3V00A

Studies of a constitutively active g-alpha subunit provide insights into the mechanism of g protein activation.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
351
structure length
351
Chain Sequence
b'HMGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDPYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMHLFNSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1/ Gua
molecule tags Signaling protein
source organism Bos taurus
publication title A constitutively active G-alpha subunit provide insights into the mechanism of G protein activation
pubmed doi rcsb
total genus 95
structure length 351
sequence length 351
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 3v00A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v00A01
2C5LA 5FBQB 1DAIA 3S1AB 4D0NA 3G5UA 5IK2A 4CRWB 1X8LA 1TQDA 1RRCA 4RCZA 3W6NA 4RFSA 1XU4A 4V03A 1SXJD 2IL1A 3TW4A 3A1VA 2WHXA 1M6NA 4HYYA 2VHCA 2D2FA 4Q9IA 1DG1G 4MGIR 1JAHA 4MGYR 4OK6A 4URWR 1XEWY 2AN9A 2QT0A 3GEEA 3VX3A 4AC9A 4Q01A 2ZM5A 3UPUA 1E2IA 1XF9A 1D2NA 3CM0A 4Q21A 4GRAA 4PC2A 3TJZA 1QHHA 1S3SA 3W8NA 2IYSA 4ZCMA 1Q3HA 1K5DA 3WNCA 5GADl 1T0JB 4S2EA 1GP2A 3V00A 1VCNA 1OIVA 3CWQA 3EIQA 1UKYA 5IT5A 2DFNA 1XJ0A 4IOJA 1S8FA 5FOWA 2YNMA 4FMDB 4FMCB 1YE8A 1I2DA 2AFHE 4KITB 2AD1A 4LHYA 3U3OA 3RDPA 4WZAE 2JJ2D 3Q3JB 2QBYA 2ZJYA 1AK2A 1OFHA 1NVUQ 3VU9B 1CJKC 1MOZA 1U2RA 1VYVA 1P62B 4O2LA 4EAQA 3AB3A 3AVVA 3MCAA 4A1FA 1ZYUA 1E99A 2WMOB 4M1SA 4Q4AB 5BWMA 1U0JA 1WF3A 4PC3A 3RWOA 1V43A 2BKUA 3GJ4A 5JECA 4YLGA 3L43A 4MDEA 3KXIA 3B5JA 1NJGA 3ZZTA 221PA 1N6KA 2JIZD 2MSCB 2G6BA 2PZGA 5FTJA 4IXNA 2FU5C 1VYUA 3B2EA 2ZI3A 3KB2A 3IUYA 2WWIA 2X2FA 5D3MB 5CDFA 4ACAA 4R7ZA 1JALA 2WM9B 4URZR 4PHTA 4C7OA 3MJHA 1M2OB 2IEZA 1KSJA 3QXSA 4A2QA 1E6CA 4HB3A 3I4LA 4OJQA 4XSHA 3GCGA 3SR0A 4DDWA 2A3RA 2ORVA 4XTRA 1R0XA 1CULC 4MUBA 4CEIB 1E1QD 1FX0B 2YINC 1IY0A 4M1MA 1AS3A 1D9XA 2OFOA 1X86B 3U7HB 3GFPA 2H1LA 3HJNA 2QAGB 1JQLB 1SULA 4I1VA 2YWGA 4OI2A 3LWNA 2IYLD 3FHOA 5CK4A 4IDQA 3THYB 1OXXK 1P2UA 5K8IA 1MABB 3LD9A 3KFVA 4PHGA 3LQQA 5CLLA 2IXEA 1ESMA 2PBRA 4GBMA 2O8FB 3QVUA 2JLYA 1NY6A 1OYWA 3I32A 4NDZA 4R2HA 3FMPB 4G5GA 3H0KA 5FBRB 3VKGA 2Y8EA 4CEJB 1DARA 4K8OA 1WE2A 4KLZA 3U60B 2F55A 5DYGA 1DO2A 2F3RA 1EESA 3IHLA 5FL7D 1DOAA 4NTZA 4KHZA 2VLIA 3KKPA 5JEDA 1BMFD 2QMUA 1E2QA 2BEJA 5EXTA 5FR1A 4AIIA 5C46F 2QRZA 1RYFA 4US2R 5FH9A 4JLJA 1T8TA 3IDQA 5EXPA 2IX3A 2IS1A 2R6CA 4BLSA 2P0EA 4E5UA 3ADDA 1II8A 1OH5A 2H5EA 4X8MA 4RY2A 2OG2A 4WIAA 4GPTA 4IDHA 2E87A 1XEFA 4A4DA 4FXPA 3AP3A 3CF2A 2W6JD 3B6EA 1X1RA 1UM8A 2IEYA 3RS0A 1Q57A 3THXB 1XTJA 4PO1A 4ZCIA 2ERXA 4WW0A 3GLHE 3AH8A 3AEZA 4O2RA 4TYPA 1F6BA 1W0JA 4QL3A 1H8ED 2OXRA 1JECA 1I4DD 1SVMA 1ZBDA 1W2GA 1Z3IX 1ODFA 3TW8B 2NO0A 4R9UC 3LFUA 4HAYA 4C0BA 1G8GA 1N6OA 3Q7PA 4XTCS 1AKYA 4PAOA 2JLUA 4M22A 4YDSA 2CXXA 3GJ8A 2ZE5A 3FMFA 2VO1A 1TQ2A 2C2HA 2WKRA 3UG7A 2EFHB 2ZRGA 1P2TA 1GRQA 1CJVC 3WRYC 1RRGA 3SYNA 2ZUBA 4ZDWA 1RVDA 4BZPA 1U94A 2D06A 2OAQ1 2ZJ5A 4GOKA 5DLQC 4FD2A 2QP9X 4JKIA 2QM7A 5CIQA 2YOFA 3ZVMA 4EFMA 1AM4D 2PX3A 1NLFA 5FOUA 2VBCA 3W8RA 3LW8A 2I4IA 4CT4B 1OT3A 3IQWA 3R9WA 1NBMD 5HKKD 4LBYA 5AJYA 2WJVA 2ZSEA 4TMKA 1W1WA 1W36B 2YJTD 5DI9A 4RFVA 1LTQA 4DDVA 2EWVA 2V1UA 2FG5A 4N0EA 4A0FA 1MH1A 2R62A 1OLOA 4ESVA 1IN4A 2CMKA 1JBKA 5FTKA 1SVOA 2AX4A 3HU1A 5EE3A 3QQ5A 1VCIA 5FTMA 1E98A 3T1QA 3BS4A 4YQFA 3MLEA 3VTKA 3OHMA 4GZMA 4TQUS 2BHRA 3MG9A 4DKXA 4TL9A 3FMIA 1CXZA 4KXFB 4GP7A 4GOXA 4IW3B 5FUWA 4LC1A 1NL3A 5FUVA 4PZZA 3AVUA 3EXAA 1GUAA 4FMCF 3WBJA 4YMWA 3GLFA 2Z6VA 2GK7A 5G3YA 1YRAA 2IXFA 4M9QA 4LSGA 4MRNA 1J7KA 2PMKA 3LAWA 2C98A 3PG5A 1ZM7A 4KVAA 4ZPXA 4NU0A 2C78A 3Q85A 4JBXA 2HXSA 4IDOA 2QNRA 1NVVQ 5DISB 2FSGA 3QKTA 4HSEA 4RD4A 4LJAA 1VYTA 1Z06A 2QUZA 2YOGA 1G291 3AF1A 1E1RA 1YRBA 3PUZA 4DBLC 4PHFA 4B34A 3KZ1E 3LA6A 4WVFA 5CIWA 4ZV4A 2A2ZA 1JI0A 4CEHA 2O8DA 1XX6A 1PZNA 2OHFA 4DLSA 3EC2A 2GDJA 4AKIA 1W49A 1CP2A 3B1YA 1JPNA 3PEVA 2HF8A 4HB4A 3PFIA 2PLFA 4V02A 2V54A 1IN5A 2EFCB 2WWWA 1XD2B 1NJFA 1E0JA 4P3YA 2ZITA 3SFVA 4F7WA 5JZVA 1A2BA 2NTYC 2JJ8A 1MO5A 4QG7A 4DJTA 1CS4C 4HAZA 1ZM9A 1W5SA 4O25A 4G5RA 4PAMA 5EP2A 4FI3C 2VF7A 2DFLA 4NYMQ 1DBSA 1SGWA 5M04A 1HQCA 1T0HB 1GG2A 2GJ8A 2IYZA 5E7MA 1R0ZA 2H16A 3VR6A 1US8B 4B2LA 3SEAA 4D80A 1IXSB 3T35A 3V4FA 2FH5B 3NHAA 1OE0A 3R20A 1N6IA 2N46A 1XPUA 1KO8A 3B85A 4PO9A 2IUTA 2WV9A 2XZPA 3EG5A 3QF7A 1KHTA 2ZUDA 3HWSA 2ONJA 4AWXA 2QGNA 2ORIA 2BBWA 1F60A 4GNKA 1GKYA 1SVWA 3K9GA 3W5JA 5DN6A 1U8YA 1A2KC 1HUQA 2X8AA 3O8RA 3KQHA 3K0AB 1RE0A 3U4QB 3A4MA 4A8JB 5DNYB 3ETLA 4D26A 2KBFA 1DG3A 5FPHA 4JYCA 1OH6A 3CBQA 5JWHA 3SJZA 2LWIA 2ZR7A 3ASZA 3FYHA 4G5SA 1SHZA 3HDTA 1XTIA 1N2CE 1P9WA 2E9SA 4OI1A 1YVDA 3GD7A 4TMZA 2RGBA 4Q4JA 2AD5A 2ZPTX 2Q9CA 3AP1A 3CO5A 4MRRA 4D4MA 3U3JA 1VKJA 2XB4A 3QE0A 2GEDA 3EAQA 4PTLA 5HZHA 1GFIA 2CNWD 2GJKA 1MR3F 1E2DA 3IBGA 2ZRDA 4MRSA 1KKLA 4Q02A 1DTSA 3GPLA 2OE2A 1VTKA 3PVSA 4JL5A 4TZ6A 3U3KA 2OCPA 3SYKA 3BXZA 4CF7A 1ZRHA 4JJKA 1ZW6A 4HAVA 4XH9B 2BM0A 4QFMA 3CH5A 1P9RA 2XXAA 3PUVA 2MSEB 2XNDD 1IJFA 1NI3A 5G40A 5JSZB 2L0XA 4NP6A 2Q9AA 1KI6A 5L3RA 4JSYA 3UMSA 3THXA 1OH8A 1RPZA 3CH4B 4PAQA 3BH7A 2EQBA 4KU4A 1MRSA 3SFZA 3KQKA 2KWIA 3KKOA 2GAOA 1KDOA 1UF9A 3SJCA 4FWTA 1PLJA 3R9IA 4M1TA 2RH5A 1TEVA 3QNUA 2VPPA 3PIRA 2HCBA 3EX7C 1RJ9A 2NO6A 3RSOA 4Y0VA 1GL6A 3EZ9A 1G7RA 4B74A 4KBFA 2I3BA 4NCIA 4OK3A 4OK5A 1KK1A 4YXWA 1QHHB 4GZLA 4LI0A 2VHTA 5A5GA 5E3HA 3BOSA 4RD1A 2BJWA 3ZLJA 3WYAA 2YKGA 3OAAA 4KSCA 2GCPA 4F4IA 2F7SA 2GESA 2JGNA 2HYDA 4KJZA 2NZJA 2JLWA 2FNAA 1LS6A 3RRNA 3TNFA 2DFKB 1W4CA 3LXXA 3F5FA 4XWOA 4DSUA 4L16A 3K0AA 4MYHA 2W0SA 4M1YA 1A1VA 1KJWA 4BUJA 2J7KA 2W6ID 1G20E 2QQEA 3QVVA 2DY1A 4HLCA 3IQXA 1BYUA 3VHXA 4EPWA 3OFNA 3BJIC 4JLAA 3HP1A 2CE7A 1G7TA 2KI5A 3C14C 2OM2A 3CZQA 1CR4A 4IDPA 2QORA 1CF4A 3O8CA 2R2AA 1EK0A 2ZXUA 4TQAA 3G0HA 2VP0A 3UXMA 4TYWA 1FUKA 3SNHA 4I99A 3UWKA 4Q7JB 3KUDA 1CR0A 5J4LA 3F3YA 1GNQA 1OSNA 3B1XA 2O52A 2V8OA 3IKJA 4Q7KA 1A82A 2KBEA 1W4AA 4NL4H 4BRUA 1RZ3A 5AUQA 2YC2C 4E03A 3KXLA 2X1VA 5TXGA 2HLDD 3N70A 3VKWA 1Z63A 3IIKA 1W47A 2G3YA 4FINA 4E09A 3ND9A 1HH4A 4BFUA 2QMEA 4MRVA 4PSKA 4G01B 3LVRE 1XFAA 3R8CA 621PA 4C3ZA 1ZP6A 2IYWA 2IYUA 3HR8A 4LGMA 4E22A 1M34E 3L2OB 4ZO4A 1FNMA 1M7HA 4C9BA 2ZIAA 121PA 2ZE8A 3OEHA 2OBNA 2NO9A 1N6HA 4LJ8A 3U7GA 4RZXA 4C7OB 1W44A 3RSLA 3QSYA 1ZIPA 5EUQB 5JS8A 1OFTA 1IN6A 1YJ5A 3I73A 4XWAA 5FTNA 4HZUB 4V0ME 3X1XA 2XTZA 3NIBA 5JFGA 4TMVA 2YC4C 4LYJA 2WWYA 2IS2A 1Y63A 4QRHA 1TL7C 4TN1A 3EPKA 1F2TA 4RZ3A 2JDID 4DT1B 3FPAA 2ZSBA 3A6PC 3AKEA 3KFXA 4JJZA 4B33A 1FPMA 3ADKA 1MO6A 3EW9A 1W48A 2ZRJA 5GJWC 4EIWA 1Z6XA 4BE7B 1G64A 2FX3A 2WIAA 2EYQA 1JPJA 3IILA 1TUIA 2JAQA 2ZU0C 1FMJA 4GT1A 4IJMA 5EE9A 1ZUNB 3X1WA 4CZ2A 5TMPA 5JJIA 3K0CC 5TB5A 2G83A 4M1OA 4I1OA 5KYKA 4TYNA 4JZKA 3K70C 2PL3A 1BIFA 2P6RA 4N0DA 4MYTA 1SXJE 2H8KA 4EUNA 3KX2A 4FCTA 1VECA 1JNYA 4A0HA 2HLDA 2ZTSA 3CPJB 5DGXA 3RS5A 4HLUA 4B2PA 4B76A 3LLMA 3RRYA 4Y0AA 1XXHE 3BD9A 2O8EA 3A4NA 2FA9A 4WZBE 3NBXX 1W7AA 2WPDA 1KO5A 4HAUA 1S1CA 4P33A 3FVQA 1Q44A 1TMKA 1TU4A 1YR8A 2W2VA 2WKPA 5FR2A 2WJGA 3U3MA 2DPXA 5KNDA 1PUJA 3ZGXA 3CUEF 3EZFA 3R8FA 4MDFA 2J0VA 4V0LA 3IO5A 2CHVA 1FNNA 4V0KA 3SU8A 3I1FA 1G8YA 2ZRLA 4PPNA 1P73A 5AJXA 1NVXQ 2I1QA 4TMWA 4MKHA 4CVNA 3AUYA 1ZIOA 1B23P 4XOIA 5C4GB 1PUIA 4IFEA 3RRZA 4B47A 2KJQA 3QBTA 3CRVA 4JLVA 4DCUA 3I8XA 1QHGA 2F1JA 1S0UA 3BAFA 4ZI2A 2PLRA 1ZVQA 4DVGA 821PA 1AGRA 4LJ5A 1EXMA 2CK3D 4HUQA 5DI3B 1NN5A 2HT1A 3CRRA 4GMXA 2IBMA 3WYGA 1Q22A 2FV8A 2LCFA 3WMGA 3TE6A 3K70D 4LHZA 2WJHA 1GRNA 1KZGB 3GQBA 1Q0UA 2QTVB 4PC1A 3SI7A 1U9IA 4D6PA 4GSYA 4LHWA 3REFA 3ZDQA 3NDBB 2UZ3A 2ZEJA 1KI3A 2VHUA 1W5TA 2JLRA 2NOAA 1CIPA 1RC8A 4LJ4A 4KLNA 4BFYA 4PR0A 4GFDA 2WJJA 1G8PA 4CYMA 3CW2A 3AVOA 4RKEA 2QRNA 2WSSD 2NPFA 1H65A 1P2SA 2CHGA 2OESA 2ZJAA 4KYIB 4UXHA 1U98A 1OW3B 3TK1A 3QPVA 4MUAA 1GOTA 2G0NA 3MSXA 3PEWA 4ZCLA 5EXSA 1Z83A 2GNOA 2OLKA 4HAXA 2YYZA 2IYVA 3K8YA 4M9SA 5BW8A 4URVR 5JLJA 4EQ6B 4BGDA 5CM8B 1GITA 1OHHD 4M9ZA 2BIFA 2V3CC 2ATXA 4A0GA 3BERA 3THOA 1NMYA 2CHQA 2FPMA 4B3CA 1G6OA 4NCKA 3RS2A 1ELOA 1EWRA 1CR1A 3T1OA 5EE5B 4W9MC 1BYIA 1N6LA 2FSFA 1E2MA 5FUXA 1Z2CA 3L0OA 4URYR 2CLCX 1YZNA 1DAMA 1KMHA 2OBLA 1E9CA 3FMOB 1KMQA 5B57C 4A6PA 2C96A 3HYRA 4ZDIA 3LRPA 5F2EA 1YU9A 4BLPA 3QOFA 4DZZA 1E79D 2VIIA 2O0KA 4IDNA 3BFVA 3QKSB 5F9HA 3GLIE 1D2EA 2FN4A 2VSOA 3DMNA 3MAAC 3QF4B 2HV8A 2VL7A 2X19A 5G41A 3AVXA 2BVNA 3IO3A 4NYIQ 1COWD 4LPSA 4TYYA 2CLDX 3K9LA 1NMXA 4PO8A 3B60A 1YR9A 2R6FA 3TSOA 1BOFA 1U81A 4IVPA 2ZS7A 1E9EA 2GXSA 1L2TA 2V7QD 2FDCA 2R65A 2OO7A 1R0WA 4JMPA 3VFDA 2GTPA 2EWWA 4A8JA 2O8CA 3DKPA 4I4LA 3GEHA 3KXKA 5FOTA 4N3NA 4M9XA 4Q48A 4UJ3A 4RZ2A 2QE7A 3D6TB 4QNMA 3AF3A 5CB6A 1X8JA 2B7CA 2QAGA 2ZS9A 3TBKA 2GF0A 1J99A 1ZM3A 2DWQA 1II9A 4PZYA 721PA 1PVOA 2WOOA 4FCVA 2X77A 2YWHA 2OFXA 2XAUA 3AKYA 3LH5A 5IHPA 4LWZA 1R5NA 2NPIA 4I1UA 4M4SA 2FZLA 1N6RA 1UDXA 3GJ7A 2G1JA 2XX3A 2IYYA 3EA0A 3CRMA 4YONB 1L8QA 4FWIB 3T34A 4LJ6A 2ZSDA 2F1HA 3AF4A 2GAAA 4NPHA 1AQUA 1NVWQ 1LW7A 2PZFA 1A7JA 3OZXA 4Q03A 4ARZA 3P20A 2ZI5A 4TL8A 3FE2A 4OHWA 1XEXA 3K9NA 2VHQA 2ODBA 1JR3D 1CR2A 4NONA 4UNRA 4LBVA 1G3QA 1II8B 1KSFX 3CF0A 1E2EA 5FL3A 4AG5A 5HE8A 5AJWA 3A37A 1Z2AA 1Z6AA 4MA4A 2WKQA 5FOSA 3ICQB 5D3QA 1EFRA 4LV5B 1P4SA 1XTSA 3E2IA 4PHHA 3OEED 5BYJA 1DAHA 2BCGY 2IW3A 2XNSA 1KJZA 4UXJA 3C5CA 5DHAA 2Z4RA 5A0FA 3TKLA 1G4UR 1NG9A 3ICEA 3B13B 3NEYA 2WIBA 3EWAA 1EFUA 3BWDD 2BKEA 3NC0C 4I81A 4QOSA 1RW4A 2RHMA 2WBLC 3I5XA 2PEZA 4B3BA 4WBSA 1WB9A 2ZRPA 4YMVA 2GA8A 2AWNA 2ZAOA 3MGCA 4DLWA 3K0SA 1E0SA 3AQ4A 3BE4A 4BZXA 4NMMA 1UKEA 4A2WA 4JL8A 4ESHA 4LV6A 4HI0E 2G88A 2JJ1D 2WVJA 3T5DA 3PUWA 4CW7A 2EW1A 4DUGD 3ND8A 3QKUA 1Z0JA 5EE1A 5EP1A 3I72A 2FF7A 1GRRA 1E4YA 3UATA 5H8WA 3X1YA 1U8ZA 3EZ7A 4DEYA 1OKKD 1IN8A 1R5OA 2JLQA 3LV8A 2A5FA 2FGJA 2QP4A 4OHZA 1K8RA 2B8WA 4BFSA 1CRPA 3DO6A 2VQSA 1BO6A 1JXMA 2F9LA 2W2TA 3T61A 3BGWA 2AHOA 3NEJA 1N5LA 1QG2A 2GJSA 3PV0A 1D9ZA 1Q12A 3GLHB 5FTLA 1AJEA 3U6KA 1Z47A 4QGGA 1UKZA 1T9HA 3ZVRA 2VA8A 3H2YA 1RRPA 1J90A 4JVSB 4TLEA 5G53C 3VKHA 4B35A 4JT2A 4C0QC 2VHJA 2A5GA 1W4RA 3FWYA 2BCJQ 4C0AC 2OXCA 1GM5A 5BYKA 3I92A 4PC6A 4A2PA 4DIEA 1P5ZB 2XITA 2FFQA 3CKLA 1IONA 1KI4A 4TL6A 5JRJA 3U6BA 5F3WB 1F2TB 4Q1CA 1G19A 4DUGA 5JRZA 2ZAMA 1TNDA 4U00A 3B82A 1SKYB 2TMKA 2ZYTX 1WXQA 1Z0KA 3GJ5A 1VG1A 2O0HA 3L8ZA 3LBIA 3WHLA 2WTUA 4LV8B 2C99A 1NN0A 1HT2E 2C03A 2VH5R 1II0A 2IHYA 1QHYA 1NBME 3N2IA 4MH0R 2YOHA 1R10A 4BEBA 3R7WA 4GMDA 2LKCA 4BLOA 2XSZD 4HZUA 4JLMA 2Q9BA 1Q1QA 3DZDA 4US1R 5LB4A 1KDTA 5C4MA 3TVDA 3QG5A 1SXJC 3FOZA 3WNDA 1AA9A 1XPOA 5F98A 4XVUA 2XB2A 1FP7A 1WQ1R 3F0TA 4DSNA 1WBBA 2VEDA 5JHGB 1E9BA 2OZEA 1OKKA 1JR6A 2MMGA 1NSTA 3AV0B 1OXTA 1YZKA 2WOJA 3WY9A 4QBIA 3NG1A 2BMFA 3SBDA 3VHLB 4Q7LA 3W3AA 2JLSA 2KSQA 1DE0A 1FQKA 3Q72A 2P2LA 2BJVA 2ZI4A 2QBYB 1IXRC 1H8HA 4IKEA 5TDHA 3HU3A 1P7CA 2HYIC 1DAGA 4L9WA 2CL6X 1YQTA 2PCLA 4QJ3A 3Q7QA 1NMZA 5SZIA 3RABA 4IOMA 1I2MA 5CDFE 1CJTC 2H18A 3SJBA 5L3QB 4EKDA 5JCPA 4C2UA 1N0WA 1G17A 1PLKA 4H9GA 1XRJA 2FJUA 1OYYA 3OAAD 1G5RA 4D82A 4CEHB 2BBOA 5KSYA 2CBZA 1JR3E 3BC1A 4MRPA 3GLGE 2VTKA 4MGKR 5FI0B 2GEVA 1SHKA 1TU3A 1YR6A 1YZTA 2C8VA 1E1QA 5LB2A 5C18A 1ZNZA 4WXPA 3T5GA 2ZJZA 4K81B 2ZJBA 3UKDA 1K6MA 4YXWD 3LX8A 1CEEA 2ZVQX 1A5TA 1LF5A 2IS4A 1OIXA 5AUNB 1CU1A 5CM9C 1KK3A 5DE3A 2OFWA 3CONA 5LPNA 3CLVA 1QRAA 1KMHB 1KO7A 1HYQA 1F3OA 1FP6A 3LDAA 2IWRA 4A92A 3C4JA 5HR5A 1XD8A 4DRZA 2F43A 3REGA 5LDDC 1VIAA 4W5WA 2HJVA 1VDZA 2ODWA 3JVVA 5CJPA 1JJ7A 3CNLA 4D25A 5EP3A 5GJBA 1SVIA 2DWOA 1R8SA 1Y3AA 4BFTA 3SZRA 3A1TA 3A1WA 1EG7A 3I61A 2ORWA 4BZQA 3GLIA 2AK3A 4QGAA 2DB3A 5TY0A 1E2KA 4JLBA 4FIDA 1E32A 1XZPA 4O0MA 2QP3A 4PX9A 4IEIA 5TARA 3W5IA 4IOLA 4A9AA 4CT5A 3GLGA 5C1BA 5JSZA 4NYMR 4Q9HA 3R9XA 3BB3A 1R2QA 1KI6B 3NDPA 4PFSA 3ZVLA 2H17A 1US8A 3MMPA 2ZANA 3AGPA 1RIFA 2X2EA 1VG8A 4PQYA 4Z1MD 2EFDB 3DHWC 4M1WA 3D7MA 1GIAA 2OV2A 2QPTA 4W5HA 2WJYA 3B1WA 1UAAA 1ZINA 4TL7A 4QBGB 3FHTA 3LBHA 5AUPB 2W58A 4LHVA 4QJ4A 4DCVA 1AGPA 3A36A 3U2QA 2J0SA 5L3QA 2JLXA 3OE7A 4P4SB 1E2FA 4LZZA 3TQCA 2A5DA 3LXRA 2C04A 2GJ9A 2AK2A 1M8PA 2J3EA 3CPEA 4TTQA 2J7PA 1KSGA 4KI0A 4UNSA 1ZC4A 3UWOA 1DAEA 4BFXA 5A4JA 1UDWA 1OB5A 4TZ0A 1RFLA 2BDTA 5KSOA 2P6NA 1N6NA 3QEJA 3TQFA 2BMEA 3QUSA 4US0R 3VX4A 2O8BB 4Q4JB 2FFAA 1E2LA 1JEDA 1NLZA 5H70A 5KDDA 2DYKA 3LW7A 5JHHB 3QKSA 2ZJ2A 3D8BA 2QSZA 2VP5A 1R8QA 4A0RA 2FPLA 2WICA 2RGGA 3PR1A 3AVTA 1MKYA 2BMDA 1FTSA 4ITRC 1XJQA 4NYJR 4LHXA 4G5QA 5K8TA 3GFTA 1QVAA 4BECA 5H68A 5P21A 1XJCA 2ZQ5A 3NTUA 1FFHA 3O8DA 1ZNYA 3FFBA 1AQYA 1ZM2A 2WAYA 4MKIA 3SHFA 3TUJC 2OCBA 1XCMA 2K5UA 3WP0A 3TIFA 5SZHB 1NSFA 2CJWA 4ACBA 2CVHA 1CJMA 2RMKA 3FDIA 3L8YA 3UMFA 2CNWA 2D7CA 4IVRA 4Q9LA 3ZD7A 1KNXA 2AKAB 4DSOA 3GLGB 3GLFE 4TQ9A 1FOEB 3P26A 1CRQA 1VCOA 4V0NA 5EXXA 5CYPA 4DLXA 1QHNA 4L5BA 1XCPA 3M6AA 1X3SA 3L82B 4F38A 4C30A 1XD9A 3CB4A 4ZIRB 4EPXA 2Z83A 3NVAA 5JI2E 1QHXA 1HE1C 2R44A 3DVLA 4MITA 2J45A 2I1VB 1CJUC 4JLPA 4L8GA 1VPLA 3KDSE 1ZM4A 2FEMA 1Z0DA 3UMRA 1CKEA 3PQCA 3WYFA 5KNBA 2XTMA 2QPAA 4LYFA 4DC9A 3VNVA 1QDEA 3EASA 4IOKA 1RKBA 2WZQA 2ZRBA 1ETUA 2QGZA 5GVSA 4TSFA 4M53A 5GVRA 2XNDA 1W4BA 3TLXA 3GLFB 3GP8A 3TR5A 1MO3A 4A8JC 1T5LA 2ZRNA 4TLDA 4OQLA 2ZSAA 3CR8A 1YZLA 4KO8A 2ZS8A 5KDOA 2EFGA 2IF0A 5SZKB 2O8BA 5CITA 1G5PA 1P75A 4NYJQ 4Z8YA 2J9RA 5FOXA 1ZJ6A 4Z8XA 1T4GA 1U90A 3M4YA 2HEIA 2CDNA 4LJ9A 2VSXA 2WSSA 1J8MF 1CLUA 1G3UA 2P67A 4X8HA 2ZE6A 2RGXA 4FMBB 4AKGA 1E9DA 2ZE7A 4K46A 2IUUA 3PCRB 2BM1A 3AM1A 2QN6A 3ZZ0A 4B43A 3AVQA 5J5CA 4L4UA 4LCBA 2GCOB 4P32A 2EYUA 1NIJA 3C7KA 1QVRA 5HPYB 1SZPA 1MT0A 1GKUB 2VP4A 5JJLA 4ASUD 1D2MA 2DWPA 3GLHA 1XD2A 4RD6A 3DM9B 1UBFA 2NGRA 4LX0A 4GP6A 4WAUA 4DIDA 3RRMA 2Z4SA 2PT7A 4IVQA 3X2SA 1DO0A 1E9SA 4TLAA 1NF3A 1ESNA 3W3ZB 3U4QA 1XTRA 3M0EA 4DHEA 2F43B 2G1KA 4B6FA 1KNQA 4O3MA 1VCMA 3W34A 3TVTA 3O47A 3CX7A 4KFRA 2QU8A 1FZQA 1XB2A 1R0YA 3OIUA 3C15C 4Q7MB 4PPFA 4RCYA 1E3MA 3A58B 4DCTA 3QG1A 1IJEA 4JBWA 4JL6A 2J0UA 5KSPA 3SBEA 3KL4A 3HPQA 1HQYE 4EPVA 4NYIR 1T91A 2D7DA 4FN5A 1QHSA 1Z5ZA 1W2HA 4QBHA 1MV5A 3U44B 1YZQA 4NCNA 3L0PA 1TF5A 3PJRA 3IGFA 4RSGA 3S1AA 1J8YF 4AURA 4CDGA 1KK0A 2Z5FA 3WXMA 1GDDA 4Q66C 1LB1B 4TMXA 2CL0X 2RGAA 4JVNA 1KY3A 2PJRA 1SVKA 3P4YA 2W2XA 2NO1A 2R6GA 4IHQA 4QC2A 1TEXA 1SXJA 4LUCA 4JYBA 3AGQA 2RKOA 3E70C 2R6DA 5SZJA 4B3DA 2ZYUX 4DCSA 2KB0A 5LBIA 4D2IA 1GAJA 3ECCA 2ZRFA 1YHNA 3OIVA 4NE2A 1Z0FA 4A82A 2V7QA 5CB8A 4BPBA 1XXHA 1U8AA 2ASEA 2GEUA 3QBVA 1NVVR 2DFTA 4NKRA 2QMHA 1TPZA 2FMXA 5HTKA 3MRSA 4S35A 2WWXA 3BK7A 2QTFA 1N0VC 3WP1B 4XIGS 4P31A 4H1VA 1M7BA 3KKNA 4RD0A 1R6BX 4UNPA 1NKTA 1SKYE 1Q20A 1YZGA 3TGPA 2C9OA 1SVSA 1KYIA 2IYRA 1Q1ZA 3OESA 3VR2A 1S1MA 3RWMB 3AKDA 2GETA 5F9FA 1P61B 4Q5IA 1AZSC 2GBLC 1ZC3A 2OLJA 1NNEA 2QEQA 1R5BA 1S9HA 4EDHA 3MFYA 5C2JB 3U3RA 1G5TA 4UXIA 3T1TA 2GXUA 2AXNA 1YR7A 2HJGA 3E1SA 1XMJA 5FI1B 3CPHA 4DEXA 4PQRA 2KE5A 2HT6A 4Z51A 4PPQA 4GDFA 3T12A 3CNOA 1OXSC 2JIZA 3SE0A 3VR3A 3I62A 3OFND 1FW6A 1XNJA 2PT5A 1NY5A 2MSDB 4Q00A 3R7WB 4V0OA 3WMFA 5DO9A 4Q19A 2J59A 3MUFA 4RZUA 5DIFA 1N0UA 1HTWA 1FQJA 5L3VA 4TYQA 2EU8A 2Z0MA 3PUYA 4LC0A 2B21A 4KYUA 4TTRA 2RGNC 1KTVA 2FFHA 2WPDD 3LY5A 2YHSA 4R2IA 4TWZA 3TSWA 2XZOA 4DB4A 4C4PA 1U0HC 1I4TD 3OEEA 1S96A 2RGEA 2A9KA 5HCIA 1OH7A 1IBRA 2XTNA 5EE0A 2O8CB 4Q4AA 2IC5A 3EPLA 3UG6A 1ZD9A 1QZXA 4HLQB 2RGCA 3CRQA 3I3SR 2VRWA 4KODA 3C16C 3DOEA 2NG1A 4OHXA 3NBZC 4WZ6A 5KNCA 3P4XA 3RC8A 3NH9A 1KAGA 2F9MA 3LNCA 2A30A 1P6XA 3QPWA 2JA1A 5FPTA 3SHWA 2P5TB 1VG9B 1GVNB 4JT4A 1RJ9B 1VG0B 3ADCA 4Q47A 2DR3A 5FPSA 1KDRA 1QHIA 4UQOA 5HE9A 1UKVY 1T5IA 1VHTA 3ZYCA 2Q21A 5FBLB 2GCOA 2OILA 2JLVA 1GZSA 2GRJA 4B73A 2W00A 4HUQB 5DI3A 1BMFA 2ZI9A 1ANKA 1BS1A 2ECKA 1Z0IA 1E2GA 1YZUA 3DZ8A 3VAAA 3PUXA 3ZD6A 2N1BA 3SDZA 4LY6A 3U44A 421PA 3EARA 1G41A 2P3SA 4AKHA 4Q4HA 5J4VA 2REOA 2REBA 4FW9A 4LJ7A 2V6JA 2DBYA 3P32A 1NRJB 2XZLA 4QGHA 1XEWX 2W6JA 3SJAA 1KOFA 5L3SA 1G3IA 3U7FB 2ZR9A 2PJZA 2HDNB 1ZCBA 1WA5A 2JJ2A 3ZQJA 4XD7D 1W0JD 4NZYA 3FGNA 3A1UA 3TUZC 1E9RA 3QY0A 1UJ2A 4LDJA 5KDLA 4TLCA 1B0UA 2IXGA 1LNZA 2UZIR 2G9NA 5JWOA 3VR1A 2ZETA 2QL6A 4J0QA 2ZSFA 4AYTA 4H1UA 3KB1A 1TQ4A 1KKMA 3K0FA 1P9NA 4PSAA 1T3LA 3C41J 1Z6TA 2YVUA 3SC3A 4EPTA 1XMIA 2IYQA 1OPXA 4Q9KA 3ZIAA 2OUKA 2RB4A 3BBPA 1WBDA 1M1YE 2FEOA 4QKQA 4HDQB 1E0AA 3AP2A 1CBUA 1DVRA 2FZ4A 3OIWA 5HZKA 2GCNA 4TMTA 3ADBA 1AS0A 2ZREA 3NXSA 4Q1AA 5K8UA 1COWA 2A78A 1XWIA 1LFDB 1LVGA 3KKQA 1O3YA 1NN1A 3PEUA 2PZEA 3WHKA 4MKFA 1XPRA 1T8UA 1JJVA 3LO5A 4TT3A 3LQRA 2IHBA 2ZUCA 2J1LA 1H8HD 4AY2A 4U5XA 1KAOA 2FSHA 3CF6R 3U5ZB 4G3XA 4C0SA 1DEKA 4HLDA 4V0MA 3H4MA 4OBEA 1WRBA 4DB2A 1OF1A 4P4UA 1Z22A 2GF9A 1NN3A 3RS4A 1EFTA 3EIEA 3N2EA 1GL7A 5FL7A 3HR7A 4AYXA 3HPRA 5J4KA 4F4JA 1E2NA 4B2IA 2NO7A 2HF9A 5BN4A 2V6IA 3L0SA 2NQ2C 4AI6A 1ZU5A 1TX4B 4ZKDA 1F2UB 5FBVB 4OQNA 2O8DB 4EJSC 5EP4A 5BN3A 2E1RA 3B1VA 1KJYA 1TF7A 1KI1A 1DADA 1P72A 3EA5A 1ONBA 1D6JA 4R71A 1FMLA 3RYTC 2F6RA 4LBWA 5B2ZA 3BFKA 4DSTA 2ZVPX 1XXHB 2ANCA 3K70B 2WJIA 1KO4A 4LYHA 3RLFA 3ZIAD 3DOFA 3Q5EA 2J87A 2IA5A 1OXUA 1JR3A 3BRWD 4YMUA 5ANRB 4HB2A 5JS7A 3CX6A 1E1RD 4HATA 5B58C 3SN6A 4B3XA 4C0KA 4M0LA 4B75A 1UBEA 2Q3FA 2VF8A 4L15A 1G4AE 4DCNA 2CE2X 2FPKA 3SQWA 1DAKA 4OKSA 1R4AA 3RNLA 1G21E 4JSTA 1X8KA 1EFRD 2QENA 3WBKA 1XZQA 2N42A 1D8TA 1TAGA 3KJIA 3BB1A 4N1AA 3AUXA 1T3SA 4EJSA 3GJXC 4DXAA 1OIWA 1D5CA 2FSIA 4UNQA 4II7A 3KQLA 4AK9A 4JLDA 4KV9A 1XP8A 3RC3A 4TT3D 1ZNWA 1VHLA 4AKEA 3O8BA 4MQBA 3VU9A 3ZJYA 3V4RA 3TR0A 3OIYA 2QI9C 3FTQA 2Q3MA 5BN5A 1PV4A 2H7VA 5FPKA 5G3ZA 2O8FA 5DH9A 5IDVA 3SS8A 2AL7A 4B3GA 4QM6A 4Q1DA 2QSYA 1NP6A 3CR7A 2CL7X 1Z28A 1E94E 5FOVA 4IRUB 5FFMA 4Z54A 3TRFA 4DDUA 2WAXA 3KTAA 3IEVA 1J70A 1Z6GA 4D4KA 1AIPA 2H92A 5J40A 4EFLA 2IK8A 1IOZA 1KGDA 2QG6A 4D0GA 2AWOA 4ILEA 1RRFA 2P5SA 2OEPA 1UBCA 2CCKA 3QPUA 5ELXA 1FL9A 5AR1A 4OL0A 2JJ1A 3IIJA 5KU1A 2J7PD 1E2PA 2XOKA 4OI4A 2VYFA 5E7IA 2HCJB 1X6VA 3Q5DA 3AF2A 2XXAB 2V4ZA 1EGAA 1XDBA 2WWHA 3B9PA 4HLUC 1OXVA 3JZAA 2R6AA 2J0QA 5EQTA 3OE7D 2A7QA 5EUMA 4LOAA 4ABYA 4XVQA 1PJRA 2OCYC 5J4HA 4EFNA 2B6HA 3VNUA 1JB1A 1XBTA 3RS7A 1ZUHA 2FWRA 3QXHA 4BWYA 1M74A 3K09A 1O87A 3KQUA 3NC1C 2ANBA 3GJ3A 3H1TA 2WMNB 3H84A 1LS1A 3EC1A 5IF9A 2FE4A 3HYTA 2UKDA 1IY1A 3TAUA 2JLZA 5LD2C 4Q4LA 1GNPA 4R98A 3DKVA 2XJ4A 2QTHA 2ZROA 1BKDR 2DHRA 2F3TA 4URXR 2GXQA 4GI7A 2Q3HA 1JEEA 2QMOA 4OQMA 4DLRA 1KY2A 3QJYA 2RGDA 4KFUA 3GMTA 3L0IB 2ERYA 1WP9A 4TLBA 1ZD1A 3VQTA 4JLNA 1NKSA 2FFBA 1P60A 2QA5A 4OQXA 4PSVA 2F1IA 2J0UB 4LBZA 3C5HA 3NKVA 4OJKA 1FTNA 2QZ4A 3K53A 1DS6A 1HV8A 1ZAKA 5KSZA 3BORA 4D4JA 3QIAA 4P4TA 2XOKD 4XD7A 2OBMA 4M1KA 2B92A 3AVWA 3HU2A 3J81k 5KO2A 1E9FA 4ZKEA 4XWKA 2WSMA 2D62A 2V55B 3EPJA 1VIYA 2NMVA 1UEIA 4M2LA 2DCUA 4HB0A 1HA3A 1N3BA 4GOJA 3ZH9B 5JJKA 5CYOA 4DWJA 4DT1A 2ZI7A 1GWNA 1F48A 3G82C 4G1UC 2J41A 3FFAA 4KCGA 4HZIA 4MYUA 1ZUIA 2YWFA 4QHYA 2W0MA 5L3SB 4LK2A 1V5WA 3D3QA 1XTQA 2PEYA 4KFTA 2ZU6A 4JLKA 3DL0A 4XSGA 3MWYW 5AWFC 4RJLA 4DLZA 5DN6D 4TSFD 4HEJA 3CZPA 1E69A 1DAFA 4YMSA 1E2JA 3GLIB 3MWJA 1IY2A 3UK6A 4A15A 4F4CA 4NBSA 2GXAA 1W36D 2QPOA 1UFQA 1E9AA 3U61B 3EPHA 3RHFA 2YZ2A 1G6HA 1UBGA 1R7RA 1UPTA 2RAPA 4D81A 2FOLA 5TV2A 1ZNXA 1H8EA 3P27A 2UVQA 3I5YA 1KI8A 1G7CA 1AS2A 2GWHA 2QT1A 1W36C 3QI2A 3ZS9A 2NIPA 3VMFA 1P3JA 2SHKA 2QAJA 2JEOA 1HT1E 5LD2B 2C9CA 4QGFA 1KI7A 1Q3TA 3K0CA 3K9HA 3A1SA 4BLRA 4ERNA 1N25A 2A5YB 3EWSA 5FBWB 2VSFA 1E4VA 1MRNA 2PCJA 2VP9A 2IWHA 4ZIRA 2MMCA 3E5HA 3IPYA 1JXOA 5GJCA 4PC7A 1SVLA 3THWA 3DDCA 4ASUA 3U7EB 4W5JA 4C0HA 1RYHA 2V9PA 2ZRCA 4LPKA 4BRWA 4WXRA 1S4QA 2QAGC 4IFBA 3VR4A 4XVRA 4Z1MA 1NBMA 5AUOB 5HKKA 3BH0A 2XSZA 3CIOA 4BFZA 1IXZA 1GKIA 4DLUA 4NHOA 2JDIA 3WMEA 4QM7A 4C0LA 3A4LA 4OHYA 2GVDC 4B3FX 2BMJA 3KKMA 1W0KA 2CLSA 4QHTA 2CJWB 4YDHB 5AK0A 3EZ6A 1TADA 4BLTA 1F2UA 4E07A 1UEJA 3FB4A 2GZDA 2RCNA 2GZHA 3NWJA 4F92B 4A36A 3B9QA 1L7VC 2C95A 4KBGA 2GVZC 1TUEA 1XTKA 5DSZA 4Q1FA 1HE8B 2XGJA 3MWKA 3KTAB 3MJRA 1OFIA 5BQ5A 4P4SA 1G8HA 3LX5A 1TF2A 3NHBA 3MD0A 2O8EB 3W6PA 1KZ7B 3CWZA 3FKSA 4AD8A 4B6EA 5JMTA 1ZU4A 1C9KA 1Q1BA 5EJEA 1HEIA 3IEUA 2NZ8A 4XJXA 1I4LD 3T06B 4EQ6A 1LY1A 4Q4HB 4M8NE 2ZYWX 2BBTA 4JBYA 2J5XA 1HURA 3B8HA 3RAPR 1EWQA 1IQPA 3KUCA 4KFSA 1Q1EA 3QXCA 3IHWA 4QHSA 4DLVA 5HCNA 5J4YA 4EJSB 4JVLA 1Z07A 3DPUA 1PLLA 4KAXA 5CK5A 2AXPA 2BEKA 4FMDF 1G7SA 2CEAA 1E96A 1W46A 2ZJOA 2GKSA 1BH2A 1EX7A 4DLYA 4D4LA 2ODNA 2IS6A 1SKQA 3DM5A 3N5CA 2EFEB 1JAIA 1MABA 3V9PA 3Q8XB 1GTVA 1XMVA 4CIDA 3AVPA 1WDTA 1L4YA 1GNRA 2ZRAA 2LKDA 3QEOA 1EFCA 1QF9A 1W0KD 2WWGA 4UKDA 4WA7A 3QF4A 5IK2D 4BFWA 1IN7A 4C2TA 2CK3A 3W6OA 3OF5A 2PH1A 1G18A 4AYWA 1G3MA 1KI9A 4I1SA 5DHFA 5BXQC 2H57A 1FUUA 4G5OA 1N5JA 4QJ5A 2C77A 3AKCA 3KQNA 3T15A 2JCSA 3IPXA 1Z8FA 2QROA 2IYXA 1XCGB 3UIEA 4IXMA 2R9VA 3THYA 3WNBA 4GL2A 3AF0A 5KHOC 4CGZA 1GILA 3M1IA 5EZ5A 2CCJA 2ODEA 2ATVA 1S3GA 1VMAA 4DLTA 1Z08A 5E7JA 3NBFA 2ONKA 1K5GA 3T1VA 4U7DA 2OCAA 3TAHA 3FKSD 3QENA 4B48A 4B44A 1L4UA 2P65A 2ZI6A 3GFOA 3BH6A 2AR7A 2OT3B 3UANA 3ZQ6A 5CLQA 4MYCA 4OYHA 5E4FA 4RFSB 4IEEA 5JCZA 1IAQA 3SQXA 4L9SA 4TTPA 4PPGA 1G9XA 2O0JA 1J2JA 5TVKA 1N5IA 3I8SA 1ZD8A 1U9IC 4EPRA 1U99A 4DDTA 2HXYA 2BOVA 4POAA 3ASYA 3KJEA 3C8UA 1S2MA 3NBYC 5KPJA 4PANA 4Q9JA 2PX0A 5H1YA 3B78A 2PMDA 3TUIC 3D31A 3QXXA 3WRXC 2YWEA 2Q0HA 1KIMA 2ZYVX 1Z29A 4RKFA 1KO1A 1OJLA 4Q18A 3QKRB 2C9YA 2O5VA 1TTTA 1N6PA 3PITA 5K8LA 4Q1BA 4U02A 1OB2A 4KVGA 1G1MA 2RHDA 3W9YA 1E2HA 1XMSA 4NH0A 4AG6A 3KJHA 6Q21A 2GJAA 5KOYA 5KTYA 4QBFA 3ZVNA 4JVMA 3DMDA 1WCV1 1QBKC 2GHIA 4X8LA 1U0LA 3RANA 1GSIA 5E95A 2ZRIA 1IM2A 3LLUA 2QQ0A 1ZMXA 1OV4A 3KJGA 4G0NA 4MKGA 4OI0A 4WOPA 1Q21A 2BC9A 3K0EA 4RVCA 1TQ6A 2GBLA 2QM8A 2QY9A 2D74A 4W7SA 4BQSA 1KI2A 2QE7D 1C1YA 1G8FA 1QG4A 2WWFA 1M7GA 2BV3A 3FKQA 1LF0A 1LV7A 4UJ5A 2EVWX 1T3HA 2BBSA 4JKYA 4JIMA 5AJVB 3ZS8A 1EFHA 3EIHA 4PZLA 5GJVC 2JASA 1MO4A 2ZRMA 4OHVA 2ZRKA 3NH6A 4LRWA 3BIFA 1JQJC 521PA 3CX8A 1UADA 4NCHA 3H86A 5L8VA 2D2EA 5JI3E 3VR5A 1E0KA 3IIMA 3GJ6A 1C4OA 3BFXA 3B7GA 3LVQE 2CVFA 2F1RA 1A4RA 3K1JA 3F8TA 1G3RA 8OHMA 2OAP1 1XEXB 2A5JA 2RGNA 3BB4A 3RVBA 4CEJA 1CTQA 1Z0AA 4PQFA 3EZ2A 3Q9LA 4HDOB 4YC7A 1OHHA 5D3MA 2GILA 3AVYA 3K09C 5JWRA 3ZZUA 1SXJB 4F93B 1AZTA 1SQ5A 3PEYA 4LJYA 4JLOA 4RD3A 2CCGA 1NIPA 2REXB 2IUSA 4MGZR 2W6IA 3JVUA 3LBNA 2ZR0A 2HUPA 2Z43A 4ZDKA 3B1ZA 1DPFA 1FX0A 3X1ZA 3GJ0A 2P6UA 2IF2A 5DYIA 1T6NA 4C0JA 1HY3A 5IRCD 1DELA 1NG1A 2Q6TA 2YV5A 4NCJA 4LYAA 1F5NA 5CJ2A 4F91B 1E79A 1IHUA 2IYTA 4KSBA 3X1DA 3A8TA 4ON9A 1KK2A 4M21A 4QXAA 1P2VA 3CNNA 4QNRA 1AKEA 2J46A 2G77B 5AJZA 1ZCAA 2ZJ8A 4YMTA 4X8OA 1EX6A 2G0TA 3P1JA 3PXGA 4ARZB 2R8RA 3PENA 2V1XA 4A6XA 1AN0A 3TSZA 4CEIA 3RS3A 5EZ6B 5J47A 1G16A 1NLYA 3QXJA 4JS0A 5KPDA 2D4HA 1OFUX 4BASA 2GK6A 5UKDA 4EPYA 5FUYA 1GL9B 5JBQA 1X1SA 5B30A 2ZRHA 4URUR 2JATA 2B8TA 3MWLA 4ZDJA 1YKSA 4Q1EA 3GEIA 2D3WA 5FPYA 4BFVA 2B7BA 4HAWA 3TH5A 2XEXA 4BLQA 3ONWA 3OEHD 3JZMA 5KUTA 2OSBA 3IBYA 1N5KA 2AKYA 4B32A 4HDCA 3TMKA 4P0TA 3SOPA 2W83A 3W90A 1KDPA 3CRW1 3DEFA 3K0FB 4B71A 1WMSA 2VP6A 4FCWA 3THWB 4BEJA 2VP2A 1Z6YA 4ZI3A 2IT1A 4PXAA 4D0LB 1S9DA 4RD2A 3QKRA 3SYLA 2GZAA 3FHCB 2XJ9A 4HUTA 2AFIE 4UNNA 2FGKA 4OQFA 5B64A 5JEEA 2BWJA 1KSHA
chains in the Genus database with same CATH superfamily
4V38A 2C5LA 4FMPA 3E18A 3FRIA 4D0NA 3AYZB 5I7EA 5KHAA 1D0SA 4ZI7F 1TQDA 1RRCA 4PINA 4RCZA 4HGPA 2XMPA 3W6NA 3C3MA 4E4YA 1BKSB 2PH7A 3LYUA 3EC7A 4EG8A 4V03A 3IMEA 2PUCA 2C3UA 3DUFB 1RWVA 3M6XA 4IIJA 4J6EA 4MXDA 3WISA 3PQDA 4QTUB 5IDXA 4H7DA 4PTZA 4YBRA 5K0CA 5EPUA 1JLKA 2HBRA 3P9CA 3AHGA 3DDSA 4HYYA 4Q9IA 1I4EB 2X4GA 3GUVA 4QPJC 3I9KA 1UFOA 2FQQA 1T29A 4HP8A 4MGIR 5LU8A 2OORC 3DVRX 3IL2A 2R2GA 4NJOA 5EL0A 2O14A 1ORRA 1DBWA 2B99A 4QRIA 3UPUA 2ETXA 1I9CA 3C98A 3CM0A 4CF3A 4FDLA 1QHHA 1IHXA 1EVYA 1FLVA 1G5IA 1KVUA 2R4UA 5CRIA 4L0CA 3WNCA 2Y05A 5GADl 4S2EA 4TWRA 1GP2A 2C0CA 5HX7A 3VYUB 5IN4A 1OIVA 3CWQA 1GGVA 3I28A 3PC2A 1QP7A 4REQB 4QYIA 1PZMA 1XJ0A 4RUKA 4DLBA 4IOJA 1CIJA 1S8FA 1XAGA 2P0AA 5FOWA 1WETA 3BBLA 4V0RA 4H4CA 1Y8QA 3N28A 5TMDA 5IVIA 3QWIA 1YK1A 4KDRA 4RK6A 2JJ2D 3Q3JB 3LZDA 2ZJYA 4WUTA 3RDPA 2FQWA 4IUBS 1L9KA 3RVJA 1VYVA 4UAVA 3V97A 3RU7A 3MCAA 4A1FA 4M1SA 1E99A 1PFGA 2PXCA 2V3VA 4PC3A 4QPZA 3RWOA 1TO1E 3RADC 1NNI1 1V43A 4R0NA 1MEOA 3MTBA 1XRLA 4YLGA 1JTFA 1UXGA 3KXIA 5JECA 1NJGA 4XUDA 2VHYA 4TUYB 1ZPDA 4BQOA 3ANSA 2QUKA 3EVGA 4I4IA 1N6KA 2NW6A 1V37A 2G6BA 5IF3A 1U4NA 4IYRA 5DKFA 1BSVA 2HMWA 3DLPX 2ONZA 2JI4A 4L6CA 3JAWA 4ACAA 3NTOA 4HNAB 2QG4A 4Z3DA 4PHTA 3OKFA 3SQMA 1SKBA 3MJHA 4C7OA 2IEZA 5CDYA 5EN4A 3I4LA 4OJQA 2R47A 4KR6A 1UPCA 3BWBA 2JFFA 5FEUA 1UIRA 3HACA 4N01A 2A3RA 2ORVA 3OT5A 1I7DA 4Z4FA 2W6MA 1R0XA 4LI3X 2PX4A 1CQIB 2QTZA 1YKGA 1CULC 1IHYA 1K66A 2B98A 2V8BA 3CRZA 4MUBA 5GQSA 5J59A 1IY0A 4M1MA 2IV3A 4KNYA 3R44A 1RS0A 1WZUA 2EAUA 1WU8A 1ZI8A 2EATA 2OFOA 4M60A 5A71A 3U7HB 4KOEC 1IMOA 4OI2A 4PGAA 1JHMA 4XFKA 1OXXK 1TYZA 3THYB 1M3SA 1W88B 1P2UA 1DDGA 3O3OB 4CR8A 2EP8A 3KVNA 5SY9A 3LD9A 5AD1A 3T7TA 1RXVA 3OZCA 2C2XA 4RK1A 4LZPA 4BO1A 3VKFA 5DM0A 3PGLA 2IXEA 4JD5A 4ENVA 4EJ6A 1Y9EA 4GLLA 3QVUA 2J9FA 2X9VA 4QLAA 5KQMA 3I32A 3UMCA 1AZLA 1CE8A 1JU9A 3FMVA 1YASA 4G5GA 4R2HA 4CUJA 2VPYA 1NUSA 3MTEA 3ZV7A 1HNNA 4K8OA 4KLZA 1EESA 3GUUA 1YL7A 4DR1B 4QPNA 1IJKA 3GY0A 3IR6A 4L0QA 4L5IA 2QUHA 1OLXA 3JQAA 2DTXA 2FP3A 4KHZA 1DFHA 2OCKA 4M0PA 5BUSA 2VLIA 1A88A 4B3JA 4B87A 2C92A 2MINA 4AIIA 3RTGA 5FH9A 5TEVA 3IDQA 1Y5NA 3W4KA 1N8KA 2R6CA 2P0EA 4NEGA 4UMDA 4DA9A 2HA0A 5CU7A 5EUBA 4E5UA 4UARA 4MI1A 1KQ3A 1II8A 2XBUA 3VR0A 5ECWA 3KHSA 3PQ7A 1U8UA 1OH5A 4RY2A 3LY7A 4WIAA 2JVKA 4GPTA 1CR6A 5FUBA 1P29A 2E87A 1OGYA 1XEFA 4A4DA 4FXPA 2VUSA 3KUUA 3WLNA 5F4BA 2W6JD 2N3ZA 4AQ7A 4KQWA 2GHRA 1QH1B 3C1OA 1S5PA 2V9CA 2ERXA 1YTLA 3GLHE 3AH8A 4O2RA 2IP1A 3C3XA 4TYPA 4WW0A 4YJ2F 1KQFA 2YZ7A 1H8ED 2OXRA 1P3DA 3V55A 1SCIA 1Z2EA 4LQCA 1C7FA 1I4DD 1SVMA 2EEPA 5KYYA 5JPCA 4KXUA 4EI2A 1ODFA 2VHZA 2F3PA 2NO0A 2VK4A 3ISTA 5I5EA 4EYQA 4ZPJA 1RWQA 1AKYA 3C97A 1MEJA 2JLUA 2F3UA 4M22A 4PNZA 3M81A 4HNAA 2O1EA 3CKMA 1JNXX 4HNSA 1R6AA 3FMFA 2BFFA 4K8RB 3FSGD 4J3JA 3WJ2A 1M2VA 4F4HA 1OZFA 1CY2A 2C2HA 3F6CA 3JARB 3AO0B 4N0MA 2Y3IA 2ZRGA 1P2TA 3HB4X 4MW1A 5EA2A 5LBTA 1RRGA 2ZUBA 2YIMA 4GMGA 1RVDA 2XXBA 4MYRA 4RZSA 4QUIA 3WLIA 1F8UA 2D06A 4BC1A 1CQPA 1PNVA 4GOKA 3WL5A 4ZHQA 5H4GA 1PNRA 5DLQC 1GTRA 1VL0A 2QP9X 4FD2A 4J0HA 3WVNA 4KEAA 2YOFA 3ZVMA 2L18A 4F2WA 4U6QA 2ZIUB 3W8RA 3RO7A 3MJTA 3B53X 3LW8A 5ITZA 2I4IA 3HMQA 1X7ZB 4TZTA 1UBOS 4C08A 4NOJA 3NTQA 3GMSA 3LWDA 3R9WA 2XUAA 4TMYA 4LBYA 2P9BA 4KXMA 4JYAB 1KY5A 1KF0A 1W1WA 2NU9A 2UVPB 1E4OA 3N59A 1OILA 4DKJA 4EMSA 4JI2B 2VRNA 1LTQA 4DDVA 1W9MA 4A0FA 1RBQA 1MH1A 1N4DA 1VJTA 5FTKA 2AMYA 1SVOA 5EE3A 1XA0A 3QQ5A 1GQRA 5AXBA 4YR7A 3T1QA 4G37A 1E7YA 2W7TA 2WIKA 3BWXA 3VYVA 5F7OA 4OGFA 1KWKA 1PT9A 1H4QA 1H2BA 2XBMA 5BSFA 3HB9A 1XDGA 4HQNA 3FOBA 1MRZA 4CM7A 3WRXA 3ZR4B 4PZZA 3MNFA 4IIJB 3W3AH 1GUAA 4FMCF 2VPWA 3LRTA 3WBJA 4GP9A 4NVRA 3QOWA 1JHOA 2V7VA 3BEOA 4H4EA 4ZAYA 4M9QA 4QT0A 2G4LA 5DP1A 9LDTA 4BGUA 2YWRA 1Q7CA 1TCVA 3OPYA 4HFMA 4Q82A 1HYEA 3GAMA 4KVAA 1J2RA 1RLUA 2D2VA 3I42A 2ZUEA 2PM8A 1SD2A 3Q85A 1YTUA 1ZK0A 4RM3A 1T2DA 4WPGA 2VZ9A 3THRA 1K86A 1T3TA 2A9PA 3ZHVA 4J0KA 4MJXA 3G8CA 1P8JA 1Q2UA 3OZTA 2ZIXA 2CZGA 2ZYIA 1Z06A 4DUYB 1G291 2CJPA 5FPQA 3VAZA 4DA0A 4D8VA 4ZV4A 2A2ZA 4FKMA 5I9SA 3PRJA 4CQLA 1FJGB 2OHFA 4MIOA 3EC2A 2GDJA 4AKIA 4YAEA 2EIHA 4UEOA 1KBQA 3A25A 3HNOA 2B2XA 3B1YA 1DQYA 4BC0A 4EECA 3N2ZB 1KFCB 5CD1A 2IUYA 4JBLA 4G25A 4PHCA 2V54A 4ZVMA 2BYTA 2RHWA 1IN5A 1UM9B 2EFCB 3VO9A 4X6YA 1SCUB 4P3YA 3SFVA 3CZ4A 1A2BA 2NTYC 2JJ8A 2OYCA 2AMJA 1FZTA 4DJTA 4KUGA 4HAZA 5KWVA 5K2OA 1ZM9A 2Q8NA 3WNVA 4O25A 4G5RA 4PAMA 3EEIA 5EP2A 4NPAA 3UN1A 4XWWA 2VF7A 1GY8A 4I9NA 3QWHA 4K1LA 4KN6A 5M04A 1Q0TA 1T8RA 2OOKA 3OZAA 1PG5A 4IJQA 1RI5A 1R0ZA 4P2BA 3WWOA 3VR6A 2ILVA 1DRJA 1KP3A 4MCIA 1IXSB 2CC2A 3D7NA 3QFFA 3V4FA 3GZNB 5DM60 1GZ7A 2VZEA 1J0XO 1N6IA 1SBTA 3EIFA 2N75A 3B85A 2EWMA 1XPUA 1KRWA 4P81A 5EMKA 4PFJA 3ZTWA 4A1OA 3LY9A 1IUPA 2BZGA 2ZUDA 3HWSA 5IAEA 2ONJA 2A59A 1KORA 4UM5A 4AWXA 4U8HA 2ORIA 2BBWA 3DDHA 2DUWA 3DEJA 3W5JA 3ZI4A 4KR9A 1M8KA 3V4LA 2X8JA 4X85A 1U8YA 1HUQA 2X8AA 3O8RA 4YNBA 1YF3A 3ZGYA 1WKBA 1W88A 1KQGA 1GZ3A 3A4MA 1LXCA 4FDAA 4LMPA 1CJSA 5CVVA 2W2KB 4H3HB 3KSAC 1QF7A 3SJZA 3OC0A 2LWIA 2ZR7A 3ASZA 3WWYA 3OCYA 4E13A 2UU9B 1SHZA 2OO5A 1XTIA 3NVDA 5C8ZA 3THSA 3T6KA 2EF1A 3KKKA 2OCIA 2FRVA 1YVDA 1O4VA 2VHXA 3OPYB 4Q4JA 1FP4B 2AD5A 4TRJA 3ADPA 3PHCA 5FYQA 1JPVA 2Q29A 1XZFA 2Q9CA 2AC4A 1IFXA 3AP1A 4PX5A 3VVBA 3U3JA 4D4MA 2XB4A 1JV2B 3AJ8A 3QE0A 2SICE 3OOHA 3QWBA 4S1OA 3ESYA 4X1IB 4PCUA 3RAEC 3GBPA 2CNWD 4R3WA 5KVAA 3PJDA 3NLLA 4NFYA 3VJKA 5B3KA 3EEFA 2QLLA 1JRLA 3M1LA 1N3IA 3LK6A 4Q02A 1QTNA 1T1IA 3JYHA 3JQ7B 3K16A 3AL0C 5JS1A 2HA3A 1Z6ZA 1KEVA 5EEHA 4FGSA 5IYZB 5COAA 1M8JA 3SGLA 3NTVA 2AG0A 4ARSA 1GYRA 1ZRHA 4JJKA 1XG5A 1TJ5A 3NRCA 1ADYA 4XH9B 5AT1A 2BM0A 4RMNA 4R3UC 2O57A 2EHJA 2YVAA 1SIOA 1RJGA 2RG7A 2RGUA 5JSZB 4YBZA 5AVYA 4NP6A 2G67A 4Y9RA 4WZBA 5JV5A 2MYPA 2FPXA 2ZLBA 4L8LA 1EK1A 2AUMA 3MF4A 5HQJA 2EQBA 1QCCA 4KU4A 1K0UA 4FYYA 3KQKA 2JIDA 2KWIA 4YHHB 3KKOA 3SJCA 2XT0A 4D9NA 4JFRA 5ERYA 3R9IA 1J5XA 1UCFA 4IAOA 4AJOA 2RH5A 1EMDA 3ZHTA 2I54A 3NALA 1KIAA 1ZGAA 3SEQA 1RJ9A 2BP7A 1Y5IA 3RSOA 4R2KA 3EX7C 1SZJG 4QECA 1EJ0A 1GL6A 3EZ9A 4KBFA 2EJUA 1OA1A 3GOQA 4ZYXA 2XI4A 2GSWA 4ISCA 4BVEA 2Q7XA 4HQRA 4NC9A 4RHCA 3FXAA 4RGQA 4GZLA 3AY7A 3AR6A 3P0EA 5FEMA 3VMMA 4A91A 3IEIA 4DMKA 4P7FA 5HF6A 1V9SA 4RD1A 2E5FA 2XYGA 2YKGA 2JS7A 5ED0A 2YHIB 2CF6A 3OAAA 3ZD8A 5LOVB 4F4IA 1M73E 3NX4A 3PNSA 3KE9A 4FBLA 4DY4A 1PR1A 1WD7A 2GESA 2JGNA 2QTTA 2VJDA 2WHQA 3EXHB 5AIAA 2Q8QA 1BVHA 3TNFA 2X8JB 2HZ7A 4GBED 1W4CA 2Q1YA 5ERGB 1DCKA 1SG6A 4BO6A 1BGWA 5FI5A 3OO1A 1R6VA 1DRWA 4HD8A 4U7GA 4M1YA 2YBEA 3I0ZA 4MV0A 4BUJA 5BQFA 2J7KA 4AT1A 4MRAA 2QQEA 4FFVA 1M5UA 4LKOA 4BVFA 3O8LA 1ESEA 2Q1TA 4RBNA 1JZTA 1OU0A 3OFNA 3KZVA 2JGJA 3DXXA 3FTCA 3HZRA 3ZE2B 1G7TA 2N1MA 3E7WA 1EG2A 3FGOA 3SHQA 1RE1A 1CVIA 2PX5A 4IZIA 4IDPA 1CR4A 2FG7C 3A05A 4KO2S 4TQAA 1FRZA 3D2LA 3H99A 2XCUA 3UXMA 1D4AA 4C6TA 4FC6A 3HU5A 3GJTA 1KQOA 1P91A 2O3TA 2ZYGA 1AF7A 1I3CA 3EGDA 2PHZA 4YT2A 1JDZA 3S2IA 3KUDA 4KIGA 3I9JA 3F3YA 5JCJA 2Q5QA 2PMEA 1PKXA 1GNQA 2QQGA 4BX8A 3IKJA 1Q1AA 1FYWA 1FK8A 4AJJA 2O2YA 1W4AA 2XNCA 3UWSA 3GAZA 5KU7A 4YRDA 2SNIE 1UUFA 4WN9B 3RASA 2JRLA 2PIDA 5B3AA 4BVAA 2ODPA 3ESBA 3F2IA 5U1PA 5A9RA 3S1SA 5AP9A 4ZYYA 4UDYX 4I9UA 1LDEA 4FINA 2OV4A 4RAOA 1SNYA 2X13A 3D3WB 2QMEA 5EMJA 1L4EA 4YWJA 2P7HA 4D46A 3LVRE 1XFAA 3E3OA 3LWZA 4S3MA 1JN0A 2RC5A 3CIFA 3HCPA 4TV9B 2CKMA 3HRKA 1TCAA 5H3HA 2IYUA 4NU8X 1BVYF 1GSAA 3O0DA 3L2OB 3P0FA 4JEMA 4JROA 2QXYA 4M83A 4RMJA 4JJAA 1I4OA 2ZIAA 3JWHA 4H7HA 4HADA 5CNKA 4C4XA 4C9BA 2BP7B 3W6OA 5IULC 2YV3A 1DMRA 4G4JA 1T36B 5JH7A 5BV2P 3U7GA 1J21A 3BDIA 3G8DA 4JBGA 4KYTA 1W44A 5K5EA 1X7XB 2IEIA 3OM8A 4GU5A 2J0EA 4HY3A 4PR3A 1JSZA 5EUQB 3H9UA 4H16A 1YJ5A 1OFTA 4HRVA 5AOCA 1V9CA 4AL4A 4BNZA 4OA5A 4V0ME 1H2YA 1RR6A 2XTZA 3EGXA 3TMYA 4E3ZA 1IY9A 1REQB 3B12A 3IRUA 3QIVA 3EJWA 1QH8A 2I2WA 2IS2A 1Y63A 1DTEA 3KXDA 3ZDCA 3DPIA 4C1BA 2GPNA 2JDID 4PLGA 2ZSBA 3AKEA 3KFXA 4AZ3A 1M5RA 1YI0A 4E5KA 2ZRJA 3B9BA 2C97A 4BE7B 2AHRA 2FX3A 3G23A 1JPJA 1FMJA 2BJHA 2C7QA 1RM5A 3BHNA 5B7GA 3WLTA 3RC1A 3WKAA 5C34B 1R6UA 2G83A 4X84A 5IXJA 4HGOA 2ZYDA 2Q27A 2O59A 2D0OB 4II3A 2Q99A 1MO2A 1OX6A 3EMKA 3DAOA 2HXGA 3FDXA 3IELA 1RI3A 4A6EA 2PL3A 4HH0A 3WSTA 3K70C 2P6RA 5TT1A 4JP8A 1DP4A 4F72A 4EUNA 5LZ4A 4L6AA 3KX2A 4XPIB 1B76A 2BEVA 5K0JA 1VECA 4A0HA 1OCEA 1EB8A 4ZJZA 2W2LD 4C6TB 3AUSA 4PN7A 3DL2A 3MVEA 4L8YA 3NYRA 4B76A 1QF6A 4FI3F 3KOWA 4Y0AA 4BXOA 3KHTA 3BD9A 2O8EA 2FA9A 7MHTA 1PAUA 3TIFA 2EG9A 3ZCRA 1KO5A 3HKEB 4JLWA 1S1CA 5TMBA 4CHGA 2ZGVA 5D84A 1WMAA 1Q44A 1TMKA 2GTIA 5HZGA 3I2FA 3NCHA 2V7BA 4ZAVA 3FJYA 2IKSA 3SSAA 1ZN2A 3ZGXA 4I5IA 5EIHA 5BT9A 5KNDA 3AB7A 2J0VA 1V1JA 5CCEA 4FEYA 1NKVA 3IO5A 3OSUA 3H1GA 1T0UA 2YMPA 4F5ZA 3OBIA 4AJIA 4DRXA 1K4YA 2I1QA 4J91A 1EUDA 1SC1A 2H48A 1PYOA 3FD8A 4LXGA 4MKHA 4TMWA 4CVNA 2BGGA 1BFKA 1UBUS 1ZIOA 2RBEA 3DZFA 3N7UA 2GN8A 4XOIA 1RYNA 2YDXA 1DC3A 4IFEA 3TI7A 5JMWA 4B47A 1CUYA 2KJQA 1F12A 4YJKA 2ZTVA 3CRVA 3I53A 4U0KA 1QHGA 2M32A 2W8ZA 2NNWB 4A16A 2IDKA 1S0UA 4OXQA 3BAFA 3UKOA 2AMLA 3GO4A 4AKTA 5KCZA 4JYZA 2NTNA 3RSCA 4DVGA 1QQ6A 821PA 1MIOA 1AGRA 3PXDA 4JEUA 4LJ5A 4ZAWA 3SS7X 2VP3A 3LFTA 1BDIA 4EELA 1NN5A 1NJ8A 2C59A 5I8ZA 2IBMA 1HR0B 3WYGA 1Q22A 2FV8A 3F96A 5CVDA 2G17A 2FSVC 3PWSA 1IWBB 2QX9A 1Q0UA 5IXYA 3HGMA 4D6PA 3JQGA 4GQBA 4HNUA 1FUIA 2QXTA 2OCGA 4MWTA 1H5QA 4EB0A 1J9ZA 3R0IA 1KI3A 2HMYB 2VHUA 4KGXA 4YCAA 1CIPA 4DDKA 1CDOA 4KLNA 4PR0A 3TZKA 4I3FA 1V8OA 2WJJA 4LW8A 1X2EA 3RFXA 4BVBA 1G8PA 4ENWA 3CW2A 4WGFA 2ZWAA 2B78A 1W4ZA 2QRNA 4M0KA 2NPFA 2OESA 4UXHA 2DPGA 3COYA 3STUA 2Z3VA 2C1EA 1FFDA 4MUAA 3LPNA 4O2BF 1QS0B 4FNAA 2G0NA 5DLEA 1X87A 4LNUB 1SQ0A 1V0JA 1V7PC 1Z73A 3FGPA 1Z83A 5G2OA 3KV1A 2OLKA 4K26A 4EF6A 1IN1A 4M9SA 3DMTC 1NE2A 2IPLA 3NJRA 3F90A 1OHHD 2HA2A 3T1YB 3VZSA 4YPOA 2ZCJA 3QM1A 4LTMA 5ALRA 3VA7A 3BERA 1A9RA 3EK2A 4NCKA 3RS2A 1EWRA 1CR1A 5IUKC 4PRYA 4XVCA 1EE2A 3DMFA 1P4HA 1U2PA 1V3UA 2LIVA 2X8WA 5DK6A 4BNVA 1E2MA 4NOLA 3ABSB 3CU5A 5JAMA 1G21A 3S7TA 2RIRA 5FLKA 3WK9A 3O9VA 2EP7A 1DAMA 2NX2A 3DKRA 5HXAA 3L4KA 2PH3A 3TTXA 1KMQA 3RVPA 5B57C 2HPAA 4AJ1A 3ANMA 3ORSA 3K2EA 2WA1A 2O2GA 1U7HA 1YU9A 2J4CA 4P7KA 4R8SA 5F2EA 4RVOA 4BLPA 5A4AA 5H59A 5KTSA 4HYQA 2O0KA 3LUHA 4NCBA 1WPRA 3BFVA 3QKSB 1G2QA 4Q7EA 3EYWA 4FGJA 3ABIA 2P79A 4B6SA 5F9HA 1FSGA 4TUYA 1GLGA 4BYGA 3A31A 1P6UA 3KZXA 3OLQA 4QNNA 3AZOA 1N77A 1W76A 2VL7A 4R1PA 1PVVA 4NYIQ 1COWD 2O0LA 3MBKA 2XGMA 4RHYA 4PO8A 1XDWA 4EATA 3EDRA 9MHTA 4QOEA 1RSZA 3ST7A 4F2PA 1C50A 1GQYA 1IMJA 1FRNA 1ESDA 3BXOA 2A88A 3MINA 2V7QD 3EGWA 4ZQFA 2IGTA 2HC9A 2GPWA 3TAXA 1XZBA 1ZMTA 2E4VA 3G02A 2GTPA 5CT8A 4A8JA 3K15A 4XPZA 3DKPA 4I4LA 1QYIA 2OMKA 3GEHA 4XB6B 3LKVA 4Q48A 5CFMA 1VGVA 4LDNA 2YN0A 1XHFA 5CK4A 5C32A 3EIOA 2HV9A 1C5KA 1V1RB 4QNMA 2W70A 1X8JA 1E0DA 1A96A 3N0VA 1GNLA 2B7CA 2FMFA 4S24A 2WTMA 4DV7B 3CCCA 3FCOA 4XFJA 1Y80A 3ZJTA 1D5WA 1FP4A 1II9A 2KM1A 1U1IA 3FPSA 4HMOA 3HI4A 4M89A 3U4HA 4BKQA 3OMLA 2DJIA 3ZDXB 2YWHA 5KVSA 4RK5A 3RV4A 4GDMA 2NU7B 5JOQA 2HU8A 4DZRA 1LLCA 1N6RA 2FR8A 4I9FA 4FOLA 4M0DA 4MPDA 4RIFA 5IXSA 5ESDA 3EA0A 4H0NA 2XRZA 4AUKA 2I55A 3PUIA 1L8QA 5AJHA 1QIEA 4J4HA 4DF3A 2UZ1A 2XWBF 3AF4A 2GO1A 4L8VA 1NVWQ 2IZ0A 4N82A 4BZZA 2Y1LA 2PZFA 3OZXA 1EFDN 4RJJA 3P20A 4TL8A 2XZTA 3FE2A 2M6KA 4Z4IA 3K9NA 2OOSA 1Y9JA 3RVRA 3DZCA 1CR2A 2O2XA 1C8LA 4ZVKA 1G3QA 4K0RA 1II8B 2B1JA 3GH1A 3IR5A 2A8YA 2GM3A 1HF3A 2Q49A 3QBEA 4OYRA 4KHPB 4WN9A 5IH3A 2IIBA 3A37A 2XVMA 3NAGA 3ZDDA 3ICQB 3DTVA 5D3QA 4BO2A 1EFRA 1Z12A 4JJFA 5GIPE 5LUAA 4LDQA 4JA2A 3GFFA 1T0PA 9LDBA 2FPPA 2G7ZA 3E9NA 3GFSA 1DAHA 2BCGY 2IW3A 2Z58A 5BYJA 1SO8A 3SX0A 1KJZA 3ZDBA 5DBEX 1GT91 3HS3A 1JFSA 2VLBA 3ENWA 4NMXB 1CY8A 2IOYA 7GPBA 4YI3A 3HXKA 1MENA 5DM70 1ZR4A 1G4UR 8AT1A 1JUDA 4PLVA 1BX1A 4PW0A 5IW8A 1WWKA 2YX1A 5EMMA 1RW4A 1MIHA 2WBLC 3DXZA 4FUQA 4NPCA 2JEZA 1BE1A 4D8YA 1W87A 3DYVA 1YQDA 1JIXA 1J2UA 1YSCA 1V5IA 1YE3A 2Y0EA 3BE4A 1D04A 2PAAA 2RH4A 3HCEA 3HHEA 4DC1A 3VTZA 2BT4A 1FVOA 4MK4A 1PI3A 1QH8B 3ACCA 3CN9A 3K94A 3PUWA 3QA3E 1BQEA 4Y30A 2EW1A 2R4TA 4JENA 4DUGD 3QH4A 5D5PA 1NLUA 5EE1A 3I72A 2J6CA 2QSUA 3PTLA 4NX2A 1YJCA 2QN8A 2FF7A 1GRRA 2I2CA 3JVIA 5E8JA 1BDHA 3X1YA 1U8ZA 1V71A 2BEUA 4TWIA 2PSJA 1L4FA 3AFNA 1KEZA 3PL1A 1OKKD 2QE6A 1PR6A 1CZKA 4UW9A 2ECPA 3M7IA 3MT9A 2QP4A 2J8ZA 4C7MA 2IU3A 4WY2A 2BRUA 3UK0A 2VQSA 3JD3A 2RHJA 2F9LA 3PDIB 3ZCUA 1E6UA 3AESB 2AHOA 3R2JA 3U7QB 4MSUA 3EVFA 3HKDA 4E11A 3GLVA 4A3SA 4G84A 2OWEA 1G66A 3FYTA 1T4DA 2YBDA 1UOEA 2NZVG 1WUYA 3ZVRA 1YS4A 4D0GA 3H2YA 2IE8A 4UVGA 3NYIA 5FNVB 1VLQA 1OMOA 3FWYA 2A5GA 1W4RA 3LP6A 4I55A 1YMVA 2AOWA 2BW0A 3E2MA 5AW8A 1JGTA 1NI4B 3ZJVA 1LX6A 3I92A 5CM2Z 4CR7A 4PC6A 4NBTA 5ALUA 3W8DA 1P5ZB 3UAYA 2FFQA 3CKLA 4TL6A 5F3WB 3GLTA 4IQ4A 1CUBA 4NBLA 4Q1CA 3FPJA 5B2FA 3JQ8B 4Y3UA 2RCYA 4QUEA 3WTCA 4CUKA 1TNDA 3P9RA 3B82A 3EXG1 1OWMA 1TU0A 2W90A 1Z0KA 3DTVB 3L8ZA 3LBIA 4FD3A 4ZVSA 1QZZA 3Q98A 4ZVVA 2PUGA 5BVGA 2JHPA 4L8WB 2VH5R 1DX9A 1II0A 1QHYA 2IHYA 2VDLB 4K9PA 4M99A 3UJCA 5K8CA 2I9KA 2FG6C 1G63A 1XKLA 1LK7A 1E3JA 4LZOA 4B40A 4GMDA 4NYJR 2Z8YM 1PJ8A 2H4ZA 1SUDA 1YDEA 4IMIB 5HFNA 3TQQA 2FW1A 4HZUA 4JLMA 2R6R1 2WD9A 3RT7A 1Q1QA 3W77A 2MYUA 3ZDEA 4NH4A 3MGAA 4A8HA 4Q3AA 4EI7A 3MTQA 1IG3A 1NR1A 5A4KA 1MG5A 2EDCA 3UV6A 2XB2A 4UAGA 4N4AA 1FTQA 2RAFA 3Q0TA 3F0TA 2IZOA 3JWEA 2VEDA 2XOEA 1E9BA 4C20A 4YQYA 3K1TA 4LVUA 2Q5OA 1SD1A 2OZEA 1BW9B 1VKZA 5F9MA 1NSTA 2PL9A 3A6KA 3AV0B 3KV3O 4IQGA 4LVNA 5GTDA 3ZBTA 1ID8A 1KEUA 3WY9A 5AW2A 1VA4A 3LGAA 4PG6A 3SBDA 2P30A 1UP7A 4KAAA 4Q7LA 5E6SA 3WWZA 4B6QA 4BN5A 5ADUS 4X65B 5ADHA 2ZI4A 1ETHA 3IT1A 4KGZA 5C5CA 1BGXT 4IKEA 3WC4A 3BD7A 1RXEA 3HU3A 4BLUA 4DJ5X 1JU4A 3A4TA 1N75A 1Q84A 3IAEA 3ILHA 4IH9A 3GRFA 2HRZA 1DC6A 3ZX4A 2WV7A 4CT0A 1WZCA 2ZBGA 3ROQA 3MINB 4YQZA 4A6DA 3HWWA 3SJBA 3IUMA 4ZRMA 5THKA 1L1QA 3C87A 4HQ0A 1F1BA 1N0WA 2H0QA 1MJFA 3AIMA 4K03A 3GU3A 3PQ5A 4H9GA 4Y8VA 2FJUA 2DWCA 3QVOA 3UW1A 2EFJA 4K2HA 1ENYA 1GCIA 1ECGA 2CBZA 1IL0A 1JEAA 1OZHA 2ZDHA 4MRPA 4CCAA 1GQQA 2VTKA 2HHAA 1Q14A 1XGKA 5E9JA 1XF1A 2AVDA 3AUAA 3CZAA 5FPPA 4X66B 1GR0A 1VGQA 1YR6A 3NV7A 1J07A 1ZESA 2C8VA 2POQX 2XMDA 1ZNZA 4IQFA 4YREA 4Q7QA 2ZJZA 1P77A 1DAPA 4PYOA 1FMCA 1Y0BA 3E9EA 3LQFA 3NATA 4YXWD 5AW1A 1CEEA 2GZSA 3DE4X 4A10A 2IS4A 1GTJ1 2D13A 1KK3A 2ENWA 2OFWA 4Q4DA 7ADHA 3TR6A 4YAOA 5LQDA 1FX1A 1U31A 3NHYA 5HR5A 3C4JA 2WUGA 2ZSKA 3BAZA 4AS1A 3QFRA 4DRZA 3JYLA 3HABA 1SC9A 3REGA 2TYSB 1J0CA 2HJVA 1Z2DA 2Y0BA 1F4LA 1MX3A 2QRJA 3GVHA 3QLEA 5CJPA 4CQLB 3DHEA 4DPLA 4EYEA 3CLSD 5JNVA 4D25A 5GJBA 1JYEA 1N4AA 1LUAA 3M34A 1UK7A 2MWMA 1R8SA 2A7XA 3JYPA 5CA0F 3S27A 5IFKA 1E6EA 2ORWA 3GLIA 1GXSA 3DE0X 4FP9A 3ZY2A 1E2KA 4O4JA 1JIKA 2XQKA 3H19A 2B8JA 3CISA 3ELDA 4LQLA 3JAMA 1E32A 4ZEWA 4JP5A 2ZUSA 1P1BA 3QWFA 2O5RA 4PX9A 2JAXA 3G0GA 3QVWA 4IEIA 3W5IA 4CT5A 1SUWA 4CF5A 3VZCA 3FF1A 4MV4A 1P7WA 4IJUA 4L72A 3RG2A 4F1JA 3GRCA 3HSYA 3KSDO 2HA5A 5JSZA 4Z53A 4Q9HA 1SG9A 3BB3A 2HB6A 1PJAA 1KI6B 3JQQA 3KEFA 4RAQA 4RYDA 5DNEA 1YRYE 3WGOA 2B35A 1J0EA 1N1MA 4PFSA 5AI4A 1EIWA 1R66A 2CXOA 4WLFA 4S1NA 2GM5A 3MMPA 3IJPA 3RYHB 3RCBA 1IPEA 2XNKA 5T4HA 3QEAZ 1Z6PA 2C2BA 1KYVA 3CEPB 3F7OA 2DLCX 3PXCX 1NJSA 3S3TA 3TTVA 2QPTA 3F7MA 1NVMB 3D7SA 5C81A 3C2QA 4TL7A 1QHEA 1ULZA 2HWUA 1UWVA 2IGBA 1VGRA 4DA7A 2PH5A 4DQXA 4DXHA 2JGRA 2K6GA 5DX1A 3BA1A 1C3XA 3A36A 4DCVA 3KZCA 3U2QA 1QV6A 3MOGA 3PQ6A 5L3QA 4Z4EA 4Y7DA 5AOAA 3R40A 1OUMA 2JANA 1C80A 4PIMA 1ZH4A 2C04A 3V1KA 4EEZA 3N5KA 4J03A 4YIHA 1KJQA 4TTQA 2FDXA 4TV8B 1TYCA 1KSGA 4UNSA 3ROKA 2NP7A 2C00A 2ACKA 2FDRA 3RYCB 4PS0A 3L8EA 1RFLA 2AEEA 2VPQA 1L4HA 1H9CA 4R8RA 3WI7A 4K9QA 1V1MA 1K63A 2BMEA 2FPOA 1EB9A 3FOAA 3FPGA 1R0BA 4OQZA 2NV0A 4Q4JB 5IAKA 2P4QA 3VX4A 5JTTA 5B3LA 2FFAA 4UAUA 1NXQA 1JEDA 2YHAA 2DQYA 1PF7E 1VPVA 3EQZA 5H70A 3LW7A 3VAYA 5LBUA 5CDGA 4ZHQB 2PKYX 3TRJA 5K1ZA 3BVPA 4ND6A 4WI1A 2P6OA 4AJPA 1A8SA 1R8QA 2XB8A 4NJMB 3L07A 3VR6D 3WO1A 3WLOA 3DCIA 2A14A 4ZOEA 5LSAA 4QLBA 4K87A 4D7AA 5GZ6A 3WGTA 1P1KA 4ITRC 3DB1A 1SZDA 2I62A 5K8TA 1OV6A 5KREA 1O08A 2IHJA 1NJ1A 4Z9BA 1WKCA 4RTOA 1SJ9A 1T5SA 1ZNYA 1ZM2A 3TUJC 1H3EA 4MAFA 3VC1A 4MVJD 2AN1A 4RNCA 5EIOA 3HB5X 4L7VA 3RVQA 1ZLYA 3WP0A 5K0SA 1YVPA 5B4TA 3Q41A 5HYVA 4S2UA 3UV3A 3ZJ4A 4Y6LA 1E60A 4RA9B 2DXIA 1RYZA 4BNXA 4RVFA 4V3CA 1D1PA 3JQ8A 2L69A 1SRQA 4Q9LA 3R09A 4NLLA 3SLKA 4P54A 2R751 4JQCA 2OUIA 1YS2X 1FOEB 2BFBB 4EG5A 4V0NA 2HWKA 2H00A 4H1WA 2X0KA 5ARDA 3V7UA 1RBMA 3GIDA 4YCBA 5A02A 1X3SA 2C54A 1J2TA 2YQ4A 3L82B 2HRDA 1FS6A 4C30A 1BS9A 1UBRS 3RRFA 4EPXA 1RHQA 1TJ4A 1HLPA 3AY3A 4JFAA 3JQFA 4UU8A 1HE1C 2R44A 3VHRA 2J45A 2BI4A 1FFSA 4KMOA 4L8GA 4NENB 3BE5A 4BWGA 1U02A 5T4EA 1T3GA 2OG1A 4JXKA 3SKVA 1E64A 1GPYA 2FQYA 2BUBA 3UMRA 1CKEA 3WYFA 3FOWA 4F7DA 1H5NA 5ER9A 1LBSA 1SHUX 4YRGA 1WXXA 3TEFA 1L5GB 4ER0A 2OD2A 3GFQA 3W9UA 1ZHHA 1FDSA 3REQA 3VNVA 4BGVA 2EEZA 5C80A 2W8BB 2V0GA 5GVRA 2VI5A 4B2YA 1RRKA 4JEHA 5KC8A 1PW5A 3V42A 1NQAO 4A8JC 4JU9A 1T5LA 2ATIA 1MFPA 4P1ZA 4OQLA 2P2DA 4YEDA 2DTEA 3DBHB 3ZWNA 4DAOA 5IVPA 1DQNA 3T5CA 4G5YA 5KAMA 2I1WA 3KTFA 2IXAA 2XA1A 2CFSA 2O8BA 2A6PA 3H9QA 1P75A 4P35A 2J9RA 3GUZA 4JGBA 2UYGA 3GYGA 3HB7A 4I1PA 1T4GA 3HBFA 1CUAA 5ALPA 1Q7GA 3U9SA 1JDUA 4X24A 5C1DA 3ZLVA 4PFQA 2FSVA 1YQWA 3SFTA 2DKOA 1RC1A 1NBEA 2VTBA 2X22A 1HSOA 2QUIA 5ALNA 2WJ4A 3S81A 2O7NA 1SR8A 2ZE7A 1NV8A 2I2BA 1V41E 2QY6A 2I03A 4RHFA 3VZPA 3SOZA 1H66A 3F3KA 4MWCA 3AM1A 4X6XA 3ZZ0A 4RE6A 4WEQA 2W11A 4YPFA 4AS3A 4B43A 4YLYA 1NDUA 4L4UA 4LCBA 4P32A 4DA4A 1NIJA 3E9DA 5D6OA 3Q10A 1M6EX 1GKUB 3GMDA 3R9XB 3VUEA 3WZLA 4ASUD 2FI1A 1IBCA 3PDCA 2O5EA 4MR9A 5JJLA 1ZJYA 4O2BA 4LX0A 2YFHA 3GDFA 4LGYA 4WAUA 2Z4SA 3MJEA 5K3FB 4C03A 4IVQA 2QMYA 4AZ3B 4TLAA 1MB4A 1YHZA 2COEA 1CQJB 4PFKA 3ER8A 3TRDA 4EA7A 3U4QA 4TROA 3KYDA 5B7QA 2ZJ1A 2K4MA 4QJBA 3K9FC 3T3GA 2WY2D 2QU8A