3V00A

Studies of a constitutively active g-alpha subunit provide insights into the mechanism of g protein activation.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
351
structure length
351
Chain Sequence
HMGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDPYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMHLFNSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1/ Gua
publication title A constitutively active G-alpha subunit provide insights into the mechanism of G protein activation
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
total genus 95
structure length 351
sequence length 351
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 3v00A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v00A01
2QQ0A 4TWZA 4HAUA 5HE8A 3K70C 3M0EA 4NU0A 4BFTA 3CB4A 3UANA 4DWJA 3REFA 2WAXA 3T15A 1WMSA 1T8TA 1SHZA 2UVQA 2W6IA 3B1WA 3I8XA 5KSPA 1OH5A 3ZQ6A 2ZRDA 3N70A 2JIZD 2G3YA 2GJAA 4LHYA 4F4IA 1KI1A 1QHXA 3U3OA 1TQ4A 2A5DA 1OIVA 3AGPA 4TQ9A 1SZPA 2CHVA 2Z83A 3W6PA 4B33A 1X8KA 4V0LA 2GJ8A 3NC0C 3PUXA 2H1LA 4GZLA 4HSEA 3KJIA 4P4UA 1SKYE 2WJJA 4CEJB 1GAJA 2FFQA 5EXTA 3SYKA 5JLJA 4FMCF 1AS3A 121PA 1F2TA 1QHYA 1EX7A 3EWAA 4HLCA 4MUAA 5J40A 2Q6TA 4QGAA 4GOKA 4Z1MD 4WIAA 2REOA 1D2EA 5FPKA 1LS1A 4QC2A 5C2JB 1XEXA 4Q4JA 5D3MA 2A7QA 2JA1A 621PA 1NL3A 1CJUC 2J0VA 1CJMA 2FX3A 4AKGA 1GL7A 5JFGA 3OEHD 4D2IA 1R10A 2DFLA 3QPUA 4LHXA 5J4KA 1KJWA 3E1SA 1CXZA 3MFYA 5J4YA 3PJRA 3V4FA 2Z5FA 3BC1A 4TQUS 4RY2A 3GJ6A 2V55B 3OEED 4NYJQ 2CL0X 4N3NA 2YKGA 4F92B 3S1AA 3IGFA 2PMKA 1AM4D 4M1YA 4Q21A 5DN6D 2QAJA 4HB2A 4W5WA 1NI3A 1KSHA 5FPSA 1J99A 2WVJA 1WCV1 4IDPA 2HXSA 3EPLA 4RKFA 3ECCA 2IS1A 1GIAA 3KX2A 4R2IA 3ICEA 3EW9A 1JPJA 1E3MA 3TAHA 4URUR 3JVVA 1GL9B 2QMHA 3GCGA 4KO8A 4YMSA 5G40A 4MKHA 4W5HA 3X1WA 2ZETA 3W6NA 2PMDA 4G1UC 1NKTA 1CF4A 1U81A 2VSXA 4W7SA 2NZ8A 3BWDD 3SHFA 4HAWA 1NVVR 4TZ6A 1G8YA 2GHIA 2GKSA 2D74A 4MA4A 4DKXA 3J81k 1GP2A 3T1VA 1E94E 1P2VA 3LA6A 1T5LA 2ZJBA 5KDDA 4QM6A 1KSJA 4N0DA 1VCOA 4B34A 4OI2A 4WZBE 4H9GA 4UXHA 3HP1A 4KU4A 1C9KA 1OXSC 2R9VA 3TUJC 4IXMA 1MO4A 2ZYTX 1NVXQ 3C4JA 2BC9A 2VP4A 4OI1A 3EZ6A 1TMKA 3B2EA 3AVXA 1E0KA 1SVMA 3AUYA 3CRRA 2WBLC 4ZI3A 1NN3A 2RGNA 5L3VA 1XD9A 2A5GA 1TEXA 1DAKA 1Z6AA 5KNBA 2GK6A 3QKUA 3ZLJA 1GILA 4EPVA 2WM9B 3JVUA 1RIFA 1IQPA 1E2KA 2AK3A 4TLAA 1NLFA 3HU3A 3A6PC 4IHQA 3TW4A 2P6NA 1Z6XA 4NMMA 4NP6A 5IDVA 4ASUD 1UBCA 3QNUA 4PPQA 2RCNA 4M1OA 2RKOA 1FP7A 4GI7A 3IIJA 3G0HA 1KO7A 3I4LA 4V0NA 1Z47A 3WNCA 1XMIA 4IDQA 4Q7LA 4EFNA 5L3QB 4TT3A 1X3SA 2CCJA 4M1TA 4R7ZA 3H86A 3W3AA 3R7WA 2G0TA 3RS2A 1P62B 2LKCA 2ZR0A 3GJ3A 1GITA 1G19A 4GL2A 2JLSA 1CU1A 1E2IA 1GNPA 1AS0A 2J7KA 2ZS9A 4M22A 1T9HA 4EPXA 3MWJA 4Z1MA 3W8NA 5K8IA 2BEJA 5JHHB 3UG7A 3I8SA 3TR0A 2QTVB 1QG4A 2WOOA 1JPNA 4D0GA 2NO0A 5FTNA 1XEWX 2ZANA 5EE0A 1ZAKA 4IRUB 3OEHA 4Z8YA 2IYWA 1AN0A 3K53A 4RKEA 4FD2A 1W7AA 3IO3A 1NVUQ 1JR3A 4D81A 5BW8A 2GJSA 1DADA 4L16A 4XD7D 3K0SA 2NMVA 2EYUA 3EX7C 3OIYA 4PSAA 1P75A 2JLXA 2F3RA 3OEEA 1YR6A 5IHPA 2IXFA 4ZIRA 4A0HA 5ELXA 2PCJA 3DOFA 1LF5A 4M9ZA 5B64A 1PVOA 4EQ6B 1JQLB 5FL7A 3A1TA 2CLDX 1E96A 3THXA 3QG1A 3K0AB 1T6NA 1DAIA 2ZUDA 4FI3C 4JL6A 3L8ZA 1Q57A 2C03A 2J0UA 3PVSA 4PO9A 4V0KA 221PA 3I73A 2MSCB 1DBSA 3NEJA 4Q1BA 1E2GA 3QEOA 1II0A 4ZO4A 5KPJA 1M7BA 3BXZA 4D6PA 4IEIA 1UJ2A 1ESMA 1VTKA 1S2MA 1VDZA 1D9XA 4LI0A 4HUTA 4A2QA 4EFLA 2DY1A 3LVRE 4I1VA 1W0JD 1R4AA 1E2PA 1Z3IX 3GLGA 1OFHA 1KZGB 2ONKA 4HB0A 4CEHA 2QE7D 1HA3A 2NQ2C 4B73A 5SZHB 2ZS8A 4G3XA 4TYPA 3TH5A 4KBFA 3B82A 1TQDA 3WNDA 1XMSA 5FTKA 4LYHA 1RPZA 3CX6A 4C0HA 3KJGA 3TLXA 4MGZR 4QBHA 3ZVLA 2J5XA 4HZIA 1TX4B 1UEJA 4L15A 1D5CA 4ILEA 3AKYA 1W36C 5DSZA 3LD9A 4US0R 2ZTSA 3KB1A 3JZMA 4Q18A 4DC9A 1HT1E 4NYIQ 4TMWA 4HUQA 4Q48A 5TVKA 2JLZA 2DWOA 4DCTA 1VMAA 1KMHA 4QGFA 1IN4A 2RGNC 4LHWA 4A9AA 3MD0A 5BQ5A 821PA 2XOKD 4M1KA 5DE3A 2OBMA 3R9IA 5FL3A 3UXMA 1FZQA 1DAMA 5AJZA 1W46A 1HH4A 5AJYA 2IUSA 2JLRA 3KXIA 1MR3F 4BPBA 1OFTA 4XWAA 1OKKD 1UDXA 2C77A 1Q1QA 3WHKA 3THXB 4DVGA 1Z5ZA 2QG6A 3LWNA 2QZ4A 4JBYA 3MMPA 4OHWA 4HDOB 1CR2A 1U9IA 4GOJA 4ASUA 4KYUA 1ZC4A 3NG1A 5CDFA 1YRAA 4P4SA 2C9OA 3U7EB 2GK7A 2OM2A 3ZD6A 3RANA 5AUOB 4DJTA 3D3QA 2HUPA 3T1TA 1LFDB 4KYIB 1TL7C 4E5UA 3R8FA 1G64A 5BWMA 5CJPA 2DYKA 2VHQA 2W83A 3TSZA 4BEBA 5F9FA 4LYFA 2VF7A 2ZJOA 4JVSB 1JR3E 1XTSA 3Q8XB 4I1SA 4BFUA 3SFVA 1G9XA 2B8TA 3QXHA 1JALA 1G7RA 4Y0AA 3T1OA 1RJ9B 4G5OA 4DIDA 4LPKA 4NZYA 1KO8A 5AR1A 5AWFC 1QG2A 3QKRB 1Z6GA 4GDFA 4PC7A 5DI3A 2C9CA 5BXQC 4XOIA 4AC9A 1E98A 2JJ2D 4C7OA 1XZQA 3AVPA 3TMKA 3THYA 1UEIA 3O8RA 1FW6A 2JLUA 3LBNA 3BIFA 2HXYA 3NEYA 1Z2AA 1KMQA 4EJSB 4D4JA 2QGNA 4S35A 4XVRA 1S96A 2WMNB 1CKEA 4A8JB 4Q9KA 3HU2A 3NBXX 3NDBB 1DOAA 2FGJA 1DAEA 1X8JA 1YZLA 3SJCA 2GWHA 4JT4A 4K8OA 2WTUA 3IQWA 1ZJ6A 3BH7A 4FMDB 4MYCA 4Q4HB 3GLGE 3RDPA 1OW3B 3AVWA 1OFUX 4OHYA 3AKCA 3OIVA 4CGZA 4KFRA 2OCAA 1U99A 4F93B 4DUGD 2EVWX 3B60A 3VR6A 3O8CA 4NBSA 4CDGA 4IVRA 1EGAA 2VP0A 2ZEJA 3KB2A 2BM1A 1U90A 3QY0A 2ZROA 4RZUA 1US8B 4BFXA 4PAMA 4FN5A 4B3BA 3KQLA 1T3LA 5KNCA 1P73A 2PEZA 2IYUA 3P27A 1ZVQA 5B58C 2HJGA 2F9MA 4BUJA 3TRFA 5KO2A 1DAHA 1NNEA 2F43A 2BMEA 1DAFA 3CO5A 4EPTA 4IXNA 4NCKA 3PUZA 3T1QA 1X1RA 1D2MA 4QHYA 5FBRB 3GLIA 1VKJA 2BJWA 2A2ZA 3CH5A 3PV0A 2XTMA 4YMTA 3B1XA 3FE2A 2QT1A 3GPLA 3QUSA 1YR7A 4US1R 1CRQA 4QBFA 3VFDA 3SYLA 2BMJA 3QPVA 1E9FA 3PEYA 1EFRD 1KI4A 4E22A 1G20E 2XOKA 3A4LA 1G4UR 2D4HA 1E2DA 2CLCX 2C99A 2VIIA 4NHOA 5DI3B 3WYAA 3B8HA 3QEJA 1OH8A 3FFAA 1DPFA 1U94A 2EQBA 4S2EA 4Q03A 5C4MA 4AY2A 5IF9A 3VX3A 2ZSDA 4PZLA 1A7JA 1WF3A 1XTJA 1RRGA 3CNOA 5FI1B 5CDFE 2JLYA 2WOJA 1KDPA 4B3DA 1ZC3A 2QAGA 3OIUA 2O8EB 1T91A 4HI0E 1E9CA 3SS8A 3UPUA 1MABB 1NLZA 3KQNA 1FMJA 2CLSA 4HZUA 4MH0R 3UWOA 4HAVA 3ZZUA 1MO6A 4RCYA 5EXPA 1AQUA 3REGA 3WYFA 4DDTA 2Q9BA 1XD2A 2GF0A 3AGQA 1X6VA 2G88A 4DB2A 1OXTA 3U6BA 4BRWA 3LXRA 4QRHA 4G5SA 1QHSA 3L82B 1KI6B 4PC1A 3H4MA 3NDPA 3EZ7A 2IX3A 2NPFA 1FNMA 4PC6A 4U02A 1N5KA 3PITA 1W4RA 5EXSA 1MO5A 4URWR 1FFHA 1JI0A 1L8QA 1E32A 4E03A 2NIPA 4MRVA 3DL0A 1E2LA 1F60A 2ERXA 4R2HA 2ODWA 4TSFA 1TF7A 4URZR 1KYIA 1KK1A 1WQ1R 2GTPA 1ZW6A 2R8RA 1G3UA 1KDRA 4IJMA 4OQLA 2O0KA 5IK2A 4OQNA 4LC1A 1A82A 1Z22A 1FOEB 2GCOB 2PJZA 2V7QD 4H1VA 4JZKA 3NH6A 3KQKA 1XZPA 1RKBA 2PT5A 5FOUA 2JASA 2P6UA 3O47A 4CT5A 4B3CA 4XTRA 5C46F 3B6EA 1CLUA 2VH5R 2VBCA 3AVVA 2HYIC 1PZNA 1G291 4DT1A 1J2JA 1HTWA 5F2EA 3SNHA 3UG6A 2MMGA 1WB9A 4LYAA 5CIQA 3VNUA 3AVOA 4FCTA 3FKSD 3EZ2A 4YC7A 5EZ6B 2OHFA 2H16A 1MRNA 2C9YA 4BRUA 2AR7A 3Q5EA 3AVTA 4V02A 3AVQA 1QHGA 3RC8A 2FSHA 3B1YA 4URVR 1UBGA 3A1SA 4G5QA 1AIPA 2JLQA 2F1IA 3K0CC 4HLUC 1KZ7B 2JLWA 1GDDA 2PEYA 2YWFA 4C4PA 1KK2A 3MWKA 3KKQA 4OHVA 1M34E 4ZCIA 2W6ID 1G41A 1XP8A 3MJHA 4DSOA 2GXSA 2ORIA 4GOXA 2ZM5A 5FTMA 2DFKB 4DUGA 3QG5A 4YQFA 4BFYA 5SZKB 4QNMA 4MRNA 1KY3A 1FX0B 3QF7A 1Z83A 3AP2A 4XJXA 3SBEA 1ZBDA 3LV8A 3C14C 4GSYA 3ZYCA 2F9LA 3EA0A 2QUZA 4AKEA 3GLIE 3EC2A 2CJWA 1RW4A 1XEFA 3B9PA 4F91B 5BYJA 2X2EA 1ANKA 5EUQB 2E9SA 4DDVA 5IT5A 5JI2E 1N6LA 2W6JD 1KAOA 2A3RA 4BLSA 1W4AA 2XZOA 4CF7A 4DBLC 3K8YA 2Q3FA 2ZVQX 1ZU4A 5KSYA 1GG2A 3QF4A 1EFRA 1SVOA 5JEDA 1LB1B 3GJ5A 1IY2A 2ZJAA 2MMCA 3WYGA 2QQEA 1VIYA 2C98A 3SBDA 5LD2C 3OAAA 1SXJA 4L5BA 5IRCD 4A36A 3CPJB 2FU5C 1ZYUA 4HLDA 4IVQA 4FW9A 4EFMA 2FDCA 1GKYA 3K0FB 1KGDA 3FMFA 1XDBA 4FCWA 4M1MA 2OLJA 1G21E 3PCRB 2ZRCA 3FPAA 5FOWA 3P4YA 4M9XA 4MDFA 3DKPA 2EU8A 3TR5A 3ZS8A 1Z6YA 1K5DA 4HYYA 4CW7A 4C0SA 4LJ5A 4LJ4A 2FV8A 2YZ2A 1DTSA 1F5NA 5AJWA 1WA5A 4TL7A 3T61A 4BEJA 3AQ4A 3CRMA 2WJHA 3U3MA 2W2TA 1TNDA 3VR1A 4A0FA 2BWJA 5KDOA 4IVPA 3VU9B 1P6XA 4CEJA 4A92A 3D31A 2ZIAA 3CRQA 2FGKA 4XH9B 4HB3A 4DLWA 5UKDA 4MYTA 3GFPA 1OT3A 2OEPA 4C2TA 1NJGA 1A2BA 2B8WA 2ZRAA 4YMVA 4G0NA 2IS6A 1TU3A 1DO2A 3X1ZA 2A5JA 2WKRA 2V7QA 4JT2A 2IYZA 1YKSA 4D25A 1KOFA 3FWYA 2IW3A 4QBGB 1OXVA 4PHGA 4UNQA 1CJKC 4QGGA 1CR0A 1XWIA 3K70B 4GFDA 3FMIA 1ESNA 4QJ3A 2XXAA 3BD9A 4I81A 2DFNA 1IJEA 2JCSA 1GRQA 2DPXA 2ZS7A 3OHMA 2NO7A 3KL4A 2ODEA 1UKYA 3QF4B 1NN1A 3BRWD 4ZDKA 5JI3E 2XJ9A 1YZQA 1Z29A 4TL6A 4Q9LA 3IQXA 4NH0A 1KSFX 1SXJB 4QHSA 1G3QA 3U3JA 3NHAA 4LJYA 1GSIA 4AIIA 3KKNA 2WWFA 4C0LA 3CX8A 2OCBA 1KO5A 2BBTA 1WRBA 3K1JA 4LY6A 3HWSA 1N6OA 3LBIA 2H17A 3K9GA 5JECA 2P5SA 1ZD8A 4JLDA 4X8MA 3WXMA 2XX3A 4XVUA 1JB1A 2ZRBA 2O8FA 3VKGA 1ZM9A 1OB5A 5F9HA 2ZRLA 5JHGB 1F2UB 1Q3TA 3EIQA 4QM7A 3GLFB 5DO9A 1BMFD 1MV5A 5JCPA 1WXQA 2BMFA 2DWPA 2I1QA 2QBYB 3AM1A 4MITA 1HT2E 2G1KA 1E2HA 3HPQA 3BFVA 4Q1CA 2ZRKA 4C0QC 3CRVA 3PEUA 2YWGA 1XPRA 2D2EA 2RGGA 4TT3D 1VG8A 3U7FB 4PZYA 3N5CA 4UNSA 4DB4A 2NGRA 4KVGA 4A0RA 1G6HA 1ZINA 3ZS9A 2W6JA 2BVNA 5EE3A 1RZ3A 4XWKA 2KWIA 5FBLB 1GFIA 1TAGA 2ZYUX 3SE0A 4BFWA 1UBEA 4BLQA 1SXJE 1BIFA 3F3YA 2RGXA 2ZI7A 1K8RA 2EW1A 1IOZA 3L0IB 3IHWA 4J0QA 4Q7MB 4RSGA 4RZ3A 4TYNA 1NSTA 1W1WA 3ADKA 4DLSA 3L2OB 1JR3D 2XXAB 5FUWA 1TEVA 2QL6A 4BLRA 3DZ8A 1VG0B 4LHZA 2HLDA 3NWJA 1ZM3A 2OCPA 3ZVMA 3RLFA 2CK3A 2XGJA 4OQMA 1G5RA 2KI5A 3DPUA 4JL8A 1VYVA 3JZAA 1E9AA 3PQCA 5FL7D 3U4QB 4N1AA 2GAOA 3B5JA 4PSKA 5AUPB 3AF4A 3GJ7A 4EAQA 4CRWB 2EFGA 3TAUA 1JNYA 3BH0A 4O2LA 4U00A 3TKLA 2V1UA 4IOKA 5L3QA 2O8FB 1Z0IA 3ZIAA 2VP5A 5BN4A 4JLVA 2JDID 3UKDA 4JLBA 3C5HA 5BN5A 2VLIA 2DBYA 1E9EA 2BIFA 2OO7A 5CB8A 5FH9A 2OXCA 3NC1C 3IEUA 3MG9A 2YINC 5FFMA 1KNXA 3TSOA 3CWQA 2N42A 1XB2A 2ANCA 4OYHA 3IBGA 2FN4A 1KKMA 2ORWA 3RABA 4A15A 5TDHA 2BCGY 2CL7X 4B43A 1HV8A 3D7MA 3AP1A 1R6BX 2GBLC 3HYRA 2Q3HA 2WJVA 5ANRB 5C18A 4NYMR 5CJ2A 3W6OA 4C0JA 1OXUA 5DNYB 2V54A 1WBDA 1G8GA 3A1WA 1VCIA 3EIHA 4OL0A 4Q9HA 4TTQA 1E0SA 3FB4A 1EWRA 3I1FA 2ZJ5A 3A4MA 3CF6R 3SOPA 5LDDC 1KO4A 1R2QA 3KKMA 4PQYA 2RMKA 1XXHB 1E1RD 2PZEA 3Q7QA 4P3YA 3VX4A 2HCJB 2KB0A 2YJTD 3AEZA 4EQ6A 3LVQE 4LWZA 3Q72A 5CLLA 1OH6A 2AXNA 4LX0A 4YDHB 3BFXA 1U8AA 3CWZA 3K0AA 3PIRA 2ZRFA 1E9RA 3ONWA 3BBPA 3AF3A 1H8HA 1E4YA 2J3EA 1L7VC 2ASEA 3C16C 2QT0A 2UKDA 2GJKA 4NTZA 1OH7A 4JJZA 4EPYA 4WA7A 4DXAA 4L9WA 3SJBA 1Z28A 2H8KA 2ZAOA 2IYTA 4FXPA 4PSVA 1ZUNB 2KBFA 2IHBA 2I1VB 1BMFA 1IY1A 5HR5A 1M1YE 3Q5DA 2AKYA 2F7SA 4NCJA 1G8HA 4BGDA 3QI2A 3BOSA 1KY2A 1N0WA 1EFUA 3BB4A 4ACBA 4D82A 1N0VC 2Z4RA 1G7SA 5EQTA 3UMFA 2XEXA 3DEFA 2OLKA 4MDEA 3NKVA 5FOXA 3FHOA 3SJAA 2WWIA 4UXIA 4NYIR 4WBSA 4GMXA 1NP6A 5KSZA 2D7DA 4QJ4A 4DSUA 3HPRA 3OE7A 2LWIA 5D3QA 4TTRA 2F1JA 3AKDA 2CCKA 2OAP1 2V6JA 3L8YA 2RAPA 4GT1A 5E7IA 4MKFA 3A8TA 4OJQA 4WW0A 2FZLA 4H1UA 4NYMQ 1DEKA 2A9KA 4NCNA 3CNLA 3AKEA 4D4MA 2R62A 2W0MA 3MCAA 4MKGA 2OXRA 3EZ9A 2NOAA 4FMBB 2ORVA 5KSOA 4KAXA 2VYFA 3DMDA 3I32A 5L8VA 1B0UA 1L4YA 4MRRA 1FPMA 2R2AA 1XF9A 2AN9A 4I1UA 4PQRA 5CIWA 3RAPR 1BOFA 2X1VA 1Q20A 5EE1A 4Q5IA 2J45A 3QENA 2AL7A 2LKDA 5B2ZA 1TQ2A 2J9RA 1W36B 4O3MA 1VHTA 2JDIA 1IONA 3U7HB 4HDQB 4RD6A 1RVDA 5JEEA 1Q0UA 1R0XA 2WPDA 4JLMA 2HDNB 1NBMA 3X1DA 3TJZA 4WZ6A 2ZJ2A 4YMUA 4BLPA 1G4AE 1E2QA 2P0EA 5J5CA 1YR9A 2RHDA 2IHYA 3UK6A 5GJBA 2KE5A 4DLXA 1RJ9A 1Q44A 3KKOA 3RC3A 1XJQA 1OV4A 1AZTA 1IXSB 4B2IA 4KBGA 1HUQA 4BFVA 3KDSE 4TLDA 1Q12A 2QSZA 3THOA 4WAUA 1B23P 5CK4A 4U7DA 3QKRA 3H2YA 2X77A 3M4YA 3CF2A 4ESHA 1PUJA 4PTLA 1SULA 3AVUA 1SVSA 1I4DD 3IKJA 2ERYA 2AD1A 2VSFA 4E07A 1E1RA 2NPIA 1NMYA 2EFEB 2QMUA 2XAUA 2Z0MA 1G18A 1XFAA 4AI6A 1OJLA 1E2FA 4EJSA 3NHBA 1GWNA 1OF1A 5FUYA 3PXGA 2FMXA 2H92A 4A8JA 4E09A 3RRYA 4F38A 2IEYA 4ZDJA 1NJFA 5LPNA 3B13B 4DLZA 3K9HA 421PA 4Q9JA 5JJIA 3CLVA 4M8NE 1OXXK 4Q4HA 5B30A 3VR4A 2FG5A 1K5GA 2ZE6A 4D4LA 1HQYE 5L3SB 2OG2A 3CRW1 2NO1A 3EPJA 3ZVRA 3LY5A 2DB3A 4A6XA 3V4RA 5EP1A 2RGBA 4D4KA 5JRJA 1M8PA 4Q02A 1N5JA 4JBWA 2G83A 4OHZA 1T4GA 2X2FA 4DEXA 5TY0A 3PG5A 5GJCA 1E9SA 1US8A 1GZSA 2Q21A 3Q3JB 4PC3A 4JIMA 4PZZA 1D2NA 3KQHA 3C15C 1XTKA 3RYTC 1P2TA 1R5OA 2WWGA 5A5GA 3LAWA 3KQUA 1NG9A 3X1XA 4CT4B 2GESA 3VAAA 4LJ8A 5E4FA 2CMKA 2D06A 3LH5A 3H84A 4TSFD 1KIMA 1N5IA 1A4RA 4BLOA 1IN8A 1X1SA 2PX3A 5KOYA 2VTKA 3TSWA 4A2WA 2WWYA 3N2EA 4DDUA 4GBMA 1SVIA 1M6NA 4URYR 5IK2D 2EYQA 2FPKA 2JEOA 2RGDA 1KO1A 2ZSFA 1F6BA 4JLPA 3WY9A 4X8LA 2JGNA 5LB2A 2FJUA 3TE6A 4RZXA 5FTLA 1QF9A 2QP9X 1GL6A 1J70A 1GNRA 2BKUA 1Z0AA 4NONA 4AG6A 4V0OA 1E0JA 1I4TD 3K0EA 4DEYA 2QN6A 3WP0A 4JLNA 3GJ4A 2ZRHA 4DIEA 2REXB 4MUBA 2G0NA 3OIWA 1H8EA 4C0AC 4RFSB 2VEDA 3W3ZB 1GNQA 1YZTA 3UMSA 2O8EA 4LV6A 3W9YA 3FKQA 1MABA 4KHZA 1IAQA 5F98A 4JKYA 3DM5A 3QBVA 1IBRA 3QXXA 3DMNA 1XCGB 2GEVA 3CZPA 1DO0A 1NBME 4DCSA 1P9RA 1RE0A 3MLEA 5G3YA 1VPLA 2ONJA 3QXCA 4BWYA 3BJIC 2FEOA 4MGKR 1KI6A 1IXRC 1JR6A 4AG5A 5KPDA 1LTQA 5EXXA 3GLHA 4V0ME 1SVWA 1ZIOA 3EARA 5HZKA 2A30A 4B74A 2PH1A 4MYHA 4NPHA 3AF2A 1OLOA 4AD8A 4FMCB 4DCVA 2ZRMA 4WOPA 1JQJC 3IUYA 8OHMA 2OZEA 3UWKA 3RSOA 3QOFA 4PX9A 4RFVA 2YVUA 5LB4A 2QP3A 5B57C 3SZRA 4IEEA 2GCOA 2ODNA 3GMTA 2YWEA 4URXR 1ZM7A 1KJYA 3KKPA 4UJ3A 1N6KA 1ZNWA 1NN5A 4BASA 3MAAC 4MGIR 1YE8A 4IOJA 1YZKA 3ZZ0A 2D2FA 5CITA 2CL6X 1XMJA 2RGAA 1J8YF 4CVNA 2J46A 3CH4B 3RS5A 1KNQA 2CNWA 3GFOA 3LDAA 4IDNA 3ETLA 5FTJA 3TQFA 3CF0A 2P65A 3FOZA 2I4IA 1ZMXA 2IF0A 4KSBA 1DARA 3RRNA 4M2LA 2ZXUA 3I5YA 3OAAD 1SXJD 4DZZA 2O8BB 4PHHA 1VCMA 2ZI4A 4PAOA 4AWXA 3DM9B 1U9IC 1S0UA 2VPPA 1W4CA 3NXSA 1AK2A 4PPFA 4TLBA 1EFTA 4GMDA 4RJLA 3P4XA 1QHIA 2ZJYA 3CM0A 4QNRA 3VKHA 4C30A 3GJ8A 4OHXA 5KUTA 5M04A 4JSTA 1W44A 1E99A 4M21A 3CW2A 1U0JA 2ZAMA 2O8DB 2EFCB 3B9QA 3QJYA 4A1FA 2ZR7A 4XWOA 2WIAA 1BO6A 1FX0A 4UNNA 3QIAA 4KFSA 2WSSA 2ZITA 4YMWA 2ATXA 3LLMA 3PUYA 4DLRA 1Z06A 2J7PD 2ZE8A 2DFTA 3GLHB 4B3XA 5DGXA 3IEVA 3TBKA 1Z8FA 1RRFA 2ZJ8A 3TW8B 4DLYA 1OPXA 1TADA 1CR4A 1G5PA 1XRJA 3QKSB 2W58A 1A2KC 2YV5A 1EX6A 2QNRA 5AUQA 2PBRA 5G53C 2CHQA 3A36A 2GDJA 1ZD9A 2MSEB 2IWRA 3ICQB 1FP6A 4QGHA 1IY0A 5CM9C 3WMEA 2AXPA 1AGRA 1CIPA 1S4QA 2GNOA 1QRAA 2GXAA 2FSGA 1EXMA 1RC8A 2ODBA 2VQSA 5FBQB 3R9XA 3CX7A 2DR3A 4IFBA 3SHWA 3CIOA 4JL5A 3GFTA 3AV0B 2HF8A 2C2HA 5FOSA 2W0SA 1EFCA 1VHLA 3B78A 1NKSA 2JJ8A 2YWHA 3RS4A 1E69A 1U8YA 3K0FA 1DAGA 4WZAE 1VYUA 3MWYW 1MT0A 1X86B 3TUZC 2XITA 1Z07A 1D6JA 2AKAB 1LVGA 2REBA 3LRPA 2AWOA 5SZJA 1DVRA 3TIFA 2CE7A 2DCUA 2XB4A 2WWWA 1KAGA 3GLHE 3MUFA 4HDCA 5HTKA 4HB4A 1XX6A 1KJZA 1A5TA 2MSDB 2ZPTX 1MH1A 3BB1A 3QPWA 3TNFA 2FFBA 4TMVA 1CEEA 2AK2A 2GZHA 2WKQA 3MSXA 1COWA 2NO6A 4HAZA 3VU9A 1W4BA 2J1LA 3DDCA 3EA5A 5G3ZA 2FPMA 2HCBA 4KXFB 4N0EA 3ZH9B 4JKIA 3U3RA 1L2TA 5KHOC 4XSHA 4DRZA 4US2R 1DG3A 4F4CA 2QP4A 2FFHA 5LD2B 4ESVA 4QJ5A 3EXAA 3N2IA 1Y3AA 1LW7A 3DO6A 1W47A 3KFXA 4TMZA 4XVQA 2GCNA 1TUIA 1GUAA 4OK3A 2O8CB 1Z0JA 2ZYVX 1CS4C 2CHGA 4ZCLA 1QHHB 4B35A 4K46A 1HQCA 1J8MF 2QEQA 4TYWA 2PLRA 3B1VA 2NO9A 3P32A 3Q9LA 4LSGA 4TYQA 1G17A 3AF0A 1SVLA 3KJEA 4ARZB 5EUMA 4PO1A 1G7TA 1Z6TA 1GKIA 1N6NA 2BKEA 2ANBA 3U44A 3G82C 3THWB 2OFWA 2XNDA 3R20A 1Q1EA 1QBKC 2OBNA 4RVCA 4EPWA 1DS6A 3PUWA 1F48A 2B6HA 2QAGC 4JLOA 2HLDD 1JXMA 3QSYA 1J7KA 1R5NA 1ODFA 2ZYWX 2CK3D 4NE2A 4G01B 2A5FA 4KLZA 4P33A 3RS0A 3U60B 2OBLA 1UADA 2IYVA 1YR8A 3A1UA 5K8LA 2ZI5A 2GZDA 5TMPA 2IS2A 3ZQJA 4IDHA 1GKUB 5EE5B 2OT3B 2IUUA 5GVSA 1F2UA 3K09A 4I99A 4B6FA 3GLFA 1I2MA 4UNPA 1W0KA 4U5XA 2AFHE 1NLYA 3RVBA 2B21A 2P2LA 2QBYA 1N3BA 3B7GA 3VHXA 3WRYC 1R0ZA 2J7PA 2V3CC 3FHTA 5HPYB 4KODA 3SN6A 1ZU5A 3ZIAD 4R9UC 4A0GA 4ZKEA 1XPOA 2V9PA 2YHSA 1UDWA 2FSFA 2KBEA 3EPKA 4D26A 3CPEA 1KDTA 1XTRA 1M7GA 3EASA 2AWNA 4Q1FA 1S9DA 4BLTA 3SU8A 4JYBA 2J0QA 2QPOA 3L0PA 1Z2CA 3C8UA 1O3YA 3U5ZB 3RRZA 4FCVA 4Q19A 2ZSEA 1ZCAA 3C5CA 4PAQA 2SHKA 1EFHA 2GVZC 4IW3B 4JLJA 4M53A 2PZGA 1T8UA 3I62A 1YHNA 3LW8A 2BBOA 3WBKA 4DCNA 3LNCA 1G3RA 2N46A 4OQFA 4TMKA 3VR3A 3IILA 4PHFA 2HT6A 4LYJA 2AHOA 2WICA 3U44B 2VP6A 2P5TB 3U4QA 2BMDA 4CEIB 1CJVC 1ONBA 4LOAA 1GRNA 1SKYB 1T3SA 4PFSA 2E87A 2BOVA 1H8HD 3CUEF 3EIEA 2GEUA 4NKRA 1TTTA 1G8FA 3PFIA 4Z8XA 5GJWC 3T5DA 3SDZA 2HYDA 3VMFA 5TB5A 5JSZB 5CB6A 1H65A 3P20A 2F3TA 1W49A 5HCNA 3LO5A 4KCGA 2I3BA 2GJ9A 3G5UA 3KUDA 4AURA 5EJEA 1L4UA 4Q9IA 1VECA 1II9A 3P1JA 4LUCA 2E1RA 4LBYA 2IF2A 4R98A 1WDTA 4CYMA 1II8A 2H7VA 1UAAA 1DE0A 1XTQA 2P3SA 4Q7JB 3CBQA 2OUKA 1G8PA 3AB3A 2VHUA 4FMDF 2HEIA 4ZI2A 4UXJA 2IYLD 3U6KA 4AKIA 3CNNA 5K8UA 1E2NA 1LY1A 2JJ1A 1AKEA 3BORA 4KVAA 4PQFA 3AVYA 4Y0VA 1GM5A 2ZSAA 3OE7D 1LNZA 1C1YA 4LZZA 5J47A 1SXJC 1S8FA 5BN3A 2WHXA 1X8LA 1KTVA 1XEWY 3L43A 4JSYA 1RRCA 3NH9A 4Q4AB 4P0TA 3LX5A 2NTYC 3OFNA 1XXHA 2CVFA 4L9SA 2BV3A 1W2HA 2Q9AA 4C2UA 4JS0A 4LRWA 3FFBA 4ITRC 1CTQA 1UBFA 2J41A 1AZSC 4Z54A 1AGPA 4KFUA 1Z0FA 4ERNA 1OYYA 1HE8B 2YC2C 2W2VA 5TXGA 4DLTA 1ZNZA 1I4LD 3GLFE 1YZNA 1RFLA 2TMKA 1S3GA 3K09C 4ZKDA 3SC3A 1T5IA 1EWQA 5JJKA 5JS8A 3DZDA 2PL3A 4FINA 2CEAA 4DSNA 1E79D 4HATA 2H57A 4YXWA 1LV7A 4M9QA 4OBEA 3T12A 4B47A 2N1BA 5DHFA 4MYUA 4QHTA 2ZVPX 1XJCA 1KI9A 2QGZA 4B44A 4KITB 1ZM2A 4D80A 3KTAA 1ZCBA 5E3HA 1OB2A 3MGCA 4UJ5A 1JJVA 2FNAA 5HKKA 1W48A 2FZ4A 4BQSA 1P9NA 2W00A 2FSIA 2YC4C 5JWHA 5DH9A 4G5RA 2WPDD 3EZFA 1WBBA 1NBMD 2ZUBA 2Z43A 1QHNA 2D7CA 2C95A 3C7KA 1II8B 2X8AA 4IOLA 4JVMA 2Z4SA 3VR2A 1OHHD 1MRSA 4DLUA 1FQJA 2C5LA 2GXUA 3NBZC 1HE1C 1R0YA 3MWLA 4EUNA 5EZ5A 5GVRA 3T5GA 3F8TA 5H70A 1ZNYA 5KNDA 1N5LA 4ZV4A 2VHTA 2ZRJA 2VHJA 3IPYA 3MRSA 4LBVA 5TARA 1UF9A 3M1IA 4AYXA 1BYUA 4LHVA 5GADl 4QXAA 3W34A 2QI9C 1JJ7A 1GOTA 3IBYA 4O0MA 4MKIA 4FWIB 1SHKA 1F2TB 2IA5A 1HEIA 3OESA 2OAQ1 3I3SR 1P60A 4Q1EA 2XZLA 3E2IA 5CM8B 2ZSBA 4I4LA 3UMRA 2PX0A 3VNVA 4GP6A 1ETUA 2BJVA 1U0LA 1XEXB 4Q4JB 2BCJQ 5D3MB 3AH8A 5JMTA 3EPHA 1QDEA 4PO8A 1U2RA 3F0TA 4B32A 4TYYA 1DELA 3FMPB 3R9WA 3FHCB 2W2XA 1W5SA 5GJVC 1P2UA 3K9NA 2QM8A 4TL9A 4OI4A 2R65A 3KTAB 2ZRNA 3LW7A 4LDJA 5FOVA 2CVHA 2RHMA 3SJZA 1Q1BA 3VTKA 3S1AB 5FBWB 2OFOA 2UZIR 2RB4A 4I1OA 2GCPA 2B92A 2JIZA 4C9BA 5H68A 1NG1A 2ZU0C 4IDOA 4GP7A 1XXHE 3IDQA 2WAYA 2WIBA 2OFXA 3BAFA 2FFAA 5DLQC 3GP8A 4LC0A 1N6PA 5P21A 1E2JA 1MO3A 1EG7A 1YRBA 3MJRA 4JVNA 4DLVA 3ZJYA 1O87A 3TUIC 4NL4H 4F4JA 2WWHA 5EP4A 2NZJA 4BFSA 3TGPA 4OJKA 3T35A 1FQKA 1ZIPA 2QENA 3I61A 1IN6A 3ND9A 1E9DA 1N6HA 1S1CA 2EWWA 3NTUA 1GTVA 1NMZA 4B48A 1NY6A 1TQ6A 5JCZA 3KZ1E 3EAQA 3TVTA 2IC5A 3L0OA 1S1MA 4GRAA 4OK6A 1PLJA 1XMVA 3KXKA 2FH5B 2IBMA 1JECA 4KSCA 5LBIA 2VHCA 1NVVQ 3L0SA 1H8ED 3QBTA 4MRPA 5L3SA 1E79A 4IKEA 1N0UA 5CK5A 2QMEA 2HT1A 3R8CA 1YZGA 1NMXA 2ZJZA 2OSBA 2QRNA 2GVDC 3SFZA 1QZXA 2XJ4A 2PZFA 1BS1A 3H1TA 3ZD7A 1PV4A 2GEDA 1FUKA 1NRJB 2HJVA 5KTYA 1JEDA 4Q01A 2Q3MA 5E95A 1GRRA 4O2RA 3SI7A 3BK7A 3ASYA 4AKHA 5DN6A 1LF0A 2AX4A 3QKTA 3WP1B 4F7WA 3I72A 3W5IA 1KI2A 2EFHB 2CXXA 1OHHA 2QTFA 2ZREA 2J0SA 4V0MA 3FVQA 1UFQA 5FR2A 3LBHA 2GZAA 3ASZA 4POAA 5CYPA 1UKZA 1YU9A 2IYQA 3IHLA 4XTCS 3K9LA 3WHLA 1G3MA 1KI8A 721PA 2IYXA 1N6RA 2ZUCA 4LPSA 3HYTA 3TVDA 1A1VA 3C41J 1RRPA 2R6GA 2CNWD 3O8BA 1N25A 1Z08A 2OILA 3R7WB 2V4ZA 3SEAA 4DHEA 1R5BA 3AP3A 2ZE5A 4QFMA 2FOLA 5JRZA 1SGWA 4LCBA 4WVFA 4RFSA 3NVAA 1E2EA 5J4HA 5C4GB 3BE4A 4JLKA 1KHTA 2IK8A 2QSYA 1VG9B 2IYYA 4BECA 4Q00A 4WXRA 2WMOB 4Q4LA 1YJ5A 4OK5A 1XJ0A 4YDSA 3TK1A 2G77B 2QA5A 1R7RA 2FWRA 3W8RA 4OKSA 3X1YA 1FTSA 2AD5A 5DYGA 3P26A 3IPXA 5EP3A 3ADBA 1S3SA 3BH6A 4GNKA 1E2MA 1R8QA 2HF9A 3ZDQA 3HJNA 1M2OB 2IUTA 3QQ5A 2V6IA 3LX8A 4ZIRB 2WSSD 4Q1DA 1VG1A 4LBWA 2G6BA 3CR7A 2EFDB 5FBVB 4TMXA 2F55A 4GZMA 5CYOA 1AS2A 1Q21A 4AYWA 2VSOA 4P4TA 4QOSA 4NCHA 4LK2A 1TPZA 1SVKA 1ZD1A 2J0UB 3F5FA 3SQXA 2XZPA 4B2PA 3ZVNA 1HURA 1GVNB 2ECKA 3KXLA 1G5TA 1FUUA 3HDTA 5SZIA 1JAIA 4Q66C 5JS7A 1UKVY 2GF9A 3QVVA 4JJKA 2QRZA 3KUCA 1YZUA 1S9HA 3DHWC 5FOTA 3U61B 3RWMB 4A4DA 4OQXA 1C4OA 1ELOA 1M7HA 1ZNXA 1ZP6A 2QPTA 2VF8A 3Q7PA 4LV5B 4M1WA 3UATA 1ZM4A 3GLGB 2FEMA 2IXGA 5EE9A 1JEEA 2D3WA 5FPHA 4CEHB 2O8BA 1JBKA 3A4NA 2BDTA 2R44A 1KK0A 3M6AA 4RD2A 2VL7A 2X19A 2GILA 4JVLA 3DOEA 4BE7B 2VP9A 2QROA 5G41A 1FL9A 1ZRHA 4HLQB 5DHAA 5FI0B 4A2PA 5C1BA 1Z63A 2R6FA 2XTZA 4XD7A 4K81B 2O8DA 3RS7A 4A6PA 1OSNA 4PPNA 2F1RA 4HUQB 5HE9A 2V1XA 2YOGA 2WKPA 1RYFA 1TU4A 2BM0A 1W2GA 1KMHB 4LJ6A 2Z6VA 4KLNA 5BYKA 1COWD 1E9BA 2J87A 2P67A 2Q0HA 5DISB 1Z0DA 4JLAA 3EWSA 3I5XA 1E1QD 1Q1ZA 2WWXA 4NCIA 1J90A 1PJRA 1OYWA 3QKSA 5E7JA 4RD4A 4AK9A 2O5VA 2ZQ5A 3D8BA 4ACAA 1EK0A 2IL1A 2KSQA 2ATVA 3E5HA 4V03A 3RSLA 4AYTA 3GJXC 5EP2A 4WXPA 1AQYA 3RHFA 5KU1A 1P61B 3PUVA 3K0CA 2Y8EA 2F6RA 1Q3HA 2ZRGA 4HLUA 3QE0A 1W0JA 4RD0A 2A78A 2RGCA 3K70D 4P4SB 2CBZA 3ADCA 4EJSC 521PA 2LCFA 3H0KA 4B76A 1KI7A 4YONB 2QE7A 2FA9A 4Q7KA 4TTPA 4A8JC 1OIWA 2UZ3A 3PEWA 2VO1A 3V00A 5AUNB 1BYIA 5A0FA 2FE4A 4RD1A 5JJLA 2YNMA 4LJ9A 4W9MC 1XPUA 1LS6A 2ZU6A 2XNDD 4X8OA 4YLGA 1P4SA 2VA8A 4RCZA 2BEKA 5DIFA 3T34A 2OCYC 4M4SA 1IXZA 2XB2A 3WRXC 1P2SA 4IFEA 3AF1A 2ZE7A 2BHRA 4B2LA 2CCGA 2J59A 3Q85A 1BH2A 1YQTA 3KFVA 3WMGA 1E4VA 1T0HB 1I2DA 4KI0A 2C78A 1KDOA 1MOZA 4QKQA 1NSFA 2CE2X 2EWVA 2O52A 3QVUA 3V9PA 1AKYA 1G16A 4JMPA 1ZUHA 2QY9A 4BZXA 3VQTA 4OI0A 1PUIA 5J4VA 1E0AA 1G6OA 1XCPA 3QXSA 1Z0KA 3ZZTA 1W0KD 4HAYA 3CONA 1V43A 4C7OB 1D9ZA 3IIMA 1BKDR 3THYB 1RYHA 2YOFA 4UKDA 4ON9A 5FR1A 1OKKA 1D8TA 2OE2A 1K6MA 2YYZA 5A4JA 2FF7A 2R6AA 5FUXA 2QMOA 2WJYA 5J4LA 2BBWA 1NF3A 1XBTA 2A5YB 4XSGA 2JAQA 2O8CA 4LJAA 4O25A 5DYIA 5H1YA 2ZI3A 1QHHA 1WP9A 4QL3A 5KYKA 4Q47A 2GA8A 2XSZD 1NN0A 3GEIA 3IO5A 2RGEA 4ARZA 2GETA 3IIKA 3ADDA 1N6IA 4LV8B 2D62A 3THWA 2QORA 2H5EA 1XCMA 4L8GA 3LLUA 3LXXA 2ZI9A 2R6DA 4MRSA 4PR0A 3W5JA 3B1ZA 1NIJA 3EG5A 4LBZA 4QG7A 3HR7A 1T3HA 4ZPXA 4TLCA 2IEZA 1Y63A 2DWQA 3OZXA 4JYCA 4Q1AA 3CPHA 1M74A 2FPLA 5CLQA 4LJ7A 1OIXA 1P72A 2F43B 2YOHA 3SQWA 3KJHA 2DHRA 2F1HA 3T06B 1PLLA 1TF5A 3A1VA 3I92A 1NIPA 3CZQA 3GLIB 5DI9A 4FWTA 2Q9CA 2RH5A 2JJ2A 3VKWA 1CULC 2ZRPA 1JAHA 3D6TB 6Q21A 5JWRA 4M9SA 3TQCA 5H8WA 2KJQA 4HEJA 3VHLB 1FMLA 3HR8A 3NIBA 3GJ0A 1AA9A 1CRPA 5JBQA 4P32A 2NG1A 4M0LA 4DCUA 1E1QA 2CDNA 3FDIA 1KI3A 4HAXA 3PENA 1P3JA 2QPAA 1DG1G 2OESA 3DKVA 2WJGA 3FYHA 3RNLA 3WMFA 3NBYC 1PLKA 2WZQA 3ZGXA 1V5WA 4UNRA 3CR8A 2WSMA 3UIEA 2QAGB 1TF2A 3FGNA 3GEEA 1KK3A 1W5TA 1QVRA 3CKLA 4HZUB 4KV9A 4MQBA 5FPYA 2JJ1D 1U8ZA 3PEVA 4KFTA 1XD2B 1KKLA 1ZUIA 3HU1A 4CZ2A 2OV2A 1VCNA 4RD3A 3LQQA 1CBUA 4D0NA 4B6EA 4MGYR 1QVAA 1UM8A 2O0JA 2BBSA 3BGWA 3BS4A 4PC2A 3OFND 4NDZA 4TMTA 2IS4A 1IM2A 3QXJA 1IJFA 3GEHA 3O8DA 4CEIA 4R71A 1T0JB 4G5GA 4ZCMA 2PCLA 1E6CA 2R6CA 1SKQA 2QTHA 2ZR9A 3GD7A 3A58B 1JXOA 3WBJA 1IHUA 4B3GA 1CP2A 2IYSA 1P7CA 3FTQA 4ZDWA 3RS3A 2GAAA 3GQBA 5JSZA 1KSGA 2AFIE 3OF5A 3U2QA 3ND8A 4BZPA 2GRJA 2G9NA 2JLVA 4YXWD 1G7CA 1OE0A 1NVWQ 2C04A 2V8OA 3NBFA 3U3KA 4ABYA 4EPRA 1IN7A 1UKEA 4DT1B 1F3OA 4P31A 5AJVB 1UPTA 1FNNA 4M1SA 4L4UA 4XIGS 2ZI6A 5HKKD 3FMOB 2IXEA 3B85A 4DSTA 2IT1A 2PLFA 4W5JA 3EC1A 1P9WA 4IOMA 2JATA 3DVLA 1P5ZB 4Z51A 3U7GA 3X2SA 4EDHA 5JZVA 1VIAA 4A82A 4EKDA 1YVDA 4PXAA 2WV9A 2XSZA 2ZRIA 3AUXA 5FUVA 4FIDA 5AJXA 2C96A 3LQRA 2C8VA 1FTNA 4PANA 1HYQA 4CIDA 1U0HC 3RRMA 3WNBA 2QU8A 5JWOA 1N2CE 1NY5A 1XD8A 4II7A 5TV2A 3SR0A 4PPGA 1XNJA 1CJTC 2B7CA 4Q4AA 2XTNA 4QBIA 4BFZA 3W90A 4B75A 4KJZA 1U98A 2PT7A 5FPTA 3RWOA 3SYNA 5F3WB 4BZQA 3VR5A 2O0HA 2GXQA 1G3IA 4TQAA 2L0XA 4C0BA 4PHTA 4UQOA 2IYRA 2VP2A 2HV8A 1IN5A 3A37A 3BB3A 4TZ0A 4C3ZA 2IWHA 2CJWB 1OFIA 4GPTA 4B71A 1HY3A 5KDLA 5E7MA 1R0WA 1AJEA 1WE2A 5HCIA 4X8HA 4DDWA 2H18A 4LGMA 2K5UA 2GBLA 1R8SA 3LFUA 4JBXA 1G1MA 5K8TA 5AK0A 4NYJR 2B7BA 4TLEA 3BFKA 3FKSA 4ZDIA 2G1JA 5L3RA 1Q22A 1W36D 5HZHA 4B3FX 1XU4A 1EESA 3E70C 4TN1A 2PJRA 1VYTA 2WJIA 4C0KA 2P6RA 2VRWA 1CR1A 1TUEA 4TL8A 1XTIA 2QM7A 3BERA 2XNSA 4RZ2A 4D0LB 3PR1A 1MKYA 1SQ5A 4EIWA
chains in the Genus database with same CATH superfamily
2QQ0A 4HAUA 3T54A 2O2JA 1FRVA 1PQWA 2GKGA 2WVAA 5LA6F 3M0EA 4NBKA 1X7XB 3CB4A 4NU0A 2G6TA 3QV2A 3B36A 3UA4A 1Q7BA 3KV3O 3DEKA 3GVXA 4MQUA 5A2GA 1CZLA 3IE2A 4BNWA 2ZRDA 3AI1A 4O1IA 1PGQA 2W22A 4GR9A 4H1TA 1OIVA 3GT0A 3I23A 4BTLA 1SZPA 4XPIA 3C7CB 2QTLA 2ZXEA 1RJGA 3W6PA 1DO8A 2GJ8A 2E6UX 3PUXA 4YJ2F 1PT7A 1NBIA 2VT2A 3D8UA 2WJJA 4PU0A 3JQ9A 3BZUA 2Y1WA 5JLJA 3ZDDA 1XDWA 2H4HA 3A3OA 3KQSA 5JXGA 3NP7A 121PA 1GADO 1T1JA 1VA4A 2ARKA 2DTEA 4CLHA 1C1XB 1G8JA 2FG7C 1UJ4A 4TRJA 1J2UA 1U0SY 1PFVA 4WIAA 1L5SA 3GDGA 5KNLA 2R47A 2FAXA 5HILA 3R7AA 1GXSA 3D7LA 2ZG6A 3ZWNA 5JDIC 3FB1A 1O96A 621PA 5P8WA 9GPBA 2G80A 1FW8A 1W73A 3LWZA 3HCAA 4EG3A 1DCTA 4IIXA 2P2ZA 4LHXA 2PMCA 5J4KA 5K1ZA 2A35A 4MP8A 4ANFA 4U7WA 4CM1A 2PQ2A 1E20A 1NMEA 1VP9A 2PYZA 3DHVA 1K5HA 1ZIYA 3E1SA 3MFYA 4K9DA 5EEHA 3ABSB 3ZJ4A 4EI8A 5IKPA 1K97A 4E7PA 4RY2A 5U1PA 4P4NA 1HSZA 4KLCA 1UWLA 2F62A 3CUUA 2C9BA 1A4UA 4I50A 2QLFA 2CL0X 1JPUA 2EJCA 4UFPA 2YKGA 1NQTA 1YZYA 5F73A 2YY6A 3S7ZA 2ZJ0A 1KETA 4GBED 3TMYA 2FHPA 3ZDFA 3W5DA 4XR9A 3ADCA 2QAJA 5KSWB 3ZHUA 4LDPA 3JZDA 3NYWA 1XZBA 1NI3A 3KHKA 3A6DA 2GTIA 3JTEA 4Q4CA 5ITSA 5FPSA 3HJUA 2WVJA 3GIDA 4NQZA 3ENWA 3G17A 1THGA 3BIXA 4IDPA 4JLWA 4M54A 1TVKA 3ECCA 4EF5A 3EPLA 3KX2A 3ICEA 2QGFA 2DKNA 3TAHA 1SCBA 1X9HA 5K5EA 5J2UF 4O8ZA 4QSHA 4IR7A 4MKHA 3L8HA 5D3KA 2X15A 4N5NA 2MTBA 2F17A 3X1WA 1OI3A 2PMDA 3F7NA 3RK4A 5K45A 1NKTA 1V1MB 1DC4A 1CF4A 3T6KA 1MV8A 4HXYA 2VSXA 4X3CA 3SHFA 2M6RA 1GQ2A 5C5EA 2YXEA 3RASA 1NVVR 6CHYA 1H3EA 4TZ6A 2GKSA 4C07A 2D74A 4DKXA 1Y6ZA 1QGYA 2OD7A 5BWLA 3SOZA 3TF5A 1P2VA 2ATEA 3A28A 3LA6A 4EJ6A 2RHHA 4YLEA 4JQCA 5KDDA 3O03A 1KSJA 8ATCA 1YBFA 1IY9A 1C4KA 1TM4E 2D5CA 4PM4A 1Z2PX 4H9GA 4WLUA 3SPXA 2AIRA 4CMGA 2QS9A 3EDQA 4QOFA 4AJJA 4AZWA 4XW2A 4LCEA 2DOKA 3VOTA 1KYVA 1XMXA 4IXMA 2AR0A 2ZIUB 3NTXA 3QLEA 4I19A 4OHUA 4WNCA 1HE5A 2BC9A 3WYCA 1HMYA 2VP4A 5J23A 1IL0A 5CCXA 3KOUA 4BNVA 4HQNA 1SXGA 1IQUA 3FPSA 3IXMA 5DBIA 3C3DA 4CU5A 4ZQCB 3B2EA 4XVHA 3A2NA 1ZJ4A 5I7FA 4RBNA 3F2VA 3CH6A 3IUBA 1E0KA 3CRRA 3AVXA 3IOEA 4U2GA 2I4NA 2EFYA 2WBLC 1U2QA 2QN7A 3GEDA 3HADA 3QV1A 1WDKA 3BJMA 2RGNA 4YQYA 4WSOA 4DBZA 3FDZA 4E3WA 5L3VA 3NNNA 1WBJB 4JI0B 1Z6AA 4DZTA 2O0LA 2X6RA 1GILA 3G8BA 3I01M 1RIFA 5KYNA 4W82A 3BULA 3HVIA 3HU3A 3A6PC 1RLTA 4F06A 2P6NA 4ZYXA 2I6XA 1E5TA 3KC2A 4P2GA 2HPZA 2XVMA 4EO9A 2PN1A 2UDPA 3MB5A 5DGIA 2JCBA 4UCQA 2RCNA 4CKWA 4GI7A 1WULS 3OLQA 4EFNA 1TKBA 2VNIA 4JYAB 1S2NA 3D6NB 3KQWA 5AOVA 3H4TA 3HYSA 3R7WA 4JJAA 4R01A 2LKCA 4S05A 1GITA 1U7PA 2R86A 5LZ2A 1T35A 1DIRA 1RXSA 1VIMA 3B6IA 2JLSA 4AICA 4KHPB 2J7KA 3VU1A 1T9HA 4QT0A 3LGXA 3EEOA 1RHJA 2ZUSA 3H1FA 3LT2A 1Y4AE 5EC8A 3RJZA 3K16A 4ROSA 3TR0A 4CCAA 2PMFA 2YUTA 2K6GA 3AHCA 2HLPA 1EBBA 4B4VA 3ZY5A 1NYTA 2Q41A 2QU7A 2ZANA 4QYSA 2A9QA 3WGQA 1FLDA 3I2GA 3DGEC 4ZOLA 2AMJA 2H48A 2IYWA 3MGBA 4BUZA 2Z6QA 2XOXA 3ER6A 2WU3A 4X92A 3RKUA 1NVUQ 4D81A 4PEVA 5BW8A 2GJSA 3KZOA 4L16A 1V7CA 2AS0A 4J2TA 2EYUA 1V8ZA 1JTFA 5JSHA 3EX7C 3JALA 5KTPA 2I2BA 1EINA 1TU0A 4HDKA 1M2OA 3UTDA 4AMGA 3CZ5A 3LT4A 3EULA 4WX2B 3MUNA 4A0HA 1ZEMA 4ZIRA 5ADHA 3DOFA 1PVOA 2WSBA 2VA9A 4EQ6B 1JQLB 2NV2B 5FL7A 1BVUA 2D1TA 3A1TA 3UV3A 3I1IA 2OM6A 5HIAA 2CLDX 2H2IA 3JQBA 3S28A 2XVXA 5C5IA 2BGNA 2REQB 1T6NA 4RK6A 4NMWA 3WK4A 5JAPA 4JL6A 1BXZA 3Q3VA 4ES6A 4UM7A 1I94B 2FZEA 1KJNA 1MNQA 4MR9A 1W75A 1PG5A 3KSRA 4I9NA 3I73A 2ZT6A 1Q1GA 2MSCB 5JZBA 2GN2A 5K3EA 3NEJA 4ZALA 2DR2A 1MEJA 3OBIA 4Q1BA 1E2GA 2OTCA 1M2VB 3QEOA 1UUFA 3V1NA 4ZO4A 1P2FA 1CUBA 2JCGA 1UJ2A 2FRDA 4G24A 4ZT7A 4ATNA 1S2MA 5GQSA 1D9XA 3DE7X 3BE6A 1O9HA 3ROFA 4QVIA 4NFSA 2NUAB 3R5JA 3EMBA 1ZXLA 1YAJA 2KW5A 1Z3IX 1SHLA 1K6EA 2Q6KA 1KZGB 3AZQA 4IJVA 3SEQA 4Y2SA 2HY7A 2UU9B 4PYQA 4CEHA 1VFNA 3D2LA 4F6CA 1U4OA 1QX3A 2ZIXA 1HA3A 4NNPA 5JC1A 5SZHB 2D4AA 3TH5A 4QT4A 3B82A 1TQDA 1JIIA 4JB2A 4Q93A 4XCXA 2D5AA 4OLHA 4MGZR 3ZX5A 4Z9YA 4RK7A 2J5XA 1QP8A 4JT8A 4C04A 3CVWA 2Q6IA 5AMXA 1JDUA 2OQVA 5EJ5A 3AKYA 1FSGA 5I4KA 2CBXA 1AUOA 1QIKA 2P1RA 2SCUB 3KB1A 4LS3A 3UHJA 4DC9A 4NYIQ 3VR0A 4P08A 5IJAA 2DWOA 2HGSA 3WIDA 4DCTA 1KF0A 1SY7A 2CMDA 2YXLA 3PKJA 2CNLA 4MVYA 4D79A 3EF3A 4YUZA 3EEIA 3V97A 2RGNC 4KGDA 2HA0A 4LHWA 2YFQA 3OZVA 1UBJS 5E8JA 3WYDA 4A9AA 5EHQA 3UXMA 1W46A 1ID8A 4HFJA 2SKEA 1GY8A 2QTAA 2JLRA 3L8CA 4UBOA 3KXIA 3UB4A 2QUIA 2XF2A 3I9KA 1RAFA 3TZCA 3Q10A 3ZHQA 3JATB 4BC0A 1G2IA 1NVKA 4ALIA 1OLUA 4GZ6A 1I30A 3DXFA 2C77A 1Y0BA 3BZWA 3DEJA 1BXGB 4DVGA 1GO2A 3EEFA 3M81A 3A6GA 4JBYA 5E4JA 1RQPA 3FMGA 3DO8A 4OHWA 3M49A 4G23A 3C6YA 4HDOB 3TVYA 4S3MA 1FMCA 1U9IA 1V7QA 3WS7A 3IL2A 4KYUA 3L7IA 3NG1A 4YRAA 3CVVA 1EJ0A 4P4SA 4I2NA 4WERA 1DJNA 1KBQA 4N49A 3NZEA 1QNFA 3HBNA 4HUJA 3RANA 3EGVA 3S0JA 4MULA 4DJTA 1L8LA 3O4VA 4JOBA 4KQCA 5ER9A 4W1RA 4DDHA 1ITZA 1TL7C 2CMHA 4MO2A 3I37X 4BX3A 2MWMA 4Z49A 1XRQA 2IE8A 2O3SA 4FC6A 2XD9A 3C3EA 4EQZA 4MIKA 4EHKA 5IC4A 1TK3A 2DYKA 5REQB 3TSZA 1IZ7A 4BEBA 3A2LA 2ENUA 2VF7A 1TA9A 4LYFA 5F9FA 4C88A 2NZWA 5ALLA 1JLMA 1AHHA 1KYZA 2D1RA 2GPYA 3GLSA 4LFCB 5EHXA 2EJUA 2HBQA 1G9XA 2O5CA 3ZWVA 1P2GA 1WMFA 3T1OA 2VAMA 3K05A 3H2HA 4MYDA 1TT7A 4NZMA 4MUNA 2GWRA 3NIWA 4NZYA 1TZMA 1KO8A 1LI7A 1E1CA 3TLMA 3GRZA 2ZB4A 4YECA 3BIWA 4ZYYA 1JHQA 1E3DA 1ZBQA 1QG2A 2W6MA 5AWFC 4XASA 2OYSA 5FJIA 1EWKA 1UXGA 5DI3A 1K4YA 3JQBC 3O84A 3DC7A 5D84A 3F5SA 3VNRA 4ABTA 2JJ2D 5DT2A 4C7OA 4RS4A 1ZSYA 2OUIA 5EKDA 3AVPA 3TMKA 3O8QB 2X3YA 4BCBA 1FW6A 1QQAA 3W06A 1M3SA 4KR3A 1UPBA 2AE1A 1UK7A 2HXYA 3BIFA 3DONA 3IAFA 1KMQA 4QXRA 3RU7A 2OHVA 3BIOA 4WJLA 4XX0A 1S96A 3TI9A 4Q9KA 4R8LA 1UMBA 1DOAA 2FRDC 3SJCA 1ADYA 4LGVA 5DYWA 2FB9A 2XWQA 4R6XA 4KR2A 1E7SA 1SZDA 4UTZA 3FCEA 3IQWA 3O6VA 4MYCA 3TCXB 4JLUA 1VZ2A 5BMVF 5I9MA 3W8DA 3I2YX 1P5FA 2EW8A 1XC7A 2V6BA 4MCJA 1L7EA 5EKTA 4HDRB 1G42A 3VZSA 4CF5A 2HSZA 2CLIB 3TLEA 4BGIA 4IO1A 1AKRA 1VE7A 5BW6B 2FDRA 4MWCA 2P3QA 2G17A 3GUUA 4ZT5A 3ZNQA 3BL5A 2CNDA 2QQFA 4NBSA 3W2HA 3PKIA 1DDOA 4N12A 3RD5A 2X6TA 3KB2A 2BM1A 2ZBDA 4WCFA 4M0CA 3O95A 4MCHA 5AOBA 1M34A 4EKNB 2VTBB 1MX5A 1E63A 4YY3B 1CD5A 1PDVA 1PQUA 5CB4B 2I62A 4ALLA 1VHDA 1I7QB 3KQLA 3QVGB 3FTEA 1PNTA 1J23A 1SC4A 4G81A 1F6DA 2PEZA 2W2LA 2HJGA 1K4KA 3V2UA 2ODPA 2JARA 2UVPB 3K35A 4CF3A 2JAUA 3FYDA 4P34A 1DAHA 1MDBA 2BFCB 3HN7A 5B4TA 3THSA 2BMEA 2O6LA 3CO5A 5FWAA 1NNEA 1X7WB 2F1KA 4IXNA 4FFSA 4NCKA 1RYZA 4N54A 3WAGA 3NIGB 1QLWA 3RFTA 3NYIA 2GTHA 4WL0A 3PV0A 4UW9A 3B1XA 2QT1A 3GPLA 3QUSA 5DX0A 1Q15A 1VE5A 3WLEA 4ZJPA 1MEEA 1E9FA 1FE8A 1KI4A 4QTUB 1G20E 2OGSA 3A4LA 4DIUA 1V11A 4E22A 4EF4A 4EX7A 2WB2A 2PRKA 2CLCX 1GCAA 4BJ1A 1VLVA 4LZNA 2X9NA 1OH8A 4EGJA 2ALJA 4S2EA 4Q03A 4AY2A 3LTNC 4QUGA 3VX3A 1I5RA 2ZSDA 3A1CA 3IQFA 3B8EA 1A7JA 3BDIA 3PGJA 1XTJA 3WL3A 2QX6A 2H5JA 3CNOA 2X4GA 2HTFA 2H0RA 1XVLA 2IDMA 1T6YA 2L82A 3G3EA 4RKRA 3R41A 1PDOA 1CRWG 4X41A 3BTSA 4TTVA 3VSDA 4QRDA 4QICA 3GLVA 1T91A 2O8EB 5ITZA 2QJTA 4KWTA 3WK7A 1CRZA 3GVCA 5CNKA 3Q3GE 1MO6A 4RCYA 3IRVA 1L6IA 3UCEA 4WZAB 1QO0A 5EXPA 4GOND 4DIKA 4DDTA 1MAUA 1Z8NA 2ABWA 2GF0A 5KYYA 3AGQA 1I14A 3EG9B 2Q1WA 4X91A 5D5QA 4HWKA 3Q98A 4JSRA 4LG1A 1UK6A 5TMDA 2Q7OE 5CFQA 3PI7A 1QHSA 4TM7A 1KI6B 3VYWA 2EERA 1TJPB 3H4MA 3NDPA 4GE0A 3TXAA 3HVRA 3L0ZA 2FPUA 2OO5C 4PC6A 1J2EA 1N5KA 4I50F 4MGHA 3I6IA 2JIPA 1YJBA 1CNMA 3WGUA 3OZRA 1F60A 1EUDB 3IPAA 2RJNA 2X0JA 1TF7A 3BXEA 1LPBB 1KYIA 2C92A 2MYPA 1KK1A 1WQ1R 2NVWA 2R8RA 2XUFA 3C4VA 4OQLA 3TLKA 1F0PA 1D4AA 1L0BA 2PYDA 3GJZA 1A82A 3HHEA 1G6KA 1FOEB 1K08A 2HU7A 2V7QD 2YV4A 4RF5A 3KQKA 1QGAA 1RKBA 2JLBA 2PT5A 3UQZA 2JASA 2OHJA 1K8QA 2DETA 3FIJA 5COQA 1EA7A 1M6YA 1RYEA 4UD2A 1BVYF 2C00A 4M98A 4MW6A 4U9IS 4YRJA 1IVYA 3TIGA 3HCBA 1B42A 4MUFA 2HYIC 1FNCA 3SNHA 3I4CA 2IOFA 4IF6A 4EFKA 3P2IA 1QFXA 2JI7A 4CKBB 4E5KA 3MTDA 3FJYA 2BI7A 3FKSD 2Z9CA 4XI9A 5EZ6B 2OHFA 4C4AA 8LDHA 4UTRA 4R8VA 2H16A 4HFRA 4BRUA 2PZLA 4CKCB 4V02A 3GF4A 2M6SA 2CNNA 2EF1A 2R4UA 2YIMA 1ESCA 2FSHA 4LMRA 1IBCA 1UBGA 5CW1A 2XECA 4DQKA 4QFBA 2Y1DA 2JLQA 4AJ1A 4NDAA 1ZEJA 3SS7X 1KQGA 1HTBA 2I2DA 3KJNA 4B2YA 4EFDA 2JLWA 1GDDA 3AUTA 3ITNA 1L4MA 4MWTA 1ESDA 2B5VA 2FQQA 1KRHA 3NBKA 4C4PA 1DRUA 3ESXA 3NHLA 5DRTA 2V7XA 3AINA 4NFLA 4QTYA 3W05A 1A95A 4KR9A 3AB7A 4WCFC 1FYWA 1H2HA 1XWFA 1XP8A 4Z1OA 5IHXA 1W85A 2ORIA 2FOIA 1TKRA 4FTWA 4GOXA 1RKQA 4S1OA 3AR9A 4CLEA 4QNMA 4NK5A 3HBJA 2PD3A 4QDJA 3T9EA 4N5MA 3EEQA 2QVLA 1ZBDA 1SUPA 3QOYA 1PTKA 3KKZA 1BE6A 4TS9A 4L08A 5EIBD 4I4TB 4XUDA 3JR7A 3ED1A 4ENVA 1BMQA 3QNMA 5JMOA 3GLIE 4I6EA 1L4GA 5AVXA 2EP8A 5D85A 1VPTA 2FTKE 5IT5A 1R9GA 1HLPA 1CUUA 1E5DA 5EXEA 1QC5A 1AXGA 5DHTA 1SRQA 4BLSA 4OP1A 2HQRA 3ICVA 1YC2A 2GCIA 3KAPA 2Q3FA 3DZCA 4HYEA 4L75A 3FN4A 3FY4A 1RQNA 2ZVQX 5A5DA 4FONA 2G06A 2F3SA 1GZHB 5K2MA 1KAQA 4LX8A 1UM9B 4ZD6A 4INJA 4OMFG 1DB3A 4RY8A 3WYGA 4YRPA 2C8JA 1L8OA 5A3RA 2Z95A 4WFQA 1QXSA 3DQZA 1SQSA 4HH3C 2ZJ6A 4JHXA 3K6JA 4IIFA 3CPJB 3EWNA 1YS2X 1RWXA 2FU5C 4RMGA 1MB2A 3TW0A 5I01A 3H5WA 4BNTA 2AJDA 2WIKA 4LYGA 2CGEA 1UQRA 5HGXA 2W2PA 2CD7A 2FDCA 2BH9A 1Q19A 1XDBA 3TLYA 1IRXA 1AHPA 1VM6A 1SMKA 2OLJA 1G21E 1QFYA 4H15A 2ZRCA 3FPAA 5FOWA 4M9XA 2P7IA 5F1OA 5JIBA 3DE4X 3TEMA 4ZOLF 4MUMA 1VE6A 4HYYA 3D5TA 1T15A 5JMPA 3HXOA 1A9XA 3OQOA 1S6YA 5CJJA 3JU3A 2W5UA 2YZ2A 1DTSA 4LRSB 5AKXA 4TL7A 4PYMA 4BEJA 1DDGA 3CRMA 3U3MA 1I1QB 3ILHA 1VC2A 4RY0A 4IVPA 2O7VA 3G6WA 3MC1A 2GZ2A 4H35A 4M9RA 3E7XA 3N59A 3ZGYA 2NSYA 2PVCA 3N6RA 4EMSA 3O73A 1JSCA 1C8KA 2CFTA 4L02A 3R5XA 4ZEOA 4QDKA 1L7BA 5AM2A 4I5FA 2VVTA 5IJ0B 2QYTA 3VR4H 4H4CA 4HDMB 4P84A 4WGGA 4R1MA 3KEOA 3X1JA 5EIXA 2HQBA 4G0NA 3ZHZA 3T4XA 5EHIA 3X1ZA 1HNZB 4UZEA 3ZDXB 2V7QA 1QB7A 1YONA 4A10A 3CE6A 1PU2A 1PFUA 3ECSA 4REQA 3R7NA 3SLRA 1U7TA 4UPDA 5CVVA 3FMIA 4QJ3A 1REQB 1CIJA 4CODB 2Z57A 4L07A 1IJEA 1EB8A 3C8HA 1GRQA 2DPXA 2ZS7A 3ENKA 3LUJA 2ODEA 1UKYA 4UMFA 5ADVA 3BRWD 4HQKA 3NR2A 2XJ9A 1P3Y1 3SAJA 1Y5MA 3KE9A 3O9VA 1YRWA 2Y99A 4JR1A 4D4IA 2MSNA 5B3KA 3H3JA 1X1BA 1KSFX 1OBFO 3KCNA 5AI5A 1SXJB 5EJ7A 4QHSA 3NFRA 3U3JA 5JYEA 1LX6A 1Y9JA 2Q3EA 3HDGA 3OZGA 4PZEA 1SJ9A 1U9JA 1Z4PX 3NTOA 2C2XA 5DNAA 5EKXA 5ERXA 3CX8A 2OCBA 1TA0A 1WRBA 3TTXA 1GZVA 2OV3A 3EH2A 1KWGA 3O0TA 4PSDA 3P0JA 2FVXA 1T3GA 3DV9A 3IQHX 3U80A 4O1HA 2JANA 4D44A 2I71A 1ZD8A 1DT3A 1RM0A 3D4NA 2DG2A 4JLDA 3JSAA 1N78A 2HSWA 1K2WA 4DCGA 1XQWA 3VKGA 3JQEA 3P19A 1WSWA 3K4PA 3V4OA 3ZDCA 5EPEA 3EZYA 1LGYA 2ZRLA 3VOBA 3RYCA 5F9HA 3EIQA 2B37A 4QM7A 3GLFB 1BMFD 3ZOKA 3FNIA 1LBSA 3CG0A 5JCPA 1ZGBA 2XUGA 2BP7B 1JG3A 5ESWA 3WL4A 1MO2A 5BR8B 4YVFA 3PJGA 2B8EA 1NW8A 2R1TA 1ESEA 2IQ5A 3P9RA 3UXYA 4A5SA 2PUDA 3KVVA 1URPA 4X71A 3U7FB 2V3WA 3RUFA 4PZYA 1O58A 2XD4A 3IAAA 3PXCX 2ISQA 1RHQA 4MQMA 1NPYA 2V03A 3PNMA 3RRXA 1MG5A 2JIOA 3QEKA 4KVGA 4LOKA 5KTKA 3JWJA 2VHYA 3WADA 3ETDA 1T8WA 1R00A 3PWTA 1GAXA 3RTAA 3BHNA 1RZ3A 1NDUA 3LSYA 1GFIA 8MHTA 3OOYA 3DTVB 2FPIB 3GBSA 1UBEA 1AKUA 5L7TA 1VKZA 5IJXA 1IHOA 5D87A 1N2SA 2QN9A 2HBZA 4BY9E 1UZAA 1M0SA 2VDPB 2VF4X 3FLAA 5JG7A 3C6MA 1IOZA 4NENA 1T8YA 3ZBUA 4YCJA 3H5LA 5AVZA 3DL7A 4DLSA 3AK4A 1XLWA 2XXAB 1E5QA 1GGJA 2Y1OA 1LZLA 1NW4A 3ZWXA 3KHTA 1T9DA 3P7MA 1V1JA 2XNKA 3DZ8A 3EXHB 3NTRA 2HSGA 3Q12A 2HLDA 5IT0A 2WQ7A 1FRZA 3OWOA 3T0IA 4BZWA 1Y7HA 5DCUA 2CK3A 2PY6A 5CR9A 3LIIA 2XGJA 4J4BA 5L45A 3J80A 1YR1A 4IZIA 3DPUA 1J09A 4NPAA 4YMLA 4N41A 3HBAA 3JZAA 3ER8A 3KQQA 3GWGA 5HF8A 1OWLA 2V74B 4MUYA 2BFNA 1Z7EA 4V1CB 2CUTA 2OB1A 2PSEA 4UM8B 3SS9X 5CA1B 4TKLA 1U9ZA 4YV2A 1KERA 4DN6A 3AF4A 3GRPA 3L8FA 3A4YA 3KAJA 4A6DA 2BF7A 4F2PA 2HWUA 4MIOA 3TAUA 3BH0A 4U2DA 5EPOA 5IYZA 4GW3A 5AIBA 3OT4A 1TRKA 2O8FB 3ZIAA 2JZCA 2OGTA 5BN4A 2C5GA 3HKDA 4IJ6A 4H1WA 2P4SA 1JRLA 1VYHA 4PYLA 5FH9A 2OO7A 2BIFA 4R1UA 3FVVA 3IOMA 2OXCA 5AHRA 1LDBA 5COAA 1ULUA 3IEUA 1SPBS 1MXHA 2HZBA 3A0RB 1KNXA 4MVJG 2Z2YA 4CG1A 1TDJA 4GX1A 1QZUA 2ANCA 4A7PA 2ORWA 1M1YB 3UAGA 1OXKB 2WJVA 5ANRB 1Z38A 2QL9A 5C18A 2IZ7A 1RE1A 2C4TA 1S5PA 2XOEA 4N01A 3TB4A 3PEEA 3RNOA 3EVZA 1KE2A 1T9BA 3EOZA 4OL0A 3VNBA 3ETGA 4TKVB 4TTQA 2C8KA 4WZZA 1YQWA 1QP0A 5E8RA 5BN3B 1EWRA 3I1FA 4IZHA 4CCYB 5GY7A 3KKMA 2FDXA 4DSZA 4GC5A 2RMKA 1XXHB 2PZEA 1Z5OA 1IIBA 2J3QA 2PD6A 3LTEA 4CL3A 5DP1A 3AOEC 4J9VA 1HZZA 4LWZA 4JBHA 2OR3A 4I1YA 4YDHB 3CWZA 1U8AA 5ALPA 3VPCA 3B1JA 2YL2A 1OV6A 3MJ4A 4B45A 1W88B 2LBPA 1N3LA 3I6YA 1FP1D 2CUKA 2W8ZA 4GKBA 1FFAA 3TRIA 5AKZA 4E7OA 2V6MA 2XT0A 1H4TA 3U16A 2VQDA 2H2FA 3DHYA 4L9WA 3SJBA 1T9GR 3TI7A 4E08A 3CMMA 1QK4A 1K7XB 3BUSA 5DF1A 2KBFA 2IHBA 3M6VA 1BMFA 4YRKA 3DPSA 2BPOA 5BWNA 5C1IA 4C89A 3LPDA 4P0PB 1KEKA 5HQTA 3Q5DA 2IX9A 4YRRA 3H2KA 4BGDA 3QI2A 3BOSA 3KB8A 3F71A 3TQRA 1H05A 2B69A 1N0WA 1EFUA 3BB4A 3DZKA 3IQZA 5MHTA 3KNZA 2Z4RA 3NT2A 3LOUA 3TE7A 4CLXA 5BVGA 1D1TA 3DEFA 1IATA 5JCXA 1MD9A 5DN9A 5EQFA 5F77A 2Q1YA 4BMVA 1CFZA 1I5OA 4D46A 4LE1A 4IJKA 3HXKA 1QCCA 3W4KA 2N47A 4OXXA 4IH1A 4DSUA 1R64A 4NC9A 4L9AA 4WFIA 3Q7SA 1W5FA 5D3QA 2Y1EA 1L6RA 2WHPA 2RAUA 2Y1LA 2V58A 1PO7A 2F1JA 4GEKA 1C9MA 4KQMA 2GZMA 2Z1MA 3FZYA 4FEEA 4DV2B 2DP4E 3QUAA 1X1TA 1FSPA 1VL8A 1L5KA 2X22A 4MKFA 4AXBA 2HHCA 4R31A 4NS1A 3E6AA 4OJQA 1SO8A 5KYUB 3FI9A 4UAJA 2FKAA 5CFOA 2Y0EA 1SQFA 3T5CA 4YLYA 1RWBA 3AKEA 1TB4A 3DB2A 5C8YA 1Q1NA 1U7ZA 2R62A 3NONA 3ZU4A 4LVNA 2W0MA 5SYNA 1F51E 4IGAA 2HMWA 2GSDA 2O3RA 2FR0A 2BE7A 1HDXA 3ZDBA 3V7WA 2NOAA 4FMBB 4QZVA 1Q6YA 4ZAWA 2JGFA 3TD2A 3L1JA 4KE7A 1P17A 3RSQA 1EDOA 2D5LA 3LVFO 1FU8A 1E62A 2I2CA 5B37A 3PIDA 2E18A 1VJTA 5B1IA 4E5MA 1U2ZA 2X0EA 1W87A 1G98A 4J75A 2A0YA 1RBYA 3L6RA 5CIWA 1JQDA 3RAPR 3JD2A 1IOLA 1WQ3A 3SDSA 2OSVA 3U39A 4WKBA 4E70A 1BWPA 4PV7A 5B2ZA 2LKDA 3VTZA 5LWQA 1XZFA 3F73A 1W36B 4Y1FA 2DJ5A 1DU4A 1LDNA 5FO1A 5H4GA 5AHWA 4BS9A 3ONDA 3U7HB 3AI2A 5JEEA 1EZZA 1DWQA 4KSYA 5DXFA 2HK8A 4ONEA 4EY7A 5EWJB 1CR6A 3TJZA 3E48A 3QLUC 3ROKA 5IMSA 5TQJA 3MTJA 4GGPA 4D3SA 4GNRA 1IDOA 4CKYA 4YMUA 6ADHA 2GM9A 1Y3CE 2G76A 3F1KA 2NVUB 1G4AE 2BI4A 4YUVA 3IVMA 1E2QA 3SQOA 4BQNA 1Q7RA 1I2AA 5J5CA 3WLKX 5KNCD 1WU8A 3AXSA 4XDHA 2I6TA 2IHYA 3ZV7A 5E3JA 5IJ9B 1RJ9A 3RC3A 3SMVA 5IZ4A 1HQKA 1AZTA 1WUHS 3FRHA 4KBYA 1K6JA 2Z2XA 2I80A 4GMHA 3R8XA 1SCAA 4D6XA 2IV2X 5CEFA 5BN1A 3RSCA 3THOA 4MICA 4YCLA 4WAUA 1B23P 1N3YA 5C8XA 2A92A 2X77A 3OWXA 3S2UA 1M67A 4XM2A 2VSNA 3D64A 4E07A 4N03A 1NMYA 4TZTA 3E3AA 2Z04A 3A9TA 4RTPA 4QFCA 3UF0A 1G18A 4QXMA 1YE3A 4B6RA 4UTVA 1F5SA 4IPTA 4HN2A 5K0GA 2GN1A 2FIQA 2O8VA 4XX1A 5FUYA 1HETA 1N7JA 2FMXA 4A8JA 4E09A 3RRYA 2GLUA 1P1HA 2IEYA 1U2TA 1GT91 3DGFC 3EGWA 1L5YA 2A5LA 3K9HA 3M3HA 421PA 5BV0A 2QT9A 1MHPA 4NS4A 4Q82A 1HG0A 2YWXA 4UEKA 3UKOA 3VO8A 4Q4HA 4LZAA 4V0QA 2FG5A 5B30A 4IFIA 2D1SA 2FUNB 2OG2A 3C1OA 2DHDA 3ROGA 3RROA 1LPPA 3WB2A 3WLTA 4P93A 4O4LA 4PZPA 3DXYA 1GSAA 5AYVA 3GJQA 4BAUA 5JRJA 5K0LA 3K8ZA 1D7OA 2OOKA 2P1ZA 4OHZA 4AM8A 2FXVA 1KS9A 1GPNA 4D9JA 3ANMA 4GLOA 3GAZA 2YDYA 3FAZA 2M32A 4EUFA 3TQTA 1Z7YA 3BL6A 5GJCA 2CDRA 3UHFA 3WV4A 3B3JA 1US8A 3ETEA 5AIAA 3Q3JB 3ZWYA 3GUZA 3N5KA 1L1RA 1WF6A 1P1JA 1CNFA 1YBMA 3KQHA 1MHTA 3C15C 1PWZA 5LN1A 3LAWA 4QUEA 1NG9A 3X1XA 4E5NA 1G5IA 3SFTA 5FWXB 4RQUA 4LMPA 1XYYA 2YYAA 4UCFA 1SCUA 1M10A 2WF6A 4TSFD 1CWUA 5BQFA 1C7RA 1JHVA 1MB4A 2NUPA 2PX3A 2EL9A 1XRMA 2Z1DA 2XTAA 3E9CA 5JSKA 3UVEA 2WWYA 1HKHA 2NNLD 3N2EA 1VGRA 3TW6A 4URYR 4H6PA 3HO6A 2EYQA 1DV2A 2XLCA 1KO1A 4DRYA 4MQFA 3WY9A 4CMIA 2HM7A 2JGNA 1K88A 4OCZA 1JQKA 5LB2A 3CKYA 3U31A 1R18A 3UJ6A 2QD3A 3H2IA 3WLOA 3TE6A 1XV5A 1YA8A 3DMGA 1PS8A 1M2HA 1DCKA 4OXQA 3WC4A 1FDVA 2FFRA 1RPAA 2BKUA 3AM4A 1Q2XA 1YWGO 3QVSA 2BUAA 3FUCA 3OPYB 3II6X 1E0JA 4J90A 3TLZA 4DEYA 5AVVA 3RAJA 3E22A 2AUNA 2ZBPA 3F7TA 4XARA 1Z16A 3KOWA 2ZB2A 1J25A 3KB6A 2VDMB 4MUBA 3KUUA 4LCJA 4KR6A 3RG8A 3W3ZB 2BTQB 3FRIA 4LTMA 4YNBA 2HK7A 1JFFA 3WBFA 1DEHA 4NRDA 4OM7A 2XADA 3IH5A 4P7GA 4B3HA 4EB6A 2FR8C 1IBLB 1VI2A 2VTDA 3LQ4A 5LA6B 1A8HA 2FPSA 4D0SA 1SUFA 2BY4A 2OMEA 4M1QA 1TLLA 3TL3A 2FG6C 1NBME 2A1TS 3A3YA 4H6VA 3MLEA 2ONJA 1ZN9A 4CUJA 4DXHA 4BWYA 4EGFA 3BJIC 3CZ4A 3HZZA 3JR3A 4QYIB 4GS5A 2FEOA 1XZDA 3Q2KA 1PL8A 3K7EA 4OD0A 3RBVA 4BKUA 1W25A 4EJ2A 2CHEA 2O0MA 4FWBA 4OUKX 3O2SB 4JIGA 5C3UA 1JR6A 1LTQA 4QVGA 4KPYA 2E49A 4V0ME 1KVSA 2G70A 1ZIOA 2P9CA 2JIMA 1NJ2A 4JH0A 2BFWA 2IPXA 2IEIA 5JC8A 4MYHA 4XQGA 2JFOA 3AF2A 2I6GA 3R5TA 2OZLB 3IR6A 5A7GA 2VJAA 3L7OA 4TMFA 3UWKA 5K3OA 5DM4A 3GFSA 3I64A 5B57C 3HBMA 5A7HA 2HZ7A 4JY7A 1ODKA 1NJ1A 2C07A 2J67A 1T2NA 3IUNA 4K5QA 5JXJA 2JH3A 1YZ3A 4J2HA 3Q9NA 1N6KA 4G0ZA 1AB6A 5FYQA 3OPYI 1NN5A 3E9RA 2DUMA 2CEKA 1WO8A 3QVLA 3R3ZA 3NC4A 4WTOA 5LP6A 1YZKA 1LTHR 2IIPA 4IAOA 3RIEA 1U0BB 2GGSA 2CL6X 2GBIA 3CN9A 3N39C 1CJCA 4MV0A 1J0EA 1J8YF 3CH4B 3GEBA 1R8YA 5KINB 1O1YA 4Q7QA 4KQ1A 1RXIA 3LK7A 3HO1A 3PNKA 1Z3CA 5JVDA 1JR4A 1ZMXA 1EVYA 2IHJA 4FZRA 4ZVQA 5ICFA 3NFYA 4KSBA 4I7EA 2JBAB 3RRNA 2C7PA 3I5YA 1H0KA 3OAAD 4ND8A 1I7NA 4CQLB 2C0CA 2QSUA 1VCMA 4PAOA 2BFDA 4LYDA 1M8KA 3FVTA 1Z7GA 1QBGA 2YRXA 5IAGA 1W4CA 2WHQA 1FVXA 3NXSA 5J2TA 4ZCPA 1R1DA 4C7KA 1ATZA 4GMDA 1QHIA 2ZJYA 2A4MA 3SP1A 1Y5IA 2PXHA 3HB5X 3NBQA 3SC3A 5AVOA 3TDMA 5KUTA 4JSTA 5IDQA 1W44A 3KD2A 5L4NA 5M04A 3LYUA 1E99A 2PZJA 2A7XA 4RHFA 5AVYA 3EVFA 2OP0A 1GA4A 3B9QA 4ZGGA 3KR0A 2JJYA 3AEYA 4C6TA 4PAGA 1N77A 5SV2A 3REQB 1Y3FE 4HPXB 4JQSA 2GT1A 2XYHA 3KSAC 2ZE8A 2DFTA 2JAOA 3AHHA 3PGKA 1VLMA 4MPTA 3O1HB 1EM8B 1U7XA 3HM2A 1Z8FA 3UWDA 4DQUA 1RRFA 4OUDB 3TW8B 4KLRA 3HCCA 1GRCA 2BRUA 1UODA 1RPTA 2AFHA 3TWOA 4BP1A 3R0JA 3ZK7A 3QKSB 2W58A 2M9MA 3OC0A 1T3TA 4UTOA 3UV7A 5A02A 2QNRA 2EARA 4IJWA 2V4UA 3EA4A 4R2MA 1ZD9A 2IWRA 5CB0A 3E9MA 2YZGA 2JCXA 3GWZA 2VJMB 4YX9A 3RKSA 2H5IA 3H83A 4DG8A 3Q3EA 2C88A 3C24A 1CIPA 5T57A 1ZVMA 2EZUA 5IYZF 4EG1A 4D3ZA 2XH8A 5I7WA 2VQSA 1RC8A 3R9XA 2Q7XA 4L73A 4OA5A 1JB9A 3IV7A 2FEAA 4YN3A 2VF5X 4D6YA 2QVBA 3RODA 1HYGA 1U0OC 1P7PA 1Y7PA 3C6BA 4MXDA 2RE8A 1E1LA 4E21A 3MGGA 1RMTA 4L4XA 5FOSA 5JASA 3KYDB 2AUTA 4GWKA 3B78A 5KNBH 2DTXA 1BFUA 2YWHA 4WJZA 3RS4A 4LNUA 5DYTA 4FX2A 1J9GA 5DVZA 4RV4A 1BDMA