3V00A

Studies of a constitutively active g-alpha subunit provide insights into the mechanism of g protein activation.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
351
structure length
351
Chain Sequence
HMGAGASAEEKHSRELEKKLKEDAEKDARTVKLLLLGAGESGKSTIVKQMKIIHQDPYSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACFDRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFSFKDLNFRMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMHLFNSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAGNYIKVQFLELNMRRDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A constitutively active G-alpha subunit provide insights into the mechanism of G protein activation
pubmed doi rcsb
source organism Bos taurus
molecule tags Signaling protein
molecule keywords Guanine nucleotide-binding protein G(t) subunit alpha-1/ Gua
total genus 95
structure length 351
sequence length 351
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00503 G-alpha G-protein alpha subunit
A PF00503 G-alpha G-protein alpha subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 3v00A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3v00A01
2JASA 3FVQA 1G3RA 3SOPA 3T06B 4C4PA 2ZS9A 1EFUA 2QTFA 4GOXA 3O8DA 4HB2A 1DO0A 1UKYA 1IQPA 3RS4A 2DB3A 4Q7LA 3NDBB 2QU8A 3IPYA 1SXJA 1ZIOA 3FMPB 4MKGA 2BJVA 1EWQA 3U3JA 4HDQB 5J5CA 3FHTA 1MH1A 2Q6TA 2ZS7A 4KSBA 3VKHA 3K0SA 4PC1A 3P26A 3I5YA 1E2LA 3K9NA 4HB0A 1EFRA 3OIYA 4D2IA 1DAHA 1JALA 4C30A 1EX7A 2VHUA 3SEAA 4QNMA 2EWVA 1DARA 2NG1A 2ZSBA 4TTRA 4G5SA 2WKPA 4IDHA 3B1VA 1S9DA 3IQXA 1GM5A 1JPJA 2XJ9A 1ZU5A 3KDSE 3RS7A 4YLGA 3KUCA 4JIMA 1QHNA 2YV5A 1E2EA 2VP6A 1KI9A 3C4JA 1WA5A 2WVJA 4DXAA 1W2HA 2AX4A 3MJHA 2P5SA 2XSZA 4JSTA 1I4DD 1NSFA 2CLSA 2JJ1A 2NGRA 2OBMA 4PC6A 2QGZA 4A1FA 2AFIE 3KKOA 5FOSA 3I3SR 1LS6A 3RVBA 2XZOA 1OXUA 2GXQA 2HCJB 3MJRA 3NHBA 3B1YA 1K6MA 3EZ6A 3KFXA 4DDVA 3WHKA 2PZGA 4FMCB 4HLUA 5AWFC 2J41A 3AGQA 2JLXA 4FCVA 1UPTA 2BKEA 1Q3TA 3IILA 4HZUB 2AL7A 1P3JA 2RGEA 5CJ2A 2W6JA 1E0SA 4DCNA 1GL9B 2I1QA 2DY1A 2QNRA 3LO5A 4MGYR 1VCOA 2VYFA 3A37A 5E7JA 4OK6A 3IO3A 2AKYA 4I99A 4Q4AB 2VHJA 5TARA 2FDCA 1E2KA 4WIAA 4XTRA 3FWYA 4BEJA 4FXPA 4ZDIA 2RHDA 5TDHA 1I4TD 2AHOA 3LA6A 4PSVA 3K9LA 4QHYA 5KPDA 2QORA 5KTYA 1RW4A 3HYTA 3T61A 4ESVA 1D2EA 2NPIA 1X8KA 3LXXA 4V0KA 2VPPA 3ZLJA 1JXOA 4P4UA 5KUTA 4JT4A 3AM1A 4NE2A 2FGKA 5CIWA 3NDPA 5AR1A 4I1OA 1KO7A 4TLEA 3U6KA 2JAQA 3QOFA 5IT5A 1AIPA 1L8QA 5CM8B 2QGNA 3DKPA 3ZVLA 2RGNA 1KYIA 4NYJR 4GNKA 1D2MA 2VSXA 1KI4A 1FNMA 4XOIA 2V1UA 3RANA 2GK7A 3ZD6A 1FUKA 5JI3E 2YKGA 1ZU4A 4Q00A 3BC1A 4YQFA 2H1LA 5JCPA 4TTPA 1II9A 3EA5A 5CM9C 5EP4A 1SVSA 1BOFA 4ESHA 4DEXA 2KI5A 2GWHA 4M1SA 1E9AA 5JWHA 4LI0A 4BFSA 5FTKA 3RRYA 1CJTC 5L3QB 5A0FA 2KB0A 4V0OA 4TMTA 1X3SA 4A82A 2IEYA 3BOSA 4OK5A 1NKTA 3DM5A 2V6IA 5EUMA 2Q3HA 2QMUA 2XXAA 4MQBA 4U00A 3U7HB 3I1FA 4ACBA 2CEAA 2EYQA 3KB1A 4B2PA 2PMKA 2WWHA 2VP2A 4C2TA 3IPXA 4URYR 2DFNA 2J46A 3GEHA 4PAMA 4EPVA 2XZLA 1N3BA 1OT3A 1W36D 4DLWA 5DHFA 2OAP1 4ZCLA 4XWOA 4M1KA 5J4HA 2GJ9A 4MYTA 1OJLA 2W6JD 4IKEA 3QKTA 4D4MA 1W46A 1U9IC 3U7FB 3EWSA 3ZS9A 3FMIA 3GQBA 3ND9A 4KFSA 3AV0B 1KO5A 1YHNA 4OKSA 4QKQA 2QBYA 4PO1A 1KO4A 5L3SA 1VDZA 1D6JA 3M4YA 5F98A 2IYUA 2GKSA 2XNDD 4Q7JB 1P61B 1HEIA 3GJ3A 4GDFA 2XTMA 4GRAA 4LV8B 1OFTA 3W90A 2JEOA 4W5JA 1G41A 2WWIA 1Y63A 2JJ1D 2WJJA 4OK3A 2LWIA 2GEVA 1YVDA 2GNOA 2WM9B 3FHCB 4I81A 1JAHA 4JJZA 4TQAA 2EFEB 5LDDC 1KI1A 2GJSA 2ODBA 5FBVB 1YRAA 3C41J 4BFZA 1FQKA 3U3OA 5JMTA 1UKEA 2YVUA 2DPXA 1E4YA 1HUQA 2BC9A 1TQ2A 1YR7A 4D0NA 1D2NA 1KDOA 1KK0A 1KJWA 2WWFA 2ZPTX 1NVXQ 5AJWA 2WSSD 3PFIA 3K9GA 1GRQA 2BBTA 4L4UA 3ASZA 1F5NA 1EESA 1NMXA 4AWXA 2HXYA 1RJ9A 4QBGB 1LNZA 1J2JA 2WPDD 3WBJA 1ZD9A 1FP6A 1U0LA 2C04A 3MWLA 2ODEA 2JDID 1RZ3A 1BMFD 2W2VA 3TSOA 1W0KD 3GP8A 2GF9A 3BRWD 3GJXC 4HATA 4ZKEA 3TE6A 2AKAB 1G8HA 2E9SA 4AG5A 1ZCBA 3G0HA 4TT3D 5CK4A 2I4IA 1N6IA 4B73A 2FN4A 1F48A 2NTYC 4D4JA 1QZXA 1JR3E 2CXXA 2FZ4A 5KSOA 4K46A 2PLFA 5FBLB 2FGJA 1MKYA 3TQFA 3MWKA 2HUPA 3HWSA 5JJLA 1T3SA 3RS5A 1Z6XA 1DBSA 1OIXA 4G5RA 1IONA 1FPMA 2PMDA 2R62A 2ZITA 4UJ5A 3MMPA 4A8JC 4U5XA 5E3HA 2NO1A 1JEEA 1G7CA 2EU8A 4E5UA 4BZQA 1TADA 4ZDJA 4NCJA 1QRAA 4XWAA 4Q1EA 1H8ED 2YJTD 3KQLA 2IYSA 2IHBA 1UFQA 1ZMXA 4X8OA 3GFPA 3T35A 1CJKC 3T1QA 1XMIA 4PZLA 1OLOA 2A3RA 2F1JA 2DR3A 1OH6A 3X1WA 3JZMA 4OL0A 1TAGA 3KTAB 3M1IA 2O0KA 2IUSA 4Q47A 3BFVA 3AVUA 1R2QA 4WZBE 2WV9A 5EP1A 1NF3A 3VR1A 2REBA 1SXJC 4RZ3A 1BIFA 421PA 4DLSA 5IK2D 2H17A 3IBGA 3ZJYA 3BXZA 4OI0A 1E0JA 3QXHA 2QE7A 5ANRB 2BMEA 3FKSD 2ORVA 1LW7A 1QBKC 1Z08A 4C0AC 3WNDA 1DG1G 4A0HA 1N6KA 2ERXA 3OIUA 4P33A 4JYBA 4S2EA 5HPYB 5KNDA 4R2HA 3RC8A 4MGKR 4QXAA 3UPUA 1U0JA 1XJCA 4HLUC 1XF9A 2F1IA 3SBDA 3LQRA 4XVUA 2RKOA 3FOZA 2QP4A 2WJGA 3RRNA 1XPUA 3FFBA 1G1MA 1KK2A 2BKUA 3OE7D 2GRJA 1E1RD 4KYIB 4TSFD 3WY9A 1DS6A 3PEVA 5KSPA 5L3SB 2D4HA 1A2BA 3Q3JB 1ZNYA 3QY0A 4NYIQ 3PUZA 5CB6A 4X8HA 3FTQA 2ZREA 5C18A 3NBYC 3WBKA 4E09A 1JR3D 3DEFA 1WBBA 1IJFA 4FW9A 2MSCB 2ATXA 3BWDD 3HR7A 4DSOA 3DL0A 1RFLA 3TGPA 4MRSA 1TU3A 1KMQA 4ZV4A 3SHFA 4TLBA 1AKEA 3CPJB 3NBZC 3AVPA 1GG2A 2TMKA 2Z43A 2QMEA 1GWNA 3AKYA 4BRWA 2JLUA 2CHQA 1U0HC 2IS2A 2NO6A 3O8BA 1KMHB 3P20A 2RGBA 4LC0A 1E6CA 1VHLA 3TMKA 3GFOA 4LPKA 4MITA 2BVNA 1QHXA 2IHYA 2HT6A 4JKIA 4JYCA 1QHIA 2IX3A 4PXAA 2J0UA 1DE0A 1T4GA 2WAXA 4CT5A 2OAQ1 3SBEA 4EDHA 2R6AA 5DO9A 1CR4A 2Q0HA 4A6XA 4M9ZA 4JT2A 2J7PD 5EUQB 4HSEA 1N6HA 1NSTA 4IVRA 5IRCD 2VLIA 1F6BA 4N0DA 5KYKA 1COWD 2J1LA 3SJZA 2RGGA 3DO6A 4ASUA 1G5PA 4Q9JA 2C96A 1H8HA 1YZQA 1SKYB 4AG6A 1QHYA 4GOJA 2V9PA 4IEIA 3N5CA 1DELA 4ZO4A 2ZE7A 4Q9HA 1RRPA 4DLRA 3UKDA 3DHWC 4V0MA 3VHLB 2QMOA 4YMWA 3PEYA 3SYNA 1KK3A 1FUUA 3V9PA 3TK1A 2GILA 1DPFA 5FR2A 4Q4JB 4AIIA 3VNUA 1BH2A 2ZRDA 1M6NA 3TR5A 4KVGA 3FB4A 1CF4A 2ZYUX 1F60A 2V3CC 4OHZA 2ZRLA 4QGFA 2JJ8A 3V00A 5CYPA 3GLFE 3O47A 2F9LA 1GRNA 4WZAE 3SYLA 1E0KA 4NCHA 5JFGA 3VR4A 4M9SA 4LJYA 1D8TA 4M4SA 4RZUA 2EFGA 4DCUA 3PQCA 1A7JA 5IHPA 4PQYA 2XB4A 3E5HA 5F3WB 2AWOA 5FH9A 4TZ6A 3EZ2A 4Q18A 2XAUA 1OB2A 1PUJA 1R4AA 1KO8A 1G20E 4TYYA 1NBME 3W9YA 3GLIE 1W5SA 4DUGA 4M9XA 1SQ5A 3K0CC 2VHCA 1GUAA 4HAXA 1XEWY 3FDIA 3ZH9B 3TW8B 2BIFA 2ZSFA 5SZKB 3PUYA 4Q5IA 4IXMA 4Q4AA 4DCVA 5AJYA 2BV3A 3QKRA 4WW0A 5KSZA 3VKGA 2IYVA 2ZS8A 3B1ZA 4XSGA 3WXMA 3JVUA 3K70D 4BLTA 3GLFB 2ZVQX 4A36A 4C9BA 3CPHA 3QG1A 2OILA 2CNWA 2J45A 2QAGB 2WJYA 1IY2A 5HKKD 1KGDA 2ZR7A 5JHGB 1G4AE 1PUIA 4DDTA 2D7CA 3GJ6A 2ZEJA 2BEKA 3RRZA 5FPTA 1GNPA 3D8BA 3QXJA 2OFWA 4XD7D 3CRMA 3KKMA 3Q5EA 3D3QA 3M0EA 2O8EA 2GVZC 1S3SA 4WA7A 5K8UA 4ITRC 5B57C 3A6PC 3KTAA 5FOTA 3TW4A 1W48A 1GP2A 3BE4A 4YMVA 3UMFA 3OFNA 1OHHD 5H8WA 2R6CA 5GJVC 2XEXA 4HLCA 1I2MA 1Z22A 1Z5ZA 1MOZA 2VL7A 3TVTA 3SC3A 1XNJA 1EK0A 1DOAA 3MD0A 3KXIA 4NP6A 1Z29A 3ZQ6A 2R6DA 1U2RA 4A0RA 4MKIA 2FU5C 1E96A 4W9MC 1KKMA 3KKNA 3NH9A 1E79A 1YE8A 4WXPA 4RD6A 4LRWA 1FFHA 1C4OA 3W34A 3UATA 3ZZ0A 2GCOA 1TF7A 2P6NA 3VHXA 1XWIA 3S1AB 3NC0C 4D82A 4MRVA 2ZROA 3RWOA 4AKGA 4M2LA 2J0VA 3DKVA 4Z54A 2FFHA 3EPHA 5FR1A 1W47A 2AD1A 4N3NA 1NBMD 4GZLA 2A5GA 3VMFA 4TLCA 5EP3A 1NLYA 5DIFA 1JJVA 3MFYA 2MSEB 4KFTA 4AKEA 1Z6GA 2WJIA 1P9NA 1ZC4A 1U98A 1A1VA 2IS4A 2VHQA 3IIJA 3CRQA 4TL8A 4GMXA 4US1R 1W2GA 1XEFA 4DLYA 1VG1A 1XJQA 3AVTA 1G7SA 2BMDA 4MGIR 1U81A 3CH5A 1P2VA 2G6BA 1XB2A 3ETLA 3FGNA 1Z0AA 4XTCS 2CBZA 4O3MA 4TYPA 3GPLA 3QKSB 2HJVA 4A0FA 3ZQJA 1SVLA 4OQFA 4IDQA 2F43A 1E0AA 2W83A 3TSZA 1OFHA 3UG7A 1NI3A 4ACAA 1Q1QA 1ESNA 5DN6D 3U44A 2P67A 5JSZB 1NN3A 4QBIA 4R9UC 2GA8A 4IVPA 3IEVA 5JJKA 1JR3A 4C0KA 4LJ6A 3CLVA 4RCYA 4FN5A 1AM4D 4JLAA 4Q02A 3U61B 2W00A 4RD4A 3S1AA 1XEWX 2J0UB 3PENA 3L8YA 1R0YA 2FX3A 2GJAA 1DEKA 3IGFA 4IOJA 5L3QA 3PITA 2K5UA 2PLRA 1P7CA 4OI4A 4RD0A 4Z1MA 2IYRA 3FMOB 3OE7A 4NCIA 5FOXA 1TTTA 3SDZA 3THYA 2DWQA 4KBGA 3PG5A 4LWZA 4KLZA 5H70A 1XRJA 4M53A 3WNBA 3LW8A 4DLXA 1MRNA 2GZAA 3UG6A 3B5JA 2FFBA 1G8FA 4L8GA 1WRBA 1O87A 3L0OA 2Z5FA 3OEHD 4OJQA 4C0JA 5KDOA 4A2PA 4GMDA 1EFTA 4B2LA 5FUWA 3K70B 4PAOA 4DHEA 2IS1A 1F2UA 3AEZA 3BB3A 1IHUA 2C77A 4C7OA 1KNQA 3KJIA 3U60B 3GLIA 3LVRE 5KO2A 3W3ZB 4DSUA 1WCV1 3DZ8A 3OIWA 1ZIPA 3L43A 2GXUA 2HF8A 4DT1B 2VRWA 3GLGE 2F9MA 2QMHA 2KWIA 1HYQA 4M8NE 4A92A 1G3MA 3Q72A 3GEIA 2QEQA 5FUXA 2ZIAA 2CL6X 4PPGA 1ZM4A 3EPLA 2GZHA 3THWB 2ONKA 5ELXA 2ZRAA 1KI3A 2G1JA 4NZYA 4DC9A 1MABA 4HI0E 4URZR 3VTKA 6Q21A 1G3UA 1H8EA 3EZFA 1PZNA 2WSMA 4TMVA 2YWGA 2PZEA 2OBNA 1JAIA 3K0FB 4HAYA 1US8A 1N2CE 2IEZA 5FPSA 1EGAA 4US2R 4G01B 3AP2A 3TH5A 3CRVA 2E1RA 3KUDA 3NH6A 4B3XA 5J4VA 3QEJA 3W8RA 2CHVA 5H1YA 4Q1FA 4URXR 1L7VC 3P4YA 1IY1A 2GDJA 4EUNA 1SULA 1R6BX 2LKDA 3CNLA 3RAPR 5GVRA 2X1VA 3IIKA 1G3IA 3B13B 3GLGB 4UJ3A 1CR2A 4PC2A 3REGA 3X2SA 3SU8A 2NIPA 4TT3A 2FSGA 1KSJA 1CXZA 2CNWD 1KY2A 4B47A 4DSTA 5AUOB 4IDOA 3NHAA 1AS0A 1IN4A 2ZJBA 2IYLD 1EFCA 2XOKA 2BMJA 1DAGA 4DKXA 3NC1C 1U9IA 2EYUA 1KIMA 1S1MA 3BH6A 3NG1A 3B82A 2GXAA 1E1QA 2IW3A 1MABB 4JLKA 2QE7D 1ANKA 4PC7A 2RB4A 2W2TA 2WPDA 1ZM7A 5FUVA 2IUTA 5E7MA 3C14C 2GCOB 4GFDA 4A9AA 3IDQA 4B3FX 1G7RA 4LHYA 2X19A 5BWMA 1DO2A 1Z6YA 4EAQA 3Q5DA 1S2MA 3TSWA 5B30A 3U4QA 5BN3A 2ORWA 4QM6A 3RSLA 1NN0A 4RY2A 2REXB 5EXPA 2FEOA 4B2IA 4BLRA 1AJEA 1CEEA 1VCIA 4EPRA 4B76A 1W4CA 4CEHB 3IEUA 2ZJ5A 1NIJA 4MGZR 3RABA 4O2RA 3NXSA 1S1CA 3OAAA 1RE0A 1WDTA 2AK3A 4I1VA 3WMGA 1SVWA 2JA1A 1X8JA 4RVCA 4P3YA 1QDEA 1CKEA 1E9BA 2AFHE 2XNSA 4MUBA 2XNDA 2FNAA 1NL3A 4TL6A 1GDDA 4ARZB 3B6EA 4O2LA 5DYIA 4EFLA 3Q8XB 4G0NA 2UZIR 1MO6A 4GI7A 4F91B 4ZCIA 1N0WA 3QKSA 3ZVRA 5JRJA 3PVSA 1VYVA 4I4LA 2D2FA 1S9HA 4WZ6A 1RRGA 1E2QA 4JMPA 1Q1BA 1KDTA 3BFXA 1RJ9B 3PR1A 4C2UA 1N6RA 2ZYVX 4C0HA 3PUWA 2QPOA 2HLDA 3SQWA 2D62A 1KJZA 1LF5A 3REFA 5KHOC 2BOVA 4R71A 1GFIA 1KAOA 2IYQA 5EXTA 4QBFA 1B23P 2OHFA 1AKYA 4IOLA 4YMTA 3EZ9A 4L9WA 5EE0A 3TUZC 1E2PA 2WZQA 5B2ZA 4LBZA 3R7WA 4D81A 1OKKD 2J7KA 2Z4RA 4MYHA 1WMSA 2QM8A 1BO6A 1GL7A 2JDIA 1F3OA 2FWRA 3R7WB 4QOSA 2IK8A 2ZUCA 1VKJA 2IYYA 3BFKA 1OH7A 4FWTA 2D2EA 4UNNA 4QGAA 3AQ4A 3I72A 4HDOB 2CL0X 5G3ZA 2R44A 4Q9IA 4BZPA 1RC8A 1XD2A 4QJ5A 2XTNA 2QM7A 4BGDA 3TJZA 3RLFA 1PLJA 4C0SA 3U5ZB 1RRFA 4DRZA 2WICA 4B33A 3ZZTA 4KVAA 4CIDA 1VTKA 3KJHA 1DG3A 1KNXA 4PO8A 1XXHB 2V1XA 1N6LA 4B43A 4CZ2A 1RVDA 1VCMA 2E87A 1SVIA 4FMBB 3RC3A 1XTSA 3NIBA 1ZD1A 3KJEA 1XTRA 4D26A 2J0QA 3GLIB 3EIQA 2FEMA 2Q3MA 4GOKA 1Z0KA 2NZJA 1OW3B 4EPTA 1GKUB 5FI0B 1N6PA 2QSYA 4NBSA 3T34A 3KKPA 2OFXA 2ZANA 1WQ1R 1NNEA 2O8DA 4LC1A 4B71A 2CK3D 1YZKA 3NWJA 4Q4JA 1T0JB 4GZMA 1VCNA 2H7VA 2P2LA 2C95A 1QVAA 4Q03A 3R9XA 1OH5A 4JLOA 1KSHA 2ZRMA 4PHGA 4NMMA 2WKRA 2OUKA 3B2EA 1W4AA 3QXXA 4A15A 5CLLA 4DBLC 3IIMA 1JB1A 4LV5B 2HT1A 2ZR0A 3QVUA 1CRPA 3VR2A 1HT1E 1T9HA 4RZXA 2YHSA 3B8HA 1LTQA 1MO3A 3B1WA 5BW8A 1IN7A 2FFQA 2PT7A 1ZM3A 4JVSB 4P0TA 4EPWA 2VHTA 1T3LA 4PANA 2DFKB 1A4RA 3L0PA 5CJPA 4DEYA 4KXFB 1SKQA 5H68A 3VR6A 4TSFA 2O8BA 3U2QA 4PPQA 3EG5A 3BB4A 2BBSA 5JECA 1XP8A 4TTQA 5BYKA 2OBLA 2GBLC 4AYXA 4C0LA 621PA 2GBLA 1W5TA 2G0TA 3GJ7A 4JL6A 1VMAA 2YINC 1X1SA 3CPEA 3IBYA 3QNUA 4AK9A 4XWKA 3LW7A 5K8TA 4M1WA 4NHOA 3CUEF 1Z83A 2QUZA 4UQOA 1X1RA 3KQUA 2XGJA 2PX3A 3QG5A 4OQNA 5G53C 3SJBA 4MRRA 4NH0A 4AKIA 1VG9B 1Q1EA 1E3MA 3FMFA 4XJXA 3AUXA 4HAUA 3T1TA 1KY3A 2OEPA 3K0FA 5AJZA 4RCZA 3OEHA 4PO9A 1E9EA 4DSNA 1CU1A 4NONA 2B8WA 1TEXA 2Z0MA 1OPXA 3C5CA 3AVOA 3OZXA 1O3YA 1FMJA 3VU9A 5KU1A 1JPNA 3FPAA 4Q1BA 4HLQB 3GCGA 4NPHA 1E2MA 1MO4A 4HLDA 4GL2A 3DOEA 2QG6A 2QP3A 5KNBA 1OXXK 2HYIC 2ECKA 2GESA 5TV2A 3TUIC 5M04A 4Y0AA 2ODWA 3FYHA 4KAXA 2VBCA 5FL3A 1AN0A 4MH0R 4D80A 1VECA 3T5GA 3QBVA 2Z4SA 4AC9A 2C9OA 3D7MA 3CRW1 2XITA 5JWRA 1ESMA 2DBYA 3SFZA 3SFVA 4MDFA 3EPKA 3WYFA 3CX6A 4IXNA 2A5JA 2HXSA 1G17A 5JZVA 2Q21A 1WBDA 2OESA 1A5TA 3U3MA 3KQHA 2OT3B 3LX8A 2JLVA 2YZ2A 3RS0A 3LDAA 1UBEA 2ZE6A 2P6UA 2VP9A 5B64A 3PEWA 3AVVA 4B3CA 3QPUA 3TRFA 2PCJA 1Z0DA 2CE2X 1P75A 1OE0A 3WYGA 1BS1A 3OAAD 4KODA 2JIZA 2O8CB 2XSZD 2GVDC 5JI2E 4D0GA 1E9FA 4M9QA 4P32A 1DAIA 2A5DA 1Q20A 3EC1A 4P4SA 4UXIA 3W5IA 2QI9C 4NL4H 4FWIB 3VX4A 3O8RA 1X8LA 2IA5A 4NCKA 3A8TA 4IDNA 1PJRA 1P2SA 2ZI7A 4LPSA 1GILA 5LD2C 2RHMA 3TVDA 1W36C 4F7WA 1IXZA 1P72A 2GZDA 3MWYW 2IXEA 2NZ8A 1JEDA 2OXCA 1GITA 4RFSB 1V5WA 2B8TA 4N0EA 1E1QD 4L5BA 4LYHA 3ZIAA 4UXJA 1TNDA 4BFWA 2VH5R 5CIQA 2FA9A 5FI1B 1VG8A 4HZUA 3HYRA 5FL7A 1CR1A 5IF9A 4Q1AA 4JLMA 1BKDR 2IUUA 2FV8A 4UKDA 3NVAA 5TVKA 4Q7KA 1M7BA 4LBYA 4D25A 1HE1C 4JLPA 4OQXA 3OF5A 4TMZA 1DVRA 4YXWD 3U6BA 4PSKA 2FSHA 2WOOA 4E07A 4MRNA 1NVWQ 1X86B 4IW3B 1R5OA 4F4JA 1WF3A 4OQMA 4EJSB 3G5UA 1ZUIA 2ZRPA 3KXKA 1GRRA 4AYWA 4GSYA 1OSNA 2NO7A 4Q4HA 3BGWA 3CRRA 2W0SA 3NKVA 4EJSA 5BN5A 2GJKA 1N0VC 1NLFA 3QXCA 5EE9A 2VP4A 3V4RA 2IXGA 3BD9A 4W5HA 2MSDB 4M1MA 3QSYA 4Q9KA 4MKHA 2YWEA 2WJVA 3DVLA 3CBQA 1XTIA 1YZTA 4LHZA 4BZXA 1WE2A 5D3MB 3ADCA 1UADA 3N70A 3ZDQA 4ZPXA 1W7AA 2IWRA 4AY2A 2ZRIA 1E9RA 1OXVA 1TEVA 4Q21A 2V6JA 2BDTA 1U8ZA 1P5ZB 5EXSA 4YONB 1NP6A 4LJAA 5E4FA 4CGZA 4JZKA 4K8OA 1XX6A 2OG2A 3PJRA 5JSZA 5C4GB 3EX7C 2FZLA 2G3YA 4FMCF 2O8EB 4OJKA 3GLHE 3SJAA 2NO0A 2YOFA 1HT2E 2R2AA 3KX2A 1Z2CA 1E2GA 4DCSA 3I61A 3ICQB 1ZUNB 3MCAA 2BBOA 4YMSA 1KOFA 2DCUA 3GJ4A 3K53A 3K09A 4D0LB 5CYOA 4TLDA 1VIYA 2VIIA 1Q44A 3L82B 2L0XA 3SYKA 521PA 1ONBA 1FZQA 3K8YA 3QJYA 2QZ4A 3SHWA 1OIVA 4ERNA 4I1UA 2AXPA 1UM8A 3BAFA 2CHGA 3QENA 5J4LA 1TF5A 1II8A 2FE4A 4Z1MD 2GEUA 1IJEA 2QQ0A 3CX7A 4QRHA 1TUEA 4ARZA 1G8GA 3B60A 2A2ZA 1IN8A 1CTQA 3LWNA 4NYJQ 4BLSA 2OZEA 2C2HA 1J99A 2C03A 3CO5A 2Q9BA 3A4MA 4IOMA 3SI7A 1YU9A 2C5LA 1FP7A 5BXQC 1SVOA 4HZIA 1N5LA 3PV0A 2B7CA 4KYUA 3D31A 4DCTA 5DI3A 1E9CA 4RJLA 2PJRA 1JECA 1GNQA 2F3RA 4IJMA 3CB4A 4TMXA 2ODNA 2JATA 4F4IA 2X8AA 1V43A 3LY5A 1E2HA 2CJWB 3L8ZA 1XD8A 3K1JA 4PFSA 1XCGB 4B3GA 4O25A 3FFAA 3ICEA 1U8YA 2D3WA 3BH0A 3WRXC 1YZGA 5F2EA 2B92A 4ASUD 1XMVA 1XEXA 1AGRA 2P6RA 2O8DB 2ZJOA 2CLCX 4MYUA 2ZUDA 1GKIA 4OHVA 4EFMA 1YR9A 3UXMA 1OYYA 1JQJC 2VF7A 1HQCA 3HPQA 3KB2A 4M1TA 4BPBA 3UMRA 1RYFA 4R98A 2P3SA 2OCBA 2P0EA 4LYJA 1XBTA 221PA 5HTKA 1G5TA 1Z8FA 3F3YA 1ZINA 1NVVQ 1RIFA 4JBYA 5EP2A 4CT4B 4URWR 1E98A 4TL7A 4QJ3A 3KQKA 3LQQA 2QAGA 1CR0A 3B78A 4V0NA 4R7ZA 1EFRD 5FFMA 1OV4A 5GADl 3AKDA 5CB8A 1R0WA 1UAAA 3GLFA 1NKSA 2H57A 3CZQA 4E03A 3SNHA 4Q19A 3QKRB 1CIPA 3T12A 1U8AA 2ZRBA 3LAWA 5DISB 1LFDB 4U02A 4FIDA 1QHGA 2ONJA 3AB3A 3I4LA 4BLOA 5EE5B 3T15A 1J70A 4CF7A 4G5GA 1R5BA 1QHHA 2CVHA 2ZSAA 1P60A 4NTZA 3KJGA 3QF7A 3R8CA 4EFNA 4DIEA 1E2NA 1OHHA 3BH7A 4CEHA 5CLQA 3SS8A 2G0NA 5DN6A 4BQSA 3TKLA 2G77B 1N6NA 2BJWA 1YQTA 4B6EA 3U4QB 1KI6A 4W7SA 1IXSB 1E1RA 2JJ2A 2G83A 1KSFX 2VEDA 4A0GA 5FTMA 4RD2A 2OE2A 2Z6VA 1KO1A 3SN6A 5LB2A 4BFTA 1FL9A 1G7TA 1ZD8A 5D3QA 1SKYE 1AZSC 2QY9A 4TYWA 2C9CA 121PA 5FTNA 2OV2A 3DZDA 3F0TA 4CEIA 4Q01A 3VR3A 4KHZA 4JS0A 2ZJZA 3PUXA 1Z47A 4DLZA 3W3AA 1XD9A 4NYMQ 4Q1DA 5DSZA 2BWJA 1JNYA 4B44A 4UNSA 2NMVA 1GVNB 4KITB 4JJKA 4KFRA 1R7RA 2IF0A 2VP5A 2GHIA 2QAJA 3HU3A 4Q66C 3DOFA 4XSHA 4HB3A 2ZU0C 1XTQA 4LSGA 3THOA 1G291 1BYIA 1KZGB 2IXFA 1IN6A 1XDBA 2R8RA 1XJ0A 2ZI4A 1QHHB 3DDCA 5P21A 3NEYA 3LLUA 2C8VA 1US8B 5KOYA 1C9KA 1SXJB 3I92A 3EASA 2XB2A 2RGCA 1OFIA 2KE5A 4O0MA 3DPUA 2AD5A 5UKDA 2J9RA 4G5OA 2ZRKA 3MAAC 2WKQA 4M1YA 1P2UA 2DHRA 1FW6A 2RH5A 5C4MA 1Z28A 3U3KA 2JJ2D 1U99A 5G40A 3SJCA 1E99A 1W49A 4LV6A 4TN1A 3KKQA 1FX0A 2WAYA 2ZE8A 4IRUB 3HU2A 2GETA 4UNQA 4P4SB 5KSYA 2SHKA 3QF4B 3THXA 4MUAA 2CVFA 4YXWA 2RGAA 1N5JA 2O8CA 5AJVB 4KBFA 2J87A 1TL7C 2PEYA 2ZQ5A 3HP1A 3OEED 4TQUS 3JVVA 4PR0A 3VKWA 2ZSDA 3LRPA 3ZS8A 1LS1A 5HKKA 2A9KA 4EKDA 2GAOA 3K0CA 2DWOA 1QG2A 1OIWA 2PX0A 2UZ3A 2HCBA 2ZRFA 3AKCA 5G41A 2NQ2C 1I2DA 2QTVB 2O5VA 1D9XA 4DLUA 1NN5A 3ZIAD 1TUIA 2WWXA 4KU4A 1VYTA 5J4YA 1P9WA 3LBNA 5EQTA 3ASYA 4PPNA 3BBPA 2GXSA 3A4NA 3THWA 2CCGA 1KI7A 5EZ5A 3RHFA 3GMTA 4FMDF 3EZ7A 1G5RA 1OYWA 2WIBA 1G16A 1Q3HA 2BHRA 4LCBA 1G3QA 1AZTA 4K81B 1IY0A 2BMFA 3KZ1E 3QE0A 4U7DA 1FX0B 4HAZA 3B85A 2ZM5A 2PCLA 4PX9A 4OYHA 4A4DA 4TMWA 5CK5A 2F1RA 4LGMA 1S0UA 3FHOA 1ZJ6A 4HYYA 3VNVA 4OI1A 3E1SA 1GAJA 4QJ4A 1SHZA 2QT0A 1IAQA 5AUQA 1M2OB 4HUQA 1TQDA 3CWQA 4A8JB 1K5GA 3R8FA 2A5FA 1TU4A 3MUFA 3NTUA 1GIAA 4PQRA 2D7DA 2REOA 1Z06A 4BFXA 4MDEA 4FCTA 2Q9AA 2RGNC 5C2JB 2RMKA 3KXLA 4ZKDA 3AGPA 5JEEA 4PHTA 1B0UA 4C3ZA 3HDTA 5L8VA 3KL4A 4KCGA 1P6XA 4HDCA 1S3GA 3SR0A 2OCPA 1L2TA 4PSAA 1P4SA 1EFHA 2QT1A 1R0ZA 2ZXUA 3HR8A 4PTLA 1DAKA 2D06A 2G9NA 3WP1B 2CCKA 4XVQA 3RDPA 2A78A 3VR5A 2V4ZA 1R5NA 3ONWA 1DAFA 1ZNWA 1AA9A 1P62B 2NO9A 5JLJA 1H8HD 1YRBA 1DAMA 4NCNA 1IM2A 5HCNA 1SVMA 1E2DA 3GJ8A 1X6VA 5L3VA 4GBMA 2V55B 2B6HA 4F93B 4RD3A 4FI3C 3WHLA 2JLZA 3AUYA 5EJEA 2W6ID 2PEZA 1JQLB 2FMXA 1OFUX 3EA0A 3MWJA 5FBQB 1D9ZA 3WNCA 3ZVNA 4NYIR 2H5EA 1MRSA 1NMYA 2A5YB 4DIDA 2IYTA 3C7KA 1KTVA 5KNCA 1NJFA 3A36A 1XPRA 4BFUA 1JI0A 2WWWA 3CWZA 5C1BA 3OHMA 1VG0B 1G4UR 4QC2A 3I32A 2ZR9A 3WMFA 4XVRA 1J8MF 3AVXA 1CLUA 1QF9A 3CM0A 1ZC3A 1FNNA 4L16A 2XTZA 3ZYCA 3PUVA 4DB4A 2ZYWX 1PV4A 3T1OA 2IF2A 2PZFA 2IYXA 1Z07A 2AXNA 1N0UA 2AN9A 4UNPA 5GJCA 5JS8A 1CJUC 1KHTA 5FPKA 1NN1A 2W0MA 3TIFA 3LVQE 5G3YA 4PAQA 4C0QC 1CJVC 4MKFA 2O52A 1EX6A 2ASEA 1M7HA 1W1WA 1XD2B 3R9IA 4BFVA 1S4QA 3E70C 5JBQA 3MLEA 2G1KA 4TWZA 4X8LA 2OLKA 3PIRA 3VAAA 2IWHA 2CK3A 3HPRA 2OFOA 5J4KA 4ZCMA 2HF9A 4POAA 2OSBA 4PZYA 1MT0A 4TLAA 4YDHB 4RSGA 1EWRA 1YJ5A 2IYZA 3LBIA 3LFUA 2V7QD 3H4MA 3I8SA 3X1YA 5TMPA 3QI2A 4A2QA 5CDFE 5E7IA 1K5DA 1DAEA 1W0KA 4ZDKA 3TR0A 3W8NA 1HQYE 2EQBA 4IVQA 2VO1A 3CNOA 1E32A 3R20A 1Z6AA 4KFUA 1KMHA 3A1SA 3IUYA 1BYUA 2WOJA 3U3RA 2BM1A 4Q7MB 4DJTA 3PCRB 1JBKA 3CR7A 2QQEA 1NRJB 3BERA 3ZVMA 4M1OA 1SZPA 2ORIA 3Q85A 5IK2A 1IBRA 4A8JA 4QGHA 3ECCA 4AI6A 2GJ8A 2FSFA 1M34E 4LHWA 2PH1A 1JJ7A 4AURA 4Q4HB 2NPFA 4C0BA 3L2OB 2KBFA 5GVSA 1XPOA 3UIEA 2DFTA 2ZVPX 5BQ5A 2D74A 2J0SA 5DYGA 2H18A 4IDPA 2JIZD 4LYAA 4RZ2A 1KDPA 4HUTA 3U7GA 4OHYA 5SZJA 5B58C 2YOGA 1NVVR 2Z83A 2ZRJA 2VSOA 2WJHA 3CR8A 5E95A 3I5XA 2QN6A 2CMKA 1XXHA 2V54A 1XU4A 3T1VA 1KI6B 2VF8A 4CEJB 3MGCA 4NYMR 1NY6A 1T8TA 1SXJD 1YZUA 2X2FA 2HLDD 2ZUBA 2HDNB 1XCMA 1ZRHA 5FOWA 2BCGY 4QGGA 3N2EA 3DMDA 4RFSA 1ZYUA 1E2FA 3BB1A 5HE8A 4ZDWA 1EXMA 3QKUA 1E4VA 1S96A 2PJZA 4RD1A 3VX3A 5HZKA 5FTJA 4KSCA 3QXSA 1MR3F 3UWOA 1GOTA 4Z51A 4B3BA 4P4TA 3I8XA 1P9RA 2UKDA 3AP1A 4LZZA 2OCAA 4WXRA 3SE0A 4B34A 3EIHA 4Z8XA 1JXMA 2VP0A 3AF1A 3LXRA 3GLGA 1I4LD 1YZLA 4LDJA 4D6PA 2H8KA 4DZZA 1G64A 1BMFA 1NMZA 4WAUA 2CL7X 4KJZA 1ODFA 3GD7A 3IO5A 2HV8A 821PA 5HE9A 1M8PA 2VA8A 1RYHA 3QQ5A 4JLNA 1KSGA 2ZYTX 1ZP6A 3WMEA 4B6FA 1Q21A 1LV7A 1G8PA 1AK2A 1OF1A 2JGNA 4HUQB 4PC3A 2QPTA 2WSSA 2FJUA 1Z63A 2B7BA 3FE2A 3MSXA 3A58B 2O8BB 3CONA 3ZD7A 2OLJA 2JLSA 3H2YA 5TB5A 1VHTA 4KI0A 1Z6TA 3PXGA 1AS3A 2XX3A 3LBHA 4TZ0A 4NU0A 3X1ZA 3RS3A 4M22A 1FOEB 3THYB 3AVYA 1M7GA 4LJ9A 4JLJA 2LKCA 2V7QA 1C1YA 3D6TB 4HB4A 4DVGA 4CEJA 4JSYA 4DT1A 2I1VB 3WRYC 2ZI9A 2V8OA 4MYCA 1Z0FA 5HR5A 3CF2A 5GJBA 2QSZA 2A7QA 4LJ4A 3CZPA 2RGXA 4PZZA 4HEJA 5CDFA 5EE3A 3Q7PA 4HAWA 4Q4LA 2DWPA 1GKYA 2WIAA 4FMDB 2ERYA 3X1XA 1W44A 1T5IA 4NDZA 4CEIB 3I73A 3A1VA 3QUSA 1SXJE 4PHFA 2KBEA 1T0HB 4BUJA 2A30A 1WXQA 2ZE5A 2FFAA 2FG5A 1EG7A 1J90A 1ZM2A 1GTVA 2Q3FA 3OESA 4G1UC 4B3DA 1XXHE 1TQ4A 3AF2A 1UDWA 3K0EA 3ZGXA 3IHWA 2YNMA 1D5CA 1U90A 5JRZA 2ZSEA 3QVVA 4E22A 1VIAA 2ZJAA 3EPJA 2ZETA 4LX0A 5K8IA 3RYTC 3R9WA 2R6FA 1XTJA 4QHTA 1R0XA 3F5FA 2R9VA 4LOAA 3H84A 2FH5B 3LLMA 3P32A 4ON9A 4LHXA 2I3BA 2DYKA 3CKLA 3OIVA 4LHVA 2WHXA 2NOAA 5F9HA 4OBEA 4IEEA 1N5KA 3U7EB 4F4CA 1N6OA 5SZHB 2VSFA 3ADBA 3U44B 1WB9A 1Q1ZA 4J0QA 4BWYA 4JBXA 3CNNA 3NBXX 4BRUA 3Q7QA 2J5XA 2VQSA 3T5DA 4JL5A 4WVFA 5DHAA 4V0LA 1HTWA 1U94A 4ABYA 3A1WA 1OB5A 1FTSA 1AQYA 2F7SA 2GCPA 4DLTA 2ZU6A 4F92B 5FOUA 3H86A 1ZW6A 4URUR 2J3EA 5DI3B 2QPAA 3TAHA 3AKEA 2ZRGA 4GP7A 1Y3AA 1MV5A 2GCNA 4ZIRB 1XZPA 1OKKA 2PT5A 4TYNA 3TUJC 3CF0A 5DLQC 1ZM9A 2QL6A 2F3TA 2FPKA 4GPTA 1YR8A 3UWKA 1T8UA 3EXAA 1Q57A 3P1JA 3TAUA 1T91A 3VU9B 3VQTA 1KI2A 3TQCA 5HCIA 2N1BA 2WWYA 8OHMA 2IBMA 3AVQA 4YDSA 3K9HA 1MO5A 2ZTSA 4QFMA 2HYDA 4TMKA 3MRSA 3F8TA 4IHQA 3C15C 3A1TA 1G6OA 1DTSA 2O0JA 1G6HA 1NLZA 4KLNA 2AR7A 3K0AB 1R8SA 5TXGA 2IL1A 1T3HA 3K70C 5DGXA 1NJGA 5DE3A 1CRQA 2XZPA 1P73A 3K0AA 5EXXA 1FQJA 1PVOA 4PHHA 2QP9X 5JWOA 4QL3A 2KSQA 3BK7A 1ELOA 2GEDA 1E2JA 1N25A 2H92A 2O0HA 1RKBA 4GT1A 3LX5A 3QEOA 1GL6A 4BE7B 4EPXA 4F38A 2BM0A 1UBFA 1UEJA 3NBFA 2F6RA 4X8MA 5JEDA 1A82A 4L15A 5C46F 2AK2A 1KDRA 2G88A 1W4BA 1ZNZA 3C5HA 1CP2A 1E2IA 3HJNA 4G3XA 4LBVA 2P65A 2YWFA 3UMSA 4IFBA 2C99A 4IFEA 1H65A 3RS2A 2QROA 4BLQA 2W58A 2EFHB 5JCZA 2OCYC 4LYFA 4Y0VA 1KI8A 5LD2B 1G19A 5GJWC 3AF3A 4A6PA 3ZZUA 1S8FA 1W36B 4QNRA 2WMNB 3B1XA 3VFDA 3L0SA 5DNYB 1E79D 1ZVQA 1PLKA 4UNRA 2XOKD 2VTKA 2QAGC 5AJXA 4H9GA 2JCSA 2ZI5A 5IDVA 1N5IA 4JBWA 3A1UA 3LD9A 1KKLA 3EAQA 1HE8B 3OEEA 2WBLC 2ZJ8A 2W2XA 4BECA 1W0JD 4CYMA 2XXAB 1CBUA 1II0A 1XEXB 1NY5A 3OFND 3LV8A 4QBHA 2ZAMA 4V0ME 5L3RA 3CIOA 2FPLA 1ZUHA 5EE1A 4MRPA 2GAAA 1KAGA 3AH8A 1CULC 1Q0UA 1FTNA 4XD7A 1Z2AA 3W6PA 2GK6A 2GTPA 2CE7A 1W0JA 2MMGA 4B48A 1R8QA 5FBWB 3RRMA 1Z0IA 2F1HA 4OQLA 4CW7A 1XMJA 4JL8A 3WP0A 4UXHA 1VYUA 2PBRA 1M1YE 1JR6A 2FSIA 1XZQA 4B35A 5F9FA 5FUYA 2HEIA 5KPJA 1FMLA 3CH4B 2UVQA 1YR6A 2R65A 3RNLA 4BLPA 3TBKA 2OO7A 2R6GA 2KJQA 2FF7A 3LNCA 2BBWA 4LJ5A 4Z8YA 5K8LA 3DMNA 1GZSA 1G9XA 1WP9A 4TQ9A 3W6NA 5EZ6B 2C78A 1ZCAA 4LK2A 4CRWB 2Y8EA 3LH5A 3AVWA 1UKVY 3ADKA 4HAVA 3GFTA 4M0LA 1IN5A 3W6OA 1ZAKA 3Q9LA 1HA3A 5JJIA 1L4YA 1W4RA 2JLRA 1UEIA 4TYQA 3EWAA 2BEJA 2YC4C 1NG9A 4XH9B 5AK0A 4YC7A 5DI9A 2QA5A 3H1TA 1ZNXA 1NVUQ 1AQUA 5A4JA 1UKZA 2W6IA 4RKEA 2WMOB 1SGWA 3C8UA 4G5QA 1QG4A 3O8CA 3QPWA 4JLDA 5FPHA 4BFYA 3ND8A 4NKRA 5FOVA 2HJGA 3AP3A 2H16A 2WWGA 3EW9A 3DM9B 2F43B 5FBRB 3M6AA 3X1DA 5KDLA 2AWNA 3AF0A 1E94E 5SZIA 4JLVA 4RKFA 1UF9A 1YKSA 1GNRA 1P2TA 3QBTA 2N42A 1VPLA 4KV9A 2ZAOA 5TY0A 1Q12A 3V4FA 4XIGS 1GSIA 3TLXA 4OHXA 2JLWA 4Q48A 2GF0A 1UJ2A 3PEUA 4WBSA 3UK6A 4M21A 1RRCA 3RSOA 4D4LA 4B74A 1ETUA 4B75A 4AYTA 5AUNB 1M74A 4N1AA 3GLHB 3EC2A 1T5LA 3GJ0A 1NIPA 4RFVA 3H0KA 5J47A 1R10A 4OHWA 4JKYA 5FPYA 4I1SA 3B9QA 3GLHA 2QENA 2P5TB 4PQFA 3SQXA 1SHKA 4KO8A 3MG9A 2OXRA 5JS7A 1COWA 2EWWA 2QRNA 4EQ6B 4DWJA 1L4UA 2RCNA 1F2TB 2J7PA 2FPMA 2WTUA 4YMUA 1LY1A 1RPZA 1HV8A 2DFLA 4S35A 3QPVA 2C98A 3QF4A 3THXB 4FINA 2FOLA 4P31A 3CF6R 4W5WA 3C16C 4L9SA 1NBMA 3N2IA 5A5GA 3TNFA 3JZAA 3L0IB 2B21A 4V02A 4B32A 4CVNA 1KK1A 4Q9LA 1IXRC 2ZJYA 1E69A 1HURA 4LJ7A 1TX4B 4JVNA 2EFCB 5J40A 3J81k 1Z3IX 4FD2A 3K09C 4ZIRA 2BCJQ 1OXTA 5AUPB 2IYWA 1XMSA 2ZRHA 1J7KA 4PPFA 2ZRNA 3W5JA 4H1VA 4IOKA 1SVKA 1IOZA 4TL9A 4EIWA 3I62A 3P4XA 4CDGA 2OM2A 1UBCA 2O8FB 3P27A 2RAPA 2EW1A 4LUCA 3BORA 3ADDA 2XJ4A 2X77A 3IHLA 3FKQA 4JVMA 2QTHA 3BJIC 3BIFA 4AD8A 2PL3A 2F55A 721PA 3GJ5A 4JLBA 1YZNA 2YYZA 3IKJA 4C7OB 4H1UA 2QRZA 1QVRA 1TF2A 5DH9A 3BS4A 1G18A 1F2UB 4DDWA 4MA4A 2JLQA 1QHSA 2IS6A 3NEJA 2IT1A 2YC2C 3CX8A 2ATVA 3IQWA 1TPZA 5KDDA 3B9PA 1KJYA 4LBWA 1K8RA 4ZI2A 2CCJA 4Q1CA 4BASA 3GEEA 2QBYB 2ANCA 4WOPA 5D3MA 5FL7D 4GP6A 1CS4C 1G21E 1OXSC 4DLVA 1A2KC 4EJSC 4ZI3A 5JHHB 4QM7A 2IC5A 2CJWA 1Q22A 1LVGA 1XTKA 1OH8A 1J8YF 1F2TA 3SZRA 2CDNA 3AF4A 3KQNA 1LB1B 4II7A 2J59A 4EQ6A 3EARA 4LY6A 2CLDX 2N46A 3FKSA 4ILEA 4A2WA 3B7GA 5BYJA 1Z0JA 1G8YA 4EPYA 2ANBA 1KZ7B 1UBGA 4JVLA 2Q9CA 5LB4A 1XCPA 2LCFA 3UANA 2JLYA 4US0R 2X2EA 3CW2A 2EFDB 4QHSA 3G82C 3QIAA 3HU1A 1T6NA 5CITA 4V03A 1NG1A 2YWHA 2ZI6A 4DUGD 1HY3A 4LJ8A 2C9YA 3RWMB 1E9SA 3KFVA 1AS2A 2YOHA 4BEBA 5BN4A 3E2IA 1LF0A 1ZBDA 1PLLA 1E9DA 1II8B 2ZI3A 4URVR 2O8FA 1DADA 1TMKA 1AGPA 4DDUA 1XFAA 4FCWA 1TQ6A 3A4LA 5FTLA 4DB2A 2MMCA 4OI2A 2RGDA 5LBIA 1HH4A 2EVWX 1CJMA 4D4KA 5HZHA 4QG7A 4R2IA 2ZRCA 2ZJ2A 4AKHA 5LPNA 3WYAA 3EIEA 1UDXA
chains in the Genus database with same CATH superfamily
1L5ZA 2ST1A 3D43A 3EQ8A 3T06B 3PRKE 5DW0A 1EFUA 2QTFA 5FO1A 5CXQA 2IZOA 4FQ8A 3IS3A 4IGAA 4Q7LA 1KEWA 3OCZA 3JY6A 3PWZA 3GT3A 3IPYA 3D6VA 3ZGYA 4FSHA 1EA7A 3OCJA 4Z7NB 4G86A 2BJVA 3H6GA 3TLBA 2QZJA 4HD8A 3HDHA 3SGLA 2W48A 3RYIB 4LF9B 2OQVA 4R05A 2W6NA 3LF1A 4PX2A 3UMYA 4JLUA 4JYPA 3JQFA 2VJNA 3ZTTA 2RJOA 4A73A 2CNLA 2OG1A 2EKLA 4NZPA 5B2EA 3WGIA 4F04A 2D1RA 2R84A 3QLTA 1PDOA 3GDFA 1P39A 1EFRA 2BSAA 2O48X 1DAHA 1X7YA 3OIYA 3I9JA 3SQNA 4DABA 4CLOB 3OPYB 2V7WA 2WKPA 4IDHA 1SB9A 5LQAA 4Y1FA 2HGZA 4IINA 3ZI4A 1A8SA 1WHTA 1UFKA 3RS7A 3OTIA 3TZHA 3E58A 1HL7A 1Y9JA 3M5WA 4YLGA 4AP9A 3KUCA 3PUKA 1DZIA 3GEGA 1KH1A 4JBNA 5LXTB 2YV5A 4HTFB 5AXDA 3EMVA 4Y9TA 4C22A 1YZHA 1GHTA 3VV2A 1SEVA 1YQWA 4RHCA 1Q77A 2AX4A 1A77A 4CL8A 3D6NB 3MJHA 4OKIA 2E4VA 1SUSA 5JAUA 5IKXA 2A0UA 3CUYA 2XSZA 1E20A 3IR5A 4RKQA 4MW0A 2SNIE 2QM3A 3L5KA 3DTVA 2CLSA 4B40A 3VSBA 4QGBA 4RTNA 1NZDA 3BSSA 5DRTA 2HCJB 2PL9A 1K7CA 3GFBA 3E7PA 1Y33E 1VPTA 3EZ6A 1KPIA 3B6MA 3WHKA 2PQ6A 2RAUA 4LZPA 1G55A 1PD1A 2C2XA 4PYMA 5CW2A 1PJCA 1UPTA 2BKEA 4DCMA 1QYXA 1O77A 4HZUB 1FFWA 1SWWA 1GZ4A 1OTHA 3JD0A 3VPHA 4NSNA 1JR6A 4RZHA 1CE8B 1V3UA 4UHEA 2DFPA 1FXWA 4G0PA 1O96A 2I1QA 4MCJA 1FMCA 4MO2A 2ZYDA 4MJ3A 3D8RA 1AKVA 1SUAA 1GFWA 4W1RA 2R8PA 3HH8A 3GI1A 1Z62A 4GQAA 5TARA 2FDCA 5IM4A 2JAOA 4A1OA 4MJLA 4EVRA 3BA6A 2GPTA 2FZVA 3VISA 4BEJA 4BUZA 4EMBA 2JPDA 4GKBA 2BI4A 2BT4A 4B8ZA 2H2FA 4UMEA 2I87A 4CTNA 1GXSA 3LA6A 2PX6A 4WEOA 1LJ8A 2YHAA 4AUNA 4BO8A 4B8WA 4QHYA 4MRAA 5EWJB 4KE9A 5KPDA 1RW4A 4ESVA 1C50A 2A0YA 2MYPA 3OE1A 5JZSA 1WEHA 2NPIA 1X8KA 5G4LA 3ZLVA 4BAZA 1XZIA 4V1CB 3KPVA 1M2NA 4OUKX 2QUIA 1R8JA 1Z2EA 4H0FA 4CKCB 5IX8A 5KUTA 2WNIA 3R40A 1WD7A 3MZ0A 3PXAA 1SG6A 4M99A 2HADA 2Q5LA 3AYXB 3L4BA 4I1OA 1IBKB 3ZDEA 4HQ6A 3QOFA 3HJAA 1L8QA 3I39X 3DKPA 3RT9A 2FX5A 4ZQEA 4GNKA 1D2MA 3ZGOA 3PJGA 4FFSA 3P9KA 4OX9Y 1WVMA 1X7ZA 3ZCTA 2EKBA 3CGWA 3FZQA 2FN8A 4M7OA 3I0MA 3RANA 4KXLA 4MICA 3ZD6A 1LBEA 3DOIA 1JHDA 1FUKA 1E6LA 5JI3E 1EWTA 2YKGA 1RIIA 3BC1A 2ET6A 5M7EA 4G09A 5FNVF 3N0RA 4E51A 1RQ7A 4ESHA 2GTHA 5EA2A 1H1LB 1HG0A 1JT2A 2CMDA 2JK1A 3QU9A 4M1SA 5JWHA 3VO2A 1ODCA 5H0IA 5A0FA 2AQIA 3C3MA 3TCKA 3BMOB 1QYRA 2BTOA 4IIDA 4TMTA 1N0HA 5BN4B 4A82A 1N5OX 2QLFA 3IYLW 4TM7A 1IIRA 1VKRA 3VPCA 1AHPA 1SH7A 1VGQA 3FWNA 2XXAA 2IOFA 4MQBA 3PWKA 1T13A 1C4KA 4U00A 4Y1EA 5AT1A 3KYJB 3Q0TA 2Q1UA 2P2CA 1Y8RA 3DYIA 4ACBA 2A59A 5I5EA 3A9RA 2H1CA 3GMDA 2VP2A 4KXUA 4LXYA 3QMMA 1A88A 2N9UA 1JS1X 3IPXA 4YGYA 2DFNA 1KFKB 2GKOA 2ID9A 4EPVA 1GR0A 1XZJA 1RHRA 2W8BB 3NZEA 2B8JA 2B9VA 4OSEA 1N3BA 2WT9A 1OT3A 3K6SB 1W36D 2EX0A 4K5QA 5F7ZA 1CUGA 2OVBA 4PBTA 4HTAA 1V9LA 2P1ZA 1JB9A 3QMPA 4PCVA 4R3WA 4UCFA 2XUAA 3D8HA 4EX6A 5AM3A 2XMSA 2GJ9A 4MYTA 1E7YA 4DG5A 2NT3A 5CA1B 3E22A 4ZK6A 5EHXA 1SA0A 3P2MA 1YVPA 4BWVA 2QD4A 2OXFA 3GQBA 3ND9A 4KFSA 1TZCA 3S2UA 3AV0B 3GAMA 5IULC 5L4SA 4PIMA 1L5KA 2WG1A 2WYHA 3IT2A 3IHTA 3I23A 4UFPA 1BCRB 3F6EX 4PG6A 2WJAA 2QBYA 1Z4LA 2CBGA 1NVFA 1QLJA 3NORA 1SBHA 2IYUA 3LXUX 4Q7JB 4MUMA 1KFCB 3AK4A 2PKCA 4YALA 1LGYA 2JEOA 2CXHA 1IRIA 3DLIA 4W5JA 4FKZA 1Q11A 2V97A 4RABA 2GEVA 2VT3A 4FYXA 3WDMA 1WZIA 5HJ7A 1KI1A 4J49A 2GJSA 2ODBA 5FBVB 2ZVJA 1D2RA 1E1MA 1YRAA 3C41J 3DMHA 1TAQA 1TYBE 5JMTA 3HDGA 1X92A 5JBNA 2XUQA 1P4JA 2JI8A 3BULA 4D0NA 3A3OA 1KDOA 3AU8A 1HYHA 3WO0A 2VAPA 1NDQA 1W4LA 4IIJA 5FA6A 4ALKA 2JCGA 1RM5A 3R3WA 3ZW8A 3RD5A 2LRHA 1NBEA 1C7QA 1NMXA 1UR5A 2HXYA 3GZNB 5SYAA 2VNAA 5CMLA 3RODA 1VHJA 2Q6KA 3WBJA 4F4FA 1FP6A 3FCOA 1PF7E 2JI4A 4JJFA 2OMEA 4L0QA 4TM8A 4MVJA 3MWLA 4EGQA 1NM5A 2ZULA 3GH1A 2JDID 2X0JA 1R1DA 3HRHA 3EZNA 4IGEA 1EFKA 5HK8A 4BNNA 3P9YA 2GF9A 3GJXC 4F56A 3NHMA 3OX2A 4XW2A 2NZUG 3O4RA 5DULA 5I9MA 5K0CA 4CMAA 3N76A 3A11A 2CLFB 5GZ6A 3PNKA 2VUSA 1YS9A 4OLFA 3WRYA 4AG5A 3HNOA 2I4IA 4CFYA 5ICCA 3TRKA 3ICWA 4BLVA 4I4TF 4AMVA 4B73A 3H75A 1QPZA 3JWEA 4ZYUA 1OMOA 1QHEA 3VNBA 4V0QA 4Y98A 3M83A 4C7BA 4RA9A 2R66A 5DRYA 3EVAA 4K46A 2PLFA 6REQB 3H5AA 1YGYA 5LQNA 4RVOA 1QFSA 4MIEA 3TLKA 3PCTA 1RYBA 2BEVA 2GHRA 2BFBA 2DC1A 2RGYA 4B6QA 1J23A 2FJ0A 3K35A 3OD5A 1GNLA 2G63A 3AONB 3O95A 5IC6A 4D9JA 3TB4A 3W2TA 2XMPA 3LPCA 4G5RA 4MB6A 3M9LA 5TGZA 5DHRA 1MEJA 2XRYA 3MILA 4LCEA 2ZITA 4UJ5A 5CA0A 4A8JC 3FCCA 1KMNA 1LKZA 1TYCA 3ELUA 1HLPA 3LHSA 1G7CA 3EE6A 2YXBA 4A23A 2HO5A 3FZGA 4BZQA 4EENA 4EMUA 3OQBA 3DEHA 5JIBA 2Q46A 4XWAA 5KHLB 2DETA 1H8ED 4KXQA 2Z08A 5A5EA 1BU5A 1UFQA 1WMFA 1ZMXA 1UK7A 2Y05A 4X8OA 4XM1A 3ROTA 3WMXA 4KRXA 1S2IA 3PD0A 3ZX5A 1Z9BA 1XMIA 3HADA 2F1JA 1T2CA 2A3RA 2DR3A 1B16A 1Q0QA 3LP5A 4OLBA 4F9GA 5C8VA 2BTEA 5DV9A 5F51A 3SR4A 3X1WA 1U5AA 4PLVA 1TAGA 1I6WA 3KTAB 3ZWPA 1DAPA 3C6QA 2JD2A 4XA8A 3MMNA 3JYHA 4C06A 2WYUA 2WAOA 4DCOA 4Q47A 3LQ1A 3AVUA 3VR1A 4WZBE 5EP1A 2REBA 1C7RA 4YRAA 4C29A 1SXJC 3OQHA 5A4DA 5K0FA 5IK2D 4EL0A 3CVYA 5E2IA 5KYXA 1Z2DA 4OI0A 2QTTA 1E0JA 2WY2D 1ODLA 5ANRB 3FKSD 3UT5A 3W3AD 1JHVA 1Z08A 4P35A 1DG1G 1N6KA 2BGRA 13PKA 3FKJA 3NPMA 4S2EA 3T9DA 1XQVA 5KNDA 4YRLA 2WQ7A 3ET5A 1YBHA 3H1FA 2QTGA 4E31A 4BNTA 2EKZA 1QZZA 1CUJA 2WZCA 3LPDA 4TKZA 1EWKA 2LV8A 4J0FA 1RAAA 3LQRA 1QG6A 3WX0A 2RKOA 2VYVA 3KTDA 3I2IA 4G37A 2AJLI 1RQLA 1U9YA 5ISMA 1XPUA 4TV8A 2AQ8A 1G1MA 4P82A 1P3DA 1AQJA 4PINA 1Z5PA 4OHMA 2W4MA 1E1RD 1N4DA 1XZMA 4DBZA 5IVPA 4TS9A 1BN7A 3R75A 3TTSA 1QP7A 1DS6A 4M0PA 2C3OA 4B2YA 3Q3JB 2WW8A 5CLHA 1NDUA 3HXLA 2DR2A 2AOTB 1XMXA 3CCFA 4NYIQ 1VSTA 5BSFA 2JBWA 5F78A 5C18A 2GWRA 3KLNA 4J0GA 5EWJA 1C0LA 2B5VA 4PICA 3AFHA 2IFTA 3KYDB 3B6KA 3TAXA 1EVZA 3EMKA 3QVOA 3UICA 4Z4HA 1T1SA 4KXVA 3L1KA 4GZ6A 5IJAA 3ZTWA 4GECA 5JV5A 4KNVA 3DL0A 4M8IA 1FDRA 3EOBI 1L4NA 4N65A 3MLBA 3OZBA 5IF3A 5CR9A 3QUAA 4ZVRA 2EGUA 1QRUA 3RVDA 4N5NA 4TLBA 1AKEA 1H4VB 3RIXA 1DXHA 1NGSA 3BZBA 4OB6A 1GWNA 2BF4A 1SHUX 3I9V1 1COZA 1U0HC 5A02A 2M6KA 2J9GA 2NO6A 4WCDA 3O8BA 2VXYA 3P20A 4O4LA 3BAZA 5EKSA 1JSXA 2X0FA 4EATA 2MINA 1L5HA 3BGVA 1CUZA 1U7PA 2D3TA 3T99A 2O3JA 4DV1B 4JKIA 3CLSC 4AMGA 1QHIA 3AUUA 2IX3A 4G6ZA 1DE0A 5EVCA 3BZWA 5ITWA 2R86A 4PRLA 5LM3A 4BP8A 4EDHA 3WWDA 1CR4A 4HQRA 4R31A 3UJPA 2RBGA 4M9ZA 3I6BA 1G8KA 1ZD3A 5KKNB 3F5QA 4OFZA 3KD2A 1WXXA 1JFLA 4IVRA 1PVVA 3WSTA 1COWD 4MEJA 1ZUD1 3DO6A 1F0NA 1HT3A 2C96A 3AT1A 1H8HA 3P0IA 1B74A 3R74A 2J67A 3F7MA 2A1UA 4AG6A 1QHYA 4ESEA 4X1YB 2A1TS 3R6TA 1LNQA 3QNMA 1GGJA 3G3EA 2V9PA 1XKTA 2JFPA 1DELA 2JFQA 3I30X 4I5IA 1QH1B 4ZO4A 1WSDA 2ZE7A 3RAEC 4N12A 4HNRA 1EK1A 3NV9A 2FKNA 3KSMA 3OX1A 4JUAA 1PL7A 4S1PA 3UKDA 4V0MA 1Y37A 3K5IA 2QMOA 1G9SA 3SYNA 4ABTA 5KU7A 3TK1A 4MS4B 4BO7A 3VTFA 2PKWA 3UJ7A 2Y2UA 1DPFA 3B1JA 1S02A 2OHGA 3OM0A 1CRZA 1F4PA 3VC1A 1QC5A 4AIIA 1BH2A 3TR5A 1M6NA 2QZZA 2X86A 4JYAB 3MXTA 5JSFA 5ULLA 1P80A 3PQDA 1ZEMA 4BTLA 4FC6A 4R41A 1UQUA 1X7ZB 3ETNA 4OQQA 2VXBA 5L51A 3IALA 2VCEA 3O47A 1P19A 4LNUA 1XWWA 4GC9A 1UQTA 3WXBA 1E0KA 2WDPA 4E2YA 5JFGA 2H1VA 2CXQA 3P9NA 2I2BA 1NBHA 4IM7A 4KN5A 3BTOA 2R85A 3KJNA 4GW3A 4M4SA 4RZUA 1RACA 4UCQA 3AEUA 3EQ7A 3JAWA 3KQYA 4JU9A 4V0SA 4D9GA 1DOZA 2ILVA 5IYZA 5HFAA 4CKCA 1BMQA 1GQRA 3JTEA 2XAUA 5K0LA 5JASA 2QZSA 4OQ4A 1ZONA 2XQKA 5LA6A 5JY1A 4TYYA 4NK5A 5HJ2A 3L49A 1VMEA 1DKQA 3ZGVA 2G4LA 3IAHA 1GUAA 2WSYB 4CIBA 3KP1A 4TMYA 3HCDA 2X2PA 4B17A 2WJPA 1NULA 3FDIA 4JC0A 3BL5A 1Q1AA 1Q15A 3ORQA 3DZHA 5J5AA 4HNVA 3ZX4A 3M3PA 2NM0A 2GN0A 2R6HA 2ZSJA 3R0IA 5SZKB 3RUFA 3TYXA 4B7AA 4DCVA 4EW1A 2ZWOA 3QKRA 1JKJB 4WW0A 1T9KA 1PL0A 4MUNA 2H63A 1DKOA 3A6KA 2HRDA 3B1ZA 4E33A 3M2PA 5HHTA 4C20A 1V6CA 2FE1A 3AEQB 3EXIB 2FPGA 4DJ5X 4E5MA 1Q17A 4QUJA 4C9BA 4OMFG 2ZIFA 3D3JA 3EXEB 3QG1A 4CU5A 2OILA 3N86A 1N2IA 5EMHA 5KTSA 3R4VA 3AZPA 3LVBA 4LYDA 1X7XB 2HWKA 2D7CA 4QU0A 3UJ3X 3VR5H 4DDTA 2YY7A 1QVVA 3OCVA 5L6LB 3R9XB 3ROMA 1M9NA 2PH7A 2BN4A 4JH0A 4AJLA 1PT7A 2AKEA 1QANA 4YJFB 2RHWA 2A9QA 2PXAA 3QJGA 4XD7D 3D3QA 1Q7RA 3K8OE 1PGPA 2D5CA 4UHDA 5K8UA 1YZVA 2DWUA 5C34B 4WNCA 1GP2A 4V3BA 3L7OA 4BO2A 3UMFA 5BV1A 1YR3A 3ESBA 2R6CA 2XUFA 3IH5A 5GJVC 4UVDA 5H8WA 3B5IA 4ARSA 3TW8A 1Z22A 3LWZA 5G4KA 2Y9PB 4BC1A 3STXA 3TVTA 1EKXA 1U3FA 1U7WA 3SC3A 1XNJA 2QVYX 1EK0A 1H2YA 1RWKA 3MD0A 1RRVA 2IZ5A 4NP6A 2JCBA 1T0UA 3INTA 1IHPA 1YIAA 2Y4OA 4UNIA 1GQOA 3KYIB 4KTVE 5KYVA 1KKMA 5ALIA 2O4CA 1E79A 1S2DA 4PCUA 4WXPA 4RD6A 1RXSA 1FFHA 1C4OA 1TKCA 3LPMA 3R3JA 3E23A 5TT0A 1K98A 1AMUA 3U1VA 2NTEA 2QN9A 2QXTA 4QFDA 1XWIA 3VHXA 3NC0C 4D82A 5K8CA 1ZEJA 2FR1A 3FVTA 1DRUA 3NM5A 1Z36A 4C04A 1PW7A 2J0VA 4DQUA 2XE6A 3CNQS 3EPHA 2A7XA 5EFOA 3NHZA 2AD1A 1RNLA 2GD6A 3B6IA 5EP3A 2Z8XA 4KFTA 4OYLA 2LIVA 4N01A 1O7JA 3OUTA 4RDCA 4EY3A 4EI2A 1P9NA 1SC9A 4XPZA 3WDSA 2KLBA 4D6YA 1ZC4A 5CDUA 2O54A 1LSSA 1JAZA 3JQQA 4A03A 2HUNA 4DQKA 3IIJA 4F2WA 2OPHA 3HJRA 4GMXA 5F2OA 4DLYA 2QN3A 1Y6GA 2QN2A 1XJQA 4EG1A 1DTEA 2FZWA 2BMDA 4ISBA 4MGIR 3SSAA 1P2VA 3DQPA 3N2KA 3UTCA 3ZBTA 3EXEA 4MO9A 5J43A 3FGNA 1Z0AA 2YFKA 3FPBA 4D0SA 1C9NA 5ARBA 1SIOA 3LHKA 1LUAA 1U0SY 1IOWA 1ONNA 1T9ZA 2HCRA 3LUJA 2HJVA 3QKSB 4IRMA 5KOHA 2NP7A 3X2EA 1O03A 2IOFK 3A9VA 1QCDA 1SVLA 3E9CA 1CB7A 4AMUA 1OFHA 1TD1A 4WDRA 3M3HA 4RIEA 3TSCA 5DN6D 4G84A 2NVUB 3S2GA 4BV8A 1WW3A 4FDAA 8ADHA 2HIGA 5DOZA 2W2OA 2OWEA 4K87A 5DMHA 2Y1EA 5KYWB 5CXUA 4QBIA 4JFRA 4CKEB 3JZIA 2V0CA 4PLTA 2EKPA 1XJWA 4C0KA 4HX2A 1SOVA 3HU5A 4WY2A 4NK4A 2FHPA 1F1BA 3S2ZA 3SZGA 4AW9A 4JLAA 2X14A 4ALNA 2PVCA 3CEAA 1ECCA 1LI7A 3V5NA 3U61B 5DPMA 3LF2A 4IEFB 5F9MA 1EFPB 1VL6A 4X9XA 3L8YA 4RBNA 2DAPA 3JX9A 4IOJA 1J22A 2K87A 5L3QA 4D3XA 4OI4A 4YRSA 2VPXA 4TSKA 4G0ZA 4B81A 2JG3A 3OE7A 2Q0SA 4NDAA 2PXCA 1ODKA 1I2CA 4KBGA 2YHIA 1YCGA 4B9AA 5K03A 4A6EA 3EVNA 4O4IF 3UG6A 2FFBA 3GT0A 4QYSA 2PRZA 4WN3A 1MN6A 3G0IA 4GSLA 1NI4B 3F49S 5BOSB 4Z0TA 3C85A 4C0JA 1W1UA 1KC3A 4BU0A 4IDGA 4D9KA 1I14A 4U1RA 4XYMA 2X1MA 4G23A 5CVEA 4XM2A 4LOHA 2C77A 1SNYA 1PFQA 1RM0A 2F17A 3QLEA 3FDZB 3FDFA 3KJIA 5CUQA 2CF6A 3UC5A 5JAPA 4FK8A 1WZUA 2XD9A 4IF4A 4EX7A 3U60B 3EEIA 2C1EA 2QQ5A 4JMLA 3OIWA 5DSTA 1DJPA 1GCUA 2VTBB 3IQIX 3OA0A 4EUEA 3DUWA 3MS4A 2DEUA 4H0CA 1Q0SA 1DXYA 3JVIA 4EGJA 3OPNA 4PNPA 2F9MA 1H42A 1XRMA 2NPOA 3MS2A 4QICA 5HA5A 3CJRA 1X7GA 1X1QA 4M8NE 3GJZA 3GLKA 3OOYA 4EF6A 5JH7F 1CIJA 2QI9F 2ZIAA 2CL6X 3LWDA 4PPGA 3AKZA 4D98A 1W96A 3PXXA 3WGVA 3VU0A 4QQ8A 3HV2A 3D6JA 2GZHA 3THWB 2ZRAA 3V8VA 5HYVA 2WPNA 2HLPA 1WM1A 4I5GA 3VTKA 4MVYA 4DMHA 3ADOA 5IG2A 3K73O 2RFLA 3ZIUA 3HBAA 2HU7A 4BYMA 1F12A 1GZDA 1GUDA 3VC2A 1DUVG 1Z82A 4G01B 1EFAA 3R5FA 2NUAA 2D1QA 3AFNA 3O9MA 1ABBA 2J07A 3H05A 3W7BA 2XGMA 3QEJA 2DQ4A 3NAZA 1HNXB 3PHLA 2UUBB 1MUUA 4UARA 4X7RA 2IUFA 3BWBA 4DDKA 4EUNA 1FU8A 5J63A 2X5NA 2X76A 5D8DA 1C3OA 5HS4A 1Z45A 9MHTA 1VSBA 2O2YA 5K20A 4NOJA 3UAYA 3TF5A 3GLGB 4UJ3A 2OORA 2YW9A 1ZCJA 1H1DA 2QRJA 1XPJA 3CUVA 5CVVA 1IULA 2FPPB 1FF9A 2EBUA 4YRGA 2HSWA 1BFUA 1RVV1 2X3UA 4E1AA 1C2TA 1IN4A 3PDCA 3OU2A 2ZJBA 3QE3A 2OQIA 5IT4A 5M5BA 3R8XA 1DAGA 3H04A 3NC1C 4IWNA 3RRJA 4LF8B 1XXLA 3WGJA 1S1MA 1T9DA 5AXCA 3D2LA 3RHZA 5IKPA 2IW3A 4MROA 3V7UA 4TN5A 1CZKA 1MABB 4JLKA 2ONYA 2R8XA 1ANKA 4UOQA 3V4ZA 5ITZA 5LUBA 5DTIA 3FPCA 3BRCA 3LUFA 2IUTA 4KMRA 4OXXA 4DV4B 3C14C 2CKDA 2GCOB 3BL6A 3TQQA 1G7RA 3H9QA 1HX7A 2OZPA 3FCYA 3AHEA 1GZUA 1QWSA 4LXXA 4QPPA 2IXAA 5EHQA 3EGWA 4DXDA 3LO8A 4YQZA 4BNWA 5LMNB 5BN3A 1OFUA 3GMIA 2JBAA 1NN0A 5CT9A 3RSLA 1OROA 5JVDB 2FEOA 2M1XA 1USWA 1UZAA 2B20A 4F4HA 1MAUA 3I5AA 4HXEB 1D5WA 1XE3A 2RHBA 1P8AA 3HNRA 4J0HA 2ZUEA 1O57A 4TS3A 1CCWA 4O2RA 4WRRA 3RABA 1H3EA 3D6HA 1NM5C 1EVYA 1RE0A 3CU5A 3BHNA 1XKQA 3UYKA 2HMUA 1QKIA 3W2GA 1DCMA 4RVCA 1QDEA 1L3IA 1CKEA 1KP9A 1UDCA 2IH5A 2Q49A 1ZK0A 1NL3A 4CE6A 4HBGA 1M1NA 3B6EA 4O2LA 2BDUA 4GI7A 4HO1X 3JVDA 1JDBB 1ZAYA 4MV6A 5BV8A 5JRJA 2Z9BA 4I4LA 3BT7A 4O4JF 4WZ6A 5A4FS 4L1KA 1E2QA 4HRVA 2OO3A 1Z4QA 3BFXA 3R5XA 1RJ9B 4XD2A 2EARA 4H4DA 5K3FB 3LMKA 3ANYB 2OM6A 2H8GA 4G8CA 2BOVA 1L5SA 4C4AA 2OO5A 1GFIA 1KAOA 4TTSA 1I36A 4QBFA 4P92A 2PUVA 1NFQA 4IOLA 4L9WA 3TL6A 4EO7A 5CDYA 1E2PA 2WZQA 3LDFA 2I0FA 1OKKD 2J7KA 4RGQA 5KQRA 4N5DA 4UU1A 1RXUA 4HNSA 4D8VA 4UUQA 2JDIA 3V2HA 5AVZA 3ZE9A 3MT7A 1T4CB 4WY8A 2IYYA 3BFKA 3S29A 3VNSA 1DKLA 2BY4A 4AJIA 2VRBA 4ARUA 4BWFB 5G3ZA 1IEQA 1Y8AA 1JIVA 3ICOA 4GZ3A 2OUIA 5HIMA 3ID6C 2XTNA 4HN2A 4S1NA 4V1CI 3ZUGA 4DADA 2L82A 2BH9A 1PLJA 1RWNA 4WK2B 4NQZA 4O5OA 3RLFA 2X4LA 2NQTA 3S0JA 4P7GA 3ZLBA 5JY6A 1UP4A 4OHUA 2QTCA 1UMBB 4U6QA 1M2WA 3ZZTA 1VTKA 5C1OA 1V2GA 3A6FA 1IYZA 1XXHB 3QELA 4K26A 1B14A 2NSJA 1J8VA 3PIIA 1MA0A 3F71A 1P1FA 4L73A 4FMBB 3RC3A 3VR0A 4D99A 5IHXA 4KR0A 1XQ6A 5CTAA 4EKYA 1XTRA 4BJ6A 2WUEA 1GCOA 3QFFA 3VSEA 4J4TA 3HL4A 3PQEA 1BX1A 3N0TA 2CFRA 4L8VA 1FY2A 1V47A 3OCWA 3ETDA 3RRFA 3ROZA 3P4UA 5LNK6 1CQZA 1E3QA 4YBZA 3KKPA 2BCEA 4S24A 5ALVA 1EEXB 3OECA 5HUHA 1NXPA 2O8DA 4B71A 3CZ9A 4D43A 4LA4A 3OO1A 4R84A 5ALRA 4GZMA 2Z2KA 2H7VA 2PBFA 2P2LA 1A8HA 9LDTA 2C95A 5IC5A 1A8PA 3R9XA 3ESZA 1LH0A 4JFAA 4UTZA 2O0MA 3INYA 3NHFA 4NE9A 3RR2A 3S1LA 4BX2A 4TVOA 4O4IB 1OH5A 1KSHA 4II3A 4J7UA 4PHGA 2CUNA 2OUKA 1CS0B 5BR8B 2QDXA 5ITSA 5CLLA 4I66A 5T67A 3HDJA 4DBLC 5E6SB 1XDDA 3C3XA 5GZ1A 4QXOA 1U63A 1CYEA 1LSJA 1CRPA 2I6GA 4LXGA 2P35A 2FSUA 3CLUC 4K9RA 3B8HA 1LTQA 1MO3A 4G0MA 1Z5OA 4G2NA 5BW8A 1SU7A 1EDEA 3AR7A 3IUEA 3L6BA 4JUDX 2PT7A 4FCCA 3DHEA 5EMKA 4XUGB 4EPWA 2AFIA 4OY3A 4PANA 3L0PA 5EJMA 4EABA 4YHHB 4KXFB 4PGAA 5L95A 2O8BA 2VOJA 4TXHA 2HMSA 4S1OA 5COQA 3EPPA 3BB4A 4H6XA 5JECA 4ZTZB 1L8OA 4W8GA 3ZWXA 3PPWA 1XRSB 4D79A 1YU6A 4AL4A 4C0LA 3CB2A 1X9IA 621PA 1TA0A 2GBLA 4Z7JA 3FVWA 5D7NA 3IBYA 1T1GA 3P9RA 5K8TA 2HWYA 3UXYA 4GD3Q 4M1WA 3OX3A 4TUYB 1Z83A 3E35A 1DMSA 1A5ZA 3KYCB 1F6DA 4OQNA 1FXSA 3IRVA 1R0BA 2D1YA 2HU8A 2Y1CA 3II6X 5KYTA 3GRZA 3VU3A 1E3MA 1E4OA 2QX8A 1KY3A 2EEZA 1TA4A 4C6TA 1E5QA 2E4UA 3N3BC 3BJZA 1H2HA 3OEHA 2HJSA 2E0IA 3OU7A 1E9EA 2AJTA 4KMOA 4OMUA 4PS0A 5IP5A 4C1NA 3VDRA 3D81A 4JJEA 2B8WA 4NONA 2DR0A 1K8YB 1TEXA 1OPXA 1JIXA 1UBJS 1ZH4A 3DZJA 4G65A 5B37A 5KU1A 4I8DA 5TPWA 4D6XA 2P3OA 4BPRA 2Q0XA 1N5DA 1J5EB 3MUOA 4AZ0B 4HLDA 2YIVX 5F2KA 3I2YX 4HDRA 4KI7A 1RYDA 3M3DA 2QG6A 2QP3A 3HFJA 3JYLA 4OPMA 1LC0A 2VDWB 2YZKA 3PJDA 1A9TA 2ECKA 4PGHA 3PHBE 1R6UA 4RH3A 4Y0AA 1T4DA 2ODWA 4Q3CA 3RJ9A 2VBCA 3OTHA 4D80A 1CUAA 1VECA 3T5GA 4M55A 3BSYA 4IIJF 3JAKB 1PU2A 4LRXA 3W0LB 2FDRA 1ESMA 1YUBA 3PDIA 4O2BA 2I78A 4BFYA 3GA0A 4G4JA 1V1MA 3F6RA 4Q6WA 4Q9NA 3KB8A 3WYFA 4BVAA 2P5UA 2UDPA 4CM3A 5JXHA 1CSEE 4H60A 1D1SA 3LCRA 3TD2A 4ES6A 1WBDA 2XNCA 2IE8A 2XUIA 5FLKA 3FBTA 3JXEA 2YZ2A 4XGRA 1T26A 4ZCRA 3NOXA 3LDAA 5JAQA 1UBEA 3FD8A 3IP8A 2KM1A 1K88A 1O4WA 1Z18A 1NF2A 1NP7A 3KK0A 5B64A 1IUPA 3AVVA 3TSYA 3WK7A 1P75A 1OE0A 3L7KA 3ASUA 3WYGA 1FP1D 1Z7EA 2RC5A 3KHKA 4IIHA 1KZ4A 2P9JA 4UBOA 3TCXB 4BVJA 3BRWA 4EEKA 4M0MA 4JI2B 2C42A 2JIZA 3M5PA 2O8CB 2XSZD 3U4AA 3VM6A 5DW3A 3WYDA 2PUDA 2IXBA 4UXIA 4P32A 5JZOA 1FSGA 5JJCA 1QGYA 3LK6A 3E22B 3VX4A 3O8RA 2YQ4A 5DBOA 4X62B 2DQYA 4NCKA 3A8TA 1DJMA 1HDOA 3DZBA 1C3LA 5KZMB 1TM5E 2LDBA 1GILA 1QQ5A 3ZGNA 1NW5A 3GFQA 2C5AA 1FSSA 4Q37A 4CL3A 3HKEB 1PV2A 2NZ8A 1JEDA 4L6CA 1EUZA 3KEFA 1EIWA 3EDOA 1WNFA 2Q3EA 1U8EA 3IQDB 3PS9A 2HHCA 2A33A 3NBMA 2B8TA 4N0EA 1E1QD 1RLOA 2GB4A 2ESRA 3BE8A 3DEAA 3KUUA 3NBQA 2I2CA 4LYHA 1P74A 2JVIA 1D3AA 2XMQA 4Y2HA 1E7QA 1TNDA 4AJHA 3IAFA 1GPKA 1Y9AA 2QL5A 2VH5R 4PIPA 3LIIA 1ZHFA 2MJLA 1ZI8A 2WABA 2GEJA 7ABPA 2XNJA 4DR3B 4M0DA 1AF7A 1F9AA 3GGSA 4HDMB 2X1HA 6YASA 2WG0A 1BKDR 1TIKA 3BK2A 2F8TA 3ZDRA 3NVAA 4ZAXA 1XR3A 2Y0DA 2ACEA 3D5TA 5FI5A 1H3NA 3DCYA 3UA3A 4GYJA 1IBCA 3U6BA 5LOVA 3OKFA 4GI3A 3U0BA 3WIDA 1WABA 1FE8A 3N2GA 3FI0A 4ILKA 4WZZA 1X86B 4F4JA 1JJIA 3G5UA 1ZUIA 2ZRPA 3MN1A 1R8YA 2HL6A 1R18A 4GSYA 2ZZNA 1SM4A 4JCCA 4Q4HA 5JQGF 3BGWA 1E63A 2W0SA 3DYBA 3UH0A 1VRVA 5B6IA 3WL3A 1UWLA 3P45A 2VP4A 3USZA 5EWMA 4D02A 2JAHA 3CVWA 1MO2A 2E85A 2MSDB 2BSQA 3AG6A 4H4CA 4HXYA 1ZXXA 4MW9A 5T4HA 1A69A 4TV8F 1SUFA 3BFPA 4I6GA 5ITVA 1R12A 1ETHA 3T8YA 3EY9A 3I64A 4RHFA 4CQMB 1I2ZA 1UKCA 2QL9A 3H6HA 1KEPA 3PQ8A 4PX3A 2DF8A 2VJAA 4WK4B 5K45A 4CXMA 4HGYA 1LVHA 1N1DA 2IWRA 3H7AA 2ZRIA 4AY2A 1XNQB 2VNHA 2BDTA 5EXSA 4M8SA 3TOSA 2AMYA 4YONB 5E4FA 3R24A 2Q6IA 3BVPA 3H1EA 3K0KA 4JZKA 4KN9S 1XX6A 1R74A 4W7HA 4E14A 4PEVA 3WYBA 2OHHA 4YV7A 3E27A 2WKSA 4MVJE 4X3PA 4YJ2B 1RZVA 1OI7A 2FZLA 2JI9A 2AIRA 3B3GA 4MQEA 3BN3A 4ARCA 5J2UB 2K6GA 2NU7A 3Q3VA 4OJKA 4PLCA 3IUSA 5DCWA 3SJAA 1ZK1A 3JCZA 4FONA 3ECAA 4CODB 4HF7A 1L5GB 2DOKA 4PM4A 5ESXA 4YYZA 4DANA 1EA5A 4J16C 4TLDA 3KWJA 3V8MA 1Q44A 3L82B 1LBTA 5KSWB 1FQWA 2L0XA 3SYKA 521PA 1FZQA 2D4AA 1SRQA 1X77A 2B4RO 2X58A 3E81A 3FNFA 3I37X 3QKWA 4LXUA 1FEZA 3ZDAA 1UJBA 4I4NA 4KRGA 4RKWA 4V3CA 1M1ZA 2Z5VA 1U5BA 2QRQA 2ZWPA 4O4LF 2CHGA 4GGOA 3TM5A 4NFHA 4CIXA 2FE4A 4J7XA 3DTVB 4UPEA 5ICSA 5F7JA 3GLQA 4NNPA 4EDFA 2UXCB 4QRHA 5HXAA 1KY4A 3LWNA 2XUJA 1JG7A 2A2ZA 4QDOA 3DPIA 1POXA 2OZEA 3W8FA 4D5GA 3CO5A 2Q9BA 3SKXA 1VB3A 1QS0A 1VIDA 1XOIA 2C5LA 1EE2A 4G9BA 5FQNA 3REOA 5BXQC 1SVOA 4UMDA 5CXSA 1I3MA 1MX1A 5BSUA 5JC8A 5JPDA 1U1EA 4RGYA 2AOWA 5D6OA 3T94A 2X0IA 4ZZ0A 3D31A 4OGLA 2DHEA 3TZCA 5CEFA 1E9CA 1WXGA 1PFUA 2JCVA 3V32A 1GNQA 2PJRA 1UCFA 5BN1A 3CB4A 2FEXA 4F4IA 5GWXA 4HNAA 1Q7GA 3ZG6A 1Y1KE 3K2EA 1SBTA 3TJRA 5B7GA 2OZVA 1XD8A 1RCUA 1MOQA 4TQGA 3K1JA 4PFSA 3CVXA 1HOTA 5AKEA 1RXIA 3PI7A 2V5AA 2L2QA 4X1IA 1PG2A 2FAXA 4WKGA 2NU8A 3ICEA 4PTZA 2D3WA 1M6WA 3BH0A 3WRXC 1HKHA 3GPIA 4PN3A 1K1EA 4ASUD 3GZJA 4X91A 1AGRA 3L8MA 1T4CA 1NWCA 4NMHA 1U0GA 4JGGA 3DTVD 4MYUA 1ZISA 2PSFA 1JXAA 4PFKA 3D5EA 1V5EA 4R69A 1I6MA 4DWWA 4F3NA 1EP1B 2Q5QA 1TAHA 3GRKA 1DAOA 2QMQA 3KB2A 1PQ4A 1A4XA 4BPBA 3DT6A 5BQOA 2X8WA 3H5NA 3FFWA 4R98A 1ZVVA 3LVFO 1QFMA 3U1TA 2XDYA 1L4FA 2BGUA 1ACLA 3HO1A 2HK6A 3AFOA 4MQMA 2B8EA 3I6ZA 1G5TA 4Y1RA 2I54A 3F3YA 1NMSA 2Z6QA 2A67A 4MMZB 1NVVQ 3L07A 5M3BA 5EP2A 4C43A 1MXFA 2RDMA 3IKVA 1A95A 4XGKA 1DDIA 2BSXA 3STHA 4CT4B 4ICIA 4QJ3A 3KQKA 1GZVA 1WY5A 4YUZA 1ZH6A 2I6TA 5AW2A 3GAAA 5HP4A 4X94A 5C8YA 4V0NA 1OV4A 2WA2A