3UZXA

Crystal structure of 5beta-reductase (akr1d1) e120h mutant in complex with nadp+ and epiandrosterone
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
325
Chain Sequence
DLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIHVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-oxo-5-beta-steroid 4-dehydrogenase
publication title Conversion of Human Steroid 5beta-Reductase (AKR1D1) into 3β-Hydroxysteroid Dehydrogenase by Single Point Mutation E120H: EXAMPLE OF PERFECT ENZYME ENGINEERING.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 113
structure length 325
sequence length 325
chains with identical sequence B
ec nomenclature ec 1.3.1.3: Delta(4)-3-oxosteroid 5-beta-reductase.
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3uzxA00
1XGDA 4FAMA 4H7CA 3R8HA 4XZIA 5LIUX 3CAQA 4HBKA 1HQTA 4PMJA 2PDLA 4L1WA 1PZ0A 3WBXA 2ACUA 3UZYA 2ACRA 4JIHA 4G5DA 2FGBA 2PDUA 4JTDA 4PR4A 2PDYA 4NKCA 1PWLA 3NTYA 3WCZA 2IPWA 3WG6A 4OTKA 4DBSA 2DV0A 4GQ0A 2FZ9A 4PRRA 3H7UA 4ZFCA 2PDHA 4QXIA 1AH3A 3UFYA 5LIYX 1RY0A 2C91A 5JH1A 2PDCA 4WDUA 4H8NA 2CLPA 2IPGA 2F38A 2INEA 4LAZA 2BGQA 2PDXA 3UZXA 5HNTA 4PRTA 4Q3MA 1ADSA 1YNQA 1JEZA 1ZGDA 2PDNA 4PUUA 4XZMX 4FALA 4GA8A 4ASTA 4QBXA 1EXBA 2PDJA 4JQ3A 2IKIA 3RX2A 3R8GA 1T41A 1R38A 2HV5A 2R9RA 4F40A 4LBRA 1IEIA 4LB3A 3UYIA 2IPJA 4IGSA 1T40A 3R58A 4XO6A 4GQGA 3CMFA 3UGRA 2PDWA 2BGSA 2IKHA 2ACQA 4WRHA 2HE5A 4DBUA 1Q13A 4ICCX 3LNMA 1YE4A 3F7JA 3WBYA 3QKZA 4XVDA 2A79A 2I16A 2HEJA 4PUWA 3VXGA 2INZA 1A80A 1LQAA 2DUZA 3Q67A 3KRBA 3DOPA 5AZ1A 3N6QA 4JTRA 2FZ8A 3MC5A 3ERPA 2J8TA 3GHSA 1K8CA 4JIRA 1YNPA 3H4GA 1C9WA 3R43A 3M64A 4L1XA 4LBSA 1RALA 1YE6A 3Q65A 5LIWX 4GACA 5JH2A 2PF8A 3V35A 4WDXA 2IKGA 1FRBA 3DN5A 3GHTA 1X97A 1XF0A 3LUTA 2PDBA 3GHUA 3R94A 2IQDA 1S2AA 2DUXA 3EB3A 4XZLX 1GVEA 3CAVA 2HVOA 4RPQA 1MI3A 2HDJA 3BUVA 3CV6A 4JTCA 3C3UA 3G5EA 2IQ0A 1IHIA 4YVPA 5AZ0A 2ISFA 1VBJA 1PZ1A 4XAPA 2PDKA 4EXAA 3T42A 3ONBA 5HNUA 5LIXX 2WZTA 3RX3A 5C7HA 3S3GA 4AUBA 3CV7A 3UWEA 3LZ3A 1UR3M 2ALRA 1EKOA 4GIEA 4QR6A 2WZMA 5HA7A 3P2VA 4WDWA 3FX4A 3BCJA 1ZUAX 4FA3A 4LAUA 4JQ4A 3B3DA 4FZIA 3BV7A 1Z89A 3R7MA 4EXBA 4WEVX 3LENA 3COTA 4XK2A 3R6IA 4MHBA 1MRQA 4JQAA 4XZNX 1S1RA 2PDGA 3EB4A 3V0SA 3UZWA 1X98A 2PDIA 4YVXA 3V36A 1Z3NA 3M4HA 2NVDA 4DBWA 3V0TA 3LBOA 2ACSA 1LWIA 2IPFA 1X96A 3LZ5A 4YS1A 4XO7A 3D3FA 4I5XA 4GABA 3H7RA 1SM9A 4WDTA 1ZQ5A 1M9HA 1AH0A 1Q5MA 5KETA 1AFSA 1ZSXA 3RX4A 1MZRA 3ONCA 3LQLA 2HE8A 3V0UA 3U2CA 1AZ1A 2PD9A 4JQ2A 4R9OA 4JQ1A 3GHRA 1XJBA 2HVNA 1EF3A 2BP1A 3EAUA 3M0IA 1EL3A 3BURA 2FZBA 1Z8AA 2PEVA 4XVEA 3G1RA 4DZ5A 3MB9A 1AZ2A 2F2KA 2FZDA 4JIIX 2PDMA 2AGTA 4HMNA 2PFHA 2FVLA 2PZNA 2R24A 1QRQA 3O0KA 4XZHA 2P5NA 3GUGA 1PYFA 3UP8A 2PD5A 4YVVA 3WBWA 1S2CA 4QX4A 2IS7A 1S1PA 3LN3A 2IKJA 5LIKX 5M2FX 4IJCA 4Q7BA 4GCAA 3FJNA 4JTQA 3UG8A 4WGHA 3UZZA 1US0A 2QXWA 1RY8A 2I17A 2PDQA 1QWKA 1OG6A 3LQGA 5DANA 4IJRA 4LB4A 4YU1A 3O3RA 3N2TA 2PDFA 3CASA 1J96A 1HW6A 1VP5A 4JTAA 2NVCA 2PDPA 1Z9AA 1PWMA 2VDGA 1AH4A 3LD5A 3LEPA
chains in the Genus database with same CATH superfamily
1W9PA 4QFUA 3R8HA 4XZIA 2DFAA 3LCXA 3WQCA 3S5ZA 3VOCA 3O15A 1OFRA 3BLFA 2PDLA 2OZ8A 4L1WA 4QG8A 1B90A 5BXTA 3L5MA 1I6NA 1TPEA 1BXBA 2CCRA 4MG4A 4ZA0A 1XINA 2X30A 1OC6A 3B04A 1OHLA 4MPKA 1TIMA 5HINA 2IPWA 5I3DA 3VNKA 5DY3A 3PPHA 3S4TA 3WF3A 1UB3A 1XQLA 3TMQA 3OBAA 4FK9A 3WDRA 4PRRA 4ZFCA 2DVUA 2YOCA 3CWHA 1AH3A 1JFXA 3DGBA 3ITXA 1BD0A 2J4GA 2DDXA 3WQOA 3OODA 2ZE0A 5FIPA 1EYEA 3LCFA 4EPDC 3UZXA 2I57A 2DW6A 1ADSA 1VHCA 1FP9A 3PPCA 1K8ZA 1P0DA 1A5CA 5JVLA 4BQ4A 1A5AA 4HNOA 3D47A 3WLRA 2A3CA 2OG9A 3CT2A 4NZCA 3IARA 1QNVA 1Q7ZA 1OZMA 4P7QA 2OGJA 3SM0A 4ADUA 3ITOA 4CN4A 1EF2A 5DMNA 2CYGA 1DVJA 3VZYA 1XPGA 2WW5A 2D2OA 4DO7A 3VNJA 4Z2IA 2CHNA 4I8YA 1H7OA 2GJRA 4AF0B 3QR0A 4O1EA 4L6HA 3II1A 4A2RA 3TQPA 3B0VC 1U22A 4JTUA 2WMJA 2XTKA 3OOQA 4GFIA 4IG2A 1W9UA 4UXDA 7TAAA 2YCJA 4C65A 4FNTA 2MNRA 4ICCX 1XM3A 4M6QA 1O94A 4I90A 3ZR6A 2CERA 2MUCA 2GUYA 2VVNA 3NWRA 2V67A 4GQQA 4GYFA 1BRLA 1X8CA 4QDPA 3UCQA 4AIOA 1GZ1A 1RBLA 2QDGA 1K03A 1W1A1 2VRQA 4H9YA 4IUOA 3P81A 1KFJA 1NTHA 1SUXA 2CIPA 1W5NA 1UWSA 2J9ZA 4Q8NA 2WM0A 3UGVA 3MSYA 2IMRA 2WC4A 3NOEA 4O50A 5CZ0A 4NU7A 5FF7A 1YE6A 3TCEA 3H21A 2EGZA 5DX7A 4O54A 4Q8VA 4DZHA 3CYVA 1J2BA 3THCA 5BRQA 3EWWA 4PBFA 2G8ZA 1JDEA 1QO2A 3A23A 2PWHA 1XICA 1RCXB 4LY4A 3PUOA 4BF9A 2NX9A 5H8PA 4K39A 1R46A 4Y8FA 3V4BA 1GVOA 4ZQPA 4IHCA 3CC1A 4RE2A 2XU2A 4RPQA 1E40A 3JS3A 1DQXA 4D6HA 4DN1A 3LLDA 4MZYA 3QZAA 3TN5A 2C1HA 1YRRA 3DFNA 5DMYA 3C3UA 1XV8A 3M46A 3VIJA 4AC7C 1XYZA 2GFTA 2WC3A 2PLCA 3H4WA 2PDKA 5PTDA 3IGSA 1LG1A 4ZOAA 5HXMA 1EIBA 2XGBA 4CVUA 1ZENA 2ISDA 1MMFA 2VGFA 4XD5A 3UEQA 4H9XA 4FLRA 4HJFA 3W7LA 3JRKA 3V7PA 4PUEA 2BY3A 5DRCA 4WVXA 5I03A 3BGJA 4PMDA 4QAWA 3P6LA 1CGUA 4E8DA 3B0YA 1I2PA 3CHFA 1XSJA 1KR1A 3PANA 1FWDC 1LT8A 1OCJA 1NOUA 3AZRA 3TYDA 1F05A 3U4AA 3KP0A 1A5NC 2E6YA 4CN6A 1JJKA 3FSTA 5C8BB 1DIEA 1S5VA 4OWGA 4NZFA 1J79A 5A8MA 1ZBCA 5E0KA 1FXQA 3TC7A 3DBNA 1UZHA 2XIQA 4GNJA 1PKLA 4H6KA 2YDRA 4A3RA 3Q94A 1R2SA 1LTDA 2GK1A 1OJXA 1F4AA 2P76A 4IX0A 2XIOA 1ALDA 4PCPA 5LNVA 2DZUA 1NFPA 4A4AA 2E5DA 5CZJA 4I5XA 4Y2WA 2OWXA 4Z1DA 5H91A 1O1HA 2OSYA 1KCLA 2Y6ZA 5BW6A 1ZLPA 4KESA 4AAJA 3VFLA 1IR1A 4RE4A 6XIMA 2PD9A 1WXJA 3UESA 4IPLA 3TEVA 1FFRA 4LAOA 3KOFA 1E5JA 2RH9A 3BLKA 1HJUA 2REQA 1RJQA 1R3WA 1OX6A 5EMLA 1GONA 2V5JA 4QLJA 2Y7GA 3PJWA 1ENUA 4DZ5A 3AFBA 4RPPA 4CNOA 2O7SA 4OV9A 5DCDA 3VM5A 1CGWA 2JEQA 4LNCA 2LLEA 3RU6A 4ZEPA 3DBPA 3R5EA 1T7LA 3PM6A 4DXXA 4Q6XA 5E6ZA 3ZOAA 4W89A 3UJEA 3FN9A 2DZXA 2AQWA 2D23A 5FF0A 2PZNA 4OU1A 1KWGA 3PK7A 3VD9A 2YKKA 4Q4OA 5HQMA 2PWFA 3IS4A 2CEQA 1TG7A 3S1VA 3IGUA 4BQ2A 2V38A 1WCGA 2G3MA 3ENLA 1FCQA 3CHDA 3RLVA 4JTEA 5TF0A 4DEFA 3OA5A 4CGTA 3G77A 3AXHA 1KLYA 1N82A 2WXDM 3UY7A 1GVFA 4FXSA 5I0DA 1RY8A 3NQDA 4DWSC 1ISVA 4M51A 3TJ4A 4YU1A 3EWUA 3MUZ1 3KP1A 5CPLA 2ZUMA 1W3LA 3ES8A 1EGZA 4JHZA 3KOXA 3LTPA 3SY5A 3SY8A 4GIYA 4MF4A 1E3XA 1VP5A 1I2NA 1K9FA 1TTPA 4C1KA 4IUGA 4AVOA 3CHVA 3NGFA 1MUCA 2Y8VA 2ZC1A 1UKQA 2DVTA 4GUIA 1BG4A 4IP5A 3LA4A 4D72A 4M3PA 2G97A 5K9XA 1Y65A 3KEHA 5SWUA 1P6WA 2FHBA 3ZWSA 4P8WA 1LRNA 3UJRA 1OD0A 3BDKA 4RKAA 1TZ9A 2J47A 4I3GA 2PLJA 3QHNA 2WMKA 2ZC8A 2POTA 2GL5A 8RUCA 3IJ9A 3GXMA 4IL2A 4JN7A 4NNCA 4NUWA 5EBUA 5LIYX 5J5DA 3P80A 5K9CA 3G0SA 2G0WA 2XIJA 2W66A 4S38A 3SDOA 2VGIA 3PBMA 3FJ6A 2FVMA 4GISA 2J77A 5HNTA 3UCDA 4JNMA 4NAFA 2HXUA 5ECUA 4QNWA 3O6CA 2XSBA 3UXLA 4ERAA 1ZGDA 4AU0A 3GZAA 1JFHA 1J5SA 3EA3A 9XIMA 4PEEA 2AQVA 1NAL1 2E67A 1FFQA 1TPVA 4MJZA 1R3YA 2V68A 1T6MA 3L4UA 4K36A 3R1ZA 1QJWA 4AEOA 3GKFA 3DERA 3P74A 2EJAA 1T40A 3FV9A 3VC5A 3NJ3A 3CMFA 1HKJA 1O5XA 2I1OA 3UJFA 1A3HA 4QJ4B 2Y1HA 2PA6A 2ZBTA 2ZDRA 3FW6A 4LW7A 2V2HA 3NPXA 3TH6A 4H8UA 4ZFMA 1YTKA 1IGSA 5BZAA 2QF8A 1W2VA 1YE4A 3W22A 1N8FA 3N25A 1PPIA 4ZQRA 1EJUC 1Y0EA 3CTTA 2PP1A 3VIOA 4D9PA 5HJXA 3QGVA 3RPTA 3FLUA 3THAA 2FZ8A 4DVOA 3CT7A 2A3LA 3IJQA 1E0WA 2OSWA 1XKJA 4H6EA 4GZIA 4L7ZA 3TAOA 3M5XA 4GBDA 1DBTA 5BU6A 3WQPA 3HBLA 1AJZA 3FXGA 3SCNA 4HNVA 2WQDA 4L1XA 1FWTA 1RALA 5FAGA 5MF5A 1GW1A 3CGTA 3BARA 4JS3A 3NGJA 1O66A 5EMMA 3WLIA 3DN5A 3BMXA 1HP4A 2PDBA 1Q6RA 3M0XA 1JXKA 3HZ3A 4ROPA 4LY8A 1PKMA 1B9BA 1REQB 1OQFA 3W83A 1MZHA 1A53A 2YDAA 3FAWA 5TAOA 4YWSA 3S6OA 2YBTA 2QPSA 3G5EA 1ZU8A 1ZP4A 4OT7A 3GVRA 3DFTA 3W4RA 1OCQA 4KMQA 3K2GA 3TV8A 3KRZA 3LCHA 3T42A 1B3ZA 3ONBA 5FA5A 3GTNA 4QITA 4HHPA 3T4WA 3QPZA 4AUBA 2ISVA 4HOWA 3SCTA 3SCQA 2W6RA 1FKXA 3SY1A 1B9ZA 4D6FA 4GIEA 1EXPA 1H0GA 1V7AA 1K9EA 4C1LA 1QI2A 2WVSA 2V3GA 5DBUA 3WNOA 1YIXA 3N4EA 3VFCA 3B3DA 4FZIA 3AYTA 3R7MA 4Z2GA 1Q6EA 3E96A 1M04A 1OGGA 2E6DA 1R2RA 2V5CA 4DUWA 1PCKA 2DEPA 5I5RA 2BTMA 1H7WA 1HO1A 1R3QA 3AIWA 5GNZA 1BKHA 4G56A 3TN4A 2CZ5A 1FKWA 3AIUA 3D0CA 1F6YA 2ZCGA 1R8LA 3S1WA 4NT0A 1G01A 3WO8A 1A47A 4F66A 1W37A 4IXXA 1J10A 3RMJA 3D46A 4K37A 4YS1A 1N7KA 1OC5A 3H2OA 2YBVA 4ZB5A 3TX9A 1SM9A 3MMWA 1DEDA 1E6PA 1ZY9A 2BX7A 1MQPA 2DIEA 4JZ5A 2HE8A 3WX7A 4F0MA 4HOZA 3MP5A 1TA3B 1K4HA 3L2LA 1OF8A 4LCQA 1QMLA 1XS2A 5CH9A 1AL8A 4GWEA 3BLLA 2BP1A 1VENA 3KOYA 1V0NA 2XHYA 5DF0A 5C9UA 2PWEA 4IFOA 1YKWA 2B0MA 2VTFA 3VE9A 2QMKA 4HGXA 2WSYA 5HR7A 1GQKA 1RLCL 3CB8A 3PZQA 3R25A 1Q7QA 4Q6JA 1LRQA 3VTRA 3ZMRA 1E9ZB 3AIBA 1AJ0A 1PTAA 2R24A 3CQIA 2RGMA 3O0KA 4DPPA 3PP7A 4H6RA 5HDRA 5DT5A 1KB3A 1WUFA 4Z0SA 4UMBA 3T0DA 5CCZA 1JCTA 4UFLA 5CGMA 5H1WA 3AWNA 3AIVA 4IJCA 4Q7BA 3QW3A 1QI0A 1DJZA 1RXOB 1DQUA 4GX8A 4AD5A 1YX1A 2Y2WA 2YA0A 3UPBA 5DXXA 3KTXA 4LAMA 4AZIA 3DEQA 1J0JA 3GU2A 4LB4A 2OO6A 2A6NA 1GORA 2Y7FA 5IXEA 2PBGA 1XRVA 1WDDA 1CB2A 2OZTA 5HAOA 4DJFC 1H1YA 4WIWA 3UD6A 1PSCA 5EY5A 5HJYA 3P5YA 2D22A 2A7PA 3ZR5A 4Q8OA 2XSXA 3TSDA 1TZ7A 4GOAA 4CLMA 4GYPC 2C3ZA 3RK8A 4EPBC 4BS0A 3TR2A 2HS8A 5IOBA 3O06A 3MUIA 1XCXA 3UVIA 2HPMA 4CCDA 2VC7A 4DWSA 3IRSA 4F2UA 3V3WA 1B3VA 3TC6A 1H4PA 3TNBA 4WSHA 2EKCA 4GQ0A 4LU0A 3MCMA 2BWGA 4GO8A 3L4ZA 4IIDA 1LBMA 4OE7A 2QZRA 4UZUA 3SRFA 1K7EA 3IIXA 5CBIA 2QCMA 3W74A 1CENA 4WDUA 1V03A 3RO8A 3SJNA 3CUIA 1VJIA 4F79A 1SO3A 3HQ1A 3EOUA 3IUHA 5EFDA 4LUSB 4NYUA 4A3HA 2DQWA 1NFGA 2Y85A 1OG0A 3PZTA 3VC6A 3FGCA 3PTKA 4UQAA 3PBWA 2W27A 2YCLB 1Q2RA 1UWTA 1YMYA 3UY8A 3WNKA 3DIPA 3CK5A 1VB9A 4AWEA 2QDEA 4N9DA 3M0ZA 4LNYA 2E9LA 4RL3A 4FX6M 1OWQA 2GSJA 3HF3A 4DO6A 1VBGA 4HYVA 2JF6A 2DGAA 4J3TA 3NQFA 4P8UA 5GVJA 4NX5A 4AX7A 4KWUA 3K4AA 4W87A 4AC1X 1B31A 4IL0A 1DYSA 3HURA 3WBYA 1GOWA 1U30A 3CAKA 2C15A 1S2WA 2V81A 5ABHA 3GFXA 1JR1A 2WSPA 2Z1WA 4MAZA 3CO8A 2JIEA 2Y62A 3ERPA 6REQA 2J8TA 1R85A 1FQ0A 2XM2A 3H4GA 4HOXA 2HS6A 3Q58A 6ALDA 3D3AA 3ZVHB 2H9AA 3E9AA 3PZIA 4Q8QA 1XIEA 3RU8X 5LIWX 2ISSA 3LPFA 3TA9A 3KW3A 4UUIA 1FRBA 3AIQA 1KBBA 3S2MA 3VGHA 1LLWA 7CGTA 1TWSA 4CD6A 1XIHA 3CUGA 3CM4A 1RLDA 3UQNA 3ZR4A 5IHRA 3BJFA 2ZRXA 4XUGA 2JQXA 4XBJA 3WQDA 1W1PA 3S2NA 3E0FA 1UP3A 1EX5A 1QOQA 4QSHA 4ECLA 2ZUNA 2HDJA 3TC3A 1JYXA 1LT7A 3WD3A 4LALA 2XH4A 3M0YA 4WOQA 2R1LA 4XKYA 1DJYA 3RIKA 3DHDA 1ZJAA 3AHVA 4O0KA 3S5NA 4Q33A 1UD4A 2V2CA 3B05A 1H5VA 1KCZA 1LJYA 4GJIA 3WZ0E 4IPNB 2OLSA 4JN6A 2WZTA 1MDLA 5A6JA 5FJJA 3M0MA 3RJXA 1ZRQA 2FB3A 2UY3A 3H54A 4RNFA 1DKWA 3TIMA 5D32A 1AODA 1XIGA 4MTVA 4FR6A 2XYLA 1SR0A 5A2BA 3FX4A 1KM4A 1UR2A 4LVDA 5D8ZA 2JKAA 4CEXC 2WNQA 3W1NA 4DJED 3KBSA 1JYNA 2D2GA 4UTFA 3UPMA 1Z89A 2FJKA 3NYDA 3R0KA 1OINA 1VJSA 2A1YA 4FLOA 4QIUA 1RQBA 1GTHA 1BXNA 3OU8A 3M5ZA 4D1IA 4Q4KA 1VFMA 2OT0A 4M82A 2QT3A 3QY7A 2CITA 1M53A 2ATMA 4QTGA 3CXOA 4GQRA 1DHKA 4QDMA 3VGFA 1NF7A 2Y89A 4M6VA 2OO0A 2NV1A 5A6TC 3GUWA 2R1NA 1SSGA 1CWYA 3BAIA 3OVGA 3PAJA 3VX0A 3CS2A 2JGQA 3N1AA 4W8AA 3H7RA 3UETA 4AMCA 1QAPA 4X0VA 1H51A 2XISA 3LCIA 3RCMA 1B57A 1JI1A 1GKQA 1V7YA 9CGTA 2VC5A 5TIMA 2OKTA 1WXYA 3PPFA 3QQ1A 3SIMA 1G5AA 4KH2A 1OYAA 4AZCB 5DMMA 2Y70A 5A94A 2NWRA 1TJRA 5L9FA 3UZ5A 1RH9A 3A12A 3GFZA 3SGUA 3WBAA 5LSMA 1MDRA 2VX7A 1ESWA 3G8EA 5E9XA 3OTRA 1YBQB 4Z1YA 5G4EA 3KVJA 3UVAA 2P10A 4KERA 4GC3A 1UPPA 4IMEA 1HJXA 2P5NA 3BMVA 3PVFA 3DESA 4UIOA 4RDWA 3ZJ6A 4W9TA 1OZQA 3EPNA 5F2LA 3SW6A 4DXVA 1PL9A 2IUZA 5G1MA 2VQUA 4HPNA 1GOIA 3PSVA 3ABRA 5LIKX 1VF8A 1PTDA 1TVNA 2PU1A 3SUTA 1RP8A 1W56A 3DENA 2HISA 4B5VA 2GGIA 1U2YA 1B5TA 3CLWA 1H1ZA 1GOMA 2O4QA 5D2YA 3OHMB 2GUBA 5A8PA 3N6HA 1XFCA 1QK0A 2C0AA 3FA4A 2X0SA 2G4FA 3GU1A 1R6WA 2TYSA 3STEA 4QLKA 4K2SA 1XYMA 2VFIA 3O6DA 4J3UA 3QLLA 3QPEA 1XW8A 4YNGA 4XD6A 1JCJA 3KCLA 2NV9A 3TSBA 3IJLA 3BAJA 3WD4A 2YCEA 1DJNA 1VRXA 2V0TA 1IYXA 4BWLC 1PVNA 3UZYA 4OIFA 4J35A 1HJQA 1RVGA 4FR1A 3NPWA 3GH4A 1GOXA 1IZCA 3V75A 4K1WA 4Y7EA 3VOHA 2GWGA 2VELA 2G3IA 2WPBA 4C6CA 4DJFA 4PUMA 5XINA 4MFEA 1TIWA 3OIHA 3PZNA 3BXWA 8TIMA 2XVLA 4XSLA 4PSPA 5AYZA 4H8NA 2EPHA 2VEGA 1HXJA 4NZ5A 1FBAA 2ZX5A 4N6EA 4GYPA 4L4PA 1YDNA 3F4CA 4I9TA 2ZTJA 3BOXA 3B9EA 1YNQA 4R85A 4PB3A 2WB5A 3WBEA 4O0ZA 2PGWA 5EFFA 2TSYA 3OLIA 4TQTA 5AYIA 4PUUA 1KM1A 5CSSA 4FALA 3S9IA 4GA8A 3VK5A 1EXBA 1VFSA 4PL2A 1W3KA 4C6QA 1HT6A 4DXKA 3KBJA 2J7EA 5HNNA 2HV5A 1US3A 2XUCA 3P0XA 3GC5A 4EX4A 5I77A 1HL9A 3C2YA 1RAKA 3PWIA 2E28A 4IGSA 5HMDA 3W7KA 1WAWA 3DH7A 3EDFA 5G4HC 4AYGA 3VABA 1U5HA 3TLQA 2DZBA 4MLRA 3NL6A 3JVAA 1ISZA 2VYOA 1QW8A 1W3IA 2R14A 2YFNA 1KTCA 4O57A 2FTYA 3IVSA 3QF0A 4Q7IA 1H41A 3F7JA 3WLPA 5A3HA 2OODA 2CKSA 2Q01A 5JBDA 3U5UA 2A79A 3L9CA 5F4SA 3U2OA 4EAYA 3BLOA 3VZXA 1EWEA 1RQEA 3W00A 5FJTA 1K8XA 1LL6A 1K3UA 3VIHA 1XC4A 3GHSA 1MEWA 4AZHA 1FWSA 1YNPA 1FWRA 3U8GA 1X1NA 3LPOA 4GK8A 2DH3A 5REQB 3MCOA 3T4CA 4O28A 2D0HA 2ICSA 4ZOBA 1JDCA 3KDOA 2X16A 4WDXA 3WY1A 1QTWA 3MKCA 1L6WA 4BCEA 4C7FA 3RYSA 2AAMA 1E1FA 4HPHA 4FNPA 4JL1A 3GIPA 4MY8A 1GVEA 4L80A 2BY2A 3W1UA 3BCFA 3BUVA 4ACZA 3PF3A 4XBKA 3CV6A 1BF6A 5ABEA 4LC6A 5IM51 2UY4A 1VBJA 3TTSA 1CGTA 3LK6A 4EXAA 3PUGA 1DORA 2WNZA 3NSNA 4URIA 3TOYA 2PRLA 3MVTA 4CU8A 4ZE4A 4QNEA 1O4UA 1ECQA 2XDFA 3BLDA 4XD3A 1UIOA 1YTEA 3LERA 4V27A 4MMWA 5LA2A 1UP2A 1DIDA 2E40A 1O95A 1NARA 5HR6A 2C13A 3ALGA 4FA3A 1VZWA 3ANYA 3AXKA 2ZX8A 4I5UA 5EA9A 1A0CA 1QNSA 4CNNA 2G3NA 4HCDA 5U7SA 3VOGA 2FB2A 4LF2A 3OGRA 4TOQA 2NSOA 2VRKA 1R86A 3O63A 4HSNA 1W0MA 3DFYA 4DO4A 1EP1A 2YSWA 4ATDA 3WNNA 4B90A 2CLMA 3WH6A 1KXVA 3COTA 1VH7A 2ALDA 3UWYA 1W9VA 3MWAA 3T2PA 5T9BG 4NL1A 3NQ8A 3AMGA 3G8RA 4JHOA 2PGFA 1BFNA 1S2UA 2DZWA 4ZQOA 3B06A 1V5XA 2XFYA 3C56A 4RJEA 1CECA 1V79A 3MP4A 4F9JA 3LZ5A 1XX1A 3L4VA 4BR1A 1YNYA 4HMEA 2YW4A 3AC0A 3LBMA 3RN6A 1ODUA 1W17A 4MJ4A 1KTNA 2NW0A 3IPWA 4YYFA 3EOSA 4H01A 4R88A 3E49A 1I9CB 4JQ2A 2DJLA 3GLCA 2FPYA 2HVNA 2X0YA 3LYEA 4PL1A 1RUSA 1CZ1A 2ZVIA 4YLWA 2A3BA 4O1DA 1XDJA 4BY3A 4NJIA 2NV2A 3E0WA 2CFFA 5C9RA 3B0PA 2ZRYA 3MV11 3T0TA 1XLAA 5F2GA 2EO7A 4ZGYA 3VDAA 3AS1A 1KTBA 4GMEA 4V1XA 2D3LA 1JZ4A 3FKRA 1UIPA 3O9NA 2G4JA 5I3KA 2EG6A 4NZ4A 4O18A 2X2YA 2WSQA 3DC0A 3KVLA 3BZJA 4N02A 2PZ0A 2QJHA 1EX1A 1LOSA 1VIZA 1AMKA 4F0KA 2ESCA 1W1ZA 5C2XA 5A6BA 2BXYA 4WR3A 1SQ7A 2I9UA 1UUQA 2EQDA 3ARQA 5M2FX 2PTWA 3L2MA 4U2ZA 1FP8A 4GVGA 3BW2A 2WJFA 3SCWA 3V5FA 2NUYA 4ZXLA 1LL4A 4JX6A 5LXXA 4EK7A 4WQ6A 1IZJA 3GKAA 1BPLB 5C9WA 5F7UA 2O55A 1CYGA 2ODOA 1RHCA 4JKLA 4ZSTA 4M29A 4GY7A 2BNJA 1VJZA 2VC6A 3IGHX 1E43A 3B8DA 4HQVA 1TKKA 1BF2A 1DWIM 3VPLA 3N2XA 3R11A 3F4WA 3N6JA 1QU4A 4LUTB 5D9NA 3ARYA 3ICJA 4LS0A 1UH3A 1CT5A 1MW2A 1F3EA 1ME9A 4ZQNA 1Y8BA 1Q8AA 1LQ2A 4PEKA 3CPRA 3MTWA 5T26A 1KRAC 4AEFA 5D05A 1VHNA 4ZB2A 1GPWA 1Z48A 3FEQA 1EYWA 3BPWA 2D24A 3CU2A 1WUEA 1XQKA 4MJ2A 4WXYA 4FEZA 3MI2A 1WBHA 3SUWA 1RK6A 4J2PA 3W27A 3OGSA 4W7VA 3W9ZA 2PDHA 4D8LA 4YCPA 4CQCA 2DUAA 3H12A 2WJZA 4U5KA 2OXNA 3WF1A 1P7TA 4QE1A 5BYWA 5G2HA 3C0SA 4Q3MA 3CQHA 1L2UA 3WH9A 4QS5A 1JEZA 1W9XA 1BLIA 2DORA 4C6MA 2UWFA 3T8QA 3N04A 4BWLA 3WELA 1G4EA 1SR9A 2WLZA 1YXYA 2DT2A 1A50A 1JPDX 5I3GA 4X9YA 3WQEA 4IIGA 3TP4A 2XVKA 1T41A 3XIMA 2ZADA 2Q8ZA 3SCRA 1L8NA 2BLEA 3VCCA 1FHUA 3IV8A 1GW9A 2JEPA 2QJMA 3BZGA 2ZZ3A 3I3DA 3SCPA 3O2LA 1Q6DA 1YXDA 2IKHA 3RCNA 1JYWA 3Q45A 1ISYA 5BRPA 1LM1A 3USBA 1ONRA 3H2EA 1GCYA 1LP6A 4ORIA 4DBUA 3W7DA 1BTMA 3LMZA 4K68A 4JKKA 3LV6A 1BYBA 4R34A 2RHGA 4Q7NA 3K8MA 4CU6A 3PBUA 3SQMA 2OOGA 3QR3A 4Q4MA 3DOPA 1XUZA 3ZJKA 3A13A 3MC5A 4QCEA 5A8QA 3M0VA 1UP0A 4O0QA 1I2RA 3R43A 4AYSA 4S23A 2YA1A 1VEPA 4LBSA 3G2GA 4CNUA 1WDRA 3C2EA 1LCOA 5A95A 3WEZA 1TWIA 2P8CA 3L21A 3APYA 1OK4A 4OQVA 3QV9A 3W71A 3PUEA 1EZ2A 1XRSA 4CD8A 1LG2A 3HIJA 2E6AA 1VBHA 3G3DA 4UTLA 4PULA 2UY2A 4LVAA 2NZLA 1HTIA 4XZLX 2Q6ZA 2ZDSA 3VNYA 2CHRA 4JTKA 5FCZA 2POZA 2PP0A 3KZPA 4JTCA 2PTZA 4L6DA 3FSUA 2WVVB 4YVPA 3GTHA 3BC9A 1EJRC 5CPMA 3VGDA 1UYQA 2OU4A 1F61A 5D8WA 4JTJA 3GIYA 2WVTA 1XLDA 3S3GA 1XKYA 3UWEA 2QCDB 4NG3A 4QQUA 3ZT5A 3WFLA 1SO4A 1M5WA 3C4UA 2DZTA 4UCFA 1F5ZA 1RK5A 4QR6A 3TONA 2XPKA 4IGNA 4XZBA 5AB3A 3TOPA 2E5CA 1QR7A 3CLMA 2HMCA 3LTSA 4KRTA 4KFOA 2WCSA 4A21A 2CZVA 3HU7A 3E0LA 4EXBA 4QISA 3OB8A 2CKRA 4H3DA 5EB8A 4O8RA 1XYFA 4ZOEA 5GJPA 3CHCA 2WLYA 4PTDA 2R1KA 5JBFA 3WMSA 3AJXA 2FPVA 3TXVA 4PMOA 2HSAA 1LWHA 2D20A 4P8VA 3V0SA 8A3HA 4PB5A 3UZWA 1XYBA 2XFRA 1WA3A 2ADAA 2Y61A 4FNQA 4W86A 3UZJA 4ZL1A 3AMLA 3ZLHA 3E2SA 5D2VA 3NYZA 4DBWA 4IT1A 1F2JA 2OOFA 4ADTA 4UB9A 4TIMA 4H2HA 2ZVRA 3MMDA 3NNTA 2X40A 3REQB 2Z1VA 3EXSA 1W1IE 3D3FA 3EXTA 1B30A 3S83A 1ZSXA 4RXFA 3SCSA 3UF9A 3PZMA 2YL6A 4L4MA 4GXWA 3V0UA 3RGTA 3U2CA 1JDFA 1TE1A 4NASA 4R9OA 2Y5SA 1ADOA 3FIGA 1TQJA 4UNIA 3TE9A 2EEXA 1E72M 4J27A 4XISA 1XCWA 1D7KA 3AROA 3VNMA 1RSCA 1WO2A 3R0DA 1XGEA 2Z1BA 5KITA 3DFHA 4WSJA 2X1RA 3AAMA 3B40A 1TE6A 3W87A 3IJIA 4GI9A 1KFWA 4E2VA 5HMSA 1FCUA 4HMNA 4GKTA 4PMVA 3D5HA 3K8KA 2ZA1A 3GG1A 1ZL1A 2Z27A 4I5RA 3W7NA 1RZMA 5CJNA 3I6RA 3R13A 1MQRA 1UC5A 3ZJ8A 2AL2B 3HG3A 4FSAA 2RJGA 2BG5A 4YVVA 4IH3A 4OUIA 3HPAA 1ICPA 4MYAA 2VCBA 4HPGA 3ABQA 5TNVA 4JTQA 4PMYA 3TW7A 4A8RA 3W7PA 3AHXA 2GDQA 5GJMA 3LSCA 2PE4A 3TUUA 2YFOA 1VPYA 2VT0A 3G1FA 3CB3A 2ZX7A 3VINA 4C90A 1EQPA 3FKKA 4P5UA 5I23A 3WL1A 1D8WA 3TW6A 5XIAA 3IVUA 5AVNA 3GAKA 1ONEA 1XIFA 1X1OA 3OG3A 3C8NA 1UHVA 2QULA 5FACA 3SEPA 3EWBX 3EX1A 3I4EA 1MQQA 1N2VA 1IEQA 5JMUA 1MNZA 3V5CA 3IK4A 3R0UA 2C7FA 1XBVA 3P82A 1QPRA 2PDUA 4HTYA 2QLYA 3D6NA 1C9DA 3K46A 3VNLA 4HT3A 1QI4A 4C7DA 3WCZA 4QS6A 2CW6A 3MI3A 2XWDA 4J40A 4JY8A 4PCNA 1PAMA 2V5KA 3MDWA 2E6FA 1RV8A 1AQMA 1EOKA 1TYGA 3H7UA 1KGUA 2GJXB 3BGAA 4UTTC 3LS9A 4F0HA 5M03A 1KM3A 4XTDA 2J6VA 2IPGA 5FJUA 1G1YA 2OWWA 2PGRA 1UOZA 3UR2A 4S3DA 3T09A 4TMCA 4DWSD 2XSAA 3ZSTA 4YCOA 5EMYA 1JAKA 2OT1A 4R33A 2I7GA 2D1ZA 2WK2A 3RR1A 1LLOA 3TNOA 2NWSA 3WNPA 2YL8A 1TV8A 4IFKA 2J7DA 4ZCWA 2Q3RA 4GZJA 3BMWA 3T2OA 5JQ9A 2WJEA 4LB3A 2E7FA 3TYEA 1RJRA 3O8AA 2V9DA 2AOSA 3NURA 4RR4A 2VFFA 2C14A 4GO9A 3KAOA 1HKMA 1J9YA 5KZDA 4HKPA 1OFAA 3KBWA 4NZ1A 2G3JA 3W88A 2Z2BA 3E2QA 4LEFA 5F2IA 4E4PA 4MY9A 3E3HA 1EP3A 3DFSA 2DUZA 3CYJA 5AZ1A 4NVTA 3WFZA 1G4SA 1HVXA 1C7SA 4KCUA 5LXEA 2YB4A 2A3HA 4XB3A 3ZO9A 1CPUA 2OEJA 4HD5A 3S9ZA 1KFKA 3GDTA 3I3BA 2FTWA 1IZKA 1FOBA 1QPQA 4GLEA 1R3TA 1XWYA 5A8OA 3NDOA 1FWAC 3FFSA 3S8HA 3QV7A 1N55A 2DZVA 2V5LA 4NAEB 2B81A 4EAMA 2NUXA 5AHMA 3UXAA 3FCPA 4GI6A 3O1NA 3BV4A 1DP0A 1S2AA 2XN0A 1OM0A 3WUEA 3TQ0A 4OGZA 1K4GA 3WJZA 5KZMA 4GH1A 1YDVA 4AEEA 4QJ5B 1D2KA 1SU5A 3UNTA 2OQHA 3N2BA 4KWSA 3T44A 4YWIA 4B5WA 3Q2DA 2IQ0A 4EPEC 1POJA 3LLFA 2WQPA 1E6SM 2CNCA 4DO5A 1BWKA 1C8VA 2B7OA 4D8ZA 2VURA 3L4TA 2ZOXA 1ZBKA 3U5YA 3LZ3A 2FKPA 1TREA 4JPGA 1CXFA 2Z1KA 3HOJA 4RZ5A 3IIPA 3LCLA 1FWHC 4EKJA 1WAUA 3RLHA 1ZJHA 4JAWA 4RZ6A 3QGKC 5BRBA 2OB3A 1XDLA 1F73A 4U28A 2JE8A 3OZOA 3AS0A 3CL7A 3MUY1 4F0LA 4ML9A 4XK2A 3VVGA 3BAKA 4XV0A 2W3ZA 3GWQA 1CXLA 2BV9A 2P8BA 1WKFA 4AD0A 4YVXA 3VNDA 1TPB1 4MSSA 1W1VA 2ZE3A 4A8LA 1BEUA 1TTIA 1GOKA 4ZENA 3B4UA 1GWJA 2FMNA 4C6KA 3UG4A 1TQXA 3URBA 1X96A 2WOQA 4CQDA 1V6XA 5CXPA 2PTDA 2QUNA 3BTNA 5HK4A 4DYKA 4AD2A 1ZHAA 3GR8A 2YCKX 5I24A 3ABSA 1VBRA 1Q5MA 4C6IA 3ONCA 3GO2A 3EKGA 3N2MA 1FWCC 4BHYA 1I4NA 4LUIA 2O56A 3C2FA 4FLQA 2O92A 1PIGA 1QW9A 1LUCA 4QE4A 3VD4A 4UFHA 3LXBA 2PUZA 3GTXA 4V1YA 1A4LA 1UJPA 4K38A 4DF2A 3CUZA 4LRSA 3E74A 4ZTYA 5B7YA 1VCGA 1V02E 1NDWA 4FXFA 3QTPA 3LU2A 4FO4A 1IIGA 2PDMA 1O5KA 2ISWA 2OYKA 2TMDA 3NQAA 3U57A 1IGWA 2H3DA 2JK2A 1IEWA 3AXXA 3HTWA 4K1GA 3NA8A 3QY6A 5F1UA 4PC8A 1QHZA 5AYBA 1E0VA 4O14A 2VEFA 1UWUA 1JRBA 5C9ZA 1VFTA 3M1ZA 4PCSA 4QROA 1S2CA 3EEGA 4L9ZA 5F1VA 1XH2A 1OFEA 1FDZA 1VFFA 2OGYA 4NIRA 4UWMA 2OYLA 3FJNA 3BAXA 3NQ7A 3MY9A 4LWWA 3TJLA 3UU0A 4FP1A 4KCVA 3QV8A 3WUBA 4ADSA 3GW3A 4M5PA 1UOKA 5K4XA 3TWAA 1ZAHA 3HFTA 2VZVA 3RF9A 5C6MA 1FWBC 4OJYA 4HZ6A 3UA4A 3BOFA 4ZB0A 2CZFA 3WQ8A 1E71M 1R9XA 2HROA 5AHLA 1XG4A 1ZBVA 1XG3A 1U1UA 3ARZA 4FAMA 3IEBA 1TPH1 1V3LA 1O7AA 2ZXDA 2XJ7A 5ABFA 1V6TA 1PCWA 1W8SA 4PMJA 1XI3A 3GXNA 3TZNA 4F0SA 3W7QA 1KV8A 3GC4A 2FH8A 3F5KA 4ERGA 2QJIA 3ZLFA 4I9MA 1UW9A 2ACUA 3LLXA 5C55A 2BBFA 2FGBA 1S39A 4CD5A 4UTKA 2CLOA 1NOWA 4S3GA 3H2NA 3IAPA 4JTDA 4PR4A 2JKPA 3B8WA 4YTQA 2DU2A 3OA3A 3G1XA 1WZMA 1VYPX 3YPIA 3K30A 1FA2A 2X0HA 3M7WA 1FHVA 2FZ9A 1V4YA 4DQWA 3GG8A 7REQA 1Q8JA 4HZ8A 2OZ0A 3UYCA 1CB7B 3WMLA 2BB0A 5JH1A 5I7GA 1PZ3A 1QOXA 3FEMA 1TR1A 4W5ZA 1AMYA 2PWUA 4UOJA 1CDGA 1IT8A 1DE5A 2BY1A 1E1CA 1HUVA 3VM7A 4G1KA 3DZ1A 3AYSA 1SJCA 1UJQA 2VX6A 2PDNA 2VENA 1KFLA 1IXPA 2NQ9A 3W6LA 3WK0A 1PUDA 4DJFD 2OX1A 2PCEA 5CLTA 1LWJA 1R38A 2VGBA 4FX7A 2OQYA 1OSEA 4M56A 3CZJA 1VEOA 1WDWA 1NVMA 4DBDA 2XIBA 4UTTA 1A5KC 4HP5A 3OBKA 1QT1A 3QQWA 5CC3A 1U1HA 3FA5A 4Q8WA 1DWJM 4C1NB 2WANA 2QYGA 4J3VA 4V2XA 3P14A 4PMXA 4HNCA 2QEZA 4AWSA 4PB4A 1G67A 1HKWA 1VQTA 3VXGA 1ITXA 4LTSA 3QMTA 2GVEA 3T81A 2VZOA 2YR1A 3B97A 2CLFA 2Z2UA 4JHMA 3AQUA 2F7FA 3N14A 5D2XA 2ZXBA 4XX6A 3CUHA 3ECQA 4IIFA 3B8SA 1AD1A 2DT3A 3GXTA 3BW3A 3M64A 1FTXA 1BVZA 2H3BA 3Q65A 4UZSA 3T6CA 1VKFA 4JFTA 1CGVA 1XLJA 1XYAA 2VFDA 1WE5A 2ATSA 4KWOA 3UA3A 1QUMA 1VCVA 3W81A 1UMLA 2OKOA 2Z2AA 4O53A 5D09A 3W1XA 1XYCA 1ITUA 1EH9A 4KW2A 3MHUA 2ZX6A 1KLZA 3UG5A 3W1RA 1JL8A 3G1HA 5BXPA 3MZNA 1L2QA 4BA0A 3EYPA 4G9PA 2BS9A 3HV8A 1FY6A 2PSNA 1P0NA 1GKRA 2CBUA 2J78A 4CNPA 3FJLA 1TELA 1PEZA 3WQVA 4PH6A 3S2LA 1RBAA 3LI0A 4YMZA 3GH7A 3B9NA 4XBSA 4WZHA 1E4LA 2C16A 4RX0A 4LSBA 2A7NA 4OV4A 4IFRA 3FJ4A 4YTRA 1XC6A 1U83A 2RDTA 1UD6A 3IIZA 3JZEA 3EXRA 1SPQA 1GGOA 1Q6GA 3MP3A 5TQLA 8CGTA 4WEVX 5CZKA 5I3HA 2WMIA 4XAZA 1SFSA 4B5XA 1BYAA 1H1NA 3TFCA 1Q6FA 5C54A 1UD3A 2IW0A 1S1RA 4LANA 4HCHA 3ORWA 3W01A 1RD6A 1OABA 4OVXA 3M4HA 4QM1A 3GNXA 4H6QA 4X9SA 2J7HA 5BU9A 2R1PA 1FXPA 3A3WA 2XIIA 1SO5A 2QDHA 2VJXA 3W2LA 4GHRA 1RPXA 4NJKA 1HKKA 1Q3NA 1D8CA 1F74A 1W54A 4XAGA 1IWAA 3L7RA 1MZRA 3LX9A 3UXKA 1XIBA 3BJTA 4X60A 4ATWA 4H8HA 3L0NA 5KSWA 1UD5A 5C70A 3AS2A 1DTUA 4IIHA 1NSJA 3HJEA 3J7HA 4S2CA 2FZBA 5A6AA 2I5IA 2VUYA 1DHPA 4CQ9A 3LNPA 1TVLA 3HPXA 2FZDA 4JIIX 4RNJA 3GXFA 3KZSA 2O9OA 2RDWA 4GGBA 1ONWA 4AY8A 3OP2A 5CJ5A 1JPHA 1I1WA 3W70A 1IXQA 4PFHA 1UPMB 5FJRA 3MSGA 2DSKA 3WLSA 2QIIA 4E38A 1L6YA 2X7VA 3RRAA 1P1MA 4GUFA 4MFDA 1VD6A 2PODA 4BEUA 5F4WA 2E09A 4DWDA 4MB3A 2W0UA 1J12A 3VIIA 3W7IA 3URQA 1H49A 4HPJA 3WLJA 3THDA 1PHQA 2A5HA 1JCNA 3EZ4A 4GXMA 1Y5WA 3ARWA 5D2TA 2YXXA 3BICA 4GKLA 9RUBA 2FMOA 2ZA3A 2J24A 4E3VA 3S0CA 2W5FA 1ODZA 3VIFA 2X41A 2X42A 4PMRA 3CIVA 5A6BD 1H63A 3CJPA 4RV3A 1A4MA 1EEXA 5TD4A 2VO5A 4L56A 6TAAA 1EJ7L 5AHIA 3W1PA 4IMFA 4HU4A 3ELFA 2Y63A 3ZS4A 3LG3A 3W28A 1PZ0A 1FWEC 4IQLA 1O6IA 2YW3A 4CQBA 2Z1SA 2A3EA 2P50A 1JF5A 1W1TA 4TMBA 4G5DA 4H04A 4RZBA 3BANA 1KA9F 5J5RA 3USZA 1SW7A 3GD6A 4IG2B 5I02A 1WKDA 2ZXAA 1UKSA 1EA9C 4ATLA 3HN3A 4BQ5A 4ENLA 2EJ1A 4H9UA 2VD9A 1PV8A 2WYSA 1BRLB 2A0NA 2VFGA 3SJ3A 3DYOA 2BHUA 2GGJA 2B31A 3W84A 3QRHA 3QYSA 4WUIA 1WOBA 2PDXA 4D6GA 4F0RA 4O1FA 1KCKA 3RXZA 1EPXA 2FZNA 4NJJA 5HPOA 5T8GA 5AVHA 5AYYA 4O17A 1SGJA 1W3JA 4KKXA 4TTGA 3QPYA 3XISA 4UFJA 4XZMX 4A35A 4NXKA 1VGAA 1C3FA 2GLKA 3RX2A 1QNPA 1EFZA 4IIBA 4BQ3A 3HJZA 3VD5A 1J0HA 2NT1A 3UYIA 2QUUA 3E12A 3WLTA 4D6IA 4K8GA 5FL0A 3BWWA 3NQCA 2DIJA 6XIAA 4A22A 1UWRA 2WKGA 1PBGA 1FCVA 5A2AA 3W7CA 2CXGA 3W6YA 3WLMA 3RITA 1XLGA 3ANVA 2WSKA 2XN1A 2A4AA 3BW4A 2O9TA 3QN3A 4RDZA 4MKNA 3GH5A 1DWHM 1QNOA 5GPRA 1F3XA 3EPOA 2F6KA 4UR9A 5K3VA 1EC9A 4E0CA 2GVGA 3H22A 2VL4A 3TTEA 1AL7A 3NQ2A 3A4WA 3OBEA 1GYNA 4V15A 5DY2A 3IGXA 4GNKB 2QNEA 1OGSA 2DIKA 3NO3A 3CUFA 3SAZA 2TPSA 2DY3A 1IE7C 5JH2A 3BAWA 1MW0A 5FKYA 2F84A 5GNYA 5G4WA 1HJVA 1YADA 4A6GA 1U5VA 2GK1B 5D9OA 3WYZA 3SURA 3TLLA 3A21A 4RLIA 1IR2A 4I9JA 4E6MA 3HGOA 7ODCA 1WKYA 3GC2A 3GDLA 3Q37A 3W26A 4IQJA 4TX6A 4JFUA 3EDEA 2ZUWA 1UQYA 1KW1A 1WB0A 4C91A 2PGEA 4KT2A 1O5RA 4MNJA 2FYMA 3BGGA 3FYYA 1BQCA 3H8AA 1DJIA 1OGBA 3AU2A 3UWZA 5HNUA 1I0BA 1ICQA 4L9XA 3UJ2A 4Z42C 5H6HA 1H5YA 1XLCA 3HGSA 3PWAA 1H62A 3N4FA 3T55A 5FEXA 2REQB 4J4KA 1JVNA 2XIMA 1TX0A 4MNKA 2EPLX 4QDWA 1JZ3A 3L23A 1ISWA 3GBEA 3BV7A 1OFDA 4V33A 4B4HA 2VEIA 1L9WA 4H41A 1H7NA 3ARSA 3CWOX 5LKYA 1TTJA 2VUNA 3GAYA 5FD0A 4LUJA 2YJQA 3UJSA 1KBIA 1S3TC 4XUYA 4KQNA 3KLLA 5E0FA 3O7UA 1FWWA 2OWCA 1YLVA 5MHBA 1A5SA 4UQBA 2YB1A 4M8UA 3VMPA 1BVWA 3U2ZA 3GYEA 1C8YA 1LWIA 1NEYA 1V6YA 2WCGA 4UFMA 4PTMA 3BE7A 4K8EA 3LPPA 5HBFA 1XCFA 1NFBA 2OVLA 2ONEA 2HVMA 1SZEA 3KS5A 2PBOA 4GY0A 3RX4A 2XN2A 1P6CA 4MNMA 4R5EA 4WKHA 3TA6A 3C5QA 4MAVA 3T07A 3B4YA 4M24A 3LHTA 3PNUA 3QH2A 3GNDA 1TTQA 2PWDA 4B4FA 1NDVA 4EXQA 4JQ1A 5IHSA 3GHRA 4DM1A 2VX5A 3C2RA 5D33A 2GYIA 1Z8AA 2VR5A 5HOSA 3VIMA 2H6RA 4REQA 4E5TA 4N9EA 2PAJA 2ZKMX 1K6WA 3SUUA 1PDZA 2VI0A 1VS1A 1OVDA 5CQ1A 4DM2A 4EVZA 3FDGA 2EPOA 2F2KA 4QG6A 3CZKA 3W7JA 2EKGA 3ATZA 4K8HA 1SZFA 3BO9A 4GUJA 1TV7A 1W3TA 4C7GA 3STCA 1WP6A 3IACA 4J7RA 3CZEA 3QTGA 3GG7A 1E5NA 4CUCA 2PD5A 1GOOA 3NM3A 3ZQ9A 4G7EA 4U10A 1S5WA 1RVKA 2FGLA 3QQ0A 3AZTA 3E6EA 1OIFA 1GVYA 1TPWA 2ANUA 5I78A 1PXGA 3S5OA 1S5MA 4E3TA 1B3YA 1DXFA 3L2IA 1RR2A 3N9KA 4IJRA 5DANA 4J3WA 1UASA 3GZ3A 4NAFB 3LGEA 3GM8A 2PDFA 3CASA 4KETA 3ITYA 4QJ3B 1ONXA 3BCDA 1V8EA 1I75A 1QK2A 1EOMA 4W88A 3VD3A 1CNVA 2WBGA 3E0VA 3HA1A 3WLHA 5LHEA 1VC4A 3H55A 3BOLA 1C91A 4LYQA 3CH0A 1ZAIA 5LGXA 4Y8EA 2QCFA 4Q8MA 4QE5A 1DXEA 3H2CA 4UTMA 1IEXA 4DLMA 1V77A 1EB3A 4PCTA 1FWJC 2YLAA 3N73A 2Q71A 2UZ9A 3C52A 3ZM8A 3NTYA 2IXVA 4K7VA 4M0XA 2PS2A 1M7PA 2GQAA 2L5HA 1QFEA 1R47A 4IF2A 4C6NA 3FS2A 3I3EA 4RE0A 5LNUA 2TAAA 3VMNA 3VUSA 1K77A 3AO0A 3N12A 1TV5A 4EP8C 1HL8A 2Z24A 1XBXA 3SO7A 5IBXC 3C0LA 2ZXQA 4D2JA 2J7BA 3N3MA 4MLJA 4LAZA 4HB7A 1W31A 4S3KA 2VZUA 4UNKA 1GVQA 4GQBA 4JX4A 4PRTA 1JZ7A 2I14A 3W0KA 1AQFA 1VPXA 1DOSA 4S2BA 1M7JA 3W82A 3LCGA 1ZCCA 1EQCA 2BDQA 3G1AA 3PJUA 2PDJA 4IJBA 3AXMA 2ZUVA 4HIBA 4Y9MA 4JFVA 4Q8UA 2YDSA 2GGEA 2DPEA 2QVNA 2PRMA 4LC8A 2R9RA 3N9RA 2DZSA 2VWTA 3PZ9A 4M19A 4HA0A 1IEIA 4YJ5A 2C6QA 2FHFA 3NQEA 1ZNNA 5H8MA 3VCNA 4S3CA 3MPGA 3PG9A 4Z2KA 1JYVA 4Q8PA 4GNVA 4AH7A 2ACQA 1P0EA 2QHAA 1V02A 1TCDA 3SB0A 3N19B 2V6AA 2GVYA 2RJHA 3W1MA 1ITCA 4U4MA 4YN5A 3SSJA 1KXHA 5D9MA 3GU9A 4AQLA 3GVGA 5IDIA 3SN0A 4H1ZA 2I5GA 2XH2A 7XIMA 4AIBA 3TTQA 3LM3A 2INZA 4MKSA 1T96A 1XXXA 1UMYA 3K4DA 3CMGA 4R7JA 3KRBA 4RXGA 4H9TA 1UC4A 2ZZ4A 2QVHA 1K8CA 4ZOCA 3W38A 3MYPA 4UQCA 2HRWA 1A5OC 2RAGA 1XISA 4TV6A 1B4KA 2AMGA 2Z28A 1XH1A 3EX2A 3QHOA 1XL9A 5E70A 4TXEA 5DRIA 1Z32X 3S5SA 1FHLA 2PF8A 2VOMA 5A5WA 1W8GA 2QIWA 4QLLA 1THFD 2OJPA 2E77A 2EF9A 5CZTA 1KD0A 5I3IA 2DZPA 3R94A 4KBXA 4RNHA 3EB3A 1RD5A 3WLNA 5B80A 4O15A 1EEPA 3G24A 4WY0A 3VKKA 3W7OA 3RUBL 3AXIA 3KDNA 5AZ0A 1V3IA 1RA0A 5L6UA 5GQBA 3PJTA 4PN2A 3INPA 4ILSA 2ZQ0A 3C3NA 4MWAA 3W25A 1UUOA 4I7WA 1MRAA 1KCXA 3F5JA 2V3DA 2YLLA 4XTIA 4PTVA 4R7WA 1FDYA 3U6WA 4WJEA 3SUVA 3VKCA 3HMCA 3A24A 3I4KA 3QMRA 3S47A 3S9YA 4WY0B 3NQVA 3PWGA 1KBJA 3M7SA 4PSRA 3TQVA 1OT2A 4FIQA 3MZ2A 4JNZA 3KVMA 5DT7A 2CC0A 3RJYA 1Q85A 5CPSA 3UT0A 1JRCA 3ATYA 1E6XM 4FX8A 1KKOA 1A49A 3PUDA 5E6YA 4HU8A 1NIUA 1MRQA 2PDGA 3SRDA 3P67A 3U3HA 1DIKA 3VKDA 4IPJA 3AI0A 4JIPA 3HQOA 1U33A 1TMQA 1GYMA 2IXUA 3MMTA 3AIEA 3H2AA 3GNOA 4N4QA 1UBSA 2IPFA 3O16A 1DWFM 4JDYA 5CPTA 2NXHA 4XO7A 4H19A 4Z2LA 4GABA 4E2DA 1ZQ5A 5KETA 4ZODA 1VRDA 2YL5A 3W2MA 1RBOB 4JFWA 5CPNA 2GDVA 4J1OA 1AZ1A 3TYBA 5LNSA 2VCCA 3SI9A 2VOTA 1HGYA 1XJBA 3PN8A 2A2IA 1QASA 3M0IA 3WQ6A 1R0MA 1V51A 4PE8A 3L0KA 4XSMA 3DG6A 2OZ3A 2PEVA 4UOZA 5EMKA 6A3HA 2JIWA 1CGYA 4BEQA 3LHYA 3MB9A 4Z1BA 1G7VA 1MO0A 1K1DA 1CLXA 4ORMA 1AJ2A 3NZPA 2HXTA 3E38A 3NQ6A 3W2NA 1NDYA 2WMHA 1CXIA 3E2VA 3T2QA 4H00A 1K7XA 2PFHA 4DWSB 4KCTA 1JPKA 3P8IA 3NR0A 4WXZA 3MU7A 2XVGA 3BG9A 2DT0A 1JGMA 4JICA 1Q4NX 3PZVA 4RW5A 2OMAA 1UR1A 1NP2A 1OK6A 1DE6A 4B5UA 3OHIA 2J9XA 3IJ7A 1XRTA 4MZ1A 4MB5A 4WGHA 4MUZA 5FSDC 3HGJA 2PDQA 2J8GA 2PRHA 4ZQMA 1OG6A 5RUBA 2BFGA 3NZQA 4PTNA 3SUSA 3BSHA 1AW1A 4B9YA 1JNEA 3MHFA 4KEUA 1CLKA 1O60A 3VIGA 5MKGA 3IVTA 1F3WA 2E5BA 3NSXA 3FGCB 4NI3A 3ABZA 1HW6A 1R9YA 1EJXC 2NVCA 1XLIA 3VI2A 4UTUA 1Z9AA 3NQBA 4IIEA 3VNIA 1TVPA 3NL2A 2OR2A 3CPGA 4HHLA 4UBPC 4GD0A 2OPJA 2P0IA 4KEMA 4LXFA 4AVFA 3A64A 4B91A 2WCAA 4HVXA 1EGMA 2D0FA 4PFMA 1P43A 4PZVA 2BASA 1RJPA 1SW3A 3PTDA 1L8PA 3CV1A 1J8VA 5EMJA 4MB1A 3P3BA 4R7OA 5AYXA 5A8NA 1IQ8A 2ABBA 3M16A 4Y96A 2QGHA 1OX4A 4I6KA 4XG1A 5FF3A 5JU6A 1LORA 4P8XA 2BSLA 4K7YA 3SSZA 3WQ4A 1E3ZA 1S2TA 3VGGA 1NQKA 4KRUA 2HQAA 1E6RA 2C91A 2VXNA 4ZR8A 7ENLA 2CLPA 6REQB 3TDFA 1BWVA 1NDZA 1NU5A 2W62A 2GZXA 3M9YA 3NVDA 1NWTA 1FCBA 4YTSA 3QV6A 2H9AB 2GWNA 5ECVA 5I2UA 3R89A 2XZ7A 4GGHA 3SFWA 5K2ZA 1MFUA 3AHZA 4FF5A 1ZAJA 3MYOA 2WSRA 4ONVA 4ICMA 3GDMA 1W3HA 4DHGA 2IKIA 2X1IA 4NHVA 4O16A 2ZZ5A 2GVLA 4KIRA 4A8NA 4BI6A 3B0XA 4GJ1A 2CZDA 7PTDA 1NOFA 2W79A 3GSMA 1DV7A 1TV4A 1RP9A 5G5IA 4GXPA 1E4IA 2V63A 3QW4B 3VIPA 1C8QA 3ARTA 4QP0A 4XKYB 5IBXA 3WF4A 1VEMA 4EPKA 3WLKX 3F2DA 4IISA 1MSSA 4GI4A 2YCIX 2FH6A 1TCMA 4L61A 1Q65A 5C71A 1E0TA 3EBVA 4PUWA 1XBYA 2VR4A 4KEZA 3WH5A 3LI1A 4LQ1A 2KAUC 2ZRUA 1E6ZA 4CCCA 4PTXA 2V69A 5HMEA 4N9CA 3VDCA 4FS9A 4LJ3A 3NM1A 5G1YA 3KL3A 1D9EA 3UXIA 3EX3A 4PUKA 3NIYA 4IMCA 1UWQA 3VKBA 4XKMA 1DJQA 2DW7A 3QGAC 3QBUA 2Z00A 4Z1AA 1JZ6A 2BOFX 1SFTA 5CG0A 3GHTA 3URAA 3CEPA 4PUDA 3P5ZA 2V5BA 2ABAA 5DLCA 3WJXA 3KL5A 3VDBA 1UKPA 2DUXA 1Z41A 1L6FA 3LCWA 3DGRA 4QGCA 4AF0A 3CAVA 3M47A 4WSKA 2HVOA 2C79A 1MI3A 3LDVA 1U5JA 5HWMA 1IXOA 3QKEA 3F2CA 1W1YA 3NQMA 1AW5A 2ISFA 5CEWA 2J25A 2XGZA 4H83A 2NXIA 3GNPA 5I09A 3VGEA 4LYKA 2C71A 3MKKA 5BMWA 3VO0A 3VMOA 4ZO7A 3PR2A 1K7FA 2WHKA 2Y8UA 4JTIA 1WDPA 1O68A 3M0LA 1JCLA 4KS0A 4HCLA 1GJWA 5HJLA 2AGKA 4HMDA 3K4WA 4UR8A 1PO9A 3F4DA 2GUUA 4KWWA 2YL9A 1UG6A 3LENA 3CUJA 1H7PA 2X05A 3ID7A 3N17A 3H4XA 3QLDA 4H9ZA 4LYPA 4DAIA 2Y8KA 3C8FA 1PX4A 2P3EA 1E70M 1GKPA 5H8UA 3T1GA 1HZYA 2HBXA 3LRLA 3P62A 2IQTA 3V36A 1Z3NA 3DC8A 2NVDA 3CEUA 3TK7A 1EJSC 1WV2A 3KHDA 1QNQA 1XLFA 1TUFA 3I7SA 1AQ0A 1J6OA 1D3HA 3SCOA 4DUVA 2NX3A 4FNSA 1BSLA 3ARPA 3T08A 4PUNA 4C6JA 4Q4SA 4WHBA 2I9EA 1AFSA 1DJWA 4PTWA 2GVJA 1ML1A 2PC8A 4X22A 3NOYA 3HPFA 3FNDA 4E4UA 5DN1A 1J6PA 2BMBA 1UKTA 5FEPA 1F9CA 1EF3A 3EAUA 2QCNA 4EWJA 3U7BA 3BG5A 2O9PA 1POKA 1Z42A 3BLPX 2OCZA 3NXLA 4EWND 1E55A 1CW2A 2BVDA 3R8RA 1SW0A 4P2VA 3SECA 4EIVA 3EEZA 2VWSA 1XLLA 1W5PA 1K9DA 4RNIA 3ARRA 4N2YA 5CPQA 4M1RA 2EAWA 4PA8A 4OKDA 4TVUA 2OQLA 3FOKA 3W24A 5JBEA 1X6UA 4Z1CA 4FNRA 1TMLA 3BK0A 2FVLA 1PIIA 3PB0A 4L4OA 1BSIA 4LCRA 3S1GA 2QAPA 1QOPA 1A0DA 1PYFA 5C5YA 1QBAA 5HATA 4B3LA 3WK3A 2ZICA 4R9XA 1A0EA 3M41A 2VFHA 2PCQA 4O19A 4YTUA 5AOUA 4PYSA 1RPKA 2I17A 1J5TA 1UH2A 4OBRA 2OEKA 1DTNA 3W07A 4TX8A 1EDGA 3A3XA 2C0HA 1AD4A 4CD4A 4DI8A 2Z6IA 1XFBA 2UY5A 1HG3A 3EB2A 3VOFA 4AY1A 4AD3A 3E0IA 2JGYA 2VEKA 4U31A 1KQYA 3H53A 4LPCA 5ABTA 4Y9OA 1TR9A 3NEHA 4UQEA 4H7CA 1XD1A 1MXGA 1JCXA 3CUXA 2YX0A 4D6JA 3ZVIA 3KVKA 1GQLA 1A5UA 3VOIA 2WNWA 1WKEA 4R53A 1UR4A 4LF1A 4JCLA 3E5PA 3TQKA 2A21A 3ARUA 3W6MA 3WF0A 4U5IA 3B8TA 1TJ1A 1PX3A 3GDBA 3AYRA 4HA1A 3WG6A 2DV0A 2QGYA 4J3ZA 3EDKA 3OEXA 5LA1A 4IPPA 4DYJA 2A85A 5IRPA 4GVFA 3IWPA 2JBMA 3WF2A 2A7RA 2VR2A 3ZFHA 3FVDA 1RY0A 1QHOA 5AC6A 1P5BA 2F38A 3IRDA 2BGQA 3DG3A 1V6WA 2VD8A 3DYPA 3HB9A 3KFTA 2X1TA 2EPMX 4JGDA 3GDKA 2CLLA 4M7SA 1P1XA 1XIJA 1LROA 1C29A 1H60A 2BY0A 3NUKA 2E0PA 2AMXA 3P8JA 3BVJA 4L1GA 1J0KA 2WNNA 1WZLA 1H61A 5HNRA 4D1JA 4JYFA 5A6SA 4J2MA 3ALFA 4XO6A 1AG1O 4GYJA 2JALA 2PDWA 4ACZB 4OOUA 3FDKA 3MDUA 3RPMA 3XINA 2GDUA 3TROA 4DUOA 3NVTA 5BNKA 4D71A 3MV01 3WSUA 4AISA 3UBPC 3A4JA 3QSRA 3EWXA 4QHRA 1LYXA 3GVQA 5M3WA 3POHA 2DSUA 4W5UA 3DAQA 2FIQA 4JTSA 3W75A 3MMUA 1OFQA 1D3GA 2E25A 2A3AA 4F2TA 4IQDA 3APGA 3QZEA 2BVTA 2W9MA 3EKZA 3HQPA 5KEZA 1LF1A 1ZP3A 5C7VA 4RCXA 1LDCA 3W3OA 5D38A 3R2GA 3H23A 2VDIA 2QJJA 3UNDA 4GACA 2E4TA 4AXKA 1XF0A 4HNLA 3EOOA 4JTGA 3KTSA 2IQDA 2QPUA 1V6VA 3I10A 1E0UA 4HYWA 1PS9A 1CLVA 3LGDA 3AUJA 5B7ZA 4RDYA 1MW1A 1HN1A 1JF6A 2E68A 1OX5A 4L4LA 3MWCA 1IHIA 4DNHA 2VZSA 2PWVA 1PZ1A 3T9PA 3TZFA 2J6XA 3RX3A 3SCUA 3AMKA 3CV7A 2SFPA 1KRCC 3TN3A 3HG4A 3TCSA 4ERIA 1UR3M 1M6JA 4OBSA 1NP0A 1V0KA 1BTCA 5HA7A 4F4RA 4IOTA 3BCJA 2TRSA 4DJDC 3DFOA 5EMUA 2PB1A 1EPVA 4A3YA 3EWCA 1TMHA 3ZT7A 1QPNA 3CQKA 1W1B1 1IT7A 3TR9A 3RLUA 3WLLA 4WCJA 3TYCA 4H9VA 2G96A 3MO4A 4IQEA 4FOJA 2Z0IA 5DCBA 3N9SA 2VZTA 4M81A 2WHJA 1XSKA 4LCSA 1P6BA 2EG7A 4TO8A 2FLIA 4US6A 1S2VA 3G6LA 4X63A 1GYLA 1REQA 1IWBA 2FDMA 4CQAA 3LBOA 2QF7A 3K5XA 1Q6OA 1FVPA 4BF5A 3RLGA 3CZ8A 2Q3OA 3WMBA 3DX5A 1JQXA 2WPGA 2NQ5A 4JOMA 4NJHA 2VEPA 1BQGA 2W63A 3E2RA 1R3RA 4TX9A 5J8LA 2V8ZA 3AIRA 1WNOA 2F9RA 1R5YA 2XFFA 4JBRA 2DSZA 4GZEA 3W1AA 2PI6A 2VM8A 2I56A 3ZZ1A 3KHJA 2VNCA 4OZOA 3KRSA 2WO5A 3PY2A 4PMUA 3H2FA 4W85A 3GIQA 2PF0A 3IAQA 4BF7A 4DX3A 3OG2A 2R94A 4N9BA 5JXQA 1HJWA 3QZ6A 4JNYA 4LGXA 1M7XA 3I6EA 3WLOA 4P61A 1CI1A 3W7EA 3OYZA 1UBPC 4HMCA 1HJSA 2ZRVA 1U1JA 3WDQA 3W37A 4IWWA 3SRKA 5FL1A 1UR9A 5FEWA 1OEPA 4U33A 4PODA 1HKVA 3UG8A 3PBYA 3N11A 2QXWA 3GK0A 3QY8A 4L9YA 4Q4RA 1P7TB 2VHLA 3LHVA 3N29A 1J0IA 1R9ZA 3M5YA 1PZ2A 1B2YA 1IT0A 2GSHA 4U2YA 1T99A 1TA3A 4JCMA 4DELA 1H11A 5D2WA 3EMZA 2QDDA 1VYSX 2R6OA 4O4WA 1TFVA 2VGGA 2CWNA 1PWMA 5CLWA 1H3GA 3LD5A 1V0MA 1XGDA 1B0IA 3EOEA 4JIQA 4CCZA 2W4XA 1QO5A 3ZJ7A 1M68A 3G1SA 4TTUA 4B5NA 1GJUA 1E56A 3RRXA 3IANA 1R3VA 1ZZMA 3WBXA 2J7CA 3ME3A 4KRZA 2PTYA 3H6OA 3OGVA 4M7TA 1KGXA 5EBAA 3S46A 1S5TA 2UBPC 3GVVA 3GRIA 1GEHA 2JF7A 1TRDA 3OZYA 1HP5A 4Y90A 3PZGA 3UFYA 1XD0A 3RILA 4LEQA 4FXRA 1VR6A 3STPA 1TJ2A 4E8CA 1KBLA 4A8IA 3G1DA 3WEOA 3A6OA 3SZ8A 2GGGA 4AHPA 1UQZA 4QRNA 4QSFA 5LNWA 2O9RA 1H2JA 4AD4A 4LFYA 2PC4A 3WENA 3HGRA 2WHMA 4O13A 2XG9A 3MO7A 2Z25A 2ZUSA 1UZDA 4JQ3A 4C5YA 3THQA 4DF0A 3G0XA 3R8GA 4OUEA 1WBJA 1EC7A 3RG6A 3GS6A 1HL2A 3NQGA 1Q66A 3UR5A 1EWDA 3DU0A 1KXQA 3F5LA 2JKEA 4DLFA 3FY1A 1PHWA 3UGRA 4UTWC 1CXHA 4A05A 4W84A 3ITCA 4KFNA 2OELA 1OB0A 2E1DA 3VD7A 4O1AA 2D2JA 3OPSA 1G6CA 3LB0A 4GPNA 3LM7A 1C90A 2OLAA 5HQEA 1CX9A 1Q13A 1MUWA 4AB4A 2GQ8A 4EANA 1PYMA 3M6YA 3EWYA 3NZ1A 1ECEA 2QV5A 3LXAA 1LQAA 1FDJA 2J88A 3WQWA 4XAYA 2CLHA 1YPFA 4OECA 4HU0A 4YL2A 4JTTA 3SCVA 4JIRA 8XIAA 4ZQCA 3WD0A 2W67A 4GVIA 4C6LA 1XLEA 2PPGA 2D2HA 4LUSA 4CNTA 3CNYA 1D3CA 3SQLA 4UFKA 3G0UA 3C2OA 2HK0A 4H4IA 2WZHA 4F9DA 1I0DA 2YCLA 1YPXA 3V35A 4MIMA 2IKGA 3VNZA 4D8AA 2P88A 4B5TA 1CCWB 5AC7A 1VFLA 4UTHA 3G22A 3P60A 4ACYA 3JR2A 3GHUA 4XD4A 3W7MA 4TVDA 4ZXOA 3W86A 2JFEX 4G7FA 4UQDA 5CGQA 3MVIA 3BL3A 3WMCA 4ZMGA 4Q22A 3GE7A 1OFOA 5F2MA 1VFUA 2VMFA 4I9AA 5G1TA 1LQ0A 3IUIA 4W93A 5CPOA 2BXZA 2ZWYA 3CPUA 2F2HA 5JIWA 4OHQA 1WXZA 1TPC1 4XAPA 2YA2A 2VKZG 1SSDA 1H7RA 2XGIA 1TB3A 3VKJA 3L4WA 2HZGA 2E9BA 1GZJA 2NLYA 2FDSA 2NVAA 4GYKA 3THUA 4C6DA 4NNAA 1EKOA 3LOTA 3RR4A 2NSXA 3QHMA 1I2OA 1KFEA 1UROA 1OIMA 4JL2A 4LAUA 3TFXA 1KM6A 4HJWA 3L65A 5D4YA 1GG0A 3W7RA 3ZVHA 3WDIA 3JW7A 1O5QA 1EGVA 2Y7EA 1EIXA 3NDZA 4V28A 3LBCA 1UCWA 1TUXA 3EGJA 4MWAD 3U4FA 5BOFA 4AVNA 4LVFA 3DI0A 2DSVA 4DIAA 3BJSA 3P93A 4NX0A 1H0IA 4AZGA 2WC7A 3M0HA 3OLDA 1W91A 3DHFA 3QFEA 1OADA 2PU0A 5EYWA 1GVSA 2D73A 1V6UA 1EUNA 1J93A 1E4MM 3B8VA 5K9DA 3W73A 1Q6LA 4TV5A 4DJDA 2QCEA 5HUOA 2Y4SA 2NQZA 5DFAA 1I45A 1M9HA 1AH0A 1I60A 3DKLA 1JCMP 3IJDA 4JEJA 3BQ6A 1E9YB 1JIBA 2E9MA 3IUDA 4JY9A 5I00A 1RQHA 3T7VA 1XPYA 3GX9A 4Z2HA 4B2DA 2QMJA 1YPIA 2J27A 4P7NA 3W53A 2E8ZA 3KX6A 3CL6A 3QJAA 2MANA 4UC5A 1EDQA 4US5A 1WZAA 3DHPA 2PLKA 1XDMA 1JUKA 3O05A 2KZHA 3OLGA 2DT1A 3QC0A 4ZSUA 3B0UX 1EHAA 3UG3A 4FIRA 4X2RA 3EWZA 1XLHA 3IV3A 1F8MA 4GY1A 2EPNA 4Q4QA 4HYRA 1QRQA 1GQJA 4QQ3A 1XLMA 4WKAA 4R3UA 5DCEA 2XH0A 3L5AA 1W9BM 2G95A 2WAGA 2NT0A 1CGXA 1XIIA 3WBWA 4QX4A 4H7VA 5E5CA 3TW9A 4OBTA 3O07A 1QI3A 1S1PA 4AY7A 3KCJA 1C92A 1DJGA 3NZRA 4QG9A 1GK8A 3UZZA 4HN8A 3BQ5A 4JN8A 3VAVA 3MUAA 1WQ5A 4S3JA 2GJPA 4YHGA 3LRMA 3GR4A 3QC3A 5DMLA 3O3RA 3KBMA 3W23A 1JZ5A 1A5LC 3AZSA 4TR9A 3HPZA 1JAEA 3EPMA 1M1BA 3UWQA 4WGXA 2QCGA 2X2GA 4AZCA 3O0FA 3LRKA 2QJNA 1M41A 3ITLA 1Q63A 1HNYA 3TAKA 2W61A 3G1YA 4KPLA 4IFKB 2J74A 3NPVA 1SYTA 3OO2A 3WD1A 2QCCA 4P7RA 3N2CA 3MA8A 1KFCA 1XLKA 4KWVA 4CD7A 1ADDA 2J7GA 3L4XA 3ZYZA 1YBQA 4RW3A 4DUXA 4H9MA 3W2UA 1ZS2A 4NKCA 1PWLA 4LVBA 2H90A 3QMSA 4DRSA 1LLZA 4IX2A 4ES4A 4H8VA 1TV2A 3N3TA 2Y7DA 1BYCA 3UWWA 3G1VA 4KIEA 4G8TA 2WMFA 1JD9A 4PMZA 3OVQA 1YQ2A 1BGGA 1O1ZA 3G3MA 1GT8A 4I7VA 1KM2A 2V30A 3RM8A 4DYEA 1Q6CA 2INEA 3CIXA 4ML4A 1T8QA 2HNHA 1A3WA 2P53A 3A3HA 3MI6A 3BSMA 2P0OA 4GUHA 2DJXA 3W7GA 2I5QA 3N2OA 1UKOA 4FNUA 3S1UA 4MM1A 3CZLA 1BG9A 4S3FA 2VCAA 1XUUA 1PTGA 1FWIC 2Y5EA 3PZOA 1XGZA 1YDOA 1NQ6A 3P0WA 3B9OA 4IMDA 5FJIA 5AHFA 3RHGA 3A5FA 4IP4A 1YEYA 1T8XA 1RA5A 5K7JA 4LBRA 4DF1A 3R58A 1B54A 1W3NA 3CQ0A 1J0YA 1GUVA 3MT1A 4JIEA 4DZIA 3M0JA 2YXOA 2GSEA 3TJIA 3TXZA 2ZIDA 5IFTA 1ME8A 1H50A 1HKIA 3CH9A 4Q32A 3LXCA 3WDJA 3FVMA 4MJMA 3WL0A 5IDZA 1VLWA 3TSMA 4CQ8A 3MS8A 3NXFA 1JZ8A 2A6LA 3NL3A 3B8UA 3LMYA 3S6DA 4Z08A 3PG8A 4L6OA 4UMAA 3N6QA 3CMJA 3PNZA 3S2CA 1HFBA 1OFPA 3TN6A 1TJPA 1C9WA 2EXOA 2XVPA 3SN1A 4N6FA 5BCAA 5CSUA 4L65A 2ZUUA 4C6BA 3A47A 3VE7A 5GNXA 1JPMA 3C0QA 4CCEA 4UTWA 4XWUA 4X61A 1T5AA 4EF9A 4O4VA 1AQHA 3WQ5A 4YYCA 1MVYA 3DDMA 4B3KA 2ZTKA 3A9BA 2F6XA 2HJPA 4UR7A 3LUTA 3QM3A 3VDGA 1HVQA 2DZAA 1P4CA 2PTXA 3KOWA 4W8LA 1QNRA 3ARVA 1EJVC 3LHWA 2BGNE 3KTCA 1XSIA 1CXEA 1MXSA 4BI5A 1OCNA 4QEEA 1GHRA 2F8QA 1LBFA 3EOLA 2V2DA 4YPJA 2VC9A 3W72A 1X1ZA 3LV5A 1V3KA 1J01A 1ZPTA 3QVQA 3SADA 3HPSA 3OZPA 1PIFA 1MW3A 4Q8TA 1QPOA 2Z4GA 3CO4A 1LUCB 1HO4A 1IXNA 2YIHA 4LT9A 2DH2A 1US2A 4TUFA 4WLCA 1DWGM 2OEMA 5E9AA 2YGYA 7TIMA 1GNXA 1MWOA 2H8ZA 1K70A 3ZT6A 1C93A 2FZMA 1K6AA 5REQA 2Z6JA 4CVWA 4D6DA 3W76A 3AS3A 3N18A 1M3UA 2PURA 1S38A 1V3JA 1JQVA 1WDQA 1E1EA 5U4NA 1NWSA 2AL1A 3W7HA 3CBWA 4MHBA 1E6NA 4S1FA 1KM5A 4MZ8A 1SFJA 2Q09A 2PDIA 1EHNA 2V5DA 2QQ6A 1KXTA 3WJSA 4TVCA 4PBEA 5T91A 1TWWA 3V0TA 1KGWA 5BWAA 4M6PA 4LS1A 4G1NA 2BXVA 5E0CA 1ZCOA 4A3QA 1P0BA 4FOKA 4HNTA 1DJHA 4K3ZA 2ZWZA 2O7QA 2PLMA 3M0KA 3V18A 2QPXA 4BKNA 1X7FA 3OYXA 4AIUA 5C2GA 4MWAE 1I2QA 4KCWA 4FPSA 2WKJA 2HNEA 3KWXA 3ZIZA 5LNRA 3L0GA 3TWBA 1GOQA 2QCHA 3NO5A 5KINA 1JPIA 2BZNA 1EBHA 3EA2A 3QR1A 5BOOA 1WZKA 3G1RA 1XP3A 1XIDA 5FJOA 3TKFA 3M6DA 4H7ZA 5ABFB 4B3ZA 2PWGA 2WZEA 3H70A 3VUPA 4PMNA 2BVWA 2D3NA 3RO6A 2YXGA 2RGLA 4GE8A 3T0AA 3QXBA 3DI1A 2XINA 4FOUA 2Z7KA 3AHTA 4Q4PA 2X09A 1R30A 5AC8A 3K1GA 3I7QA 2R91A 2NLIA 3MKVA 2E1WA 3GUGA 1KWKA 3OVRA 1J0ZA 3R79A 4MY1A 7REQB 3VYLA 1ZBWA 4I8DA 2INFA 4INFA 3QOKA 2QUVA 3RM9A 2HCVA 4GG9A 4DAFA 1FWNA 1VAHA 2W91A 1Z44A 2D0GA 3SGZA 3S1XA 4M1BA 3A9IA 3CV2A 5CC7A 1QWKA 4AZ6A 4NXSA 3C86A 1B3XA 3WNLA 1X6LA 3POCA 4NY2A 1MFVA 1KFBA 4JEQA 4JX5A 1E1CB 5LA0A 2OFJA 3URNA 3FA3A 4EE9A 1OBAA 5A6LA 3H26A 2F6UA 5BROA 1AA1B 3SN4A 3CL8A 4NILA 3FXYA 5EU9A 3QSTA 4MDOA 4LH8A 4OOZA 1JI2A 1Y7VA 5I06A 3AUOA 3T78A 1CXKA 1OF6A 3H7VA 5LIUX 3K13A 1V93A 3H24A 3T0BA 1BWLA 4U3AA 4NYYA 3NAVA 2CXEA 4U3CA 2Z7GA 1S5NA 4JIHA 2FJUB 1GTEA 3PBVA 1NM9A 4HHMA 4TU1A 3W1TA 2G37A 3F03K 1G4PA 2EHHA 2GPTA 4HA3A 5E1QA 5AHEA 4MUPA 3TTOA 5HANA 1QHPA 3G6MA 4UTIA 3GB6A 1G94A 3AMDA 3RCYA 2V82A 3DFQA 4JKMA 4Z17A 2BHYA 3QYQA 2F61A 2QUMA 2AAAA 5AC5A 4Y6GA 9XIAA 3VX1A 1BYDA 5CKSA 2CHOA 1Q45A 1BGAA 1X38A 1FWFC 3B8IA 1XYLA 4IGMA 4LUTA 2C1GA 4HSOA 3SRHA 2CETA 3MUCA 3ITTA 5CBJA 1FUYA 3AMCA 1MYRA 5J04A 3U7VA 3LHUA 1AVAA 1V3HA 2IPJA 2AQOA 5I3JA 1MEIA 2BGSA 1W6TA 5ENLA 2FFCA 3F1QA 2OSXA 3ITGA 1PKNA 1JXJA 4WRHA 3EDDA 1J4EA 3OLEA 1VLIA 3OVPA 2RUSA 5A1AA 3P84A 3QKZA 4XVDA 3T8LA 3PS7A 2J66A 2B7NA 4L64A 1F7BA 2ZUTA 4AHOA 3K1DA 3AU6A 5FJPA 3Q4DA 1K02A 3P61A 5FF4A 1IV8A 1YHTA 4NRRA 5DEZA 4A2SA 3BLIA 4PBGA 5M1TA 2G41A 1VCFA 3IIVA 4UTJA 3PJXA 1SMDA 2V3FA 3P7YA 1M01A 1L6SA 1VIWA 1G4TA 1MNSA 4XIAA 4ROQA 1JULA 1JGIA 3N13A 4ICNA 3U0HA 1AK5A 3RFAA 2WMIB 4GJJA 3U48A 1ZJBA 3ITVA 3FHAA 3MJYA 4IXHA 4WKFA 2GQ9A 5C0QA 3ABOA 1VFOA 2P3ZA 2CLEA 2WM1A 3RAOA 4GINA 3EX6A 1E9LA 4QJ1A 4GVHA 4FHAA 4D6CA 3RNDA 3PTMA 2J75A 4HK7A 4JD4A 4C60A 4HTBA 5DO8A 2CWXA 4YTTA 1NWUA 3WEMA 1TPFA 4OFCA 4E2BA 3VIKA 4BK9A 1TZZA 4O52A 1E9IA 3MQTA 2NQJA 5JIPA 3WN6A 4X0NA 1QATA 2ASHA 2XZ9A 2YZ5A 1W32A 3STGA 2ZYFA 3P2VA 3AOFA 3W85A 3N4AA 3WKZA 3I68A 4AIEA 3PC0A 4YHEA 4JQ4A 1N8WA 4RUBA 4Y9PA 3NO1A 1SO6A 2Z26A 3NDYA 5HWNA 1EDTA 3UXDA 4EOUA 1EO7A 4MGGA 4MNLA 4E4FA 1X6NA 2EG8A 3KS6A 1E51A 4ZBCA 4MADA 1E0XA 3UWVA 4XZNX 3EB4A 3I6TA 5DBTA 5EKYA 1OFBA 1X98A 3JZUA 2C8NA 4B92A 1DWAM 1L0PA 1G9HA 1GQNA 2ACSA 3NPUA 3JU2A 4O1CA 3S2JA 3CWNA 5BMXA 3DUGA 3QOMA 3ABXA 2BHZA 2WVVA 3MANA 3KOZA 1DIOA 2CZEA 3IJ6A 5A2CA 6ENLA 2Y24A 3W1LA 4B5SA 3KBNA 5AKQA 1J18A 3LQLA 4P7LA 2H8XA 1UA3A 3U2EA 5LGZA 4JFSA 4NRSA 4WD0A 1XH0A 2QCDA 4JYEA 2C19A 5JUVA 3RM4A 1TWZA 2X1UA 2ZX9A 2GJLA 1B3WA 1F07A 4XVEA 4GCXA 4UOQA 4RZ4A 3APTA 1ZFJA 1BKSA 1KBKA 3TYAA 1GVIA 4EF8A 4GRSA 1B1YA 1DPMA 3OQEA 1EBGA 1I1XA 1Z7AA 5BXSA 1TRIA 5AECA 2ZRWA 4LBUA 5FF2A 5CZSA 2XFWA 3CHEA 1O12A 2RDUA 2UV8G 4IICA 3UP8A 4X2PA 2CU0A 1NWRA 3RPDA 4NQ1A 3GTIA 3LN3A 3S42A 4ALDA 1Q2SA 1XRFA 3WQGA 3REQA 3AICA 4O12A 1KC7A 4P7OA 4O11A 2HK1A 4RE3A 1TV3A 4UQ9A 1ITQA 4LOCA 1PB0A 2FTPA 4MDPA 5E09A 4AG0A 4XZWA 4UFIA 5E93A 1GPFA 3ISIX 4YIWA 4XAFA 5EPDA 4F8XA 3LPGA 4JTAA 4HNUA 3A4XA 1F3TA 4PCFA 1IEVA 4KGJA 1SFLA 5KMYA 2VDGA 4HK6A 3A22A 1AH4A 3VDHA 3QEZA 3HFYA 3LEPA 2R82A 3ARXA 1YYAA 3CAQA 1K9TA 3GNRA 1HQTA 4X3ZA 3WDPP 3WFAA 6TIMA 5FOOA 5DQPA 4AX6A 5GJNA 4O1BA 1QWGA 4LS2A 3CIWA 1EC8A 3MSRA 2G50A 3FK4A 5CSYA 4BI7A 1E4NA 4J3XA 5HPCA 1SZRA 3UR7A 1UD8A 4MWAC 3DCPA 3WNMA 2AL2A 2KX9A 3BAYA 2EPKX 3MUXA 3WUGA 4OTKA 4W7WA 3PFRA 5LHFA 4O8AA 1R7OA 3PB2A 1J11A 3CQJA 1GZGA 3TTYA 1UR8A 1GQIA 1M7OA 5ABGA 2AKZA 1R3SA 3C