEVA 3QPYA 2NSOA 4O1DA 2PPGA 1AW2A 1BD0A 1OFQA 2HISA 3N2CA 3NXLA 4IUGA 4F8XA 3GTHA 5T91A 1IWPA 1BLIA 1EGMA 3PBGA 4GO8A 3ARRA 2NZLA 2OZ3A 3TP4A 1GHRA 1F76A 4YTRA 3EXTA 3M6DA 2FVLA 3W88A 1JAKA 3WDRA 3AIRA 4LY8A 3BAXA 2CLHA 1UD2A 2MANA 1HGWA 1LLWA 2AKZA 5I24A 2CHOA 4Q7IA 3AUJA 3UESA 3KOZA 1EJ7L 3S1WA 3M44A 1OFPA 4IGMA 3VNKA 2G96A 2JF6A 2W0UA 5I3IA 1UMYA 3VD9A 3MVIA 1Y8BA 1RLDA 4NZJA 4NI3A 1W9VA 3IACA 3W37A 4YS1A 1UC4A 3MDWA 3AUOA 4X0VA 3ES8A 1X1NA 1X6UA 3OW1A 1GZ1A 4MNJA 4K7VA 5JH2A 1SFJA 1S1RA 4XBKA 3SCOA 2PDGA 2JBMA 3L7RA 3BSMA 4XD4A 4ZTYA 1JPIA 5BXRA 4CD5A 1KQYA 2BDQA 1GQIA 5A3HA 4BI5A 1PV8A 2AQOA 3W01A 4DJFA 3FFSA 1CEOA 5EMUA 4GJJA 2VWSA 2DT3A 3H2MA 1VBGA 2NT0A 2ZE3A 5BYWA 1GKQA 3MJMA 4MG4A 4YTUA 6REQB 1R6WA 2BXYA 2E6FA 4X0NA 4UFKA 5HUPA 1W3TA 1FDJA 3ZOAA 3VGHA 2NV2A 1IE7C 4GC3A 4L9ZA 4IMEA 1AQFA 5KSWA 1UWSA 2J8FA 3GW3A 1REQB 1U2YA 2PDJA 2C1IA 3VM7A 2P3ZA 2CWXA 1XSKA 4ILSA 1OBAA 3EBVA 3UQNA 2X1RA 4UMAA 1TV2A 2FDMA 3GTIA 3RCYA 3NR0A 2OT1A 4A6GA 1CZ1A 1MXDA 1H2JA 1G4PA 4NZ4A 5D05A 5I0DA 2A79A 5I3HA 3CLWA 2ACUA 5AYZA 3O07A 2XUCA 4V2XA 2NQZA 3RCMA 4ATDA 4ADSA 1P7TB 4RZ6A 4NAEB 4Q8MA 5E6YA 5BZAA 1ITUA 1TPB1 1YKWA 4EE9A 5A69A 1O66A 4R9OA 3O6YX 2P50A 3WLQA 4GZ7A 1XC6A 4V28A 1U22A 3BW4A 1QPOA 2CWNA 4O0ZA 4KEMA 4LUJA 3IS4A 4C6PA 2GJNA 3BLPX 3HZ3A 3TTOA 4EK7A 3GU9A 4XO7A 1V02A 2X09A 3NNTA 3WQFA 2I56A 3Q2DA 5I2UA 3BV7A 1U83A 3KBJA 2QV4A 5A2CA 2GGEA 4FXJA 1TPVA 1G4SA 4K3ZA 4ACYA 4GI8A 2J7DA 5BWAA 4O1AA 4W5UA 1UKQA 4YHGA 4WD0A 1MZRA 3LV6A 6XIMA 1VFHA 1Q7ZA 1Z44A 2WVTA 4RNHA 3QKEA 4S3GA 1FP9A 1XLCA 5IBXC 1Y5XA 1US3A 3GY1A 3Q4DA 2IPGA 3M0VA 3IK2A 4E6MA 3LI1A 2DU2A 4WDXA 1K7XA 3L65A 5EKYA 3LHZA 3L5MA 4G1KA 3BJTA 2FYMA 1JDEA 3ITCA 1EB3A 2QCCA 2EPNA 4GXPA 3SCWA 2VXNA 3PF3A 3BGJA 3KZPA 3VM5A 4JN8A 4N4QA 2C8NA 3PZIA 4UFLA 3UR8A 2VC7A 5A8NA 1GJPA 2D24A 5LA1A 1QNPA 2ZX5A 5HWJA 3O6AA 5C8BB 3OP2A 1IYXA 3SUTA 4MAZA 1QHPA 3VDAA 3FDKA 4GY1A 1TVLA 5K3VA 1PKMA 3L4YA 1GQNA 5DMMA 1HJSA 4PSRA 2OVLA 4MNLA 4NUWA 4H8NA 2V68A 3VIGA 1CGXA 4ROQA 3S2JA 4W89A 5I6SA 4NRSA 5GNXA 3CUZA 1H41A 3KL3A 2PB1A 3WH7A 3MBFA 4IIBA 1YE4A 4JTUA 4DXVA 1HXJA 1RP9A 1XGZA 2YFNA 4JKMA 3W28A 1LOLA 1LT7A 2QCLA 3G2GA 2PDIA 1N8IA 4DN1A 3IUHA 2D69A 3GU2A 4HK7A 4BF5A 4UOJA 2FPTA 1XLLA 4IMGA 1IF2A 1Q45A 1ZLPA 3VA8A 3NJ3A 5DO8A 1S3HA 3TKFA 4FP1A 4E8GA 4KRUA 5HXMA 1EPXA 2PTXA 3C2VA 4ZQPA 4G8TA 1NDZA 1QXLA 1UKPA 2JKAA 3L9CA 2POTA 2OTDA 2P8BA 2ZQ0A 1ENUA 3S5SA 3SQSA 3M0KA 4PEKA 1NIUA 1N2VA 3S1XA 1KWKA 4O0QA 3MC5A 4HZ8A 3TR2A 2GQ9A 5HWNA 2IW0A 5A6BD 5JMUA 1UC5A 5C0QA 3GHTA 1LOSA 3LM3A 3P7YA 1R3VA 3TX9A 4AHPA 2PCQA 3I6RA 2V5JA 1YXCA 2BP1A 2E67A 1A3XA 5IFPA 3LSCA 3CGTA 3LSBA 3F5KA 1OSEA 3VZZA 4JQ2A 1D3GA 2E6DA 4BWLC 3QV8A 1THFD 1TZ7A 3B8UA 3CZGA 4FPSA 4NJIA 2BZNA 4MZYA 2IXVA 2A6NA 1ZBWA 3UXDA 2GYIA 4E4FA 3GSMA 3QZ6A 3LNMA 4IZGA 2O9PA 3CL8A 1OEPA 3C61A 2WOQA 3E5BA 4Q22A 5H8MA 4A3HA 1AD1A 3MKKA 2WM0A 4Z0SA 1KB3A 5JQ9A 4H4IA 3HB9A 1FRBA 1OGBA 4EF9A 1XYMA 3CB3A 2GVGA 4IISA 2CYGA 2G3NA 3CM4A 3GR4A 1UP0A 4L64A 2W63A 2J7FA 2Q3OA 2PLKA 3BMWA 4MUZA 2PDNA 4WHBA 4GJ1A 5CGQA 4WGHA 3A4AA 1J4EA 4EPKA 1KNWA 1RD6A 2ATMA 4QP0A 1VD6A 3WJZA 3TN4A 2ZRUA 4DBUA 3VIOA 5HNRA 4ZQNA 4UC5A 1CGVA 4XAFA 2BOGX 1RAKA 4XO6A 3TJXA 1CPUA 3W1TA 3P80A 1ICSA 2PDCA 3W76A 4CVWA 3P0WA 3BURA 1TR9A 3FYPA 4XZ9A 1B2YA 3L2LA 3OIHA 3EX4A 5A8OA 2CLPA 3NQBA 4NSBA 1SU5A 1DWGM 3KDNA 3W7DA 2QDDA 3CH9A 2C6QA 3EWDA 4PTNA 3MP3A 4M7SA 4P8XA 1R3WA 3CHFA 1SJDA 1TWIA 1A3WA 1IQ8A 1C8YA 4GOAA 1K8CA 3TIMA 2XWDA 2VR4A 1XLHA 3VIIA 3MMUA 2ZDSA 1QPQA 2FHBA 3SGGA 4KWVA 3WD4A 2Y6ZA 1VS1A 1X97A 1B9BA 3SCNA 4UTLA 3CMFA 5CPSA 1EHNA 4XKMA 1SSDA 4ACZB 1DXIA 5GJNA 1B1YA 3RK8A 3VXGA 1NF7A 1XW8A 3B40A 4YMZA 3CPGA 2ZUNA 3PUOA 3KCJA 1OB0A 3RX3A 5HR6A 1MFUA 1R85A 4X61A 3IPWA 1SMDA 2ZUSA 1UR3M 4QTGA 1YE6A 1E9ZB 3R12A 2X40A 1OWQA 4DJEA 4U31A 3I68A 4FLSA 4HCHA 2OG9A 5A8PA 4W86A 3RM4A 1FHDA 3KP0A 3PR2A 1UJPA 3F4VA 5BROA 1C9WA 2EAWA 8A3HA 1XH0A 2PTDA 1IZCA 3W1UA 1GWJA 3GO2A 3CWNA 2QF7A 2PWEA 4NJJA 4LSBA 5D32A 1NSJA 3MMWA 2ALDA 3W7EA 4AIOA 1ECQA 5MKGA 3ALFA 3AIBA 1AH0A 3UJSA 4FAMA 2Z2BA 4C65A 2OO0A 1VH7A 1K02A 3I4KA 2PWUA 3S42A 1CDGA 1ODUA 2ZUWA 4JNZA 1E3XA 3T8LA 4KH2A 3W7JA 3THQA 1DWJM 3N3TA 2DPEA 4L61A 2PF8A 3NM1A 3KFTA 1EGZA 3KZSA 1QBBA 3VGBA 3VD4A 4I7UA 2E77A 4LJ3A 5D2YA 4I8DA 1NAL1 3W22A 5K4ZA 3C2EA 3IUDA 5FA5A 3C8NA 2YW3A 1HIZA 1ISVA 1ZJHA 3SSZA 9XIMA 1K4HA 2CZ5A 3KTSA 4HPGA 5CPQA 4ZB5A 2R1MA 4KWWA 3HV8A 4XQ6A 7A3HA 3LN3A 4L6OA 1VLWA 1XBXA 3CMGA 4HA4A 5I3JA 2BGNE 1A0EA 3DXIA 4B5WA 2Q3RA 1TO3A 4Z42C 3AZTA 1GEQA 1G4EA 4X3ZA 2VUNA 3AROA 4HNNA 3T0CA 1XR2A 1QPKA 4K8EA 3VGEA 2Z27A 4IPNB 1PO9A 1EDQA 1V08A 4E3VA 1CGWA 3GHRA 3WUGA 3W7MA 2PP1A 3PSVA 4UR7A 4S3CA 1BYBA 4AWEA 3CUJA 3OZYA 1KR1A 1MQQA 2Y61A 2E28A 4PL2A 1QNOA 1UZDA 3DFYA 1RR2A 2WM1A 1RLCL 1H7RA 1NFBA 3WD3A 4JFUA 4NY2A 4P61A 1CCWB 1JG9A 3HPAA 3MZ2A 3WDPP 1DL3A 2NUWA 1AD4A 4U33A 1I0DA 2QMJA 1LBFA 1ITXA 1Q2RA 5D9OA 5BXSA 4POCA 3R10A 5L9FA 2Q09A 3SUWA 2GL5A 3NOYA 3VFCA 3GXMA 2HWGA 3C0JA 4JQ1A 2H90A 2G0WA 4A3YA 3TMQA 3KBWA 2Y88A 3T1GA 3S9IA 1QNSA 3E96A 3EMZA 2ISWA 2FPVA 3A24A 3NZQA 1FWEC 4LBSA 3CK5A 5E1QA 1FHLA 3WF2A 1T7LA 1U33A 5D9NA 2X1SA 2VENA 3NUKA 1LWIA 2V2CA 4MJ2A 2CESA 4M56A 1EIXA 2IPWA 4EWJA 3WH5A 3PJTA 1PS9A 1W8SA 5C55A 1MW0A 2X16A 1K70A 2YCLA 5M1TA 3NIYA 1GONA 4HSHA 2VP8A 2D2JA 5ABTA 1S2TA 4C60A 4IL0A 3G0UA 2YXGA 4JAWA 1HJXA 1EBHA 3W00A 5HMEA 1EYEA 1ZQ5A 1WQ5A 3QHOA 2ZXDA 4XAPA 3M1ZA 1NELA 3CAQA 1BF2A 1SO6A 1B0IA 4C6JA 5AHIA 1EGVA 1H50A 2QUMA 1OJXA 4JHZA 5HJLA 1GYMA 1KW1A 4JDBA 1W6TA 3GG0A 3C2FA 4H9VA 4WDTA 1J10A 5KZMA 3A6OA 1NDWA 1TMLA 4MLRA 1FA2A 1GVRA 2YR1A 1L6YA 3ABZA 1ZTVA 1N82A 4Q6JA 4WUIA 2OX4A 2VDHA 4DWSA 4L4LA 4HP5A 3QF0A 2DT0A 2I57A 3O06A 1HJQA 4B3ZA 3WZ0E 1QOXA 5FEXA 3C3UA 4JYDA 4UWMA 4Q8PA 1YW1A 1JUKA 3UPWA 3FLUA 4PSPA 4PBFA 4JGDA 3RAOA 2E68A 3PB2A 4FOUA 5HJYA 2BMBA 2OPJA 2VNCA 1O5XA 3TYZA 4ZODA 3GH7A 2BLEA 3AZRA 4NILA 1MW1A 2BX7A 3RJXA 1YYAA 2I1OA 3U2OA 4PBEA 3BJSA 1XF0A 5CH9A 2V2DA 3CC1A 3G3DA 4MVAA 1AK5A 3SCSA 3MYPA 1EDTA 4R3UA 1XX1A 4N9BA 4GY0A 3C5QA 3U0HA 3TYEA 4ZL1A 5M5DA 2I14A 3OQ8A 4B5XA 1R87A 2DFAA 2D23A 4AC1X 3NQ8A 2H8XA 3NZGA 3S2NA 2FQIA 1L8NA 5CJMA 2INFA 2V30A 3V36A 2FFCA 4F9JA 1CLXA 2GFTA 4MFEA 3QFEA 3LHWA 1A80A 2V63A 3H7RA 2WK2A 5GNZA 2QNEA 3EX1A 4BKNA 2PURA 4MSSA 3N73A 2CIPA 3V0TA 4PTWA 5C2GA 5JUVA 1TSIA 3WCZA 4HVXA 1SSGA 5DX7A 4ECLA 1XPYA 2OSWA 5BRBA 3FN9A 3SCPA 2PI6A 1JDFA 3DU0A 1AUSL 1TQJA 1FWBC 4GQQA 1X6LA 3H7VA 1TV4A 4NX0A 3HMJG 1WXJA 4H3DA 3DYMA 4UTTC 1OY0A 3O6DA 1MYRA 1SJCA 1FWNA 2VO5A 3C0SA 3LY0A 2RDWA 1TTQA 3IJIA 5LNUA 2XDFA 2EO7A 3FYYA 1W1YA 2P88A 5AHNA 4D6GA 5LIUX 3WMSA 4EKJA 1S5NA 4J40A 3L4UA 1RBLA 2BGQA 2YFOA 2Q6ZA 3IGSA 1HNYA 3NQGA 4AD0A 3FXGA 1KCLA 3HG5A 2I16A 4JD4A 3WF4A 2JKPA 5D8WA 1J79A 1QATA 2XGZA 3LRLA 1MSSA 4H9TA 4LH8A 4HK5A 4XTIA 3E3HA 3IJ7A 1S1PA 3AWOA 4LGXA 5IHRA 3BARA 2WXDM 4R53A 1PX3A 3MKCA 1BVZA 4JFVA 3OGVA 3AIEA 4GK8A 4AY8A 1F61A 3R5EA 2V9DA 5I3FA 3N6JA 3NQDA 4MM1A 4XB3A 2JEQA 3WK1A 3ICJA 5DRIA 3PTDA 1P48A 1Q6GA 4UFHA 2XH2A 4TTUA 2QCMA 3SCRA 3LUTA 4QEEA 3PBWA 4GNKB 1EP2A 1TYGA 2YBTA 2QHAA 2OELA 4L1GA 2VFEA 1XQLA 3BLOA 3PFRA 3CH0A 4AZGA 3T07A 4E3TA 4MDOA 4LUYA 4WXYA 1UW9A 2VFFA 4LUIA 3KTCA 3W81A 4HHMA 3ARQA 2Y70A 1OCQA 2E9LA 1HP5A 1A5BA 4B90A 3EPOA 2BODX 1MEIA 3DHFA 3VD3A 4CU7A 4S3DA 3DG6A 2HK1A 3ZVHA 4ZOBA 1KCZA 5DBUA 3T7VA 3BAKA 3LLFA 2WSPA 4FNSA 4P7RA 1QNRA 4URIA 4AMAA 4B4FA 1XH2A 1W3JA 2X1IA 4I7VA 3ITTA 5TF0A 1KO0A 3PZVA 2QIIA 3TN6A 2ZXQA 2FGZA 3F7JA 1RPKA 2UZ9A 4AZ7A 3LPPA 1ZP3A 2NUXA 5FL1A 3TSBA 3BJFA 4IMAA 3HMCA 2OODA 4E5TA 3VOGA 1BQCA 4DHGA 4LS2A 2HQAA 1BFNA 3MV01 1NWRA 3D46A 3IRSA 1JPKA 4XBSA 4MKNA 2Y8KA 4WJXA 2QS8A 1QHZA 4JY8A 4GKLA 4M6PA 1XISA 3GYCA 1HKKA 3O05A 4XZMX 1OYCA 3WQ5A 1YNQA 4UBPC 4IJBA 4Q8WA 1W1ZA 3WQ8A 3ZFHA 2E9MA 5DCDA 4H7CA 5F2LA 2XVNA 4JYEA 1S2VA 1GKRA 3AHYA 4FNTA 2EPLX 1CB2A 3BGAA 1BGGA 1CI1A 4X22A 3WJWA 4O18A 1H4PA 3IANA 2DJLA 4NHVA 3PBMA 1DBTA 3ATYA 3GVWA 3SJNA 2A2IA 1H0IA 1CIUA 3W25A 4RNFA 4CCCA 1SGJA 1WAWA 5I09A 4PCFA 4FNQA 4PCNA 4DNMA 4H6KA 4I9AA 3IVUA 5A6AA 2YLAA 3MHFA 4V27A 3ID7A 3A3WA 2R1PA 3RMEA 3ZR6A 1G0CA 4J7RA 1FWSA 4CD6A 4MIMA 5MKGB 3NO5A 4LNCA 3M0ZA 2HS6A 1FCQA 4ZB2A 4FF5A 3VE9A 3H2NA 4EAMA 1I2QA 4AZCA 2R6OA 1LCOA 3TYDA 2RHGA 3AC0A 4B4HA 2QDHA 2OYLA 1DJIA 1KFKA 2GOKA 3N3MA 2WHMA 4A21A 4M6VA 3VVGA 3WH6A 4WZHA 3PM6A 3EA3A 3ARSA 2OEJA 4DI8A 5HINA 2PWFA 1R5YA 2A3BA 3RXZA 3P14A 4LANA 3K4WA 2G97A 4DNHA 3H55A 4GMEA 3TXZA 5E09A 1GQLA 1HKWA 1WA3A 2J66A 4RW3A 1V3MA 2PDMA 3N14A 1UA7A 1Z42A 2XIMA 1V6XA 4FR6A 3GTFA 2REQA 3IJ8A 4J4KA 3NEVA 2AMGA 1KTNA 3E38A 3HF3A 1KM4A 4TO8A 4GZEA 3U2ZA 3QGKC 4WY0F 1Q5MA 4KWSA 4ATLA 4B5TA 1P0NA 1QI0A 3WQCA 3QQWA 3NVTA 1X8CA 4ROPA 3UXKA 2HV5A 5EMMA 4Z2HA 2NLYA 3IV8A 4ADUA 4DELA 3BVJA 3T05A 1EZ2A 1K9FA 5LIXX 4KBXA 3WDIA 2A7RA 2Y7FA 4H6QA 4Y2WA 1Q7MA 3UJ2A 3WLLA 4Q33A 3GK0A 3OLEA 1O94A 3EWXA 4J28A 1PBGA 2PLCA 4DIAA 2YSWA 1SFLA 4PTMA 2BOEX 1OF6A 3UA4A 3ONBA 1UD4A 3URNA 1XG3A 3U2EA 2ZZ6A 1ZENA 2Z6IA 1TMHA 5U7SA 4HZ6A 2JGQA 3TW9A 1XIFA 4MKSA 1EF3A 3DYOA 2P53A 3CS2A 4JTHA 3WNKA 4RXFA 2OSXA 5G2WA 3EB4A 3N4AA 1JCNA 2CXGA 4AISA 2DSVA 3VAVA 3INPA 3U9IA 1GGOA 1V3LA 4K68A 4XZIA 4PH6A 2YCLB 4I7WA 4NZCA 4HKPA 1H7OA 4DJFC 2B7OA 5A1AA 3UF9A 5LXXA 5FL0A 2JF7A 4LRTA 1DWIM 1JR1A 3SQMA 1F6PA 1TIMA 3BK0A 1R46A 4LCRA 4DQWA 2O0TA 4GH1A 2GQ3A 4J3ZA 2FTWA 3KVJA 1M7OA 1T6MA 2XINA 2PTYA 4FHAA 4LAUA 1WZAA 2IKJA 1OG6A 1F07A 3H4XA 4JX5A 4TVDA 1HKJA 4OT7A 3W26A 5K9XA 1XLKA 3VGGA 2OXNA 1DJGA 2HROA 3PWIA 3ERPA 4GC4A 4QM1A 3TYCA 3BZJA 2PMQA 2CHNA 3ZJ8A 1L6FA 1XIEA 1ME9A 1XIBA 2QCFA 2DVUA 4WIWA 3SY5A 5BMXA 3Q94A 1X8FA 4XD3A 5C7VA 4EXAA 3RFAA 2F6XA 5DELA 1M68A 3PTMA 2XFWA 5G4WA 4DWSB 1J11A 5AC4A 3E0IA 3L5AA 3VTRA 4I6KA 1TWDA 2AL2A 3EB2A 3CZKA 4OGZA 4GYJA 1RHCA 3PY2A 4JQ3A 3TJ4A 2CHRA 3LCLA 2E40A 1ZL1A 1ZBKA 2HVMA 2VUYA 5G2IA 2UY4A 4OIFA 3TTEA 3PZOA 4HOZA 1TZ9A 4QQUA 3LBMA 3CEPA 2IXUA 5E93A 1LORA 2CNCA 3L23A 4JL1A 3I3DA 4E2OA 2WW5A 4NQ1A 4KEZA 2ZUTA 1W3KA 3TZFA 1M6JA 5LXEA 3VX0A 5J8LA 4RDZA 2IPFA 3THAA 1DE5A 4DXKA 1UUOA 5FEZA 3R89A 2FB3A 3O0KA 1DTNA 4S3KA 3QW3A 1DQXA 4FR1A 1E56A 1LRTA 4ZR8A 1ZALA 1A4MA 3DDMA 1LROA 3T2PA 2J7CA 1H1ZA 1I0BA 2PBOA 4F0LA 1VYSX 1BTMA 5HA7A 3P8IA 3FHQA 2X1TA 4IPIA 1H5VA 4LYKA 3MBDA 1ISZA 4GD0A 3RU8X 2E6AA 4GE8A 1E51A 3P0XA 2OKOA 3FOKA 3A22A 4TQTA 5BRPA 1A5CA 5F1VA 3LHUA 3QN3A 4ZFMA 1XGDA 1YEYA 1FWGC 3SO7A 2J88A 5CLWA 3UG4A 5DMYA 1GUVA 3LRKA 2UWFA 2Y62A 1PDZA 4K37A 1SPQA 3E6EA 4PTXA 3SRDA 3TJLA 3BMVA 3KBNA 1EKOA 1BWVA 3H2EA 2WANA 3M41A 2J47A 3RX4A 3MDUA 3LTSA 4OV4A 5A6TC 2ZFAA 3A4XA 5DY3A 4O14A 2VI0A 2OEKA 4D6CA 2WCAA 1A49A 2H3DA 3E2QA 3BLFA 1VJSA 4LT9A 1RCXB 3FW6A 4LV9A 1X39A 1XYAA 2JEPA 4G7EA 4ZQRA 5EA9A 3ABSA 4AWUA 3LCGA 1O5QA 4QDWA 1KLZA 4AUBA 4EX4A 2VRJA 1Q3NA 1KRCC 3USBA 2PP0A 4C1LA 3F4DA 3WJXA 4FEZA 2CLFA 2OO6A 3UYCA 4UQCA 2QCNA 4Z1YA 4WLCA 3UT0A 3W2LA 4YCPA 3KEHA 2Y1HA 5CSSA 3MP5A 4C6CA 3LB0A 3ZM8A 7ODCA 1AW1A 1RA0A 3NCOA 3B0UX 4ERIA 2DQXA 4IPJA 4A8IA 4S1FA 4D72A 4FIRA 3OODA 1FHUA 1XIIA 3SW6A 4AHOA 4L9XA 3W7HA 5C9UA 4LS0A 3ARXA 2Y85A 3ZVHB 5DRCA 4HYRA 1FCUA 4GX8A 1CXKA 5B7ZA 2YCJA 4NZ1A 4KGLA 3CUXA 4C6LA 2GSEA 3P60A 4AZHA 5EFFA 5KINA 1GG0A 3N34A 3H8AA 1XI3A 3VC6A 3R0UA 3REQA 4B9YA 1X96A 5AY7A 3MTWA 5GVJA 2OQLA 3VOJA 1S2WA 3BC9A 3KOXA 3L4ZA 5G1YA 5BNKA 2YKKA 4UTJA 2I9EA 3UCDA 4HYVA 2V82A 4PGLA 4KPLA 1OG0A 2DUAA 4GYKA 3WDHA 1OINA 3TUUA 4EPBC 4LUTA 1QK0A 1JPDX 1DIDA 2G41A 2ZUUA 3MCNA 4M81A 3LRMA 2Q8XA 3PS7A 1K8XA 3SUSA 1TELA 2XGBA 1X7FA 3QR3A 1DXFA 1B3YA 2A3LA 3QY7A 1OVDA 2CLMA 5E9AA 1BG4A 3RHGA 4XUGA 5AC5A 3PZGA 3PVFA 4HQVA 4CKQA 1PHQA 4M5PA 2VX5A 5ECUA 2DV0A 4AIBA 4HNUA 4C91A 3CL6A 2Q02A 2WO5A 3IJLA 2DZAA 3QMTA 2O4QA 1O5KA 1H1NA 3LPFA 5TAOA 3HN3A 1R3RA 4Z2KA 3KWXA 4FIQA 1R2RA 3H2OA 3JR2A 3A9BA 1R3SA 4D8AA 4MB4A 5DANA 2QVHA 2BASA 1S5MA 2RUSA 1V0NA 1MFVA 1JI2A 3AYTA 2W62A 1M1BA 3KCLA 3SFKA 4RUBA 2IPJA 1ML1A 2ZZ5A 4HNLA 4C6MA 4AZCB 3WL1A 4FA3A 4FO4A 5FIPA 1RP8A 1ZAHA 1KGWA 2HNHA 1ZFJA 2VFGA 1VB9A 1A0DA 5AHEA 1KFBA 1NQKA 3IAQA 3UWVA 3WKZA 3T0DA 2WKGA 1GZJA 3O6CA 4G6CA 4CD7A 2Y8UA 3WJYA 3WBYA 3M6YA 4ZMGA 1H49A 2ZZ7A 1E6XM 5K9DA 1KFWA 2X0HA 3MHUA 2QUTA 3AJ7A 1E55A 4MAVA 3A9IA 4M1RA 3BG3A 3GBEA 1HN1A 3KRZA 4A8NA 1XIDA 2A85A 3KAOA 3OGRA 1MEWA 4AC7C 1OFBA 4GBUA 3RU6A 1EDGA 3MJYA 4IXHA 2Z29A 4EXBA 4HPNA 5G1TA 1TTIA 3NO3A 3GDTA 1F05A 1RVKA 2EG7A 2OKTA 3RPMA 2VFDA 2Z26A 4YU1A 2D22A 1R9YA 2FZMA 2REQB 3M7WA 1G9HA 3P5YA 3L4XA 1I9CB 4QHRA 3UU0A 1GVOA 1JVNA 3AS2A 3SN4A 1LP6A 3OBEA 5AHMA 4DJEC 2D0FA 3CTLA 3FSTA 1E0XA 4DM1A 1JZ5A 3W4RA 3UXAA 1FVPA 4ZO7A 4WOQA 3DGRA 5D2TA 3WLKX 3GE7A 2Z2AA 5FJUA 1XBZA 3SM0A 3L66A 1NH6A 4AY7A 3SJ3A 3KHDA 4Z1AA 2WC4A 5BXPA 3B0YA 3TW7A 3V0UA 3N2XA 1QWGA 7REQA 4FLOA 4H2CA 4QIUA 1QT1A 2OZ8A 4BK9A 4Q8QA 1BPLB 4W8BA 3WMLA 2ISDA 3CUFA 3IIPA 3WLRA 4QSHA 3NQ6A 4AWSA 1E40A 1RCQA 1EA0A 4IM4A 3UPMA 2R1LA 3W6MA 1ZY9A 1XV8A 4JNYA 3W82A 2A4AA 4HBKA 5IXEA 3EZ4A 4YVVA 4UOZA 3UY7A 5FF3A 5KEZA 3LGDA 2XYLA 1F4AA 3EDEA 3TK7A 3MUY1 1I1XA 4CGTA 2FJUB 3JZEA 4XSMA 4Y6GA 5CCZA 2C1GA 1B31A 1SZEA 4KCVA 4JTIA 2XJ7A 1L2QA 4NZ3A 2CERA 1JI1A 2ICSA 1W3NA 1PZ0A 4X2PA 1J01A 5KTLA 2OWWA 1E4LA 3ZIZA 2YOCA 2F2KA 1WBHA 3IWPA 5AFDA 3AO0A 4M1BA 2OWXA 3G0XA 1JNEA 3GR7A 1GW9A 5B7YA 3WEOA 2G3JA 3THUA 5I3GA 4QISA 2F6UA 2V6AA 3H2FA 4UTHA 4J3TA 2YDRA 2XN0A 3QEZA 4BQ4A 4F0HA 1JAEA 3LZ3A 4M0XA 4X60A 1NDYA 4KMQA 3S5YA 3QYSA 1CLVA 3VOFA 1EIBA 2YCEA 4DB7A 2C3ZA 1TJRA 4BY3A 1ZJAA 4O12A 1W9DM 3NO1A 3LI0A 2VZTA 4AX6A 1XFCA 4PBGA 4PCPA 1PJ9A 3WX7A 2AL2B 4YJ5A 4DO5A 1UR0A 3ABOA 5EYWA 4LAOA 2J7GA 1E43A 3ARPA 3C2OA 2F9RA 2PC4A 1OC5A 3XINA 3VUSA 2D2GA 3BUVA 1UWQA 4JYFA 5C9WA 4BEUA 2F6KA 1FWWA 1ZP4A 2VCAA 1OABA 3CTTA 3G18A 3C56A 2WPGA 3U5YA 2E6YA 3GDBA 1KCKA 1ZHAA 1NF0A 4QNEA 3ES7A 4Y9OA 1G5AA 2PWVA 1M3UA 4H6RA 4MTVA 2QJIA 3WLTA 5F4XA 4DPPA 4GVFA 4JIRA 2ZC1A 3WEMA 3ABRA 4TVCA 3MKVA 2CBUA 3W9ZA 3NOEA 3N11A 1WZKA 1H5YA 1M65A 1V03A 2NUYA 3QH2A 8CGTA 2WWCA 5G1MA 1NWSA 3GNOA 3V75A 1UZ1A 3B0XA 4PUKA 2BBFA 1PKYA 3USZA 1WKFA 4S2BA 1O5RA 1B57A 3S46A 5I23A 4GYFA 3TWAA 1CENA 2CLKA 3VNLA 1WXZA 3RX2A 4U28A 2C0AA 1TFVA 1M5WA 3BAWA 3CUIA 5BMWA 1WCGA 4I9JA 3TN3A 2DEPA 4H8HA 1IR1A 1WDWA 1EJWC 1W1TA 1MEHA 1WZMA 2W61A 1HJUA 1NU5A 3RCNA 1AVAA 1PTDA 3WNOA 3EOSA 1B5TA 5HPCA 2R82A 2F61A 4DWSC 3FSUA 4R9XA 1VFMA 3L5LA 1KFJA 3UYIA 5FSEC 2QCEA 5FEPA 3O16A 2XZ9A 2Z7KA 4L80A 1WX0A 2C91A 3DG7A 3B0VC 3KW3A 4XZNX 1IV8A 2OB3A 4IFRA 2PZNA 1QPNA 4NZ5A 4AZBA 4UB9A 6CGTA 3IV3A 3HG3A 3W2JA 2OSYA 1XM3A 3WQ6A 4QJ4B 2ZTKA 4HU3A 4LEQA 2WZHA 4OBTA 3W53A 2VEFA 3QQ1A 4NYYA 3KTXA 3VNJA 1Z9AA 3FXYA 2YB4A 3N25A 1M03A 1HVXA 1E6RA 1E6QM 3WK2A 1KBBA 1YMYA 5FJIA 1KBIA 4W87A 5EPDA 4G7EB 3AMDA 2J24A 3LGGA 4DYKA 4NYUA 2NV9A 1DWAM 3WQGA 2VVSA 3EDKA 3NPUA 2A3AA 1OF8A 3N04A 3V3WA 1IIGA 4DZIA 4LVDA 3GX9A 1KCXA 3SN1A 1JYXA 5FACA 1X1ZA 2ZC8A 4IP7A 5A6KA 3MV11 3KXQA 4KQNA 3OPSA 3TOPA 2WNNA 3WUFA 3WIJA 4PN2A 4GVHA 3WD2A 3ABXA 2BB0A 1J18A 1M04A 4NZFA 4XZWA 4MDPA 4O52A 1RPXA 1TX2A 1AMKA 1N8FA 2JKEA 1UQYA 3LTPA 2OGYA 3A23A 4MY9A 3STCA 3AIWA 3NQFA 4H2HA 3KHJA 4CQ9A 4Z08A 1WXYA 3OVRA 3WF0A 1O4UA 5HNTA 3BCJA 1UKOA 3UJRA 1JNDA 3EWBX 1PHWA 1GK8A 3MP4A 1NTHA 3AIVA 1TPUA 5HWMA 3U3HA 2JALA 2A7NA 3B06A 3LQGA 5AOUA 3PSWA 1VAHA 2TSYA 1ME7A 3REQB 4IGHA 3C2RA 3ZZ1A 3VNDA 5LYRA 1EP1A 3SIZA 1IXOA 1QO5A 1VLIA 1EXPA 4IGSA 4GNJA 4P7NA 3MO7A 4F0MA 4A8RA 1AJZA 2ZWYA 2VURA 1XCFA 1UZHA 2XIIA 3P5ZA 1MDLA 3NWRA 5FF4A 2QYGA 2NQJA 4LUTB 3PUEA 1B3ZA 3AYRA 1C93A 4CQCA 2CKSA 1CLKA 4H1ZA 3A3HA 1PKNA 1N8WA 2DZSA 3RJYA 3BDKA 4PB5A 3L4TA 1D8WA 3P61A 1TCDA 4EACA 2GJLA 1ONXA 3L4WA 4AYGA 2F7FA 1TJ1A 1LOQA 3EOOA 4RDYA 2WVVA 4TVUA 4BQ2A 1GOWA 4ZENA 3VK5A 1G7VA 4LB3A 5CZJA 3E1F1 1EL3A 1WYIA 4JXCA 2NXGA 4LCQA 1TREA 1CB7B 2XFFA 3CO4A 1L8PA 4ZOEA 4KRTA 5H91A 3K8LA 5HMSA 2QJHA 5DN1A 3H7UA 4HU4A 2DVTA 4JR5A 1HO1A 4C6EA 1OZMA 1P4CA 4QGCA 4LU0A 4WOZA 4LCSA 2W27A 4HA0A 3IGUA 2R1KA 1OT1A 4UQAA 2XSAA 4O57A 3T4CA 1BRLA 4P7OA 1WP6A 1ZBCA 3QLDA 1TUFA 2DT1A 4JL2A 1EZWA 3NL6A 4Y9PA 3CIXA 1ADOA 1GJUA 2NQHA 1BXBA 2WLZA 2VWTA 5LA0A 4X2RA 1U1UA 1CXFA 2ZE0A 3LMYA 2FHFA 1UB3A 3DHUA 4O54A 1RK5A 3STGA 1Q66A 4PMNA 2FLIA 1P5BA 1W9PA 1E5JA 1WE5A 2W66A 3O0FA 4ALDA 4J27A 8XIAA 1QJWA 1BEUA 2FGBA 4UTWA 3VPLA 3E12A 2ZXBA 1JQXA 3TH6A 2HVNA 1VHCA 3M16A 3UWZA 4J35A 7TAAA 1P1MA 4B92A 3M43A 1W3HA 1TPWA 4CVUA 3B9EA 2ZXAA 2E5DA 2X30A 2A3CA 2Q01A 5FJJA 3SCUA 1HX0A 1M7XA 3UVIA 1J0KA 1LJYA 3RIKA 5FCZA 3MANA 4JFWA 3RUBL 4AU0A 2X42A 1VEMA 3WLMA 5EBUA 5D2WA 2V38A 7REQB 4YPJA 3W38A 4FNUA 1H0GA 2DSKA 1ZJIA 4K38A 2VX7A 3TLLA 4ZOAA 2EKCA 4UTIA 4D8LA 2XTKA 1G4TA 1GOOA 2WJEA 3R4IA 5REQA 4JKKA 1QUMA 2QJGA 1Z8AA 4NI8A 3PUGA 2ALRA 1EH9A 2JFEX 1LLZA 1H60A 5D37A 3PBYA 3UG8A 2I5GA 5CZ0A 3CT7A 4PEEA 4B16A 2VHLA 1MRQA 3NDOA 3GHUA 4J2PA 3W7OA 4K6AA 1CGUA 4MMWA 1GT8A 4C6NA 4Q4QA 3DFTA 4HZMA 2HXUA 3QC0A 1GVYA 3VYLA 3CYJA 7PTDA 4GACA 3EPNA 5FF2A 2H6RA 5CSYA 2Y63A 1VFTA 5FESA 1TE1A 4BF7A 2J7EA 3CHEA 1YBQA 4G5DA 3GNNA 4JFSA 3AALA 1Q6QA 5I77A 2D1ZA 1AMYA 1XLGA 1GKPA 4RNJA 1GCYA 2BY2A 3AMCA 3BTNA 4QJ3B 4H9YA 4O8RA 2CBIA 3QXBA 1EUNA 3O3RA 3BCDA 1GTHA 5HNUA 4F2UA 3EKGA 1KC7A 3TEVA 1IT7A 3GVGA 3R25A 1FP8A 4DRSA 1EC8A 1FH9A 3K4AA 3GD6A 2B31A 3QHNA 4Z17A 3QOKA 4JX6A 1IGWA 1US2A 5LGZA 3WK3A 2DGAA 4EPDC 3OLIA 4DO6A 1JUEA 1LWHA 3ZLGA 3GAKA 2VVNA 5M03A 4NL1A 1KFCA 3BV4A 2WYSA 5LIKX 3DN5A 3CJPA 4DJDD 2PEVA 3DKLA 1B54A 1E9LA 3KWSA 3RO8A 4HA3A 4W7WA 3TSDA 1GZGA 3LNPA 2V3FA 4DO7A 3GBDA 3KUMA 3H4WA 1SR9A 1UBSA 2WQPA 1KGUA 4D6IA 3PG8A 4N6EA 3NSNA 4IIFA 1VEOA 2PDLA 3SR7A 3VNZA 2XVKA 1YNYA 1YQ2A 2XPKA 5T8GA 2TRSA 3OVGA 3MWCA 1ONWA 1QAPA 4ZO6A 1BKSA 3RLGA 3M5VA 4A35A 3P2VA 4GG9A 2A5HA 4H04A 2YDAA 4JTEA 5BU9A 2VRQA 4JOMA 3SRKA 2O9TA 4A2RA 4D1IA 3WFZA 5U4NA 4JIQA 4U4MA 2VFHA 1NFGA 1M7PA 3LCIA 3UXLA 4EAYA 1VBJA 3PPFA 4DBSA 3NPWA 3YPIA 4ZBCA 3M0LA 2WQDA 4PMVA 3V7PA 4IFKA 2DJXA 2BVDA 4Q4RA 3TZNA 5IFTA 3AXHA 5C54A 3VX1A 4O4WA 1SW0A 4TX6A 4HU0A 3PN8A 3E49A 1XDMA 1OCJA 3ZSTA 3CIWA 3O15A 5I5RA 3VKDA 3KRUA 2DUXA 2J6XA 4XD5A 3KDOA 3S1GA 4S3FA 3AHZA 4JZ5A 3L4VA 4GQ0A 5C6MA 5AHLA 1A4LA 2J6VA 2PDWA 4RE2A 4AX7A 5TIMA 1E3ZA 1V79A 4A29A 2E1WA 4QG9A 5I3KA 2VRKA 1V6WA 2WZEA 3ZO9A 1UR8A 1Z7AA 2HE5A 4ORIA 1FY6A 4XISA 1YDVA 3LG3A 4PMUA 1DE6A 2VZUA 2PDBA 3QV9A 2RJGA 3I3EA 1HFBA 4LFYA 1E9YB 4NIRA 2VEIA 4MOZA 4DEFA 2A7PA 3MSRA 3SQLA 4BI6A 1H7PA 1TPEA 2I9UA 1GG1A 4GZIA 1XKYA 5CBIA 4HMEA 2WCGA 1VPQA 3G0SA 2EKGA 3DGBA 4BI7A 1R0MA 3UNDA 1IWBA 4E2DA 4MUPA 3UWQA 4LWWA 3DFPA 3O63A 1POKA 4R27A 5I7GA 2WJZA 3FS2A 2ONEA 1HP4A 3KRSA 3GUGA 2HK0A 1F6KA 4X9YA 4D6DA 2X05A 4K7YA 1MNZA 3K8MA 4ZSTA 1KRAC 2Z4GA 4GFIA 2W5FA 5G4HC 1HUVA 2CBVA 2YIHA 3UZZA 3TA6A 3VCNA 4TV5A 2VJXA 3B9AA 2GUUA 2G37A 1DXEA 1R7AA 4A3RA 4PMZA 1V6UA 3THCA 3R7MA 2CU0A 2QUUA 4HGXA 4CCEA 1JDAA 1HG3A 3OYXA 2FZ9A 1C91A 5EMYA 1XS2A 4QE5A 3GIYA 1CTNA 4FK9A 3DFNA 4PUJA 4GI6A 3RM8A 2PDQA 2R9RA 1JF6A 3LYEA 3DZ1A 3KS5A 4H00A 1J12A 2R8WA 5CPLA 3UVAA 1UIPA 3ZS4A 3ZT6A 1KXTA 1Q4NX 1YDNA 2QCGA 1B3XA 4O0KA 4BHYA 3PK7A 2XM2A 4KGJA 3OA3A 4FB7A 4HOWA 3EA2A 5LNSA 4LPCA 3KX6A 3DHPA 4E8DA 4LTSA 2YXOA 4KIEA 4Q4SA 3B8WA 3AICA 5KZEA 1AJ0A 1AQ0A 1GPWA 2D0GA 2O7SA 5HMDA 3VOIA 3BPWA 4RX0A 1E4NA 4JTLA 5DCBA 1EF2A 3T8QA 5FJPA 1LLOA 1OK6A 3K13A 1A3HA 1W9UA 2QGYA 4OJYA 2BVWA 3SURA 1QU4A 3VFLA 2C18A 4WDUA 3N9SA 2L5HA 1HKIA 3GTXA 2GVYA 1DKWA 3ZJKA 4YNGA 1H51A 1EC9A 2IQDA 2VOTA 2WBKA 2VFIA 4KFNA 4ZFCA 1DJYA 2R91A 3LBCA 1JEZA 4S38A 2OOFA 3D5HA 4WJ8A 4KEUA 2HVOA 1PSCA 3HQOA 5AKQA 3W7IA 1SFTA 2PDKA 4WCJA 1LQ2A 2WVVB 3UERA 2J62A 3CBWA 3FAWA 1NP2A 1GQJA 4W5ZA 1D7KA 3AXXA 2JE8A 5F2GA 3W7LA 3QSTA 3PTQA 1E0UA 3NL3A 3KVLA 1XRFA 3W72A 2WC3A 3W23A 4OQVA 4UQDA 4MB3A 1OFAA 3OG3A 2IQ0A 4GI9A 1VKFA 3AS1A 4D2JA 2ISVA 3C6CA 4HCDA 3AS3A 1P6BA 2UY5A 4B2DA 3VNMA 4UFJA 3MI3A 4AD4A 2RGMA 3VDBA 1E0TA 3PB0A 1MXGA 3G5EA 1OT2A 2VM8A 3TCSA 3ITYA 4AVOA 1IGSA 1BRLB 2DZUA 1P6WA 5D8ZA 3SEPA 2LLEA 5HATA 4CN1A 3W1MA 3DERA 1R8LA 4H8UA 2VCCA 4P7LA 3CIVA 2PSNA 4Q7NA 3S8HA 3E2SA 4MWAC 3RM9A 3ME3A 1GW1A 3LA4A 4TUFA 1SW3A 2WVUA 3MSDA 2C16A 4FOJA 3HGOA 3TYUA 5TNVA 3IAPA 2XH7A 1WOAA 3ITXA 5BOOA 4YTQA 1GVSA 1I4NA 5F7UA 3MUCA 3H24A 2DZPA 2BY3A 3D6NA 2VEMA 1B9ZA 1PIFA 2INZA 5JBDA 1IXQA 2V5DA 1V3JA 4WVXA 1VP5A 3T9PA 3W75A 4HPXA 2A1YA 3G1VA 4GO9A 3I4EA 1A5MC 2Y5SA 5FSDC 1BYDA 3WK0A 2YA0A 3JW7A 3B04A 5F4SA 2XIJA 4PE8A 4IQDA 1W54A 4QLJA 4Y9MA 2EGZA 2OU4A 3GUWA 2QJNA 3E2VA 4P5UA 1E9IA 1IEVA 4Y96A 1V02E 3GDKA 2J7HA 3PTKA 4YL2A 3WLHA 2BHZA 1XYZA 3HBLA 3QW4B 1FWRA 2PBGA 1CNVA 3GXFA 2FHCA 2EPKX 5REQB 1BWKA 4RZ5A 4N4PA 2GQ8A 2EPMX 4K36A 2VOMA 4FX8A 1E4MM 4Q8OA 2V5KA 3SI9A 2FFIA 3FHAA 4NKCA 1AL7A 3OHMB 1CXHA 5CLTA 2QQ6A 2VCBA 1LUCA 4AF0A 3W7KA 1YDYA 4YYFA 4EOUA 3ZJ7A 1UKSA 3O9NA 4H6EA 5FF0A 1K6AA 2GJRA 3D0CA 3PNUA 3KOWA 4HSNA 4LVAA 4GUIA 3VOCA 4XIAA 3BWWA 1PTGA 1SMAA 4TMBA 4UCGA 3AXKA 4OTKA 5HBFA 3SGUA 1LM1A 1RY0A 5AHFA 2KAUC 1YBQB 3UJFA 3GXNA 3A4WA 3FNDA 2P1FA 4IJRA 3MA8A 1FH7A 4NXKA 3Q65A 1F74A 3PPCA 4XKYA 3RLHA 1N55A 3AHXA 2OYKA 3Q37A 4QEHA 4N6FA 1LL4A 1TX0A 2ON3A 3MUIA 1UBPC 3N6HA 1XLFA 1HZYA 4WSHA 2Z2UA 1D9EA 5HPOA 3CV6A 1WZLA 5C7HA 1UOKA 4QITA 2VT0A 3DAQA 4KKXA 3URBA 3VE7A 3QZAA 1U5JA 4V15A 3W85A 4AMCA 5JXQA 4KRZA 3M46A 4CNOA 5E9XA 2QDGA 3G1FA 3GVVA 4PB3A 2OR2A 1DWFM 4OU1A 1YADA 4AD2A 3CLMA 1LBLA 2HE8A 4LALA 4UR9A 4DAIA 1QW9A 1POJA 4D6FA 4I9TA 2CZVA 2UY3A 2ZA2A 1VHNA 1XG4A 4D1JA 5E5CA 4AEOA 1QMLA 3S2MA 4YWSA 3NQMA 4DF2A 1JZ2A 3MYOA 1EHAA 1KBLA 3RF9A 3HA1A 3V1HA 1R2TA 5LA2A 1D2KA 5DLCA 4AH7A 4D9PA 3G22A 1S5VA 2H8ZA 5K2ZA 3LGEA 1Y7VA 4FX6M 3TNOA 2ZVRA 4OZOA 4W93A 3TQVA 1FH8A 3M0JA 3HIJA 4Z2GA 4GXMA 2EPOA 5LHFA 4LVBA 1KFLA 1PYFA 3S9YA 1AJ2A 3W1LA 4OBRA 1Q6DA 1ZRQA 2AMXA 4FI4A 5TD4A 3WBWA 1A5SA 1QO2A 1I2NA 4UTKA 4WKHA 4RDWA 2GSHA 3PJWA 1E6PA 4AG0A 4JS3A 2VX6A 2ZX6A 3N2TA 4DJDA 4ZA0A 3M0HA 1NARA 3K46A 4NAFA 4MY1A 1GHSA 3DCPA 4IFKB 1I6NA 3W7CA 1VJZA 3E9AA 2Z1BA 2C1HA 1FWHC 2XZ7A 3LDVA 2VELA 1HW6A 3LLDA 3RO6A 4C6IA 1PTAA 2PLJA 4XTDA 3W2MA 3LMZA 4G1NA 4M19A 1B4KA 4JIEA 3WMBA 1P43A 1PWLA 1JCXA 3LLXA 2GJXA 1LG2A 4AAJA 5LIWX 3UZYA 3UW6A 4Y90A 6XIAA 4R5EA 2FZBA 5MHBA 4ENLA 2E8YA 2EJ1A 1A5LC 5HQMA 3W2KA 4PMJA 3GH4A 3H6OA 4B9ZA 1T5AA 5D02A 3UFYA 1AH3A 1KBKA 3DYPA 4XZBA 4IWWA 4QJ5B 2ZX8A 5KETA 1MW3A 3VD5A 4ZOCA 3NQAA 1B4EA 1FXPA 4PR4A 3NURA 4UUIA 1SYTA 5DCEA 1U5HA 1MXSA 2OJPA 1W5QA 2XFYA 3PJUA 3FYOA 2PGEA 3WLOA 2VC5A 3U7VA 1S2CA 1LL7A 1KM6A 3EA1A 2QKFA 2PGRA 2VGIA 1V3IA 2ZZ2A 3BXWA 3CAKA 3HU7A 2FZDA 3W6LA 3LQLA 1J5SA 1W1PA 1W2PA 3EMQA 2RFGA 1CWYA 3SDOA 1ECEA 1XP3A 5J04A 1RK6A 4IIHA 1KWGA 5I07A 1ICPA 1UQZA 4F2BA 2OT0A 4PODA 3QLLA 1EEPA 1W37A 3CQIA 3ZWSA 4AXNA 1WUEA 4KERA 2Y8VA 3BAIA 4H7ZA 2WKLA 2G5WA 3WBAA 2ZUMA 1KQZA 3F2DA 2AL1A 2QCDA 4PUMA 3KVMA 4N0RA 2CCRA 4GUGA 4XAZA 3GAYA 3PWGA 2CLEA 4CNUA 2O9RA 3PAOA 4IXXA 1CXEA 3OG2A 4HIBA 5AYXA 4PRRA 3S4TA 1Y5VA 4JQAA 1AFSA 3PJXA 1JCTA 2VGBA 4Z1CA 2QV5A 1W0MA 5TBOA 1XLJA 2BHUA 1UHVA 3ANVA 1JFHA 4F66A 2AKMA 4CLMA 5AYBA 1KBJA 5GNYA 1MW2A 1VENA 3PZTA 3M47A 5C9ZA 3UJEA 1OD8A 1QK2A 2PU0A 1CYGA 3P62A 3UNTA 3HOJA 4O16A 4N9CA 2DUZA 5K4XA 3TYBA 5HK4A 3EWCA 2PP3A 1D3HA 1TRIA 4QAIA 4AB4A 5H8PA 1RD5A 1HKVA 2VGFA 3CV7A 2WMFA 1MVYA 1TRDA 1WV2A 1QR7A 2Z6JA 1RJPA 7TIMA 4JEJA 3G1SA 5G5IA 5EBAA 1J9YA 2D3NA 2PF0A 3NPXA 2E5BA 1F5ZA 3T09A 3OZOA 4ERAA 3MW7A 4JDYA 4YCOA 3GXDA 4HHLA 2PRLA 3ISIX 4LYQA 4ZTXA 3S0CA 4GXWA 2CPUA 4DUXA 4NNBA 3BMXA 2XU2A 4MADA 1XD1A 1TQXA 1H63A 1K7FA 2QPUA 2RDXA 1KV5A 4W9TA 1T0OA 3ZT5A 1F2JA 2WWDA 3LCHA 3MUAA 3SUUA 3GFZA 4S39A 3NTYA 4HN4A 2CETA 3C3NA 3PUDA 1H7XA 3BOXA 2PRHA 3WL0A 4JTJA 1UD5A 2FKPA 2V8ZA 2VMFA 4J3VA 4IX2A 2DH2A 2I7GA 1P0DA 3TV8A 3BQ6A 3VIKA 3FA3A 1KD0A 2W92A 3LK6A 4RLIA 4NNCA 3ITGA 2BV9A 3IUIA 3VMNA 1TV8A 2WHLA 2DIKA 4GI4A 3T0TA 4P8WA 3FJLA 1U5VA 3Q67A 2C15A 2B4GA 1XJBA 4K8HA 5EMLA 4LY4A 3OO2A 2J75A 1DHPA 4H19A 3RG6A 5C2XA 4QQ3A 1I2OA 6ENLA 1UA3A 3TAKA 2VEGA 4LF2A 1TJ2A 4DYJA 3S9ZA 3R1ZA 1A5KC 4QG8A 2G4FA 3V1PA 5HMFA 3UWYA 1SZNA 3W24A 4DPQA 5RUBA 4O8AA 1WDPA 3V0SA 1BSIA 3GNPA 1TKKA 4RK8A 2EHHA 1C8QA 3G1RA 2ZBTA 4LEFA 1S5WA 4CNTA 1XUUA 3GDMA 1KXHA 2WSRA 4HHHA 1Q85A 3N2OA 1SR0A 3NZRA 3ANUA 4JX4A 4KETA 3IIVA 1ICQA 3L67A 1FWDC 2D3LA 2NVDA 2J9XA 4MNMA 4C6KA 3S5ZA 3GQYA 2WVSA 1JYVA 1OCBA 4QS5A 1GOXA 4V33A 3ITVA 4YVXA 5GPRA 3UBPC 1T40A 2VEKA 3QMSA 1ZS2A 1O1ZA 3LX9A 3OVPA 4AWTA 3A47A 1TWWA 1GJWA 3RILA 1O1HA 1LF1A 1RA5A 3LCWA 4ES4A 3NQ2A 4KFOA 1ME8A 4XD6A 4P8VA 1LYXA 4DM2A 2CFFA 1T99A 2VL4A 4PRWA 1QHOA 1SO5A 1OYAA 5AZ1A 2ATSA 5JH1A 4K2SA 2IKHA 3PZUA 4HCLA 3ARYA 2KX9A 3U57A 4AZ5A 4Z2IA 1C7TA 4UMCA 4BEQA 3B9NA 3S3GA 1F8MA 4HMDA 1K6WA 5DBTA 3W07A 4HHPA 1OZQA 3PWAA 1RBAA 1LUCB 1L6SA 4AF0B 4L56A 1YXDA 2GDVA 2DT2A 1T8QA 1BXNA 3VMOA 2VR2A 3UCCA 2Y5JA 2A3HA 1XSJA 3IJQA 4KCTA 1JIBA 2B7PA 4ONVA 1UH4A 1NEYA 1S39A 5A6BA 3RDKA 3L2MA 1KR0A 1J6OA 3DC0A 4ZB0A 3TTSA 2VDIA 3UZ5A 4IMDA 3HG4A 1VFOA 3SIMA 5ABEA 4W4QA 1DJZA 4ASTA 5KMYA 2DIEA 3NZ1A 4FLRA 1I2RA 1RCOB 1UPMB 1DIEA 3BLEA 1AL8A 3ONCA 4XKYB 4CEUC 1JDDA 4HMNA 3LHTA 1L9WA 3W27A 1G94A 3WQEA 4UTWC 2C79A 5A6LA 3QHMA 3M0MA 3G3MA 3TNBA 2Z25A 5HQEA 3MI2A 5GQBA 1JCLA 1CT5A 1ISWA 2YZRA 3E0WA 3QC3A 4UR8A 5BOFA 4CQ8A 4PMQA 2E09A 2X1UA 3VC5A 4CN6A 3LD5A 1BWLA 1PX8A 1PEZA 2GDUA 1YNPA 1L0PA 3M7SA 1YRRA 4F9DA 4N42A 3W7QA 3I65A 1VIZA 1S2UA 2AOSA 2VR5A 3SECA 1G6CA 1PZ2A 4FOKA 1Q6CA 4NG3A 4E8CA 2ZVIA 1PUDA 1XRSA 1XKJA 1GVEA 4KFPA 4NVTA 4ORMA 4GH3A 4DZHA 4DF1A 4CNPA 2PLMA 3CT2A 1K9TA 4YYCA 3QGVA 3KL0A 4NP7A 2FMNA 5EY5A 3W73A 3FVMA 4JTAA 5E0FA 4R7JA 3GFYA 4MZ8A 2FDSA 1UJQA 4OUEA 3BICA 3CQ0A 1JCMP 2CLIA 1NOWA 2YCKX 2P8CA 4JIHA 3LS9A 3P74A 2ZWZA 2PWDA 4Q8VA 1EX1A 3GXTA 2RKXA 1AZ1A 2QJMA 2YDSA 1KM2A 4MB5A 4P2VA 3TQPA 1NJJA 3L68A 1VJIA 2PODA 1UP2A 2Y24A 2WMHA 4NRRA 4JFTA 1OADA 5LNRA 1UZ4A 2ZADA 3KBVA 3PZMA 4UQBA 5IOBA 1SZGA 3CEUA 4H01A 3SFWA 4WKAA 1DPMA 1ZSXA 3TWBA 1P0KA 1YXYA 3MUXA 3WNMA 4NAFB 3VKCA 4W88A 5PTDA 2ABBA 3T42A 1ONEA 3COTA 2PD5A 4GJIA 4JTSA 2QEZA 4F4RA 3VUPA 2GWNA 2E3ZA 1VFUA 4A8LA 4AIEA 3AI0A 4UNIA 2XN1A 4KF1A 1O7AA 5BXTA 2YPIA 5CPNA 4X9SA 3WQVA 4RE0A 4G9PA 3VU2A 1X98A 2GJXB 3TC7A 3L2IA 2HBVA 1TJPA 4K8GA 3KVKA 2CXEA 1EWDA 4PFMA 1M41A 1FDYA 4G7FA 3NAVA 3S6TA 5FOOA 1RSCA 1VEPA 1UWTA 1W32A 2BOFX 2Z00A 3VIPA 3V4BA 4RL3A 5HUOA 2O7QA 2J79A 4Q32A 3WF3A 1D3CA 3GG8A 4E4PA 5H2ZA 4GNVA 3HQ1A 3NSMA 4UNLA 2DW7A 3WO8A 3GXIA 2CC0A 3WBEA 5EMKA 1K7EA 2HRWA 4LC6A 2EQDA 3WN6A 3V5OA 3W1RA 5D03A 3IK4A 1JZ3A 1EJTC 3BLIA 4Q4PA 1UASA 2FVMA 2G50A 3AU6A 2TAAA 2ZZ4A 3HO8A 1EA9C 1JL8A 2OLSA 3QBUA 4Z2JA 3BAYA 4UNKA 5E70A 3LPOA 1OX5A 3UR5A 2D20A 1OYBA 1HL8A 4EWND 3GVRA 3C2YA 4DWSD 3VKBA 2XIOA 1GVIA 4L1XA 2XSXA 1FWFC 2E0PA 3BW2A 5BRQA 2TMDA 3M5YA 3NA8A 3B4YA 2KZHA 2E4TA 2QCDB 2NX9A 1UWRA 3DBNA 3NQCA 4KWUA 4HJWA 3HGJA 4PL1A 1DJNA 1X7IA 4RCXA 1YPFA 3GC5A 4EIVA 1HJWA 3R11A 3VZXA 2AGTA 4U5KA 3ELFA 2WAGA 2EG8A 1TV5A 2W79A 5M3WA 4N9EA 1AQMA 3XISA 3V5FA 4AEFA 3FDGA 4IQEA 3GH5A 3P84A 1XYFA 1F3WA 2YXXA 3AIQA 5KITA 3M5XA 5L6UA 4HNVA 2ANUA 1O60A 5EFDA 3B3DA 3PHAA 2OMAA 1J8VA 1UP3A 4OBSA 5FJTA 5HR7A 3BLKA 3UWUA 2WZIA 4INFA 3GB6A 2GSJA 1JZ6A 2ZRZA 3T08A 4HNOA 5C71A 1XLEA 4P7QA 5DXYA 3WD0A 1DTUA 2BS9A 1TR1A 3AISA 3TN5A 1IT0A 3MT1A 1XINA 3CUGA 4KCUA 4MLJA 5SWUA 1JPMA 2Y5EA 4GUJA 4I90A 5CBJA 2YDQA 1V7AA 3UWEA 1XHGA 4F48A 5T26A 2VX4A 4FF7A 3PBVA 4AEEA 4DXXA 4QAWA 4A22A 5IHSA 1A50A 2NXIA 2I5QA 3FAXA 4MPKA 4MYAA 3IJ9A 2PS2A 4LF1A 1EEXA 1BVNP 4JN6A 3LU2A 4HD5A 1TJ0A 3OEXA 3VDGA 3A3XA 3W7GA 1OCNA 4R88A 1PYMA 3KP1A 5XIAA 2PU1A 5A8GA 1UUMA 3IJDA 3S2CA 4N9DA 5M17A 2YJQA 4REQA 1I60A 2W6RA 2EJAA 3AWNA 3C86A 3U48A 5GJMA 2XVLA 7CGTA 4U5IA 4PMOA 2Y7GA 5DMNA 2SFPA 5LKYA 3UEQA 1Q65A 1P1XA 4U2YA 3I7QA 3MWAA 2B7QA 4Q4OA 1RY8A 5CSUA 3EDDA 4UQ9A 1UD3A 5LSMA 1A5OC 4AQLA 3UETA 2QUVA 3QMRA 4Q4MA 1GPFA 2FZNA 1E73M 3EGJA 4IT1A 4U2ZA 5FAGA 3VDHA 3AFBA 5CPTA 4QBXA 3LM7A 2QIWA 4PB4A 4EPEC 5TQLA 3NQVA 3APGA 8RUCA 1PWMA 1J0YA 1IR2A 2P5NA 2VC9A 5A2AA 4E2BA 4IIDA 1SM9A 4J3UA 1MO0A 2VDGA 3L12A 1ONRA 4D8ZA 2POZA 4PCSA 2Z1SA 3LCXA 1XSIA 4MNKA 3IIXA 3RPDA 3HJEA 3VIFA 3HGRA 4Q6XA 4DZAA 1EYWA 3ZR5A 2V5BA 3EDJA 3UWWA 1Q2SA 1QRQA 1UCWA 3BSHA 3OLDA 4KW2A 2NQLA 1XUZA 3XIMA 4O11A 5FEWA 3M5ZA 5D04C 1MI3A 4ZSUA 4NNAA 3CAVA 2QJJA 3WENA 4QRNA 4JICA 4BS0A 1QASA 1OFDA 1VYRA 4GVIA 4AIUA 3BW3A 3UA3A 4XUYA 4BQ3A 4TR9A 4MKVA 3OIXA 3JUGA 2CLLA 3HURA 2V81A 2OGJA 3QVQA 1DV7A 2Q8ZA 4XZLX 1MQRA 4IH3A 2DVXA 2F8QA 4PUNA 1W1VA 3BCFA 1J0IA 4DYEA 4LX4A 2PAJA 1U1HA 1TPC1 5A94A 4LB4A 5FI8A 1EJSC 4I5RA 4C6BA 1XIHA 2WKJA 1IZJA 2VQUA 4O19A 4PYSA 3TONA 3EWYA 9CGTA 4M6QA 4C6OA 2QDEA 1WKEA 2X0YA 4TMCA 1EFZA 2D0HA 2CEQA 2VC6A 1JD7A 1CBGA 5FKYA 5CZSA 1OGGA 4O13A 3S1VA 3UGRA 3GVQA 4EP8C 1NOFA 2ADAA 1IEXA 1V7YA 4A05A 2B81A 3HG2A 3DI1A 3WLJA 1W1B1 4D71A 1EQCA 1UD8A 2G3MA 3GRIA 3ARZA 4RPQA 5DT7A 5ENLA 1W1IE 4B3KA 2WV8A 4IIEA 3JU2A 1Z3NA 5EB8A 5A6SA 3GIPA 1L6WA 4B5VA 3EEZA 1TUXA 5C5YA 5F2MA 3CXOA 1E6ZA 4W7UA 2WZMA 1TMQA 3BE7A 4EANA 2GVJA 4O1CA 5IDIA 5AECA 1K77A 2FTYA 1TVPA 3HV9A 4JY9A 1W1A1 5AC6A 1T8XA 3FVDA 4GFSA 3PFMA 3WNLA 6TAAA 4BR1A 4IFOA 1S46A 1ALDA 3ARUA 3EX6A 4LXFA 4GCAA 3AQUA 2BXZA 3NEHA 5AN7A 1UR9A 4J2MA 5G2HA 2WBGA 2V3GA 5D38A 3S5NA 5G4EA 2J9YA 3VABA 7ENLA 3NQEA 4ML4A 1IEIA 3V18A 3WG6A 5E0CA 2PDPA 4HTYA 2CITA 2XN2A 4UQEA 2F84A 4GQBA 3S5OA 1I8JA 2JIEA 3MMTA 1J0JA 3DC8A 3SCQA 5DFAA 3EPMA 4B15A 1H62A 1BSLA 3G8RA 1JULA 4GUFA 2JK2A 3S1UA 5D33A 3A4JA 2V3EA 1W17A 4G2DA 3RPTA 3HQPA 5FD0A 3DHDA 4JN7A 2FPYA 2X7VA 4QE1A 1TE6A 3W2UA 3K1DA 3GG7A 2WSQA 2Q8LA 1FBAA 4O28A 5LGXA 3OBAA 3VILA 4TIMA 3ARVA 3TJIA 1VPXA 4PUDA 1YLVA 1JD9A 1C7SA 1O95A 4B5SA 2XH0A 3GS6A 4MJZA 3SAZA 2BY1A 2QZRA 3TTQA 2IMRA 3F4WA 3MQTA 4PC8A 2DZXA 4QX4A 2EG6A 1NP0A 2GWGA 2OOGA 3VINA 1FUYA 3ALGA 3TOYA 4M82A 1W5OA 2PD9A 2YBUA 1B3VA 4FNPA 1XGEA 2ZA3A 3IRDA 3LTYA 1XDJA 3ZQ9A 3Q58A 3LXAA 5CG7A 3BANA 1MUCA 1OIFA 4AD5A 3V16A 1N7KA 2J77A 4FXSA 4HPJA 8TIMA 3SB0A 3R79A 2JIWA 4AD3A 3H26A 2NVAA 4L5ZA 5JU6A 2RAGA 4QCFA 3AYVA 4MF4A 3P93A 3BLLA 5J5DA 5DXXA 4HNTA 3ITOA 2GK1A 2WZTA 4IJCA 2OEMA 4FALA 4H9MA 1ADDA 3H22A 3G8EA 3FEQA 1M53A 4DBWA 1KM0A 3AXIA 3DENA 1ZCOA 1W9BM 3L0KA 3VGDA 5LIYX 3VOHA 4KWOA 4I6VA 4L9YA 4UZSA 5BWFA 4M6UA 4Q7BA 4H41A 2FJKA 3PP7A 4F2TA 3AHVA 2ABAA 3KL5A 1UH3A 2WJFA 1LWJA 1S5TA 2XVPA 3WY1A 4WKFA 4LC8A 3WELA 3ZSSA 3RNDA 3E5PA 4JBRA 3B8VA 1ZCCA 2HEJA 4PUEA 1OQFA 4LV4A 1TV7A 1VIWA 1LT8A 1XFBA 3W83A 1JZ4A 5D9MA 1OX4A 4GHRA 4XVDA 4A3QA 3VKAA 3PAJA 1QI2A 4RPPA 1KKOA 3P82A 2VYOA 3SRHA 4I5UA 3CHDA 4DLMA 1OC6A 3PZQA 4KCWA 3TR9A 2Z1VA 4OVXA 2FGLA 2PGFA 1RALA 3LV5A 3G1HA 4WSKA 1HGYA 4QE4A 4C90A 2QXWA 3TQ0A 3ARTA 4NASA 4M8UA 2PWHA 3F2BA 3OOQA 6ALDA 5JVLA 2GGHA 3CV2A 3H2AA 4BA0A 4QR6A 3EYPA 3PPHA 5K9CA 3BZGA 2J4GA 4DJDC 2Y4SA 2HJPA 6TIMA 1Q4WA 1NDVA 3BL3A 3CL7A 4CCZA 3FIGA 1F9CA 1TB3A 2NW0A 1JQVA 1YTEA 3OTRA 1B3WA 1XH1A 2G3FA 2O56A 2BG5A 1GORA 3M9YA 2DSZA 1TIWA 5I3DA 5DT5A 3WQPA 2PUZA 3J7HA 1FWAC 1DIOA 1PZ1A 3G77A 4MWAE 4QDPA 1H7WA 1MUWA 2DZVA 2PWGA 2HBXA 3SSJA 1ESWA 3KBSA 5F1UA 4CU6A 4LVGA 4WJEA 2D73A 2BFGA 3W87A 5CEWA 1GOKA 2WNZA 2E1DA 4DBDA 1XL9A 4FLQA 1E1EA 3N18A 3RLVA 2O9OA 1WDQA 1DJWA 3MSYA 2QPSA 3CUHA 3SUVA 2GGGA 3ZMRA 4ZCWA 2V0TA 3DH7A 1AODA 5HDRA 3O7UA 1WBJA 2XIBA 3NM3A 4H83A 3QPEA 3GZAA 3BAJA 2QAPA 3LPGA 1HO4A 1R7OA 3IVTA 2X7WA 1H1YA 3GZ3A 4UXDA 5E0KA 4JTFA 4ZVJA 4M7TA 3LBOA 1Z48A 4ICCX 5JBEA 2FZ8A 3DEQA 4C1KA 1OIMA 4D6EA 1VF8A 1LL6A 2TODA 4JQ4A 4GYPA 2W3ZA 2DZTA 4Q3MA 4B5NA 3C4UA 2INEA 4OUIA 3W71A 2C19A 3GM8A 5BCAA 1FFQA 4FSAA 1V5XA 3DUGA 4UIOA 3QR0A 4L6HA 4OWGA 2NQ5A 3BG9A 3EOEA 4JTKA 2C71A 1WNOA 1A5NC 1XC4A 3B97A 4REQB 3EWZA 4M51A 4MZ1A 2ZRXA 3GKAA 4DUOA 3HQNA 1DHKA 4GLEA 2B0MA 3PBUA 1HL9A 1TWSA 5I79A 1WKDA 3N2BA 2E25A 1GVQA 3PNZA 1YTDA 4RKAA 2NX3A 2PDFA 2UY2A 3RR1A 3WLNA 1JYWA 4GZJA 3N1AA 4D6JA 1QWKA 4PMRA 4HTBA 1EOKA 4CQAA 3CPUA 2BWGA 1DP0A 3TC3A 2RJHA 1Z6KA 4YIWA 1QW8A 2C14A 2ZRVA 1WB0A 1SUXA 4IF2A 4BJHA 1F3EA 4WF7A 3GR8A 3F4CA 2GZXA 3GYEA 4WSJA 1HF6A 1QOPA 2OCZA 1Z41A 3WQOA 1GOQA 3STFA 4O10A 4R34A 4DX3A 3U8GA 1UOZA 4S23A 4Y7EA 3TW6A 1X38A 1NWUA 3QJAA 5I03A 2PC8A 3A12A 4WEVX 3B8TA 4GY7A 3WDQA 4QCEA 3VMPA 4RJEA 1HJVA 3NL5A 3H2CA 3LENA 3T4WA 1DWHM 1G7UA 3R0DA 4HB7A 4QXIA 4E4UA 1LQAA 3BOFA 2G3IA 1RH9A 4O4VA 4E0CA 1R30A 2ZRWA 2BVYA 2I5IA 3FK4A 4M3PA 3QV7A 4M24A 3OQEA 3BGGA 3EKLA 1UG6A 4JTRA 3L0NA 3MHGA 4GX9A 2JQXA 4GISA 4TV6A 3VO0A 3UZJA 1VFFA 3GU1A 2QW5A 3TROA 3IVS