3V00A

Studies of a constitutively active g-alpha subunit provide insights into the mechanism of g protein activation.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
351
structure length
351
Chain Sequence
b'HMGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDPYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMHLFNSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1/ Gua
publication title A constitutively active G-alpha subunit provide insights into the mechanism of G protein activation
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 95
structure length 351
sequence length 351
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 3v00A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v00A01
1G7TA 3HU3A 1WA5A 4QHYA 4LYAA 2B8TA 4MKFA 3DO6A 3B1XA 1XEWX 1YZGA 2QI9C 4JJKA 4OI1A 3HPRA 3FVQA 4FXPA 2OLKA 4WXPA 4EDHA 5KDLA 4JYBA 1KAGA 4TLBA 4MA4A 2QTVB 2VP9A 4N0EA 2KJQA 3T06B 3GLHE 2FG5A 2R6CA 4P4UA 4PHFA 2J45A 1ETUA 5FTJA 4GDFA 3MJRA 2QT1A 2QNRA 2JCSA 4A0GA 3VKGA 3ADDA 1HT1E 3KJEA 1X8LA 5L3QB 4Q48A 1Z29A 3F0TA 1UKYA 1Q1EA 1XTSA 1E2JA 1MRSA 2OV2A 2RGNC 4JBWA 1JJVA 1G9XA 1G7RA 1KO1A 2JJ8A 2Z5FA 2CEAA 3IPYA 1ZD8A 2PZFA 3AVOA 3LV8A 3C14C 2ZETA 3DKVA 2WIBA 4CIDA 1M2OB 4IRUB 3PITA 1E0AA 4LHZA 4EFMA 2RMKA 3CNOA 3LLMA 4PTLA 1CJKC 1E2KA 4DLRA 4YC7A 2BMEA 2WSSA 3X2SA 1OSNA 1RIFA 1WXQA 1FPMA 4PO9A 1ZNXA 3BERA 5FOXA 1GRNA 3KJGA 3VR5A 4K81B 1UADA 2FX3A 2PBRA 3W3AA 2BBTA 3D31A 3HYRA 1E2QA 1ZD1A 1W5TA 1YRAA 1II8B 4M1SA 4JL6A 2VHJA 4B35A 5FOUA 2JIZD 2V4ZA 4OQXA 5AUOB 1G64A 3BS4A 1KI1A 2J9RA 4PR0A 1W46A 2WJGA 4Y0VA 3U3KA 1ESNA 1HY3A 2VYFA 4HAYA 3W34A 3N70A 2XSZD 5SZHB 4AURA 3EXAA 3RWOA 4NZYA 3VHLB 2JLYA 1MRNA 2R6GA 4ZIRA 4ZDJA 1Z0JA 3CZQA 4URWR 4Q00A 3ZJYA 4H9GA 4D2IA 3LD9A 2W6JA 2ZS8A 1XX6A 2OCPA 1OH8A 3LBHA 2BC9A 1NVUQ 1TF5A 2GEUA 5FBQB 3KQHA 1A5TA 2BKEA 1JQLB 2XOKD 2Z6VA 1Z8FA 3RRYA 3I1FA 2XZPA 2KBFA 4NP6A 1G41A 3UK6A 1TUIA 1W4RA 1VG1A 2XB2A 1VMAA 2QM8A 1AS0A 1DELA 4DDWA 2HF8A 4LZZA 2IL1A 2W0MA 1J99A 4JLOA 4NYMR 2AWOA 1N6NA 2HDNB 4DCSA 2VRWA 4URUR 1HUQA 1SHZA 1XF9A 2GZAA 1TF2A 5FPKA 3ZLJA 3U7HB 4A8JA 1FTNA 2NO6A 1P60A 3FMFA 2X2EA 1N6IA 1AIPA 1YVDA 4A0HA 1W47A 2QBYB 4MQBA 4PFSA 4Q1BA 2RGAA 4F91B 1A4RA 2V7QA 1UDXA 4Y0AA 3GQBA 4HAXA 3X1WA 2WM9B 2PL3A 3PEUA 5SZKB 4B73A 1QHGA 4OL0A 4ERNA 4AKGA 1KOFA 1OHHD 1YR6A 4PHGA 4DRZA 4MRPA 5EXSA 3UIEA 4M1TA 3THWB 2XTZA 1H8ED 2J0SA 4IOMA 1G8FA 3RS5A 3H4MA 3PR1A 2GCOB 1RJ9B 3D7MA 5IK2D 4C0QC 3PV0A 1XCGB 3K9GA 2ODWA 2Q9BA 4PZYA 1G3RA 2CHVA 4HDOB 1HE1C 5C46F 1DPFA 2MMGA 4AD8A 2QSZA 4A2QA 2IYQA 4IJMA 1VIAA 3WP1B 2HYIC 4JJZA 2ERXA 2WWFA 4ZCLA 3I32A 5EXPA 1GIAA 2GJSA 1P62B 3PCRB 2VA8A 1G19A 3GJXC 5K8IA 4PZLA 1OXSC 4N0DA 1EX6A 2AKYA 4UNRA 1RRFA 2L0XA 5E7JA 5C1BA 4JS0A 3TRFA 1T8TA 3BORA 1OJLA 4H1VA 3GCGA 2CVHA 4OJQA 3DHWC 3UXMA 3AUYA 3VKHA 3K1JA 4TYWA 2OESA 5FFMA 1E0JA 2JJ1A 5EE9A 1XU4A 4A8JC 2DFNA 4Q18A 3I73A 5G40A 4L4UA 2IXGA 4DLYA 2CK3A 1KKLA 2G0TA 2HXYA 1CIPA 1MO5A 3QF4B 1IOZA 1W0JA 4KV9A 2QRNA 4BASA 2C98A 4A82A 1N5IA 3ETLA 3B8HA 3NEYA 1US8B 1OFIA 1Z0AA 3OESA 2B6HA 4MITA 2ZRBA 4XWAA 3LQRA 3M4YA 4CEHA 1DVRA 1G8YA 2FFQA 2YOFA 1GNQA 2IXEA 2FGJA 4V0OA 2QPAA 4Q4AB 3U60B 5D3MA 5CM9C 1Z83A 1ZCBA 5HPYB 1NMZA 3R8CA 4D0GA 2O8EA 1PUIA 3SQXA 3SN6A 3NEJA 4GPTA 5FL3A 1OH6A 1DAFA 2MSEB 1BKDR 1ZUHA 2AXNA 3OAAD 4L16A 4MUBA 4OKSA 4RJLA 2B8WA 4B33A 3CUEF 3PXGA 3NVAA 1BMFA 1PVOA 4Q9KA 1KMQA 3AV0B 3U5ZB 3TH5A 2ODBA 1SXJA 3A1SA 1VCOA 4UNSA 4YDSA 1DOAA 3I92A 2KSQA 4P4SB 2AFHE 1XEFA 3L8YA 4JT2A 1JECA 3GD7A 4TLAA 2ZRJA 1JR6A 2P6NA 4B2PA 1TQ6A 2DYKA 4P0TA 1DG3A 1AQUA 4MRSA 2LKDA 5K8TA 3PG5A 4B48A 1WBDA 1AS3A 3TKLA 2QTFA 1LB1B 3IBYA 4PPQA 2DBYA 3D6TB 4TQAA 1MO6A 1DADA 1Z0FA 3LNCA 3LAWA 1KJZA 5KDDA 4JLDA 3DOFA 5LB4A 4UQOA 1CF4A 3DM5A 1G3IA 5HZHA 2CJWB 1DO0A 2QMOA 1CR1A 2PCLA 5FUYA 3W6OA 2V3CC 1R0YA 1XZPA 3PUVA 4DZZA 1MABB 2GVZC 3H84A 1V43A 2FEMA 4C7OB 5DI3A 4F4JA 3DM9B 1KO7A 2PLRA 4U7DA 3IEUA 4KVGA 4U02A 2J87A 5CLLA 3BE4A 5KSPA 3F5FA 1HYQA 2WJIA 4C9BA 3EWAA 2ORVA 4LY6A 1Z0KA 5LB2A 3GJ4A 2I1QA 4TYNA 4PAQA 1G3QA 2VSXA 1QBKC 4YQFA 2W83A 3QJYA 4RD3A 5BW8A 1IN8A 4KSBA 4RD0A 2J0VA 4OK6A 4PHHA 1NF3A 4BFSA 4CEJB 4QGFA 2ODEA 3GLGE 3GLIB 3O8CA 2FJUA 2WKPA 3HU2A 1OXUA 1ESMA 1JXOA 1E4YA 4ILEA 3QF7A 2JDIA 4UXHA 2GXAA 1EWRA 1KK0A 1S2MA 4IDHA 2IYXA 1NLZA 1DTSA 3PEYA 4HLQB 1DAMA 1SXJC 5HZKA 3AP1A 4WVFA 1SKQA 5JI3E 4TTQA 4B47A 3FFBA 2YNMA 3A1UA 4LK2A 3W6PA 1MR3F 3KXIA 3CRRA 3KB1A 3LW7A 4N3NA 3QSYA 1W4BA 3QKUA 3HR7A 2GK7A 1QG2A 2GKSA 1OB5A 1EFUA 4JL5A 4XD7D 5DE3A 4CVNA 4IKEA 1CBUA 1GSIA 1H8HA 2ZVQX 1Q1BA 4TMTA 2O8CB 3WNCA 2WOOA 5L3SA 1YRBA 1QVAA 2DY1A 3WNBA 1XTKA 3CRVA 4GP7A 4PQFA 1XJQA 2B92A 1U0LA 2JLQA 4TWZA 4ZO4A 4YMWA 4F4IA 2O8BA 3UANA 2CNWA 1N6LA 2QAGB 2REBA 4TN1A 1XD2A 5JHGB 2WKQA 4E09A 3U6KA 2KB0A 2W6ID 2XGJA 1KZ7B 2VP6A 1L4YA 1TUEA 1X8JA 5FR1A 1T6NA 5BN5A 4LOAA 5CDFE 3SJCA 5JSZA 1SVWA 2P5TB 1CJTC 3K8YA 2QENA 4IFBA 4A36A 3MAAC 3KXKA 5P21A 1P4SA 3WBKA 4NCJA 5J4YA 4ASUD 2FWRA 5DNYB 1BS1A 4JVMA 4Z51A 4ON9A 1Q3HA 3T5GA 1QHHA 3VFDA 3K9LA 1A2KC 5D3QA 1OV4A 2OSBA 5G53C 2JJ2D 3B60A 3K0CA 4GRAA 2HF9A 4ZDIA 5KPJA 1VHLA 3IIJA 2HCBA 5KHOC 1ANKA 1R2QA 2DWOA 3THYB 5EZ5A 3LFUA 2WWXA 1HQCA 2ZI7A 3BH6A 1JAHA 1Q3TA 2A5YB 4E03A 5CDFA 3L2OB 3T35A 3C4JA 2FDCA 2ZE7A 1T3LA 3LY5A 1KI4A 2ZSFA 1J70A 4HDQB 5AJYA 3K70C 4FCTA 4IHQA 3FWYA 2ZJZA 3IPXA 3P27A 4JMPA 3RSOA 1XPRA 2N42A 5FPSA 5DIFA 4PAMA 1DAEA 4GOXA 4M9ZA 4O25A 2BMJA 3AGPA 4R9UC 4YMTA 1F2UB 4KU4A 1W0KA 2UZIR 1Y3AA 4NTZA 1MH1A 4AYTA 2JLXA 2BOVA 4DCVA 1Q0UA 1NVXQ 2V8OA 2GESA 4JSYA 4FI3C 4DKXA 4HZUA 3NBYC 1IXRC 4C30A 3OF5A 2CLCX 5HKKD 5KSOA 3AGQA 4M1OA 2H16A 2ZRIA 3A58B 3PFIA 3BIFA 5CJ2A 4KYUA 3TIFA 1Y63A 2P67A 3TBKA 4LJ8A 1FMJA 2A2ZA 4UNPA 1D6JA 5JJLA 4QBIA 5FBRB 1CR0A 1DS6A 1P2UA 1E1QA 4MH0R 3ICEA 3GEHA 3K0AA 2J7KA 5FBLB 1GKYA 2QE7D 4TT3D 1P2VA 5FTLA 2AK3A 3ADBA 2QP4A 3B1ZA 3PUXA 1NVWQ 1XZQA 3X1DA 2IS2A 4IW3B 1IN7A 4PHTA 3BB1A 2VSFA 2H1LA 4YMSA 3QPWA 2F6RA 3CW2A 1W36D 2RHDA 5FUWA 2ZYTX 1T9HA 2VP0A 4D4KA 6Q21A 2PEYA 3K0CC 3TUIC 3L0OA 1OB2A 1IXSB 4ABYA 4XVUA 3FTQA 2GAOA 5DHAA 3U3JA 4BZPA 3IEVA 5AR1A 3LXXA 4B6EA 1FL9A 4PSKA 4MKGA 4CW7A 4QM7A 2BEKA 2CHGA 3KZ1E 2I1VB 2JA1A 2UKDA 2XNDA 4PPFA 1GTVA 1XEXA 4LYHA 1GAJA 3G82C 2R6FA 3E70C 5FOSA 4MRVA 5AJZA 4Q7JB 3VNVA 1OT3A 3BOSA 4DLVA 2QN6A 1JI0A 1AZSC 1FMLA 4KFTA 1IN6A 3D8BA 3SDZA 1ZYUA 3LXRA 1W44A 4M1MA 2RAPA 2WKRA 4UJ3A 221PA 1NJFA 1VKJA 1Z47A 2AN9A 1Z0IA 3KQNA 5DH9A 3BAFA 5GJWC 4A9AA 2Q21A 2V9PA 1NIPA 2IYTA 5KNDA 1Z6TA 1X8KA 3P20A 5BYKA 1VPLA 1EESA 4TMXA 2D74A 3KKQA 1F48A 3ZVMA 4GMDA 3GJ6A 4ACAA 4C2TA 1L7VC 2ZRFA 1HT2E 1KZGB 3QXJA 5IF9A 3AM1A 1T0HB 3ZIAD 4L9WA 2ZS7A 4BGDA 5JJIA 3QENA 3UMFA 4JLMA 1WCV1 1D8TA 1LV7A 3QUSA 3VR4A 1NY5A 2C8VA 1UM8A 4POAA 4JVLA 3T1QA 2ZS9A 4I1VA 4O0MA 2GA8A 3CBQA 3LBIA 4EIWA 3QKSA 1GFIA 4LBYA 1FOEB 1UDWA 4GNKA 4BLQA 1DARA 2G77B 2P0EA 1RRGA 1SVMA 3AVQA 1GZSA 4XWKA 3TSWA 1LF0A 2ZE8A 3PJRA 5E95A 3R7WA 1OYYA 3QXXA 5LD2B 1L4UA 3K0EA 1JEEA 1OXVA 2F1IA 2HT1A 4U5XA 3HWSA 5JRZA 2HV8A 1N6OA 3REFA 1E9RA 2AWNA 3JZMA 1QHIA 3U7EB 1KIMA 4EUNA 5DYGA 2OXRA 1JBKA 1Q21A 3K0FB 3LA6A 2NO0A 4CRWB 3I62A 4KI0A 2ECKA 4IXMA 2DPXA 3AVYA 2ZSAA 2XEXA 5KO2A 4MUAA 2ANBA 2WTUA 3B78A 1X1SA 1YHNA 2D7DA 1XP8A 1NG9A 2FSHA 4HLDA 1E9AA 4BFWA 4HAVA 2HEIA 2F7SA 2X19A 2J7PD 2YINC 4PC2A 2BCJQ 4MGIR 4B75A 3A6PC 4W5HA 2G3YA 4TYQA 1H65A 3AUXA 2Z43A 3R9IA 2AD1A 4XWOA 3CRQA 1IN5A 4HB2A 1KNQA 2JIZA 5FOWA 5KOYA 2B7CA 3CPJB 2F43B 4C0SA 1CJVC 4QNRA 4A0RA 3ICQB 1XTJA 3S1AA 4WZAE 1TQ4A 4JLNA 2G1KA 4RFSA 2XSZA 2IBMA 2F1RA 2HLDD 3EARA 2VHTA 3RC3A 3H86A 4MYCA 4EPYA 1HV8A 4FMDB 4S35A 2EFEB 1IONA 1FX0B 1OXXK 2ATVA 1ZNWA 2QG6A 4KLZA 4RSGA 1S3GA 1SVOA 3TR0A 2IS6A 4X8LA 4RCZA 1LNZA 2ZE6A 4KLNA 4B71A 4PPNA 4CT5A 1IM2A 1Z2AA 2ZUBA 4PC1A 5JCPA 4Q19A 5CB6A 2AX4A 2OLJA 4EJSB 3W6NA 3EZ9A 1DO2A 4I81A 1E2PA 2WMNB 3HR8A 4URZR 1GL9B 4LJ4A 1WF3A 4TSFA 4RD4A 1QHXA 1F2TB 1O3YA 2OFWA 5TB5A 3VR6A 5L8VA 3CLVA 3ONWA 2GK6A 2WSMA 1RRCA 2H8KA 4QBHA 1RPZA 1LS6A 3QVVA 5FUVA 1E96A 2QL6A 2ORWA 4HLUC 4CDGA 1XJCA 3LX5A 1ZJ6A 1G1MA 2YZ2A 1UBGA 4D0NA 3NDBB 1QG4A 5CITA 4FCVA 4WW0A 3SQWA 5DHFA 3I61A 4DUGD 2VPPA 2Q3FA 3K0SA 1GNRA 4DLWA 2ZU0C 2P5SA 5CLQA 4LHXA 5FTNA 4DHEA 4TYYA 4IOKA 2YVUA 1XXHB 5H68A 1G291 1YQTA 4G5RA 3T12A 4YXWA 4FMBB 4HUQB 4WZBE 4ESHA 4J0QA 1XPUA 3QI2A 2QMHA 5EE0A 5FL7A 2IXFA 2IHBA 4AY2A 2IYSA 1KSHA 3SYKA 2HJGA 2I4IA 4B3BA 4FMDF 3OE7A 1R6BX 1U94A 1EWQA 2EWVA 3A4LA 121PA 4W7SA 1A1VA 2ZSEA 4DIEA 4M9SA 2ZJ8A 3O47A 4LYJA 2P3SA 3QG1A 2NGRA 3MWKA 2Q0HA 2F1HA 2GWHA 3NBXX 4G3XA 1AK2A 2JLRA 4I4LA 1DAKA 1S3SA 3DZ8A 3OIYA 4ZV4A 3FKQA 1HURA 3GLHA 2D3WA 3M0EA 2J0UB 2RGDA 4Q1FA 2VQSA 1XWIA 2A30A 4WXRA 3CNLA 2IF0A 2H7VA 2WAYA 2ZYWX 3RRNA 3ZH9B 2JLVA 2FA9A 3KQLA 2G1JA 1KGDA 1OFUX 3IBGA 1KSGA 3J81k 3O8RA 3ADKA 4V03A 3AF0A 3LDAA 4ESVA 1R0XA 1KDTA 1G20E 4Q7KA 3QE0A 1RRPA 2GXUA 1E9DA 3GEIA 1VECA 2ZRDA 4D4JA 1EK0A 2GCNA 1CKEA 4UKDA 3AF2A 1GG2A 4RVCA 2VEDA 3IDQA 1KDRA 1Z6YA 5G3YA 2YOGA 3ND9A 1MKYA 1ZMXA 5JWHA 1ZAKA 2WIAA 3TSOA 1AGPA 3QEJA 1GP2A 1RC8A 3MUFA 4GL2A 1M34E 2WVJA 2ZVPX 3G5UA 4IEIA 5AJVB 4AYXA 1U0JA 3CRW1 1R0ZA 1DAHA 3CIOA 3NBFA 4LC0A 1UBCA 5E4FA 4O3MA 4QL3A 5HCNA 1TAGA 4Q9JA 1CULC 4NONA 3B5JA 2OHFA 4DB2A 1KK2A 5DI9A 1U8ZA 3OEHD 3THXB 1JR3D 4OI4A 2GJAA 3SHWA 2GJ9A 1TTTA 1PJRA 5AWFC 1ZINA 3TQCA 4LBZA 3CWQA 3LBNA 4RFVA 1AS2A 1N25A 1NVVQ 3WYAA 4B2LA 2ONKA 4DDTA 2QMEA 2I3BA 4Q4HA 5JMTA 5A5GA 3NKVA 4Q4JB 5DN6D 4A6XA 1ZC4A 2WWIA 3QKTA 2GXQA 4B34A 1TMKA 2QGNA 2WOJA 1YJ5A 4JLBA 1GITA 1NKTA 3OEED 2FV8A 3RHFA 1TL7C 2QSYA 3FMPB 1U99A 2RHMA 2CXXA 2XXAA 3GFOA 3X1XA 1A82A 4LJAA 3U44A 1TEVA 2OAQ1 4LV8B 1LW7A 2OO7A 3E5HA 3CX8A 1N0UA 1UF9A 4DB4A 2W2VA 2VF8A 3EWSA 3TLXA 2ONJA 1AKEA 4QKQA 1BOFA 5L3VA 2OBLA 1EFRD 4G5OA 5TY0A 1G6OA 2GCPA 4GP6A 1Q57A 4IXNA 3W9YA 5JJKA 3AQ4A 4ZCMA 4DVGA 1KI2A 1VG0B 3BRWD 2QAJA 3EZ7A 4IVPA 1Q12A 4LDJA 1IY1A 5EE1A 2V1UA 1VYVA 5KU1A 4Q1DA 1W36B 4Q9LA 3BFKA 3REGA 1DAIA 1W4CA 3DPUA 4UNNA 4WA7A 1NBME 4OHZA 4AYWA 3U4QA 5M04A 3QKRA 3EA5A 2BKUA 4JT4A 4BFUA 1G4UR 4GBMA 4A2PA 3VMFA 2C9OA 2WJYA 1R8QA 5UKDA 3BWDD 4KFSA 4B3FX 3AVVA 1W48A 3EZ6A 4IFEA 3VU9A 4BLPA 1VDZA 1SGWA 2BCGY 2OFXA 3DOEA 3KTAA 2PT5A 1MT0A 3QXSA 3VR2A 5J47A 1U8AA 1UKVY 1OH5A 2BM0A 2YWEA 1PUJA 2WSSD 3C5HA 4HAZA 4RZXA 1RW4A 2C9CA 3QEOA 1U2RA 1Q20A 4KODA 2EWWA 1E99A 1TU3A 4YDHB 3KKOA 1YZUA 4C0KA 1W2HA 5AUQA 3BK7A 2O8DA 4NH0A 1OIXA 3B6EA 2PH1A 2PJRA 4GT1A 4NYIQ 1J8YF 1NBMA 4D4MA 1U8YA 1YZQA 4P3YA 4GOJA 4YONB 3TAHA 3CH5A 4TTPA 1ZNYA 4A1FA 3CR7A 4BLSA 1F3OA 1VCMA 3UPUA 2FOLA 5EE5B 5J4LA 2QP3A 2RGBA 4XTRA 2Q9CA 3PUWA 1SVKA 3M6AA 4BWYA 5BN3A 3WYFA 2ZRKA 4QG7A 3SZRA 3ZZUA 1NNEA 3VR3A 1CTQA 2X2FA 5TMPA 2W6JD 3ZS8A 3TUJC 4AKHA 2NTYC 3LRPA 2YWHA 3WYGA 1O87A 2GAAA 1R0WA 3CPHA 1E9BA 4NU0A 1RFLA 4R7ZA 5DGXA 4EPTA 3DVLA 1GRRA 3R9XA 4X8HA 1YZKA 5KUTA 3MRSA 1E2DA 4A2WA 5J40A 3NC0C 4D82A 3IQWA 1II8A 3KQUA 4G1UC 2KBEA 1D5CA 4LPKA 1QDEA 4HB4A 4Q1AA 1M74A 2CBZA 1S4QA 5EP2A 3WHKA 3V4RA 1F60A 1OKKA 1E79A 1KY3A 1G8PA 1W7AA 2ZJ2A 4NMMA 4LX0A 1UJ2A 1V5WA 2NO1A 3FHOA 2BJWA 1BO6A 2Q6TA 2ZRNA 1E2NA 1KHTA 1BH2A 3PUZA 2V7QD 5JZVA 3Q9LA 4Q21A 1II0A 4LI0A 2TMKA 2OXCA 4XSGA 1NN3A 3WMFA 1N5LA 3V00A 1R5BA 3AF4A 3QOFA 3T1VA 1NLFA 2GTPA 4KBGA 4URYR 5JLJA 3ZGXA 2H57A 4C0BA 1M1YE 2ZRCA 2ZI5A 1S1MA 3EX7C 3B85A 2A7QA 2VHUA 1NMXA 2ODNA 2RKOA 3OIUA 2R2AA 3MWJA 4A0FA 3K0AB 3A1TA 4PO8A 3RAPR 4FMCB 1S9DA 4TMWA 5HE8A 2QORA 3GLFB 4KAXA 3TVDA 2ZRMA 3AF1A 5JS8A 1YZTA 2AKAB 3KFXA 2A5GA 4MYHA 1SVLA 3KXLA 1CLUA 1QHNA 4BFZA 2OAP1 2QY9A 2CMKA 2GEVA 2GEDA 2N46A 2QBYA 2C95A 1BIFA 4TQUS 2BVNA 3IO5A 1JALA 4CZ2A 4Q03A 2C04A 3EC2A 3FYHA 1MV5A 2W0SA 4DT1B 4ZKDA 3L0IB 1JPNA 1N6KA 2BBWA 3EZ2A 3THWA 1W5SA 2WJJA 3KQKA 2A9KA 5JFGA 1LF5A 3AVWA 2RGGA 3GJ0A 2FPLA 1L2TA 3ZZ0A 2IF2A 2IYYA 4MGYR 1E2MA 4QJ5A 1VTKA 2JJ1D 2R9VA 1RJ9A 2GVDC 2VH5R 4B3CA 4TZ6A 3NHAA 2CCGA 4QGHA 1QRAA 2QE7A 3O8DA 2CK3D 3RRZA 3GLGA 4DCUA 3LWNA 1JJ7A 1W0JD 4DLUA 1TPZA 521PA 4A4DA 1UBFA 2FN4A 3GMTA 1X6VA 3EIQA 3VAAA 3WNDA 4QJ3A 2WBLC 3FGNA 1CJMA 3A4NA 4BEJA 3IHLA 3X1ZA 2ZR7A 5FH9A 1KI3A 4JVSB 5ELXA 2LKCA 4M0LA 2P6UA 2NO7A 2WPDD 3BFVA 1Q1ZA 1XFAA 5FPYA 3KB2A 1UKZA 2AFIE 3THOA 4B76A 1Z0DA 4K8OA 1GKUB 1KJWA 3CONA 1E2FA 4BZXA 4L15A 2WZQA 2QMUA 3VHXA 4PC3A 4RZ2A 2O8FA 3Q72A 4MDEA 1E1RA 5LPNA 1X86B 1L8QA 2WAXA 1RE0A 3CX6A 2UVQA 3ZVLA 4W5JA 2QROA 1EX7A 2RGCA 3SC3A 1BMFD 4EFNA 1LS1A 3QPUA 2RGXA 2JLWA 3QF4A 1SXJD 1S9HA 3HU1A 1FFHA 3NWJA 4L9SA 2IYLD 4B3XA 4QGGA 3BH7A 3MWLA 4NYJR 2NG1A 1US8A 1VCIA 3MCAA 4D26A 4EPVA 4P32A 3LVRE 4WIAA 3SEAA 4U00A 4MYTA 4IDQA 4LHWA 3GPLA 3CO5A 5EJEA 1GL6A 4Q4AA 1KMHB 1ZVQA 2WWWA 4TL6A 3LH5A 1GUAA 4PAOA 3ZD7A 1PZNA 1ZP6A 3L82B 1Z3IX 3IILA 4BFYA 4LHVA 1XTQA 2GJKA 4F92B 1XMJA 1J8MF 2DHRA 3VR1A 1FP7A 2OZEA 3RDPA 4DLZA 5A4JA 5JECA 3IO3A 4M1WA 2JGNA 1IN4A 2V55B 1RKBA 2G0NA 2O0KA 3GFPA 4I1OA 3RYTC 5TARA 4QBFA 3W5JA 4L5BA 4LJ5A 1ZD9A 1Z08A 4DLTA 1LVGA 3OFNA 3FKSD 5C4MA 3DMDA 2VP5A 5IHPA 2PJZA 3NC1C 5FPHA 3RS0A 1T5LA 2OCYC 4KBFA 4OK5A 4C3ZA 4AG5A 4CEIB 3QBVA 3Q3JB 4LUCA 4MRNA 4UNQA 3LVQE 3TW4A 4DEYA 5C18A 3GLFE 2OUKA 5F3WB 1VIYA 1P2SA 4JLJA 4WBSA 1E98A 4TZ0A 4C0HA 3AB3A 2ZTSA 1I2MA 5KPDA 3F8TA 1D2EA 3BFXA 5DSZA 3KFVA 3C5CA 4DLXA 1N6PA 2CJWA 2KWIA 3GLIE 1XMSA 1G8GA 1HH4A 3A4MA 3TAUA 4UJ5A 4GZLA 4N1AA 1MABA 2SHKA 1GWNA 3DKPA 1UAAA 4OK3A 1XTRA 2FFBA 2KE5A 4CF7A 5GVSA 2C78A 4IVRA 3E1SA 4EQ6B 4C7OA 3EA0A 2A5FA 3HPQA 3K70D 4M21A 5JWRA 2J1LA 2OG2A 4KXFB 2W2XA 1M6NA 4QHSA 4NDZA 4Q7LA 2C77A 4KHZA 2ZI9A 3KKMA 4Q9IA 1JXMA 4LJ9A 4PSVA 1M7BA 1SHKA 3VX4A 1YR8A 3AP2A 4LYFA 4PC6A 1KAOA 4QFMA 4B44A 4OHWA 2FFAA 1FTSA 4V0ME 2EU8A 2ZANA 3ZDQA 3C8UA 3IIKA 1I2DA 2CNWD 3GJ7A 4Z1MA 1AGRA 5FUXA 1G21E 3RS4A 1ODFA 4QBGB 1XD9A 4R98A 3BBPA 3QG5A 1ZW6A 3Q5DA 1SVIA 3FMOB 1XCMA 2ZRGA 1KTVA 1COWA 2IT1A 2OBNA 3EPHA 4LV5B 3ADCA 2JEOA 4XVQA 1KKMA 2ZPTX 1RVDA 3SYNA 1N6RA 3HDTA 4H1UA 3ASZA 2CE2X 1E94E 5A0FA 4OI0A 2BM1A 3W8NA 3CRMA 3TSZA 3I4LA 4DCTA 5AUPB 3CX7A 1G3UA 3I72A 4GSYA 2IW3A 1R4AA 3GLHB 3I5XA 1E2HA 1E69A 2R8RA 4IVQA 1P7CA 2F1JA 4XOIA 3DMNA 2O8CA 3UG7A 1ZIPA 2H92A 1LY1A 4P33A 3W90A 4HI0E 4LHYA 1GOTA 2IYRA 2A5DA 2GETA 2JLSA 3B1YA 4RKEA 4F7WA 3NDPA 4DJTA 1ZBDA 3BC1A 1XTIA 4MRRA 1JNYA 5BN4A 5LBIA 1KSJA 3FHCB 5EZ6B 2P2LA 1P9WA 4AK9A 1FNMA 3B7GA 5EXTA 3CM0A 2J41A 4I1SA 1G17A 2NPIA 3BD9A 4O2RA 4PO1A 2C03A 1GNPA 1Z6XA 4FN5A 4ZIRB 4V0KA 2P65A 3N2IA 5IRCD 2VLIA 4D25A 4FWTA 4HLUA 4TLEA 2WWGA 1R5NA 1E9CA 3KJIA 1I4TD 5AJWA 5SZJA 2ZYVX 3C16C 1XBTA 4M22A 1XJ0A 2ZUDA 1W2GA 2D2FA 3K53A 4TLDA 4B32A 1EFHA 1JQJC 1M7HA 4DDVA 3CF6R 2XZLA 2V1XA 4FIDA 4TMKA 5FOVA 2QQ0A 3GJ5A 4V0LA 2GRJA 3CNNA 1ZNZA 2O0HA 1TNDA 1EFTA 2EFHB 2BV3A 2OCAA 4EPWA 3THYA 1QHSA 2A5JA 1YZNA 1CXZA 4TTRA 3U3MA 1C1YA 4DWJA 3VTKA 4NCHA 5JHHB 2YJTD 3M1IA 1ELOA 5JS7A 3B1WA 3ECCA 2AR7A 2ATXA 3ZS9A 1CP2A 4TMVA 3U6BA 5H70A 2VSOA 4HSEA 2VO1A 1G7SA 4C0JA 3ZQ6A 4EFLA 2QPOA 3DL0A 4A8JB 4C0LA 1F2UA 4YMVA 1S1CA 1JR3E 1NRJB 5H1YA 5J4HA 1SZPA 4Q9HA 4BLTA 2IYVA 1YR7A 4CGZA 4A92A 3AKCA 2ZEJA 3NXSA 1P6XA 1Z6AA 1R7RA 1K8RA 1NY6A 2XNDD 3B9QA 2IHYA 3GFTA 1P5ZB 4JVNA 4M1KA 1E4VA 2UZ3A 2PZGA 5CIWA 1NKSA 2QAGC 2RGEA 1KI8A 3AF3A 3SNHA 2GBLA 2IS4A 1FW6A 1Z28A 2XOKA 2E87A 3MLEA 1NG1A 4Q4LA 3QXHA 2BEJA 2X77A 4D81A 2CVFA 1U9IC 5BYJA 2GF9A 4LSGA 2ZM5A 5E3HA 3L8ZA 3LX8A 4M9QA 1GM5A 4HLCA 4QOSA 4DBLC 2IA5A 1AM4D 2VBCA 1W4AA 2C5LA 2ZJOA 1OE0A 1XB2A 1T0JB 4R71A 3RSLA 5TVKA 2C99A 2ZU6A 4M1YA 2W2TA 1VG8A 5E7IA 3RRMA 3U7FB 1XDBA 4Q47A 4US2R 1CR4A 4IOLA 2ZAOA 4PC7A 3B1VA 3BXZA 4AIIA 4KJZA 2ZE5A 2FH5B 2XITA 1FP6A 5GJVC 4HZIA 1JB1A 2OE2A 2FU5C 2AHOA 3UMSA 2ZSDA 4IDOA 3DDCA 1JPJA 3KTAB 3TE6A 1R8SA 2XX3A 3SBDA 1OHHA 5DISB 4C0AC 4O2LA 2CDNA 2FE4A 1S96A 2ZR0A 3Q7QA 4QGAA 1H8EA 1Z07A 1C4OA 1CU1A 1WMSA 2GHIA 1BYIA 3WY9A 4YLGA 2YKGA 2J5XA 4LPSA 3SBEA 1G5RA 4IOJA 1Z5ZA 4RZ3A 2WWYA 2QA5A 4NCKA 1EFRA 4RCYA 5IK2A 2O8DB 3UMRA 4RD2A 3CB4A 5EQTA 4AWXA 4Q02A 2Z0MA 2K5UA 4QRHA 2BJVA 3MMPA 5F2EA 5KNBA 3SU8A 2CL6X 1T5IA 5EP3A 3SI7A 4DSUA 3GEEA 2ZRAA 2F3TA 4URVR 1KI6A 4G5SA 3Q85A 1NVVR 1P2TA 4I1UA 1BYUA 1NSFA 3JZAA 2WV9A 4HAWA 2GBLC 2F55A 2QUZA 4CEHB 3PUYA 2XZOA 4DCNA 2IYWA 5C4GB 5D3MB 1G18A 5KSZA 3ZD6A 1IY2A 4D4LA 3CZPA 2O8EB 1N5JA 1WB9A 5EUQB 421PA 4LJYA 1ZCAA 1HQYE 2IEYA 3AP3A 5AK0A 1ZUNB 1E2LA 1G8HA 1ZM2A 3U2QA 1OPXA 3EG5A 1NMYA 1E3MA 4HAUA 1HEIA 821PA 4C4PA 2IUSA 2OT3B 2MMCA 3EASA 4ZI2A 1E2EA 4MKHA 1SXJB 3ZYCA 1IY0A 2F3RA 2EFCB 4NCNA 4Z8XA 2IX3A 5KYKA 1KY2A 2BWJA 2OFOA 2DCUA 1OXTA 3WXMA 4OQMA 1Q1QA 4US0R 1EFCA 3FMIA 1SULA 5DLQC 1YR9A 1P9NA 4XSHA 1IAQA 4X8MA 3EZFA 3K0FA 5LDDC 4RY2A 1XPOA 4LV6A 1P3JA 3NH6A 1GKIA 2EW1A 2QZ4A 3FE2A 4I99A 4RD6A 5EXXA 3X1YA 4AKEA 4MDFA 1WQ1R 1AJEA 4XTCS 5FI1B 4GMXA 3L0SA 2XB4A 3CR8A 1N0VC 2DFLA 4B74A 1XD8A 2QEQA 3AKDA 3TNFA 3A37A 2PEZA 3PQCA 2VP2A 3K9NA 1ZIOA 2FNAA 3OAAA 5CYPA 5HTKA 3ASYA 3SFZA 1T8UA 1RZ3A 5DI3B 3WP0A 1TQ2A 4TSFD 2FSIA 4B2IA 4G0NA 4NYIR 1AZTA 3OHMA 2YWFA 2REOA 4LWZA 4PQYA 3I8SA 1AKYA 1XMIA 3OIWA 2CHQA 2F43A 1I4LD 4IDPA 3PENA 4XJXA 2FZLA 3T5DA 1CRQA 2ZJAA 3TW8B 3SOPA 3EC1A 4TL9A 4URXR 4JL8A 4GZMA 3L0PA 5B57C 3B13B 3HJNA 3AVTA 2QU8A 2NPFA 3KL4A 4KFUA 2F9MA 3IGFA 2DB3A 1FX0A 4NBSA 4US1R 4QJ4A 1S0UA 4YXWD 4Q7MB 3ZVRA 2J46A 4E22A 2CL0X 3RS3A 3CF2A 5EE3A 3RS2A 4KSCA 5FL7D 1KI7A 5FOTA 1E2IA 2D2EA 3A36A 3N5CA 2BBOA 4EJSA 1XXHE 3OE7D 4LJ7A 2LWIA 2NOAA 2C96A 2WJVA 3MFYA 4ARZA 5LD2C 1G5TA 3QBTA 4WAUA 3DEFA 3H2YA 4BFXA 1F2TA 4DIDA 3EIHA 3K70B 1ZM9A 4G01B 1W49A 4HATA 1PV4A 1QF9A 2HYDA 2ORIA 2QM7A 2R6AA 2HCJB 3LLUA 2PMDA 4A6PA 5KDOA 1FUKA 4RZUA 3GLGB 1D2NA 3SJZA 1I4DD 3FB4A 1ZU5A 3FDIA 2O0JA 2YV5A 4B3GA 3PEWA 1GVNB 3E2IA 4WZ6A 2O52A 5L3SB 2AK2A 2B7BA 2VHCA 3CF0A 3KKPA 2HT6A 4NHOA 4ZCIA 2FEOA 2FF7A 1KK3A 1P75A 2O8BB 4FCWA 1XXHA 4PPGA 1XD2B 1XNJA 1G7CA 4HUQA 2G83A 1OIWA 4NKRA 2GXSA 3QY0A 3T61A 3GP8A 2H5EA 1GRQA 5H8WA 4NYMQ 1E9FA 2FGKA 4C2UA 3SFVA 5L3QA 5JSZB 2IWHA 2O8FB 2Q9AA 4OBEA 3QQ5A 1IBRA 3WMEA 4KYIB 2OBMA 4Q1CA 5J4VA 1DAGA 4AG6A 4M8NE 1OFTA 3ZQJA 5FPTA 3H0KA 4AC9A 1JAIA 1W1WA 1QHHB 3W8RA 4JBYA 3AVUA 4XD7A 1G4AE 4RD1A 5ANRB 1E2GA 2BMFA 3SJAA 2VP4A 5TXGA 1P61B 3FOZA 3AKYA 1TADA 4BZQA 1RYHA 2G6BA 2EFGA 2Q3MA 2J0UA 1PLKA 3QXCA 1E9SA 3UWOA 4ZPXA 4DC9A 1QZXA 4Q5IA 1SXJE 1UKEA 2XAUA 1E9EA 3SS8A 4JYCA 5C2JB 4EJSC 5FTKA 2WPDA 1E32A 2ZI6A 3K09A 2PX0A 1XEWY 1ZRHA 2W6IA 3T1TA 2PZEA 5KSYA 2QTHA 3BH0A 5TDHA 2ZJBA 4TL8A 4D6PA 1OYWA 3BB4A 4HDCA 2YHSA 3EPJA 3UG6A 2IWRA 4HUTA 1OH7A 1E0SA 3RABA 4JLPA 5AUNB 1SQ5A 4M4SA 2N1BA 3FPAA 4ASUA 2JATA 2HUPA 2Q3HA 3CKLA 4KCGA 4MGKR 5FBWB 1GL7A 1G3MA 1IHUA 4HZUB 3K9HA 1DG1G 2JLUA 2JJ2A 5IT5A 3LQQA 2QQEA 4ACBA 3GJ3A 3ZZTA 5JI2E 1KK1A 3RNLA 1HE8B 2NMVA 3TJZA 2DWPA 1N3BA 3PVSA 3GJ8A 3TUZC 4DLSA 4M2LA 1S8FA 4HEJA 2D62A 3H1TA 5J5CA 1VCNA 1WE2A 2IYUA 2V54A 4OJKA 5EP4A 3T34A 2WJHA 1R10A 4II7A 1OFHA 2BIFA 2PCJA 3NH9A 2ZRLA 3PEVA 4R2IA 5EP1A 1EXMA 2IC5A 2G88A 1XRJA 2EYUA 2J0QA 3RLFA 1TX4B 1EG7A 1Q22A 5GJBA 1PLJA 3D3QA 3THXA 4Q01A 1QHYA 3V9PA 4ITRC 4UXIA 5F9HA 4PX9A 1LTQA 4KFRA 1VYUA 4QM6A 2V6JA 3MSXA 1YU9A 2VIIA 4DEXA 4EPXA 2IUUA 4GFDA 2FSFA 2JASA 2ZITA 1T3HA 2D7CA 2GJ8A 2NO9A 3MJHA 4Q4JA 2CL7X 1CRPA 3IUYA 2EQBA 4DDUA 2F9LA 2WICA 4Q1EA 2ZI3A 1XEXB 3NBZC 3U3OA 2XNSA 1KYIA 2R6DA 3FKSA 3K09C 5HKKA 4HB0A 3UWKA 1TU4A 2PT7A 3CWZA 2R44A 1NSTA 2ERYA 4YMUA 1Z06A 2NZJA 3I8XA 1QVRA 1KDPA 2R62A 1UBEA 3MGCA 1DBSA 4JKIA 2GCOA 3Q8XB 4FWIB 2OCBA 2YWGA 1D2MA 4TT3A 2GILA 3AH8A 2JAQA 1NBMD 1FZQA 2AL7A 4CYMA 1OF1A 2A78A 4L8GA 1DEKA 1VHTA 2A3RA 2J3EA 1Z2CA 3DZDA 5SZIA 3IIMA 4W9MC 5AJXA 2D4HA 3N2EA 3EW9A 2YC2C 4LBVA 1K5DA 3W3ZB 1VYTA 4FMCF 4PANA 1G5PA 3ND8A 3FFAA 5F9FA 2MSCB 5EUMA 3VQTA 2NIPA 3C7KA 4TYPA 3C15C 4BEBA 1UFQA 1YKSA 1E6CA 3QKSB 5JRJA 1KSFX 4QNMA 3SR0A 5HCIA 4BUJA 2OM2A 3KUCA 3B9PA 4JSTA 3AVXA 4E07A 3W5IA 1WRBA 3U7GA 2EFDB 4FD2A 2ZQ5A 5JWOA 1PLLA 4ZDKA 4JZKA 3P26A 4B43A 3LO5A 4TMZA 3R7WB 3SJBA 4KITB 4Z8YA 3G0HA 3R8FA 5IDVA 2BMDA 2ZR9A 4BLOA 1Q44A 1OKKD 4EPRA 1E79D 3SYLA 2LCFA 2PLFA 2XJ4A 3LW8A 1WDTA 2PX3A 2WHXA 3VX3A 4G5QA 1SKYB 3RC8A 1T3SA 3ZIAA 4KVAA 1KO8A 4TL7A 2IYZA 2GF0A 1F5NA 4NL4H 5BQ5A 5CK4A 1B23P 5FI0B 4LBWA 1K5GA 3VKWA 1M8PA 4OQFA 5JEEA 1JEDA 2YOHA 3QNUA 1T91A 3T1OA 3KDSE 1OIVA 2FZ4A 4A15A 1W36C 2E9SA 1CS4C 1FNNA 3TMKA 1G16A 4JBXA 2GZDA 2H18A 3TGPA 5KNCA 1NN1A 1J2JA 4P4SA 3S1AB 1II9A 2NZ8A 2EYQA 4MYUA 5G3ZA 1KJYA 4RFSB 2ZUCA 4KO8A 4NPHA 2JLZA 1NLYA 4NCIA 5HR5A 3R9WA 2J59A 2WWHA 4OYHA 3T15A 4QXAA 1NP6A 1ZUIA 5FTMA 4D0LB 4DSOA 4Z54A 1NN5A 3RVBA 2JDID 3P4XA 4QHTA 2XTNA 1UEIA 2FFHA 4PQRA 1CJUC 4LGMA 3KX2A 3WHLA 3R20A 1VG9B 3AVPA 1HA3A 1NIJA 3RANA 4CT4B 1C9KA 4OI2A 4OQLA 4JLKA 4AKIA 4JLVA 1AN0A 2XTMA 4JKYA 5CM8B 3U3RA 4BQSA 2J7PA 2BBSA 1KO5A 5BXQC 5FBVB 721PA 3RS7A 5F98A 2VF7A 1GDDA 3AEZA 3NIBA 3GLFA 2ZRPA 2OILA 5CB8A 2DR3A 2C9YA 1LFDB 3BGWA 1H8HD 4NE2A 4PSAA 5CJPA 5JCZA 1Z63A 5HE9A 4NYJQ 4PXAA 3WMGA 1P73A 2HLDA 2E1RA 4CEJA 4F93B 1NN0A 1ZM3A 3NTUA 3EAQA 3ZVNA 5BWMA 4TQ9A 1T4GA 2FPKA 3IQXA 2YYZA 3GLIA 2ASEA 3L43A 2IEZA 1KNXA 4MKIA 1J7KA 3TK1A 4BLRA 4DSNA 3MG9A 1AA9A 2GZHA 5E7MA 5GJCA 2ZXUA 3HP1A 3JVVA 3EPLA 1TF7A 4DT1A 4Q66C 4ZDWA 5B58C 1SVSA 3B82A 5CIQA 5GADl 4D80A 1X3SA 4V0NA 5J4KA 1E1RD 1KDOA 1A2BA 1OLOA 1OW3B 1ONBA 5B2ZA 4RKFA 3TVTA 5FR2A 4OHXA 3Q5EA 4G5GA 1IQPA 1B0UA 1U81A 1U90A 2QGZA 1D9XA 3Q7PA 1ZC3A 2NQ2C 5GVRA 1KO4A 3TQFA 1K6MA 2KI5A 1YZLA 3QPVA 3EPKA 5K8LA 2Y8EA 3C41J 4V0MA 4DXAA 1MO3A 4DSTA 1R5OA 2W00A 2W58A 1ZU4A 3BB3A 4DUGA 1U0HC 1AQYA 4UXJA 5DYIA 1KI6B 4FW9A 2XJ9A 1NI3A 3V4FA 5L3RA 3EIEA 3HYTA 2RB4A 2ZYUX 2QRZA 4OQNA 3A1WA 4BFTA 2EVWX 2QAGA 1M7GA 3WBJA 4B3DA 4HB3A 1D9ZA 1TQDA 5DO9A 4AI6A 4M53A 1SKYE 4XIGS 1MO4A 3UATA 5B64A 3O8BA 4S2EA 1DE0A 1U9IA 2ZREA 2D06A 4LJ6A 2ANCA 2V6IA 1W0KD 3I5YA 5CYOA 1XCPA 2AD5A 3OIVA 2ZJYA 2GNOA 2FSGA 4W5WA 1CEEA 1TEXA 2C2HA 1A7JA 1F6BA 1ZM4A 2O5VA 5JBQA 3IHWA 2P6RA 1U98A 4P31A 3RWMB 1J90A 2Z4RA 4XH9B 1RYFA 3OFND 2CLSA 4MGZR 4F38A 3A8TA 4EKDA 1IJEA 1N6HA 1FQJA 2CE7A 2ZJ5A 2DFKB 3F3YA 4P4TA 4LC1A 2Z83A 3TR5A 5TV2A 2YC4C 4XVRA 2CCJA 1CR2A 1FUUA 1IJFA 1XMVA 2BHRA 3PIRA 4GI7A 3JVUA 2X1VA 4BRWA 4X8OA 2WMOB 1WP9A 2H17A 1E1QD 1Z6GA 3KUDA 1N5KA 3CH4B 4BFVA 4B6FA 1KMHA 4BECA 1IXZA 4IEEA 2MSDB 2R65A 1X1RA 2VHQA 4ZI3A 4F4CA 2ZRHA 2IS1A 1N0WA 5CK5A 1ZM7A 4TLCA 4GOKA 3IKJA 4V02A 2PMKA 3KJHA 3NG1A 3P1JA 2OEPA 1YE8A 2CCKA 4M9XA 4JLAA 4LCBA 1Z22A 5JEDA 3I3SR 621PA 3BJIC 4Q4HB 2REXB 2BDTA 2IK8A 4QC2A 1KI9A 3CPEA 2ZI4A 4E5UA 3UKDA 2ZAMA 1NJGA 1P72A 8OHMA 3B2EA 2GDJA 3KKNA 3QVUA 5G41A 4OHVA 1EGAA 2VL7A 3A1VA 1WBBA 2RGNA 1MOZA 2XXAB 2DWQA 2RCNA 3U44B 1NL3A 3OZXA 2CLDX 3VNUA 4OHYA 2ZSBA 4WOPA 5B30A 4IDNA 3SE0A 4HYYA 4CEIA 3WRYC 1FQKA 3NHBA 2HJVA 2G9NA 3MWYW 2X8AA 2QPTA 4FINA 3FHTA 4R2HA 2QP9X 2Z4SA 2FPMA 2IUTA 2HXSA 1HTWA 4Z1MD 4BPBA 2RH5A 3OEHA 4PZZA 1JR3A 2B21A 1UPTA 2ZROA 4JIMA 2FMXA 4BE7B 3WRXC 4EAQA 5KTYA 1COWD 3U61B 1E0KA 4K46A 1UEJA 4BRUA 3U4QB 2VTKA 4ARZB 3SHFA 3QKRB 2QT0A 5K8UA 2DFTA 4ZKEA 4EQ6A 1G6HA 3QIAA 2AXPA 5DN6A 3P4YA 3AKEA 1N2CE 4LRWA 1GILA 3MD0A 1P9RA 3VU9B 3P32A 3OEEA 2ZIAA
chains in the Genus database with same CATH superfamily
1O8CA 1WA5A 1XQXA 1YQGA 4MKFA 4QHYA 2QUKA 2PBFA 5AK3A 2W8BA 1XEWX 2X6TA 2ZAIA 1YZGA 3AO0B 4KE6A 5IAGA 3FNRA 4OI1A 2CSXA 4FXPA 1V6AA 1FY2A 5DNEA 4JYBA 2KHZA 2WB2A 3CZMA 1KKUA 3OTQA 3RTEA 4PG8A 1NUAA 2NYUA 2XNKA 2YCBA 1FQOA 1WXXA 1DZIA 3VZCA 4ALIA 2NUBA 2ZT8A 4RABA 2HA4A 2RGWA 4RA6B 3MJRA 4LCEA 3V8MA 2RB5A 2YHAA 1T5OA 5K8CA 4L2IB 5EMMA 4KE7A 3M4NA 1HT1E 1JSCA 3FPHA 3KQMA 5K0EA 4ARUA 4Q48A 1WULS 1Z29A 5AW9A 1Q1EA 1WMEA 3PL1A 3ESYA 3GROA 3OICA 4JB8A 1RLIA 2ZIZA 1G7RA 3ZEIA 3G59A 1EA7A 1NXOA 2XEDA 1L5HA 5BN3B 2CEAA 3BXPA 4H1HA 3F9IA 4EI9A 4E6PA 4FYXA 2R4QA 4N5NA 1WXEA 3WLFA 4TROA 1JXAA 4B8YA 1M2OB 3PZRA 3QLUA 3PITA 4A3SA 1E0AA 1IPHA 3DE7X 1AV6A 2VNAA 3CNOA 1Z5OA 1E2KA 4MV1A 4A6DA 1VBFA 4DLRA 1JHXA 1U9CA 1XQVA 2BMEA 3D1VA 3X2SA 3ELYA 4LMPA 1WXQA 1FPMA 3DEAA 3BERA 1S89A 1ZIYA 1GRNA 3L6OO 4IQ8A 4IICA 2FX3A 2PBRA 3DQZA 3IHKA 3W3AA 3ER8A 3HYRA 4HMPA 5DHSA 2ZJ4A 5JRDS 3U9SA 3WGJA 2IPLA 4QGSA 1C7ZA 3AEUA 4KN9S 4M1SA 2O1WA 4AWAA 2VHJA 4ND4A 2FDRA 2PWAA 3OLXA 4MPRA 3V2HA 1BHSA 1JDVA 3BS4A 4PR0A 2V7UA 1WX1A 1XDSA 5LP6A 1BN7A 1ESNA 1QB8A 2CUKA 4HAYA 4O4IA 4KWIA 4BP3A 3EXAA 4Y6SA 3SYMA 4MCHA 4EVSA 4ZIRA 2ZYAA 3KQPA 1Z0JA 5C3UA 4URWR 4W63A 3I39X 1RHMA 3WFJA 1XO1A 2RHJA 3K72B 1WUKS 3ZJYA 3GK3A 3N05A 4BCBA 4H9GA 5CCBA 1NUHA 5IXJA 1NJ1A 1U4SA 4FT4A 2VPIA 1BC5A 1J0EA 2P9JA 4M76B 2C5GA 3T9FA 3AL2A 5HIKA 1T2VA 1WG8A 2GEUA 1BMQA 1V8OA 4FZ5A 4GX1A 3SLGA 5JD5A 3AY6A 4YEDA 4EG4A 3EBLA 3UT0A 1VKNA 3I9V1 3NO4A 4N76A 1KYQA 1O1YA 4BMSA 3V8QA 2FRVA 3RRYA 3I1FA 3NIDB 3AXTA 4LSWA 1VG1A 2G1PA 1LSJA 5EKUA 4NNJA 3IP1A 1QFJA 3ZZ1A 2W6OA 3F46A 1HZZA 4DDWA 1ES9A 2VYNA 1AK1A 1N2HA 1ZXBA 1RRVA 3NBAA 4JLOA 1V1JA 4NYMR 1QV7A 4URUR 3G68A 1HUQA 1Z6QA 4G6ZA 3NNDA 5C80A 1NW5A 3BKWA 4YAGA 3DDSA 2X2EA 3A25A 1HKUA 3RASA 3TD9A 1ONOA 1EFAA 1EK6A 3KTFA 3URMA 2GR9A 4PFSA 3RJ5A 4UPVA 4J1SA 2E49A 1UDXA 1F0YA 2YV2A 4NXMB 1M83A 4F5EA 4YCNA 5I01A 4O8CA 5SZKB 4B73A 4HN9A 5KNBH 1ZOIA 3KT8A 4AKGA 1KOFA 5AW5A 3GVHA 4KQ2A 2HRZA 3OUTA 4DRZA 2QX9A 1H8ED 3UMCA 1GFZA 2VT6A 3JPWA 4IOMA 3N2LA 3U81A 4BN5A 3VPDA 3EVGA 5B6IA 1DTWB 1P19A 1APBA 3HLYA 1LLFA 5IAJA 3PR1A 2GCOB 2O2HA 2WWRA 3PJDA 3ZHUA 1BH6A 4QUGA 2VJMB 5B1EA 2C88A 4CIAA 1I6WA 3K9GA 4N5DA 4FBGA 4PZYA 2Q9BA 3BXGA 4DWOA 1YDEA 3GLVA 4CCYB 5C46F 1DPFA 2FX5A 4AD8A 2GN6A 5KNBD 3I4FA 4DLAA 1I2AA 3G5MA 4R2LA 5AQ1A 3KXPA 4ERXA 3IJRA 2W70A 1CVRA 2C3UA 2WWFA 4AZ0B 4ZCLA 1YUMA 4KXQA 5IJWA 4JEHA 4KH1A 4C43A 4O33A 1GXSA 1GUZA 3HSSA 3K5IA 1P62B 5COAA 3ANNA 3W3AH 5A9RA 3GJXC 5ICMA 4PZLA 3G17A 2OHIA 4Z3DA 3ZZNA 4DR2B 1EX6A 2F17A 1PVDA 5E9QA 4W6ZA 1E5QA 1RQXA 2HDOA 1PBNA 3R6GA 3BORA 2ZYGA 1GCUA 4BJ6A 1EKXA 1EE9A 1F0NA 4H1VA 4J8PA 1VZ3A 3T4EA 2UYCA 1Z5GA 3SP1A 3ROPA 1V4BA 1NBAA 1HZZC 1DJMA 1KFCB 4PNHA 2H1WA 1RWVA 2E2WA 3A4YA 1XAJA 2AUNA 2P1DA 2I8LA 3EW7A 4GD3Q 2NU9B 3UJ9A 2FPXA 3E5RA 5FFMA 3AF6A 1X9HA 4BX3A 2EHJA 4NICA 1C3OB 3EE6A 5JS1A 2Q5EA 4X60A 2FJ0A 1DIGA 2IEBA 4NMWA 3T52A 2VHZA 3NRBA 5CG2A 1NM5A 3K35A 1JAXA 4IV0A 1KBOA 1CUBA 3TI7A 4DR1B 3BQ9A 2JI7A 5IJ0B 4YJHB 4KV9A 3COWA 2QRNA 1BHJA 1SBCA 2R8EA 3STTA 5IBPA 3AHEA 1US8B 1OFIA 4R40A 1ZPDA 4N8SA 4CKCB 4D3FA 3NTRA 3TLYA 1FDWA 3QBEA 5JO9A 5AKLA 3TZHA 1JU4A 1Q50A 3ZCXA 3CBGA 2V6FA 3LQRA 3ZV7A 2FFQA 2YOFA 3SEZA 1NUQA 2QL5A 2V7GA 2VUTA 2QPAA 4Q4AB 4V0OA 3PNOA 2OZPA 3JZIA 2J6IA 1NMZA 5BQPA 2R6JA 4E08A 1ORDA 1MQSA 1TZBA 3MS2A 3H5NA 1PS0A 3Q2OA 4H31A 1Z4QA 4HHEA 5D85A 2J33A 4FI3F 3SN6A 5KTTA 4BU0A 3ISJA 4MHTA 1ZUNA 2F64A 1DAFA 1BFDA 3G0IA 3HI4A 5JPIA 1BKDR 1ZUHA 3EC7A 3OAAD 4MUBA 4OKSA 1SUCA 4FX2A 4FSXA 4RHXA 1PNVA 3CCCA 3WVNA 2XOEA 3EDQA 4B33A 3E15A 1OTHA 3PXGA 1IHXA 2M6SA 3NVAA 1PVOA 1BU8A 4Q9KA 4JJEA 3U5ZB 3TH5A 1Z2DA 3A1SA 1NRIA 3PDHA 1SCQA 2KSQA 4B0PA 1I9CA 4FFRA 3PC6A 2ZRJA 1C9NA 3TCXB 1JJBA 2B61A 1DG3A 3QHQA 1U1FA 1UMBB 4EOGA 1AQNA 4QLOA 4YP6A 4MRSA 1SBIA 1XE3A 3IOYA 5K3CA 3ZE1B 2WIJA 2LKDA 5ITSA 3TKLA 2JFHA 5J2TB 4PPQA 1M1NA 4KKVA 2Y2VA 4OJMX 4PF1A 1KJZA 5DWDA 3R9KA 3T94A 3DOFA 4J3JA 5H9WA 1EIZA 4UQOA 1KPHA 2Y1LA 2ZJ1A 3ICVA 2CJWB 2IYFA 3I9KA 3R5HA 4MARA 5IP5A 3LGAA 4JKOA 2IZ6A 1NM5C 2V3CC 2O0MA 1WCIA 2G17A 3LP6A 2VRBA 4J2OA 3H97A 4O1MA 2NTEA 3PUVA 4M1QA 1MABB 4YRJA 4GLFA 1ZLYA 1I30A 1V43A 5A3VA 5JXGA 2HCRA 1GCOA 1ORIA 2L19A 1R9MA 1HNWB 4K2HA 5ECGC 5FKJA 4U7DA 2IEAA 3OJCA 4KVGA 5BURA 2J87A 4LMAA 2B1RA 3BE4A 4DA0A 3JWJA 3ZE9A 4G4SO 4REQB 1DZ3A 3C97A 3FCCA 3TBHA 4KPEC 1T3TA 4HR7A 4CNBA 1B41A 2XCSB 5H3CA 1EPUA 4ETNA 4RD3A 1USVA 1YZVA 2DG2A 3EXFA 1K7FB 4G56A 4ZHQB 1TKRA 2ACKA 1V3UA 2Q07A 2Z9DA 1YVUA 3KCNA 3L9WA 4OK6A 4PHHA 4QGFA 4D5EA 3SJUA 4IJ5A 3OLWA 2I7DA 1EDZA 3CWCA 4DPLA 3GLIB 2NU8B 1M2VB 1ULHA 1VLVA 3ZGVA 3WB9A 3QF7A 2JDIA 3N2KA 3H1GA 4HX2A 5AW3A 2GXAA 4A27A 1KJIA 2ZK7A 1KK0A 1EUCA 3ABQB 4Z9XA 1NAIA 1UK6A 1BEUB 4IDHA 4KQGA 1NLZA 2EFJA 1DTSA 5ALHA 1LTKA 2Q2NA 2ZBUA 2J9FA 3AIOA 5KVVA 4GKVA 1CY4A 3I8OA 3EGEA 4HZGA 4J91A 5J2TF 5KYUB 2YDXA 2VAVA 1MR3F 2IOQA 2XQIA 1EX1A 2REQA 2F8LA 4E11A 2QJOA 2B3TA 5JC1A 1KC1A 3QKUA 3RYCA 3QPDA 1W34A 3F97A 2GK7A 4QG3A 5EHQA 3OZDA 1OB5A 3KS9A 4UHFA 4UASA 1F7UA 1UJBA 4MWCA 4MJXA 5DE3A 3TTSA 3WRVA 4ZARA 1A72A 2AG5A 1S2LA 1CE8B 1NXXA 1N2BA 1N8TA 2ZVQX 3A3YA 3KZKA 2EQAA 2D0DA 2EW8A 4DIBA 5AM3A 2ZT6A 1W5FA 3MGAA 4TMTA 2O8CB 2YJNA 3WNCA 2PRYA 4N7RA 1QVAA 1ILWA 2DY1A 4TRJA 4ZAYA 2HQSA 2BGTA 4PQFA 4DNXA 2QS9A 1J25A 4YMWA 2HHLA 2JLQA 4TSRA 4F4IA 1JVNA 3EY9A 2EJWA 5CR9A 3UANA 4TV8B 4Z7JA 4WNCA 4Y9SA 3NORA 1PEKE 1HLDA 2B99A 5JHGB 3HGTA 4ZHQF 2XGJA 4FDLA 3ZDXB 1KZ7B 1T10A 1YL6A 3C3PA 4YAKA 4QVIA 1L4YA 5FR1A 3EEBA 2JG3A 2OV3A 3SJCA 4X20A 1W9MA 4IFBA 3MAAC 4BEVA 1OQAA 4NZOA 5FUBA 5JSYA 3MTBA 4IGAA 1VP9A 1HGXA 4NCJA 2FWRA 5DNYB 1S5PA 2GGSA 4JVMA 3WGNA 4BO3A 4R51A 2PAAA 4I5DA 2WTMA 4K26A 3VFDA 3W5HA 2IH5A 4EUSA 1H85A 2IZ7A 2OFFA 4H4DA 2JJ2D 3F3KA 5DRYA 4GLJA 5C5EA 4ZDIA 1NVBA 1V37A 3G6WA 3D02A 1YRQA 5FWNA 5JSHA 1JFFB 1FSFA 2QVXX 1GPMA 1GQSA 4RL6A 2CYAA 1Q3TA 4BE9A 2A5YB 5L4NA 3CVWA 4KO4S 5ARDA 3E9MA 5IVKA 2AN1A 3AIKA 4E5YA 5HUQA 1QBGA 3TKYA 4YYZA 7YASA 3EF0A 3HHEA 3MRTA 3T35A 5I4CA 2IP1A 4DE5A 3II6X 1ZA1A 3L6RA 4C1BA 3K70C 1C2YA 2GD6A 2HX1A 4JHXA 2O7QA 4LDZA 5FBZA 4EGQA 2MYPA 4H1TA 1A96A 5IULC 3LX6A 3IR5A 2N42A 1CLEA 5FPSA 7AT1A 4PAMA 4M9ZA 2ODQA 4MXDA 1DBQA 1P2DA 3DXFA 1YBFA 4TV8F 4NTZA 5JH7A 3BF8A 1H69A 1KBQA 3GT3A 4MW7A 3U7RA 4BVJA 5K0SA 2AYZA 1Q0UA 4FR0A 4KQEA 1L5LA 4F85A 5F7JA 4X3CA 1Q0PA 4EM6A 3IMCA 3GWZA 5CLHA 4FI3C 4TZTA 3OZTA 3VR0A 4ZFNA 3HXKA 2IH4A 1NJ6A 1QU2A 4F06A 2XWPA 2LNDA 4NV0A 3LFHA 4U7HA 4EWLA 4DWVA 4NAHA 3DJYA 3L8DA 2A0WA 1LDYA 2BH9A 2P67A 1D6JA 4XIFA 1YA4A 2O8VA 1DS6A 2D13A 2XE7A 3FLBA 4MUIA 4PLCA 4B3TB 1HE4A 2A4MA 4PG6A 4XQGA 4B3JA 1H9CA 1GSAA 4O59O 2AK3A 3ADBA 4D9EA 3OY2A 1HDOA 3PUXA 4MV4A 1NVWQ 4R1LA 3I9FA 2YV1A 5TT0A 1ARZA 2VZ0A 3I2HA 3BB1A 3QPWA 2F6RA 2RHDA 4A2CA 3R1IA 2EJVA 6Q21A 1QGAA 2WJWA 3QEKA 3MBOA 4GGOA 1NW7A 3VZSA 4L51A 5BSRA 1K7YA 1JIUA 2ZB7A 1V9SA 4I6JA 2DM6A 2PZKA 1JMKC 3C1AA 1P4AA 2RHRA 3N0WA 5LZ9A 1F6DA 3T7JA 2XQVA 1FL9A 1AO3A 5EIHA 2C4KA 3TW6A 1B2RA 4BZWA 5K0CA 2FMUA 2XNDA 1GTVA 1S7CA 2ST1A 3DQPA 4YREA 2VH1A 3ETGA 4MRVA 4JI6B 1GHTA 3N07A 3VNVA 4G0PA 3BOSA 4DLVA 1U6KA 1FMLA 1Q74A 4KFTA 3HKBB 4RJKA 3TDKA 5JY1A 4KFCA 4N3CA 4WOJA 1ZSVA 1XA0A 5AOAA 2PO5A 1ISJA 1E4OA 2D1SA 4P92A 1DLJA 2D8AA 4IZIA 5LP1A 1AB5A 221PA 3M5DA 2FW0A 3EG9B 3CUWA 1Z47A 2AN9A 3KZVA 3VZPA 3KQNA 3T0FA 1DL5A 4YRNA 1L5SA 3GT4A 3MMXA 2PGAA 4Y1GA 2Q8QA 1R0BA 3UMVA 4MQLA 1NIPA 5FF9A 1A5SB 1Z6TA 2QVYX 1DKQA 3BZBA 3OA2A 1ZK0A 1YDWA 4F97A 1VPLA 2QLFA 4U63A 4QUHA 2D74A 1QO9A 2VJLA 4DCOA 2VJKA 1MAVA 4LFAB 1KMMA 1VSQA 2I1LA 2JIBA 2H2FA 3BJZA 3FDXA 3ULKA 4FUQA 4WZBB 4EELA 1PDWA 2DKNA 1D7AA 3QXJA 5IF9A 5JNVA 3OZVA 1I3NA 3SKVA 4YRAA 3IEMA 3QYFA 1ZGAA 1ZH2A 4BGDA 4YJDA 3KJQA 1I2ZA 2AJTA 3QENA 1NJ2A 1U7PA 1E58A 4ZPJA 3KE8A 4NZ9A 4ZYYA 1JKJA 2OC4A 4YI3A 1VE6A 4H6XA 1VSVA 2NVOA 2Z04A 3RVRA 4X0EA 4CV3A 3O94A 2CFIA 2JF0A 4HVLA 5KNCH 4JOSA 1VSUA 3U39A 3PT9A 4I1YA 4JVLA 2H2HA 3AY0A 4I1VA 4ITVA 2C97A 2WA1A 4O0MA 3LBIA 2SKDA 4EIWA 1VIMA 3QMMA 3T3OA 4LBYA 1K8ZB 4DDMA 1HFKA 4ZO9A 4GNKA 4NCXA 4BLQA 1TI7A 4MDYA 1E9VA 2HADA 4R9SA 4LNUB 4LZWA 2G77B 4IIEA 4MTLA 4F8YA 3B3AA 3HWX1 4RLSA 1ISFA 3FPCA 2BEWA 2W7TA 2CBGA 4FHZA 5AI6A 2EC5A 1OYYA 3UT5B 5KNCD 1V8PA 1WP4A 4RVSA 3TOZA 2KX7A 1OXVA 4CQMB 2Z9CA 2HT1A 3B52X 1RC0A 3H04A 2Z5VA 4UM9D 5BVGB 3TEMA 3RBXA 4IIDA 2YMMA 3JAKA 2PSEA 4W1SA 4YAUA 4R8MA 3U7EB 4UPEA 1FNSA 5HJ7A 3BGSA 4QEKA 2A9PA 2CF6A 1FMCA 2IQ5A 3AETA 1JBKA 1EWVA 3K0FB 4Y7DA 3TM5A 4D8YA 2FMFA 2GYUA 4J6EA 2DECA 1DIBA 4OP3A 4QPDA 2ECKA 4YAWA 3HXOA 3I62A 4AY3A 1O54A 3EVEA 1RJGA 1MJGA 1TOAA 1U0GA 1BZYA 4S0XA 1QOPB 3B78A 3FPBA 1IJBA 1YHNA 2D7DA 4X92A 1XP8A 3PL5A 2JFFA 1KDZA 1W4ZA 3H7IA 3D3JA 4TKVA 1ISGA 1KC3A 2F7SA 5H4GA 2VK1A 3FJYA 3PQ2A 4EA9A 5T67A 3DWEX 3RFCA 1H65A 3SF8B 2Z43A 3HEBA 1F8FA 3L7LA 4RK4A 1QOQB 4G0VA 4FDAA 1ZKMA 2ZZNA 3Q8WA 4EHFA 3W5AA 1IOVA 1VA4A 4C0SA 1XTJA 2D5IA 2D54A 7REQB 2P3QA 4RFSA 3HBJA 2QGFA 4KO1S 4BNHA 1ADBA 5JCOC 1D7OA 4G0QA 5GGXA 1W1IA 1SXIA 1IIBA 2Y92A 2PMWB 3EARA 4FEGA 4J7CA 5CVEA 4CG2A 3AI2A 2A84A 3JQ9A 2W2LD 3O4VA 1VSTA 4FMDB 2B98A 5B1DA 3BRSA 4EGAA 5AYVA 2VXYA 4R31A 5GM1A 3KVOA 4MW9A 4AIRA 3S8EA 4ZT4A 1FX0B 1OXXK 3LPNA 4L8VA 1LLUA 1S3GA 1QFYA 4RPGA 5HJ2A 3TR0A 4AZ3B 3IIEA 3NAMA 4BRSA 4X1IB 4KQHA 1NWHA 4TTSA 1XEAA 2AEMA 1TIPA 2ZB3A 5JCPA 2QN3A 1P0CA 5CB6A 4D9CA 2OLJA 3N8HA 1NQXA 4JYPA 3DXZA 2PS9A 3DLPX 3PQ4A 1FFEA 1R6DA 1ORTA 3NFRA 1E2PA 3A3PA 3H65A 3HR8A 3L5KA 3LCCA 4I81A 1WF3A 3A31A 3OOJA 4IMIB 1F2TB 4EEXA 1YAJA 1HG1A 2OFWA 5L8VA 1RRCA 3WKDA 3CLUC 4P86A 3T54A 4NBTA 2ETVA 3U7JA 2R79A 2V9CA 2QTWB 3NJ8A 2QL6A 2VATA 1E6WA 2Y9MB 1W1UA 4MUXA 3E3MA 4XXHA 1Z8DA 5LU8A 5JY6A 3LX5A 3PXDA 1G1MA 4ZOLA 3GRZA 1OLSB 2EZTA 1QG4A 3G1UA 2FW6A 1JHMA 3I61A 3KYCB 3JTEA 1JDBC 3QPAA 4EYEA 3PHLA 1AF4A 2Y68A 1HM5A 1V95A 5CLQA 4LHXA 2C8KA 4FOPA 1EUZA 5DK4A 2C2YA 4ENVA 2PX8A 3DTVB 2I54A 1Y1PA 1XXHB 1B8UA 2K4MA 2PX2A 1ONPA 2ZKIA 4FMBB 5H68A 4PYMA 3E0XA 3T12A 1C3XA 4DANA 4YRZA 2XKBA 4MQ4A 2HTEA 4ATNA 5K0FA 1FS4A 5EE0A 1NOKA 2IXFA 1T9GR 2OBFA 2IYSA 1N2CA 4DC1A 3E9DA 2E85A 4ZGGA 3T4UA 2WB4A 3MTAA 4FMDF 3AJ9A 1M2FA 3UAZA 1IXYA 3MXOA 4W7SA 5EFOA 3JSXA 1HDEA 4LYJA 3IERA 4ZZIA 1ZIXA 4M38A 4TYMA 2VHVA 4ZTZB 2JBAB 2WUFA 3JQ9C 4G3XA 1NXQA 4E14A 3R5KA 1S3SA 3DZ8A 1CF9A 3OIYA 1N7JA 2JAOA 3MTEA 4OJNA 4OIFA 3VOSA 2QN1A 2M6RA 3WIUA 1XAGA 4YN3A 4CJXA 1NR1A 1WUJS 4QX6A 3A3NA 3R7DA 2Q2WA 1LBHA 3GG2A 4YACA 3CNLA 1SQGA 2HO4A 4XDZA 1JFLA 1VJDA 3HP7A 4FKZA 4RZIA 2NZWA 2QUJA 5EWMA 2FA9A 2ZBPA 4Q12A 2HF7A 1CZHA 2QJFA 3T0GA 1H3NA 3BL5A 4PSDA 1KSGA 4ZYLA 1V3QE 4D8TA 2FJPA 1G5FA 1P3DA 4JUIA 2GYVA 4R8RA 2QB5A 3AERB 3W0LB 5HZMA 2JGRA 3NBMA 4KI7A 4YFYA 1QYIA 3HVHA 4NC9A 4C14A 1QB7A 2FPWA 2DUUA 2ZRDA 3T9CA 1T13A 4MDHA 1MCZA 1VKRA 3T7TA 1QRUA 1H66A 4H59A 1CKEA 2ZIVB 1GGNA 1ZA2A 2X8JB 3LHDA 4O4JB 4KR2A 4TYWA 2M1XA 4JI1B 4O4HB 4QSMA 5FWXA 3ZGLA 1J2EA 2O7SA 2O0LA 3ISVA 3HY6A 3UFBA 1ZMXA 2OORA 4F6LA 1ZAKA 2WIAA 4QQ8A 3EOBI 3IQHX 4LECA 3OQ6A 3RKSA 3TSOA 1SXHA 1YOVB 4HNHA 1X80A 1BDIA 3WLRA 5CDSA 1M34E 2RG7A 3DPSA 3ORSA 3G5UA 5BV2P 5AJVB 4UNIA 3NONA 1Q83A 3CW8X 4LC0A 3H8VA 1EM8A 2CXPA 3CQ9A 4OLHA 3BMXA 4QL3A 5HCNA 4B4UA 1T1JA 5ES3A 3OCXA 2XY4A 1FRNA 2FEAA 2OHFA 3N1UA 5FNVA 1KK2A 4E7PA 1U8ZA 3MWDA 4UEKA 3V4OA 3THXB 3S2SA 2GJ9A 2Q3LA 3WL8A 1TZMA 3OCVA 1O94A 1ZINA 5AWFC 5A5DA 3TQCA 2C4MA 3CWQA 4LBZA 5K3FA 1UPCA 4L5CA 1XRLA 1XQYA 4YRFA 5DP1A 5E6SA 4HH4A 4LVUA 4KPFC 2ONKA 5BVHA 4QUIA 2IY7A 2K7ZA 1BG6A 1H9AA 1PT5A 1T1RA 3BMOA 3EBPA 1MDBA 3U4IA 4G9BA 3ZTYA 5KMGB 4ZMSA 5DN6D 3L0YA 4K6CA 3QKTA 1L1QA 1Z18A 2QGNA 5FUMA 4BTLA 5GY7A 1NKTA 2HA5A 4R7GA 2QSYA 2R7NA 5F7XA 4RJIA 2O23A 4IIVA 3UPTA 1A98A 2CXXA 1CEXA 3E7FA 2VZLA 2O6HA 3X1XA 1TEVA 1BE6A 3ZCPA 3S2FA 1LW7A 3K31A 3WQHA 3E5HA 4DB4A 2OXIA 4IGFA 2ZBVA 4O4JF 3EWSA 4TTAA 1GCGA 4OV6B 1A9YA 2ADFA 3ZQ4A 1EVLA 3GDWA 2JCGA 4G5HA 3DLTA 2AJCA 3W9YA 3WFZA 3A9CA 2AA3A 4BATA 4ZCMA 4DR5B 1EEXB 1UZMA 3BRWD 2QAJA 3NXKA 4WK2B 3RU3A 3VUEA 5IKMA 3RSQA 5A3SA 3LLSA 2PKWA 3CLSC 5C5DA 3QNWA 1WNFA 5D6OA 3IR7A 3T7CA 3BFKA 3W6UA 1JXQA 2QUAA 3MS7A 1W4CA 4UNNA 3WLSA 4WA7A 4AYWA 3U4QA 3IAEA 3CNHA 1Z36A 4L85A 4COOA 5BRJA 5LMZA 3L0ZA 4RMJA 4BFUA 1YS7A 1G4UR 3VU3A 5D5QA 2RG1A 2WYHA 1L5MA 2O5EA 2GPJA 3VMFA 4UM8B 4ED9A 1IQUA 3BWDD 4UREA 2CFTA 4BLPA 4XGNA 3PNKA 3QRWA 3JQ8A 4G86A 1GGVA 1BCRB 3Q7IA 3VPSA 1MT0A 3CUSA 2Q1TA 2GF2A 3N0VA 1CSEE 1URPA 4P53A 1XVLA 4AQ7A 3FIJA 4RF4A 1PUJA 1IRXA 2WSSD 4DG5A 4BV8A 2AZDA 4LA4A 4PY2A 3LY9A 2C9CA 4KODA 2EWWA 4L4ZA 1X1EA 2CFOA 5KC9A 1R9JA 1O94C 2I2CA 2VI5A 3ENVA 4OHMA 4WCVA 1L4MA 2IEIA 3RWBA 4C0KA 2IYOA 4YP5A 4ODIA 5LLSA 4MVWA 4K9OA 2Y1DA 3MYRA 2I2XB 4NYIQ 4PCVA 3EPRA 1K8QA 3JYHA 4WK6A 1UT6A 4YONB 2OXEA 3ESCA 4ZEOA 1ZNYA 3TAHA 3TQRA 4A1FA 2FWJA 2WTXA 4CUZA 2X1MA 4OEHA 1U8EA 2X0RA 4H3KB 4EEZA 1YJCA 4KX5A 5C32A 1JEYB 3CX4A 5DP2A 3MJDA 2D00A 3RIMA 4WFKA 2OOKA 1PRYA 1T5HX 5GQSA 5CH3A 4PRZA 3DR5A 4FN4A 4J0KA 4FYIA 2X0FA 3WR5A 3WYFA 2H63A 3SZRA 2ZDHA 1NNEA 4RVUA 2ZUEA 3H9BA 3JZDA 3VR3A 1FFSA 2W6JD 5G02A 1GV0A 3I9V6 3N53A 3RUEA 1XNQB 2NTYC 3LRPA 5KWEA 4YJ3A 1F51E 2YWHA 3AL3A 5HG0A 3SSMA 2WJ4A 2AUTA 1ZJYA 1U2QA 2NV2B 1P2BA 3C7AA 3MN1A 4EVQA 1U80A 1RFLA 1P4HA 1RKVA 4FFPA 2DRIA 2QTNA 4MUJA 2WTNA 3G2NA 4X8HA 1YZKA 1E2DA 1O0CA 5J40A 5JFTA 4MB0A 2Q5LA 4MWDA 1ODTC 4PX5A 4QSHA 1D5CA 1VI5A 1NTRA 4LPKA 4N01A 3BEDA 2B0JA 1KQGA 3HYSA 3IJ5A 4D56A 4UTOA 3CKKA 1K0UA 2EERA 3CU5A 1MTOA 3DB1A 1F60A 5EWJB 1D1QA 3N7UA 1KY3A 4FFWA 3R7LA 5B1YA 3WB0A 2GM3A 3V1MA 2BGKA 2VT2A 5IS2A 1HFWA 1T5TA 1V5WA 1YT5A 3HVJA 3C4QA 2VQEB 1LI7A 3FHLA 5JPDA 2XCQA 1U3FA 4EVIA 2PWZA 3JR3A 2JI6A 1WUIS 2E5LB 2GEFA 5DSTA 3FWZA 3PUZA 3RYHA 3QU2A 5AQEA 1AE1A 4LI0A 3FI0A 2XDWA 4YJFB 3WLOA 1VL6A 3G2KA 2K6GA 3V00A 1R5BA 2D8MA 4R6WA 4YBZA 5E6UB 4URYR 1T4DA 3OQJA 3ZGXA 1LPMA 2KS6A 2ZRCA 3GV0A 4A91A 5ALMA 1P2GA 4ZC1A 2W93A 3EX7C 4KNYA 2A0UA 4K6HA 5CDGA 3JYPA 4LQLA 1AGNA 1N2OA 4HFMA 3KAPA 4G63A 3JASA 1XZKA 3FOBA 4A5SA 5JS6A 1CY8A 4A0FA 2QMZA 1T4BA 3QHPA 1D07A 5D87A 5TQJA 3K0AB 3UHPA 4OP2A 4PO8A 3LDUA 3RAPR 1WBJB 3WK8A 1T9DA 4M88A 2YBEA 1LC3A 2TSYB 3DWFA 2WSIA 1OC2A 4QIHA 3GLFB 1TYDE 2ZRMA 5JS8A 1YZTA 1PSWA 2NXEA 1F9EA 3KFXA 4MYHA 4R1QA 5FWYB 3N6VA 4ZT6A 5J43A 5KYTA 4PRYA 3TFOA 2GBIA 3M81A 5AP9A 2OAP1 1ZGHA 3KZMA 5H4HA 2E37A 4BUZA 3UV7A 4M0PA 3CUYA 5I7AA 3DCIA 1TM5E 1JHOA 3OLVA 5AVXA 4MS1A 4M9RA 4L9AA 4NVRA 4CL8A 1F0PA 1KVUA 3F96A 4XKJA 4BKQA 2FPIB 3O82A 5ILGA 4Q03A 2FEXA 3EC2A 1ZEJA 3T6KA 3FYHA 3MPOA 1Z2OX 1CUDA 1MV5A 4K40A 4ENQA 4DT1B 5HZGA 3BTOA 2W42A 1JPNA 3NUGA 4OX9B 4FGZA 3OHPA 2QSUA 1HTTA 2A9KA 5JFGA 3QE2A 2G08A 3P9YA 3UO8B 1A27A 3L6BA 3KVNA 4G9EA 4H15A 2HZBA 4RL4A 1QH1B 2VH5R 2R9VA 4B7XA 3SIRA 1DKOA 3E9CA 1N3LA 4TZ6A 1KEEB 2WSBA 1Z73A 3GYBA 4BN4A 2YWDA 1MNAA 3Q3EA 3G8YA 4BNKA 2Q28A 1YMUA 4DCUA 2G9RA 4R69A 3ZJ4A 1G9TA 5BR4A 1A77A 1UBFA 4IIYA 3MOSA 3FWHA 4LZAA 3OQHA 3GMTA 1M54A 1U5BB 3EXIA 3GD5A 3DE4X 4KJXA 5AKGA 3RKUA 3PYLA 4D02A 2IUFA 5DYTA 3FRJA 1EYZA 1TA0A 3FGNA 5F33A 2CKMA 4H7FA 2YFHA 4DV0B 5HJ5A 5ELXA 2LKCA 2P6UA 4XIIA 5DGIA 4EHBA 4ETWA 3DUFA 4PQEA 3KB2A 5BOSB 3OQOA 3DO8A 3HDQA 4B76A 4L28A 5JVDA 3CONA 3PD7A 4KQMA 2AGVA 1RIIA 1A4XA 1LU9A 2WZQA 4TV9B 1EFKA 2I4LA 4PC3A 1GGEA 1WVIA 3ORRA 3TB6A 3F78A 3ASUA 5LPNA 1L8QA 2R7LA 4NE9A 4S1NA 4OH1A 3UTDA 2B69A 3ZVLA 3AR3A 4W5JA 2QROA 5CA1A 5G4LA 3SC3A 5LZ4A 2GM4A 2PSHA 1WUTA 1GU1A 2FMHA 1GKKA 3OJOA 4JAVC 2JLWA 5HQ3B 2GOYA 3N2NA 4I5GA 1YUBA 1S2NA 4R2WA 3BH7A 2DPLA 2HWKA 1E1KA 3P2EA 1FUIA 1VCIA 4DR7B 2WAAA 4D26A 4EPVA 4P32A 4WIAA 2O2DA 1L8AA 4A0SA 1H3FA 2Z1MA 1P8AA 2HIMA 4GE3A 4MYTA 2VTBB 3CCFA 4E70A 2Z6AA 4X7BA 2HK8A 1GAEO 4GX0A 5JQGA 1CJBA 1X7HA 3M89A 1M2NA 5EJEA 3T95A 4PG7A 1TT5A 4IUBS 1SG0A 1DIRA 1N2JA 2O7VA 3LH5A 2A59A 1GUAA 2DFVA 3INTA 3ZD7A 1PZNA 4MMXB 3VHQA 4D0SA 1JSRA 1ZP6A 3I6MA 3L82B 4O2BA 4YGYA 3CVVA 3GA5A 1OX5A 3D6AA 4BFYA 1B6SA 2GLTA 3MT0A 5BWLA 4G9GA 1FP7A 3GWGA 2ZJ3A 4I4TB 3JD2A 2C8LA 1RLMA 3RDPA 2HA3A 5A4JA 3U19A 1ZK4A 2BT4A 4M1WA 4NDAA 4FSDA 4I4IA 2BMWA 1IN4A 1EJ6A 2BKXA 5F7ZA 4MVJM 2X76A 3WGZA 3DO5A 1L3BA 5TARA 1QMGA 2MJLA 1DG9A 4OTZA 4L5BA 1MVOA 1Z08A 3LQ4A 4IHJA 3OFNA 3T3EA 4DLTA 3TI9A 1QQ5A 4DYVA 2APJA 2XRFA 2FUG1 5CB4B 3U09A 5C4MA 4KBYA 2R00A 3Q0EA 3JVDA 2ZJ7A 4OFZA 5FPHA 5AVSA 3OLYA 3TLEA 4DR4B 4C3ZA 5CFMA 3QLVA 1TM3E 4MRNA 1B1CA 1YB7A 2H11A 4UNQA 5F3WB 2B2XA 4Q3EA 1VIYA 4BNGA 4NFYA 3BUSA 4DQUA 1DV2A 5IX8A 2N47A 2ZTSA 1I2MA 4U2BA 1MO2A 2ZGVA 3F8TA 1ZZGA 3B9BA 4FFNA 2VDWA 2EBFX 5ITWA 3C5CA 2V7XA 3GLIE 1FS6A 1UBTS 1L6IA 4GEGA 2BAGA 1HH4A 5E3JA 4UPDA 5EIWA 2XDYA 1ZRNA 3GAFA 1QJ4A 1WQ4A 4GZLA 4RTKA 3NUZA 3KL2A 4A23A 1L4NA 1Z4MA 3DKPA 3BRCA 3R24A 3V97A 4BO9A 1UAAA 4OK3A 3RT9A 1EFPA 2XLBA 1GKLA 2KE5A 2QI9F 2C78A 3I2IA 1VI6A 2H4XA 3E1SA 4QPJC 3STUA 4EQ6B 4HY3A 1OTYA 3G0OA 3HPQA 3P9QA 4RHTA 2AW3A 3UC9A 4AO7A 5AM0A 4EHHA 3SZLA 4X00A 4BMYA 1UDAA 3RRBA 5F2NA 2G07A 4LCJA 3PNBA 3FTCA 4I4TF 1MEOA 2GZMA 1KL7A 2JLCA 2VLBA 2PU7A 4AFNA 1FLDA 1C0KA 2QZSA 3LMKA 1M7BA 4DCJA 2AN5A 1HC7A 1F5SA 4LYFA 4PC6A 4IX9A 3V8VA 5CFZA 2RIPA 2FFAA 1IZ0A 1ZO8A 3BDAA 3Q7SA 4G41A 2A1IA 5AVUA 2GCEA 5CB4F 3IIKA 5JYCA 2B25A 1WSDA 4JLSA 1I2DA 1L4BA 2AFRA 2CNWD 1TZCA 2YY7A 4Z1MA 3RS4A 1J09A 4QOIA 3CURA 4R98A 4PGHA 4PYRA 4OYYA 3N0XA 5EI5A 1RZRA 1TAQA 1AHIA 2OBNA 4MS4B 1HEYA 5CH8A 4EKGA 3N5KA 2R00C 3H1PA 4RIIA 2OV8A 2JEOA 4M8IA 4O4LA 1KKMA 2ZPTX 2ICAA 4TKMA 5ARCA 4RTQA 5E8RA 4B81A 4BNJA 1YJXA 4H27A 2EEZA 3QLVC 3QE9Y 2WJAA 1ADFA 2E4UA 1SKBA 2OBXA 3KSMA 4WLNA 2GI4A 5DVZA 3QEMB 2NYRA 2AB0A 3FSEA 3CX7A 1G3UA 1K06A 2ZAGA 4GSYA 4BXOB 2IW3A 1R4AA 5F35A 3IRVA 3UJDA 3RK1A 2R8RA 4IVQA 4U6SA 3UA4A 4CV2A 1V11B 2FWMX 4P33A 3W90A 3RVDA 3M9LA 1RDFA 1DCKA 2ZUFA 4F7WA 5BW5A 2BFBA 2RDMA 3NPMA 3GAAA 4IYRA 3RC9A 1PJCA