3V0EA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 256-576(c363s)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
320
structure length
320
Chain Sequence
MRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 102
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0eA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0eA01
5BUGA 1XM2A 2P6XA 4QBWA 4JBCA 5KACA 4GRZA 1G1FA 2CNHA 1ECVA 3QCDA 2CM3A 2F6ZA 1FPRA 1M3GA 3RO1A 5K9VA 5KA2A 2CMAA 2B07A 1G4WR 4QUNA 4ZN5A 2FHFA 5KA3A 2I4GA 1OEMX 1WRMA 2J17A 5KADA 2VEWA 4OHHA 2H4KA 3GXGA 2VEVA 2B3OA 2AZRA 2I6JA 4TVVA 2CM8A 2F46A 3D44A 5KA4A 4GE2A 1PTVA 4RH9A 3B7OA 2BV5A 3F41A 4JMKA 1SUGA 2NT2A 4DGXA 2QCTA 1YPTA 2BGDA 1LYVA 2HB1A 4KYRA 1U26A 2GWOA 2PQ5A 3I80A 1U25A 4H34A 2J72A 2NT7A 5K24A 3CWEA 5KA1A 4WOHA 2H02A 2QBQA 4RI4A 3O5XA 3QCEA 4HRFA 2CJZA 5EHPA 4ZRTA 3F9AA 1OEOX 3EB1A 4KI9A 1QXKA 3LJ8A 1PTUA 2G6ZA 2B4OA 2J16A 3ZMQA 3EAXA 3ZM2A 5K23A 1PA1A 3BRHA 1PH0A 5IBMA 1GWZA 5EHRA 3QCGA 4GE5A 2CNEA 3MMJA 5K25A 2B4SA 3ZV2A 2QBPA 3BLTA 2C46A 2CM2A 4OHLA 1A5YA 2JJDA 2QBRA 3V0IA 2I75A 2HC2A 3I36A 4JNBA 4ERCA 1U24A 4J51A 1WAXA 1T48A 1Q6PA 2H03A 2H04A 3QKPA 3ZM3A 2Y2FA 1C86A 1YTNA 4YR8B 2P4DA 3A5KA 2M3VA 1L8GA 2Y96A 4HJPA 1C88A 3OLRA 1R6HA 1YGUA 1G1HA 1ZC0A 2NV5A 2R0BA 2CM7A 4PYHA 2F6VA 4B04A 1V3AA 4GWFA 4ZI4A 1I9SA 3O4TA 1BZHA 3A5JA 2GP0A 2I6MA 4QUMA 1RXDA 3RGOA 2J73A 5KA7A 2I6OA 2CFVA 2NTAA 3OMHA 3PS5A 3AWGA 4WU2A 3MOWA 2CMCA 3O3LA 1OHDA 1KAVA 2HY3A 5BX1A 2B4UA 2PT0A 2F6WA 2VEYA 2F6TA 1NNYA 5AWXA 2J16B 1QZ0A 4NYHA 5BZZA 1T49A 4NWGA 3D9CA 1C83A 5GTJA 2A3KA 3V0HA 4KYQA 3RGQA 1LQFA 2G59A 1BZJA 5KAAA 2YDUA 2H4VA 2FHBA 2I4HA 2ZMMA 3S3FA 2C7SA 4IKCA 4R0SA 3QKQA 1YN9A 3ZM1A 3V0JA 1Q6TA 2I4EA 1ZCLA 2I5XA 2BZLA 2WGPA 2ZN7A 1G1GA 1WCHA 3V0GA 1EENA 5BZXA 4RI5A 2F6FA 1OEUA 2PBNA 4RKKA 4QAHA 1D5RA 3RZ2A 4AZ1A 2AHSA 3D42A 3QCHA 1RPMA 2VEUA 2I6PA 2IMGA 1AAXA 4Y14A 1PTTA 1ZZWA 2J43A 1XXPA 2Q47A 1PXHA 4RH5A 3S3HA 2F6YA 2PA5A 2BIJA 4S0GA 4D3PA 2OZ5A 2SHPA 1G4US 1YFOA 2QBSA 1YWFA 2HC1A 3ZMPA 3S4EA 4GFUA 3EMUA 2RF6A 1YZ4A 5KA8A 1FPZA 2FJNA 1ONZA 4OHDA 2PSZA 2I6IA 3O4SA 5I6VA 1PYNA 3EZZA 1P15A 3H2XA 1OHCA 2QDMA 1I9TA 2NZ6A 2DXPA 1C85A 3QCIA 1OETA 1Q6NA 5J8RA 1YGRA 4BJOA 2J44A 2CMBA 4RDDA 3O4UA 1BZCA 4MBBA 1ZCKA 4R30A 3V0FA 3MOZA 2QDPA 5KA0A 5LXQB 3F9BA 2QCJA 3QCKA 2GJTA 3QCLA 4BPCA 5K22A 1XBOA 2BGEA 1NZ7A 4PVGA 2PI7A 4Y2EA 4GS0A 1JF7A 1VHRA 3M4UA 4I8NA 3QCCA 4D3RA 1LARA 2I1YA 2B4PA 1YTSA 2QEPA 1NO6A 3BLUA 1XXVA 3V0DA 3QCBA 1MKPA 4JMJA 1ONYA 4GE6A 1NWEA 1G7FA 1Q6JA 1EEOA 1JLNA 3V0EA 2CNIA 3CM3A 3EU0A 5K9WA 1G7GA 1XRIA 3AWEA 3QCJA 1NWLA 4DGPA 2A8BA 3D1QA 5HDEA 4HJQA 1T4JA 2I3RA 2ESBA 3F99A 4GFVA 4NNDA 4WTYA 3AWFA 4D3QA 4QBEA 3S3EA 3D1OA 1GFYA 1FQ1A 1L8KA 3D1HA 5M43A 4RHGA 2HXPA 4OHIA 4OHEA 5IBSA 1OHEA 1PTYA 1YTWA 1NL9A 2YOCA 1C87A 3NMEA 3ZM0A 4NX8A 2HNQA 3I7ZA 4R0TA 2MBCA 3GXHA 4WU3A 2H4GA 2F70A 1OEVA 1Q1MA 3SR9A 3U96A 2CNGA 4NWFA 2YA1A 2Q05A 4H1OA 4YAAA 2F71A 4GRYA 1X24A 1C84A 2FJMA 2E0TA 2CNFA 2FHCA 3N0AA 2FH7A 2HNPA 3QCMA 2I3UA 1I57A 3QCFA 1PA9A 2OC3A 3S4OA 2OOQA 3F81A 2NLKA 5MMZB 3QCNA 2HVLA 1Q6SA 3BM8A 4QAPA 1Q6MA 5KA9A 2I42A 4ICZA 2B49A 2HCMA 3SMEA 2VEXA 2OUDA 5KABA 2QDCA 3S3KA 4Z6BA 1OESA 1KAKA 1J4XA 2J71A
chains in the Genus database with same CATH superfamily
1WFNA 1SM3L 1XVSA 4JFYB 1YN6A 2W95A 3JYBA 5C3IA 5D1XE 1SEBB 4GP4B 3VRIA 1ZWIB 3MR9B 1OTTD 4NRZA 4X9HA 4GI6A 1CVSC 1KJ3H 4LP4A 1K8DA 1RZGB 3FB8B 3DTXA 4QHNB 2E8ZA 5FWRA 3GSXB 4LOFA 4MD5B 1NCJA 2K7QA 3LN5B 4MMZB 4LBEA 2C7UA 4BA0A 4PWJA 4Y4KD 2OL3A 4D9QD 2DBJA 4AL8H 2C34A 4WU5A 5KADA 1BQHA 3AB0B 1P4LB 1YA5A 4GAYA 1AS6A 2M83A 4PRHA 4YDNA 2RGSA 2WCSA 4A38A 3KH3A 3VW3L 2H8PA 3RBSA 4X4ME 4JJ5A 3KWWB 2C4FU 2AK1L 4B9CA 4PJ6A 3VTMA 3ZDWA 2OL3H 3FCSB 1E27B 1SUGA 4YHNA 5KYXA 4PW9A 3KL3A 2BHUA 3AROA 4KQ4L 2BGDA 1O6TA 3G5YB 3O3EB 4UDTB 2NX5E 3WE1A 3JZ7A 1U26A 3CFMA 1VFUA 4JHUA 2COQA 2NRDA 3MBEB 5IW6A 4NM4L 5DRXB 1FJ1B 1WV7T 1O6SA 5FOJA 3OF6A 2DWXA 3FO9A 3GSWB 4OBSA 3I9IA 5DJ8A 5IVXF 2X6BA 1A7BA 5JXED 5JPMC 1U9KA 4JO2H 1URLA 2V8MA 4XT1C 3SCMA 1F13A 3O45A 1YEJL 1BX2A 3F7VA 4XMLH 3VFUB 1BFVL 3MRJB 3X3FL 2QBQA 3GRWA 5F7EL 3PGFL 1AG0A 4MA3B 3PGDB 4YX2H 1BZDA 1I1YB 2L0DA 5DZ9A 1A1NB 1GZPB 2WXLA 2CRYA 3ZYOA 2G2RB 4JKNA 1TZIA 5LNDA 1TZGL 2XX1A 3C60C 3GRWH 2YAFA 3CPLA 4GS7B 2PF6A 4ZMAT 4CJ0A 1N67A 2XG5B 2ATPB 2BIPA 2X6CA 3MTXA 5AZUA 2JH2A 4ZFQA 1GYAA 4LLMA 1WG3A 3PFQA 2GJZB 4N8VA 5HYJA 1KYOK 4G7RB 1CDIA 4HISA 1S7RA 2ETWA 5JQIB 1EJ8A 1FFPB 1H6UA 3LZRA 1F4XL 3ZDXB 5KAQG 3F85A 1JUFB 3WFDH 4F9LA 5BS0B 1W80A 1CCZA 1KELL 4WJKB 4YZFE 5ID1B 1KFGA 3EGXA 1AD9A 3B7TA 4F2MA 1MAMH 3C8HA 2EDDA 3LH8A 1PJWA 2I75A 4AQOA 5GGTA 3FQXB 3GJEA 3EXJA 2EDXA 1XZ0B 3IDJB 2VABA 4G83A 3GXFA 4I77H 4YDJB 3IDXH 1SHSA 1G7JA 4H1LA 3PHSA 3C9NA 2A2QT 3T3PE 5IEHA 1EEHA 1KB5A 5IB1B 1K4CB 5EA0L 4EO5A 1PQZB 4KJWD 2YKKA 4AGQA 5B21A 4HJPA 5I17A 3HC4L 3F65A 2BIQA 1ZOXA 1E4KA 5DC4B 5EC1B 2OCCB 5IBLC 1NIAA 4MSWA 4HLEA 4PRIA 1MVUA 4PRAA 1NCWH 3HUJB 4KQ3H 1XBDA 3FH5A 1KB5H 2GI0A 1OHQA 5INDA 4B04A 2YMXL 4S0TD 3QPKA 3DXAD 3IPEA 5TGBA 4B9ZA 1GJWA 1HL8A 1JZGA 2P9RA 2B1OA 4NKMB 4I1NB 3O4TA 2JKIS 4QHKJ 1DN2A 4KI5F 4M6NH 4BUCA 2P48B 2Y7SA 5ISZD 3FUJA 4YHYB 4Y7MA 1ZAGA 2HZHA 1RK1A 5EUOA 1NEZB 3FYIB 5DHXB 1S5IH 1Q1PA 4KXBA 3WTWA 3ZTNH 4YDLB 1UT1A 2WZ5A 3H9ZA 4FP8H 1S3KL 1IBGH 2Z7YA 1IKNA 1NUFA 2LABA 4GPVA 5H35B 2VMCA 4XTRC 3TBSA 1D6VH 1S7XA 4NENA 3K2MC 2Z31D 4U1JA 4HXBL 3WJJC 4HP5A 2AK4B 1Z7JA 3D25B 3LIUA 1AGEA 3QNXB 4HKBB 2VEYA 3BLPX 3CDYA 3QSKB 4J4PA 3FU7B 4Z0BH 4NQCA 2VN6A 4FQLH 2VC2H 2BRRL 2J4WL 5DURB 4NWGA 1IBFA 2Q8BH 5SWSD 1U8OB 3AXHA 5F0LB 4ODBD 4PJ7E 2R8SL 5I1HL 5I74B 3TONA 2ZOKA 3DBXB 5KAAA 3DIFA 4X4YB 3M1CA 2YPVA 5FO9B 4OR1A 3OMZA 4LIQL 3KEHA 3TYGL 4ZXBB 3I75B 4PVBA 4X0KA 2R27A 4CVZB 3SPHA 3CBKB 3CFUA 2CLVB 4LARH 1KMGA 4LCYA 4LCWE 3ZIYA 4IU2A 2DWDB 1N68A 3PDGA 1JZ4A 1OANA 3TVMA 1KTLA 2ZN7A 1CD1A 3EYOA 2XY1A 2YPVH 2CA3A 2VR5A 1JNNH 4ICWA 5F3FA 3U9UA 4OZFB 5TDOA 1IBYA 3K6OA 4JFVA 1QSFB 1CTMA 3SPIA 3H3PH 1XCQA 3FTYA 1EZLA 3BIKB 2ZXAA 1CS6A 4MAYD 4QAHA 2FWSA 3QZOA 2FJSA 4BZ1L 4C4KT 3N2AA 1OAYL 4HFWB 1NDGA 4Z95L 2CKBH 3JTBA 2IMGA 4WTXA 1NZRA 1UKQA 4HIXH 4KNQA 4TNEA 5EU3B 4WGVB 2BW5A 4J3OG 4G6KL 3FB5B 4ZW6A 4LXFA 5F8QC 43C9A 1GGYA 2K6WA 1P84J 5DR5H 4KTEL 4OFPA 1VADB 2BIJA 5TQ2L 2R29L 2XIDA 3EFFA 2VERA 2VOSA 3DHMA 4R2GD 2YXFA 2V33A 2ZWNA 4KNUA 4HPYH 4PGDB 5SV3A 3CU7A 1HXMA 1LO5A 1IBZA 2EE6A 1N70A 3T4AA 3U2SB 35C8L 1OCOB 5GJTL 1NEZG 3EUDA 3HPJA 2OCJA 3N44B 3DHPA 3QAZC 4ZO8A 3ARTA 3F58H 4AQ1A 2Z91B 2C7UB 5KA8A 2MOGA 2W59A 2BS71 1PG7X 4GRLC 5ICYA 4WU5B 1UCBH 1BQHB 2V3FA 2PSZA 1PYNA 1A9BB 3DV6A 1BMZA 3EZZA 4QYAA 4P2QA 2IC2A 1QSVA 2H8PB 4G6JH 1NQBA 4JJ5B 4PAZA 1QRND 4YUEL 5AVZB 1OB1A 5IVXE 1C85A 3GJFB 4AW4A 1F6FB 4UT9L 4JFFA 4LOUD 5AZEH 4R4FH 4ZW7A 2E74C 4ZAKC 4UINH 1Q6NA 1GIGH 2H0PA 3GI9L 4JFXA 2L4OA 4YHNB 5D7IE 5KYXB 2BWQA 1P1ZA 3F64A 3OZ9H 1ILSA 4HUNB 1MPAH 2PABA 3T6VA 1BVOA 1EXHA 4XP1H 5EU5A 3DX9A 5AW1B 3U1SH 3DBSA 3LZFL 2IQ9H 4Q9QH 4R3SB 3GKWH 2KLTA 3HCVB 3PWJA 3V0FA 4D0BA 3DO4A 4LCUB 4XNQA 5HDOA 1O6SB 4AKPA 2GC5A 5KA0A 5DJ8B 3GFUA 3CVBA 4URKA 4HFUH 3L3JA 4B97A 1NBVL 3MLUL 4WFHD 3SCMB 2DD8L 4WI4A 4KKZA 1BX2B 1EXGA 4TVSa 4OZFG 4E9LA 1L7TH 4JCLA 5C7ZA 4EI6A 3ZYZA 3FU0A 4WFGD 5JIMA 4W9IC 4P5TD 3ZDZE 3V7AE 1G7LA 5ILTL 1FVDA 3EGDA 4OZHA 1UWXK 2UWEF 5FKPB 2BVOB 4YSSA 5E1IA 1HNYA 4AKQA 2N4IA 2OI9C 3IT8D 3ZTEA 1M42A 1QSEA 1T5WA 3TFKC 2BDNL 2Y6SC 3CPLB 2NXZD 4XNZC 3L5WB 1TETH 1A0QL 1BZ7B 4N9GB 3V0DA 3VFGH 5AB9A 5IM7A 1T89A 2AM1A 1YZZA 5KAQF 1P6WA 5IFJA 2VM9A 1L9RA 4LLMB 4X6CB 5AOLA 1RMFL 3NN8B 1T1XA 2OJZH 1HHJA 2EIMB 1G1OA 3GTVA 3MRNA 4GAGL 4JRLA 4N8VB 2F08A 5HYJB 4W9HC 4OUOA 3F7KA 4JPWH 4K73A 2XZAH 1S7RB 4AZUA 2JFHA 4J23A 4TRPH 1J5DA 3PWLA 1QUPA 3WXWH 4X6BB 3STBA 1U8JA 3GZPA 3MLRL 3ZZSA 2FQEA 4AVIA 4F2MB 2X1XR 1IAIM 1WD9A 5ECGA 2IWEA 2WWOA 4BRJA 5J11C 2XPZA 3R0MA 5L2KE 3EZ8A 5FPIA 2VABB 2HTKC 2PYFA 2W38A 4BKTC 5K69A 2NY4C 1NBQA 4ONHB 3TA3C 1IFHH 3PV7A 4H1LB 4I18A 4Y1AA 2JKTM 3C9NB 3SE4C 4C4KO 4AE0A 2ZONA 4ODTH 3P3UA 3SDYH 1IB5A 5EB9A 4OJYA 5I17B 2KLRA 2WLYA 4FFZA 3GBDA 1I3VA 3MRFA 2Q7YA 4KKAC 3CAFA 1MVUB 1NCAH 1G87A 1R5IA 1HYSD 3O9WA 5E99L 1MWAA 4WHYH 2HX9A 3D09A 3ASNB 1M56B 5INDB 3O6FB 4W4OC 3L2NA 2KT6A 1F3JA 1P6FA 2FJHA 3DX0A 4FFZH 4OZ4B 4PJXB 3ZRCC 4HWNA 3WAJA 4OCSL 4OFVA 3V4VA 5I23A 3W9DB 3KJ6L 1QASA 4UM9D 3MUZ1 5HGHA 1MWAH 4IRSD 2IDSA 4UV4L 1UKSA 2DKUA 4TUKL 3CHPA 5HTSA 3TCLA 1XGUB 4DK3A 5EDXA 1R9FA 3MXWH 1OEZW 1RK1B 4BD4A 4JM4H 3MSPA 2Y1VA 3APFA 1J12A 4GRYA 2O5ZH 5FWQA 3U7WH 3W3BA 1ERNA 1FH5L 4JQIL 3SDCB 2IDCA 3MRPB 3H4HA 1GZQA 4OLXL 3EYQD 4Q6YA 4IJ3B 1FZOA 1DE4B 1JGLL 5D1XA 3ZE2F 3UTPE 2ATAA 3EO1B 4B6ZA 2VQ1A 4I3SL 5D1ZB 5DD6B 5K9QG 2ZXBA 1RIVL 2X09A 5DEZA 4YEEA 3PHOA 3UO1L 4R83A 1PLCA 3K91A 3X17A 4KTYA 3NIGB 4BWTA 4XXDB 5C0GB 4NQCB 2XACC 1RZ7L 4KAQL 1EAJA 5JDJA 3LJ3A 2CKNA 3FUIA 3A23A 1UUNA 3B9KA 3DDFA 4U4IA 1CD8A 1H9VA 1BAGA 1OSYA 2Q9OA 5F6HJ 3BKMH 4HW6A 4JPIB 4N8VG 2DPKA 4AVKA 3M86A 4JFEE 5DHDA 3DIFB 2F2HA 2I42A 1UB6A 5JHLL 2EYSA 2EO9A 2WXJA 3N40F 3X13A 1KCWA 4Z7WB 5E6IC 4X4MA 1D5MA 2R2EB 4N0UE 2VJ8A 3AJ7A 3MLZL 2HFGL 3SB3A 4LCYB 4BXSV 5L9DL 5I1KH 4IU2B 5KACA 4PP1C 1THCA 1KTLB 1K2DA 4DVRH 1MCQA 1YYMH 4P2OA 4E5XA 2R39A 3PWPB 1CT8A 4GRZA 4Y19A 1XCQB 3MNVB 5GGVH 3G5XA 2NX5A 4Y5XB 1XD0A 2F68X 3A6BH 5IG7A 2Y7MA 3KPRB 2BIIA 2D0GA 4LLQA 1JPST 1JZDC 1NDGB 1CYGA 3VI4F 9CGTA 1L4IA 4A2GA 2GFBA 3IBOA 2VITA 5HI3D 1KZQA 2FHFA 5CN1A 1KJ3L 3C6LD 1FSKB 4BSVB 3HNVL 3QWNA 3VFNB 3TNNB 43C9B 4HK3J 1FNEB 4GRWE 5A3IC 1YAZA 1RUKH 4BDVA 2CM8A 1XBRA 1TCRA 1ANUA 4AL8L 5KA4A 3ARED 3UTQB 3O6LL 3VRLF 1PYWB 4WGKA 1CE1H 3EHBC 1HXMB 1WK0A 2IVFC 4HAFA 4K7FB 3IU3B 4TNWK 3TL5A 2O72A 2QPUA 3T4AB 2R15A 3PAUA 1IM3D 3CHQA 4QXVA 3AW5A 5CBEA 3WEOA 1UOKA 3QHFL 1JXKA 3FRPB 3MLYL 1CXHA 4NQDD 3LY6A 3V4UL 3EUUA 2YLKA 3L3GA 4FQPA 2CU9A 1XGPB 5FM4A 4F8LA 1IAOB 5ICYB 5ENWA 3TP4A 4ZSOB 3DV6B 1OTUC 4WWID 4DUXA 1NCDH 2NT7A 1OB1B 4DAGH 3V0VA 4RA0C 2YD1A 5DFWH 4PJ9A 1I1AA 3RVUC 4CU7A 5I1CH 1KGWA 3OKLA 3SY6A 4JFXB 4PJEB 3PGCA 1IGFL 4BQ9A 1BFSA 4PLJD 4JO2L 4PRBB 3B34A 3IEAA 3O11A 3KXFE 3DX9B 4HIPA 3GMQA 1WT5C 1OCCB 2WQ8A 2EKSA 4J8RB 4XMLL 5CEXB 5T5NG 3KBFA 4PWEA 3GBML 4LASH 3DETD 3VXMD 4BWUA 4ZQTA 5DJCB 4W4NA 3ARYA 4XNQB 5CJBA 2VLLA 1AHWB 1FZJA 3ZE0B 1W7KA 1OAZH 5MEPB 3I9AA 2NR6D 1LILA 4HCRL 4ZFOL 4OLZH 1PZDA 1C12A 3GRWL 1FG2A 4QO1A 2B4SA 4U7MA 5LKNA 2QBPA 1HH9B 4XCCH 3S35X 1YPZF 3WUWB 4OFKA 2D0FA 4NUQA 2DJ4A 4OZHB 1E6OH 4GW4A 1SXCA 3ATBA 4OZGF 3DPBA 3Q2LA 2CJTA 2EECA 3F7PC 4NBYB 1TEYA 1QSEB 3L81A 1RZ8A 1LJMA 1PLAA 2XWTB 3OGCB 1O7DC 3GMPA 5MENE 2F7IA 1HVXA 1BECA 2VDKH 5T1MA 2DIBA 2BSCA 4X2UA 1MAML 2P4DA 2V5TA 4AYFA 5IFJB 3DX7A 3MNDA 3IM1A 1T1XB 3KR3H 1HHJB 3MRNB 1IJNA 4N6RA 1RIUL 4JX0A 4JDZA 3UBFA 2BXYA 3VXRE 5A2KH 5ITBL 4HUUB 3PWLB 3TO2A 1SFDA 4PYHA 4X6FB 2MKWA 3BD3A 4UZGA 4F1ZA 3FRPG 4MJID 5JQ6H 2X41A 3L4XA 3EJQA 4D3CH 3K8LA 2EDRA 5GSRB 4FEMA 5KSAC 1V3AA 3ES6A 3QWQB 4DGYH 4W1TA 1I3GH 1NCWL 3MOQA 3O8XA 2DKMA 1KB5L 2GABA 2FCBA 1QO3A 3ULVC 2J57A 4J27A 1QATA 4PJ7A 4Y4HC 3VU1A 2G9HA 2YXMA 4OD3H 4O00A 5DO2C 1TG8A 2VDPH 5J5EA 5B4MD 3T0XA 3RGOA 3PE9A 3AT9A 3VXPA 2OXGA 1XDTT 5F7WC 4RGMC 1LGVA 4FQXD 2Q7YB 3U6XA 4M6NL 1IAIH 4TXVB 4TSCL 1Z5YD 4ELKB 4LCWA 3O9WB 1NPJA 3FSOA 1WGOA 3QIWD 3EJJX 4JW3A 1FPTH 3OMHA 2DQHH 4NPKA 4WU2A 4QRUB 4V1DE 1I8KB 4XC1H 3VM7A 3FN9A 3T2OA 4DZ8A 2X0WA 1F3JB 3UAEA 4FP8L 3ZE2E 1P4IH 2FK9A 3O2DH 4Z3GA 3TWCL 2F53E 3UCQA 2XU9A 5I0DA 2PT0A 2DDQH 3V4VB 1NNYA 1S2EA 3V9EA 5HGHB 2XWZA 3BP6B 2A6JA 3QDJB 1D6VL 5DJ2A 1VEOA 3V6ZB 1IM9A 4YHZH 1DSWA 1Z6JT 2B1HL 2FRGP 3TCLB 3U7YH 3D9CA 2IPUG 3T2QA 1NINA 2X40A 3L5HA 3LHPL 2EXSA 2WWMD 4FQLL 4MMXB 4HSAC 2BSDA 4U1MA 5JR1L 2BSBA 1PFOA 4NUPA 3WUWG 1URIA 5DDHA 1DQVA 4FC3E 5H37A 1ET7A 2FYYB 4MHHI 5D1XB 4EDWH 2YFOA 1U92A 2IPTH 3RKDD 2UUPA 3EH4B 5LGYA 2VDNH 2J7LA 4FFWC 4XO4A 7PCYA 5AVUB 4K2UL 2EZ0D 5EOCH 3QIUA 4BH7B 1SN0A 5C0BE 3QUZC 2L7UA 3JV4A 4XI5C 5HDLA 1FL3A 3NJGA 1DQQB 3BPOC 5E0FA 2YQBA 1JNNL 4L8SC 3QJSB 1TTGA 1YO4A 2BY2A 3IU4H 3QR1A 1ASPA 4Y14A 3EOAA 3VI4E 2G5BB 3X13B 4O2FB 1D5MB 5E9AA 5IVXA 5IROD 4NT6A 4IS6A 4U7KA 5I6XC 3IDUA 4MNGA 3RY5A 2CKBL 3ARGC 5D7IA 1K2DB 2P24B 1X7TA 2FATH 4N8CH 1H3XA 1CT8B 3ETBJ 2D3NA 3DO7A 3G5XB 2NX5B 1QSZA 4NHUB 5DR5L 1U8IA 2VOTA 1QHQA 4LLQB 4QRAA 3SE3C 1EA9C 5CCHE 3S5LB 1MVYA 4PV9A 3U0PA 2GFBB 5C0FA 1QFWI 3R19A 2VITB 5HHOB 4NPYA 3QHZH 1T0PB 3AQYA 1FFOA 1DN0B 1IT9H 2ILLA 5I76B 4XNYL 5BCAA 5ID0A 2Y6TE 1V7ML 4C57C 2HFFA 1K5NA 3ZT5A 1LHZA 1SOXA 3F58L 1NFDB 1XWVA 4BDVB 4N22A 4GIAA 2DXPA 4PJDF 1OVZA 3JWDC 1L9NA 5CSGA 4WO4D 4MFHA 4QUOA 4JGNA 3N41B 4G6JL 1VAHA 3SDDA 1A64A 3Q05A 2XKSA 5CBEB 3X1NA 3MACH 1IMHC 2VXUH 5AZEL 4OLUH 4F7EB 4RDDA 4UINL 2B4CH 3BAEH 4DPBX 4A7SA 4XPAH 3H7LA 3NCYS 1LD9B 3NZSA 2CPUA 3LRKA 1M2OA 1S5HB 2VH5H 4JUSA 4FGMA 3TZVA 3VGAB 1JTPA 3WNKA 4Q9RH 3U1SL 2Q1EA 1WSST 5GS0D 4XVOA 5AW9B 3VTAA 4ERSL 2IQ9L 1WAAE 1V05A 2AERT 4Q9QL 1B0IA 2F00A 3GKWL 5K22A 3LH2H 2NY2D 3MRIA 4YDVB 1J88A 1KBPA 1N3NA 5T5NF 4BIKA 2ICEA 1VENA 2V9TA 4R97B 2A7BA 5L2KA 1CYXA 3ARDA 3ZHKA 4TTDD 1PY0A 3V55A 5BV7L 3GMQB 1L7TL 2EKSB 5IVZA 2QEPA 5AD0B 4I13B 4OZGE 3VDAA 4N87A 1XMWA 3VD0A 3AQZA 5E56A 3RZCA 4WQOA 1FZJB 5KWYC 5D7JB 4RX4A 3Q48A 4W6WB 2H7WA 2JJUA 1XGTB 2HTLD 4LEBA 1EFXB 1QVOA 2OV0A 1C12B 5I0YA 1FVCA 4YXHH 1EEOA 5GGSB 4DN3L 3VFGL 1TETL 4IOSD 4M5ZL 3IGAA 4ONOA 3ULSB 4AGLA 4MNQE 4XP4H 2YZ8A 1EH9A 2JJWA 2OJZL 4H25A 1F8TH 2ZOWA 5DJXA 3DPBB 2W88A 4JPWL 3S5LG 3BYYA 2XZAL 4PIBA 4BK4A 1ZVSB 2Y69B 4KKNA 4LEEA 1OF2A 1RZ8B 2ZAHA 1QHOA 4TRPL 1FRGH 4XZUA 1R34A 4TLUA 2X9WA 5T1MB 2P52A 2A9NH 2WANA 2N7SA 3F2LA 2CMRL 1A5FL 1CICC 4DTGH 3GDCA 4ZX5A 4Z77B 1UATA 1XIWC 1Z2KA 2Y9RT 4N6RB 3KPPB 4N2NA 4PBXA 4JFHE 4N9OB 3OD3A 2HXPA 3IF1A 1IFHL 1RURL 2JI3A 4MKMA 5IWLA 2NTFB 4FXGC 3VG0L 4HYTB 2P47B 3VJ6A 2QKIC 2LVEA 4UTBL 3TO2B 4ODTL 1QA9B 3SDYL 2DI7A 3I6SA 1EHLL 2OW7A 4GW5B 2EEXA 3FHAA 4D0DB 3G3LA 2DYSB 3ES6B 1WZMA 3MRCB 1C1EH 1FNAA 2YRBA 2CLRA 1SXAA 3SE8H 2NDFA 5H4ZA 3R18A 1FFRA 1W0WA 3ABMB 4PJ7B 3EH2A 1KBBA 2AXJA 2G9HB 4PRHD 4JFEA 3QUMH 5DSCA 4UQBA 4HF5H 5CO1A 3OHMB 5HGBA 3U96A 3KGRA 2I9TB 3FSVA 3H9SE 4HA1A 3GHBH 4AX3A 4HG4J 3G6AA 4YEFA 4NWFA 2HT2C 2UXGA 1CLOH 2AQ1A 3P11H 4L9LC 5FM8A 1AD0B 4M7JH 2A1WH 1R3LA 1WCBB 4BSWA 5JYMA 2BNQD 3S3JA 3MXWL 3WDJA 2APWA 5LBSA 5EG6C 2GY5A 4KRMB 5I0VA 4N3TA 4JM4L 4QGYA 3E3QC 1UCTA 3GMNB 5EF0A 3V4LA 1WYJA 2O5ZL 4P4KC 2AJSH 3U7WL 5CEYA 4DZ8B 4EZKA 1TITA 1ZDSA 4F20A 3LNHA 2AEWA 3CCHA 3TFBA 2XXMB 1Z0MA 3CLFH 4MZ3A 5GGRY 3S4OA 2A6JB 1U33A 5LBSH 5DF0A 1IM9B 3OF6D 3BP5B 4HJIA 4JRXE 1INDH 4KJQC 1X5HA 3R7QA 3FTGA 3FUNA 4QHUA 2OSWA 3NFSH 2B49A 2XIBA 1D9KC 3VXSB 4PBWD 3OHXA 4NKIH 2IV9A 3BKML 4XMXA 1U92B 2Y72A 3QISA 1M3GA 3GMLA 4WRLA 1T66C 2LU7A 4M8QA 3I2CH 4AGMA 5I2IB 1SHWA 2JCCF 2WHVA 2JI1A 3SDAB 1Z9OA 3CLWA 3QIUB 1BF8A 4PLKD 4BUBA 1J0ZA 5AG8A 3B9AA 5I1KL 1TO4A 1FL3B 3W2DH 2PTUA 5JW4M 4YK4B 4APQA 2WIIB 4NKDA 3W57A 4DVRL 5C0JB 1G9MH 2FT6A 5HYJD 4GG6E 5F89B 1DR9A 3F12A 4CL7A 3F84A 4QY8A 2CMAA 3U46B 5JTWA 1P31A 3EOAB 1U8KB 5KN5A 1LK3L 4AM0Q 3A6BL 3FQRB 1DVFB 2BP0B 5AW8B 3NZHH 3L1OL 4L1HA 4IS6B 4NT6B 5DS8A 4NGHL 1ADQL 4ZS6C 3RNKA 4CN1A 4I48A 2J8UB 1U8PA 5D7IB 1Q8MA 5KVFE 3ZXAC 2QGBA 4FLSA 3LKRB 3BVXA 4P5SA 5IW3A 3FTUA 5LQBL 4LSUL 3NVQA 4AEFA 2ZOLB 2YEZA 3KXFA 5AW4B 1AJ7L 3D4ZA 5I1EH 2UY6A 4JM2C 3GXDA 4HOXA 3L9BA 3NA9H 1RUKL 1GMEA 2NNCA 4FXKA 5IF0A 4OCLC 4J7RA 2QCTA 1CPUA 2W60A 4UNUA 1HOEA 5BRQA 3U0PB 1OK0A 1CE1L 4KYRA 5FV2A 4L0ZA 3NSJA 1BBJA 4NPYB 4PRID 4F2FA 3BAXA 2GWOA 2ZJSL 1FFOB 2GJRA 1SDYA 3D0AA 2YBGA 2A0LC 3CVIH 3MCKA 4JFPB 5EO9A 5ID0B 1JCVA 1VCBC 4FXLA 3U36A 3HN5A 3NGBB 3ZDZB 4QR7A 4D9RD 1E9QB 2GC6A 3R06A 5I24A 5IVOA 3RX9A 4WOHA 2H02A 1OKEA 2JXMB 3SBWC 1NICA 5CLXA 3D07A 5A2BA 5IY5B 1P5VB 3P9MB 3CWGA 1GVIA 3FHQA 4IBWA 3MUHL 4DAGL 5MENA 1EV2E 4KRLB 1N8OE 3GM0A 3EOBA 2BC4B 5I1CL 3JQOB 3EB1A 5I8CB 1T20A 3BH9B 2QR0A 4ZMZA 3VQMA 3CFKB 5JPNC 2Z8SA 3ZDYB 2XWJA 1WBXA 1JBWA 1MDAA 1PH0A 4P9HC 5AUMA 1ASQA 2PW2B 4PGCA 3VXRA 1M2VA 4LASL 3ABGA 3LDBB 3CMOH 3MYJB 2HLFD 3CDZA 4OIFA 5J6HA 3UPRA 3DVFA 4HCFA 2ICWI 4NQCD 2CG9X 4NN5B 1XH3A 3V6BR 2CIIA 2CM2A 3BZFA 1J5CA 3ARDB 4JCWA 4KHTH 2F7RA 4OLZL 3HS9A 1IC4H 4KO9A 5KG9A 3WIAA 4ENEC 3V0IA 5A2FA 3MU3A 4PI2A 1XXDC 3KGSA 4XCCL 2N7AA 4OGAD 2OMWB 3V8CA 4W6YB 3DMMC 1GZHC 3FT2A 1XSKA 3VQ2C 3PXJA 1L9TA 3ZM3A 1I3RA 3MV9E 1P7QA 3PHQA 1J0JA 4M7KH 3IETA 1QHPA 4RGNE 4UTAH 4JK0D 1JTOA 4MKTA 1QVOB 2Y22A 3TVMD 4NC1C 1FVCB 4RISH 4UOW0 3GIZH 3ZYJA 1GYVA 2FEDD 1VJSA 3MGOA 4V1DA 5BXFA 4DPAX 5EU6E 1HAWA 1UOLA 4MLSA 2P44B 5ECJE 5GRJH 2IQAA 4TLKA 3VXNA 1PZ3A 2F53A 4MQSB 2GCBA 3KR3L 1LO2H 4H25B 5DJXB 3LKQA 4ABWA 1D7DA 5FYLE 2WTRB 1X5AA 1DEEA 4X9IA 1SGKA 1OF2B 4JO5A 4R0LA 3QT2A 5JW5A 1XXFC 2LTQB 3RVVC 3S97C 1ZANH 4PJIF 3NZUA 3GXMA 1BZHA 1FBIH 2C9UA 2XZZA 3QC5X 2AJZA 5JQ6L 3AY4C 5IP4A 4D3CL 3CFQA 3JT0A 2QLYA 3BIBX 3V7AG 3ZQ9A 4LSSH 5D4HA 2Y1ZA 2XQBH 1VF5C 3OC5A 2QHRL 3QA3A 3WD5H 2WXHA 3IF1B 1DBKH 4S10A 5FUZH 4L3CA 4FFYA 1JRHI 1IQDA 2OCFD 3L9EA 3UIZA 3MRRA 4HGWB 4OD3L 5FW7A 3VDBA 3A47A 4L4TB 5HD8D 3Q6GH 4ZOEA 3WIHL 1BG1A 4V2BA 3CVHL 1DSYA 3W11D 1IAIL 5CIPB 5JXAH 5C0BA 5BX1A 3PJNA 2CLRB 2WCGA 2PYEB 5MEOB 4YXLH 3RY6C 4DOHE 5B3JF 4UWQB 4FRWA 4OFIA 4XC1L 4BQ8A 5DSCB 4JFEB 4BFRA 4P9MH 1C83A 1P4IL 4KXCA 4FL4B 4P2QD 3O2DL 3WE6A 3VI4A 3Q06A 3CXDH 3G6AB 2DDQL 5DMKA 1AR1B 2NSXA 4FFVC 4JPSA 4N0UB 1IO4C 3QEHA 4JFFD 4RNRB 1JGDA 3B2UD 2O6PA 3L1EA 4DP1X 3GHEL 4DGVL 1NOLA 1R3LB 1V10A 3RKPA 4XCEA 4BSWB 2I4HA 1EK3A 4K3HA 4XXCA 5T5FA 2NZ1A 2XXFA 4JDEB 4LDCA 2LFGA 3V0JA 3RA7H 4E42A 3QYMA 3CDGB 1GJUA 3QCZA 4ONFH 3CCHB 2BZLA 2YAHA 4BBWA 1O5PA 4KK8D 4EDWL 1E2ZA 1EEUA 1FFNA 1KGCE 2P3YA 2JCCE 3FO0L 1SEQH 3ZMEA 5D1QE 2IPTL 3AU1A 4DUWA 1A6WL 2F6FA 2ZSVA 1SBSH 2MCPH 4HKZA 3QP3A 5F0JB 1I53A 5EOCL 4ZAKB 5K1JA 4WHTA 1JFQH 4MQ7A 4TOYL 4GRWB 4TUOB 3TJHD 1XCTB 2ESVB 3ABZA 4YWGH 2OP4L 1NC4B 3OHXB 5IMMA 2UX6A 2WAHA 1TENA 3GMLB 3VGHA 3VXUE 3BPNC 3IU4L 4M8QB 4NN6B 2HA1A 4DEWA 4JNXA 3AY2A 2APSA 2XQYG 4NHCH 4AIZA 4JFTA 3VD7A 5IBTH 4BE5A 5C8JB 2IJ0C 5J06A 1S9KC 1XGYH 2HMID 2AABH 1OGTA 1MY7A 3A22A 1AFVH 4MS6A 3UJTH 1N2RB 1PKQE 2ZUWA 1UZGA 3TPUA 3PAYA 1A3LH 2FATL 3N9GL 4N8CL 4NNXB 1EEQA 1PU0A 5F0PB 1JP5A 4PG2C 1WS8A 4YDIH 1UWGH 4B9FA 1YZ4A 4QY8B 3SOBH 3BWAA 3MJ9L 4WI8A 4ZTPH 1FPZA 3CMGA 3KD4A 4IBLT 4CRPA 4P57A 1WAAA 4GKOA 5BJTB 2JK5A 1A2YA 2I6IA 2XKNA 3IJ8A 2YSSB 4W9KC 2XVKA 4P4RA 2VDLB 5IJCC 4P06A 4DSYA 4JG5A 4O2EB 4XNZB 3HG1B 3LKPA 1IT9L 1G7PB 3KXFB 2YEZB 4XE5B 4J6RL 3I6LE 1W72B 4Y1AD 2RA1A 3FOLB 4PPTA 3RWGA 5C09E 1CDJA 4OZGA 3AU0A 5HI5C 5IF0B 2Y4SA 2EDFA 6TAAA 4OCXL 2WJPA 3H6AA 1IV8A 4N2IA 4TULH 3O4OC 4N2OA 1BBJB 2ZXWB 4LNRA 4KITB 3VSVA 3O9WD 4AC2A 1BZCA 3MCKB 1IC5H 3MACL 2VXUL 3K2KA 2CHWA 3EJPA 3P0YH 3TBVA 3RGVC 2B4CL 3E1ZA 4MNQA 3BAEL 1AHKA 1AXSB 3QQDA 4XPAL 3Q2CA 2IFGA 3R06B 2NY4B 2DQIH 1HX0A 1OSEA 1BSIA 1JPFB 4PVGA 2F1EA 1DSFH 3K72B 1PD0A 1YJDH 5E70A 3X1FA 3FS9A 4NRXB 4WI0A 1MCWM 3ZGHA 2VQUA 2GUOA 3IRCA 1FF5A 3NUKA 1UJTA 3LH2L 2NUPB 3HAEA 1T20B 2WVSA 2FVNA 2QR0B 1FFQA 1T7VA 4FNSA 1HOCB 1M57B 1BP3B 5D1XD 1WBXB 3F5WB 5CN3A 2R1YA 5AUMB 3PV6B 3VXRB 1M2VB 1ONYA 3HAEH 1HT6A 1FIEA 3G9AB 3SHSA 3UTSB 5J6HB 3FPYA 5HVFB 3UPRB 3GNMH 3SGKC 4FA8A 5T3ZE 4I8DA 5D4IA 3ZKQD 3EJZC 3SBQA 1R3KB 2X2IA 5I30H 3MGTA 4R7NA 1XRIA 3IGLA 2OMZB 5DUMH 3B9KD 2WUBH 3ML8A 5KG9B 3GGWB 1HAUA 4YXHL 2PLTA 3PXHA 4R7VA 4G6FD 3B6SB 3NSXA 2J8UF 1F11A 5HDWA 5HI4C 2FT7A 2Z1KA 2PP7A 1YNKL 1RJZB 4PV8A 5TH2B 4HJQA 3H9SA 5C9KA 1WF5A 1MFDH 5EF3A 1NWOA 3PHQB 2VLME 4XX1E 1TVHA 4O5LH 4K8RC 4QBEA 4XBPA 3GSUA 4OF5A 2R1XA 1FQ1A 4U1HB 5M43A 1J1PH 3WN5C 1FRGL 3M7OA 4RHGA 3WHE1 4P2OD 4PJCF 4QCIA 3OB8A 2A9NL 4EIUA 5BXFB 3QEUA 1BFOA 1U8NA 4HJ1A 5SWZB 4NO5A 4Y19D 2NX5D 1J0YA 3IJSB 2A9CA 1VGKA 1AVAA 2MOVA 2ZCZA 4MAZA 3HS0C 5CZVH 5C0AB 1KBVA 4LAQH 2H3NA 3WTXA 4XWOC 4M1GH 4R0LB 5JW5B 4JRXA 3G9VA 4ABVA 4EMZA 2O61A 5DEJA 2AJZB 1N7ML 5GQBA 2AEPH 3RHWF 1Y0LA 3LKOA 3W1ZA 2F70A 1TZHA 1JTTA 4RMWA 3DPDA 3SR9A 3IDGA 4G1EB 4G7YL 3SE8L 2AXFB 3QPQD 3HE7B 1SXSA 3BWZA 3KCPB 3GXNA 1D7BA 3M6DA 2X53A 5ESQB 1R33A 3MRRB 3QUML 4HF5L 4L1TA 3PJSA 4MBRA 1DUZA 2GI7A 3NCMA 2F8IA 3GHBL 2PCFA 1M05B 4RFOH 3S2AA 3NJIA 1AACA 1CLOL 1MCCA 3P11L 1JIBA 3PPSA 1YAIA 2O30A 4M7JL 2A1WL 5C0BB 4N20A 3TEWA 2EIJB 1OSZA 2NPLX 3RPBA 2DL2A 3BQUA 4NCC2 1V27A 4YBHA 4HPHA 2OC3A 3ME0B 3KG5A 2V6HA 4GG6A 3QCNA 2E7LA 2VE6A 2AGJH 2E6PA 3K2UH 2UZYB 4L8DA 2OYPA 4Q9BA 2VLJA 3TTSA 1NAMA 3CLFL 3QEHB 4PJ9D 3U1QA 5LUMA 1I1AD 3QRFM 2NYZA 1I8MA 2R9HD 2HLAB 1IGML 4Q6IA 1INDL 3OJDA 3QCVH 2CO6A 1OIOA 4GSQA 2I5YL 4QMEA 2WIMA 3P3TA 2ZXGA 3NFSL 4PJDA 1NAMH 4XC3H 5CUSL 3WIFB 5JORA 3N1QC 1VSCA 3IN2A 4N24A 4D9LH 2B3IA 4NKIL 1IAKB 1RL1A 2WBXA 3LB6D 5CJQH 3QUGA 4HJGB 4I0KA 3RTQD 2NQDA 3AU1B 4WUUE 4DP6X 2OYKA 3DGGB 1E9PB 3ULUE 4I9WE 3I2CL 4Y2DA 2ZSVB 3QCDA 5ERWA 1BD2B 1NLBH 1U93A 4TQPA 4F8NA 4PY8I 2P49B 5L88L 5EORH 5L6YH 4QF1A 2NCMA 5E5UB 5IMMB 4QWWD 4PJ8C 1I4FB 5A40E 1NBZA 4YHKH 1AGFA 5IK3B 1KTCA 3NABH 1ZSDA 5F6IC 2I6JA 1HWHB 2BVQA 4HIHA 4AIZB 2F46A 1OP5H 1MFNA 3LS4H 3NZHL 5C97A 4G5ZH 1PTVA 1OGTB 1CBJA 3IMTA 2ADFH 5DLLA 3LKNB 3HI1B 4CJ1A 1YG9A 3TPUB 4ZRGA 1T4KA 4DGXA 1A4CA 1IEAA 5E23A 2H1PH 1WEJH 2HB1A 2XJAA 3QUXC 1AH1A 3TASA 3WFHA 5I1EL 4U6HA 1ZIBA 4P57B 1MQ8A 2JK5B 4MS8C 3D87B 3VWKB 4X98A 3ESUF 1MCJA 4P4RB 4WF7A 2EACA 3LD8B 5B1BB 1FLRH 3HA0A 4G8AC 3O8XD 1T6WA 5E1AB 1B4JH 1ZHLA 1PZCA 3T0BA 1PCXA 3CVIL 3FCUB 4M8VA 4AH2A 4Z3JA 4JHAH 4AYDC 2VW4A 3RI5F 3RWGB 3K1KC 5D5MF 4J3XA 5HGDA 3F83A 4GLRI 3FNKA 1MREH 1MWOA 2ZAIA 5JMOC 3MV9A 2CO1A 2CUHA 2YEQA 1CGUA 3QH3A 4LNRB 1EERB 4E9QA 3LJ8A 3CD4A 3F7YA 3GJFK 4LCWD 2BSTB 1XH1A 1N0LB 2BY0A 4GKSA 1NTDA 5HHPB 1U8HB 5DA0B 5K23A 4TNGA 2CXKA 1Q38A 2NY7L 3O6KH 4MAUH 5EU6A 3H53A 2WBJA 4MNQB 4RAHA 1FHNA 3S36L 5E2JA 5JIHA 5K25A 2QPDB 3X3GH 1HSBA 5KW9H 5E2TL 1IM9D 1SZNA 3T8MA 3CMOL 4YXKL 3BEWB 1Y1UA 4NLAA 1KCLA 1E2VA 3AC0A 3UBXA 3WV0A 1W2KT 5F3HB 4KU1A 3EO9H 3ARBB 3ZZLA 4EE2A 2H9GA 1KCBA 4ZX6A 4BFBD 1KGIA 2E4FA 2F6AA 4WTWA 4X99A 2H03A 2OMYA 4KHTL 5FYLH 3GS7A 1IC4L 4OI9A 4JO1L 2LLLA 4WTZA 3W5MA 1GQYA 2HRGA 3HR5B 3M1BA 5CNHA 5DHVA 3VFSA 3HB3B 5ANME 3K7UA 1NOFA 1DJXA 1U8MA 4UUJA 4DW2H 5B3SB 4LFHD 4HXAH 1QI5A 5EU7E 1M7DA 3QIUD 4M7KL 1KN4L 3MGTB 4R7NB 1A1MA 1F4WH 3WELA 4UTAL 5DHVH 1NCUA 7TAAA 4LHUA 4DF9A 5EC2A 4RISL 2ATKB 4WUKH 3T3MF 4M7LL 4FCAA 3WS6A 3TURA 1SXZA 3C6EA 5GRJL 4HWUA 1SDDA 2GAZA 2HT4C 3DX8A 4AYBA 3H9SB 5L8LB 3OR7A 2OMTA 1R47A 4WY7H 4KTGA 1LO2L 1JZFA 2YGNA 1EVUA 3UADA 4XBPB 5F9OH 1ZLVH 3NSDA 1TT6A 3KWVA 1T0MB 4JHWH 1KYAA 3HZ3A 3KYAA 5BV7C 2XG4A 4L4VB 1LEGA 3GSVB 4GMTL 4WNJA 4KX9A 4Z7VE 1FBIL 3ZKXC 1RULH 3IDMB 3QUZB 4KKPA 4M6AA 5MP6L 4RAUA 3K0WA 4LAJH 2YRPA 3L3KA 4WU7A 4HAKA 3TEUA 2P8PA 4YLCA 5I1LB 4FZ8H 2VDOH 4LSSL 3OKMA 4Q0XH 3ZL4H 3MRGB 1X3DA 1RHHA 4X7TA 1I85A 2JCCA 1H0DA 2FWUA 3P4NB 4IRJC 5FUZL 4BGLA 5D1QA 2UXTA 3ZMRA 2RALA 3FQUA 2CDFA 4JRXB 1JYVA 2NYYD 3DROB 2Z92B 2XN9A 3Q6GL 3VFVA 2GC7C 4NZDA 4XPBL 4K94C 1Y0LB 2QVKA 1QZ0A 4NYHA 4XVUD 3QE5A 3KWTA 5JXAL 2CDEB 3T1WA 2BNUB 1MNNA 2G0LA 4KKCC 3LXCA 3VFRB 3RE0A 4YXLL 3TESA 2B59A 4TN9A 2E9WA 2JB6A 1BZJA 2EC8A 1C8PA 2X10A 3VXUA 3PYZA 2Y66A 1DVSA 2D03L 1QUNA 3CSYB 3IFOA 4FG2A 4P9ML 2PCYA 2V3DA 3B9DA 1CZ8L 1DUZB 4P2YA 4YSAA 3SDDD 3CXDL 1V55B 2VZSA 1T1ZA 4FQ2H 4NI3A 4JCMA 3MV8E 1IE4A 5CU9A 1GQQA 1OSZB 5GS1C 4ZMXA 2Z4QA 4ZW8A 3M8OH 1PKQA 2WLHA 3PFUA 3BQUB 4M9OA 4P04A 1LE5A 4IEFB 2VDQH 3R4DA 1JV2A 2LE9A 1JS4A 3RA7L 3TZVD 3RVXC 2VE6B 4NNPH 4Y9EA 2WMPB 3LEXA 1OEUA 4L8DB 4IGBC 1HEZA 4ONFL 4UI2A 1SOKA 3TBTA 1H5BC 1KXTA 4NWTH 4P0DA 4OT1L 4RFNB 4PSPA 3SE9H 1OOAA 3MX0A 1GR7A 1AZVA 1RJYA 2YO3A 2DH3A 5L2KD 4F37K 3OJDB 4UQ3A 5KSUA 1JF6A 3ARDD 1G7HA 1ZHNA 2BOLA 3FUKA 4JO4H 5DD0H 1ZZWA 2MCPL 1J9TA 1H3VA 4G7SB 1JFQL 4LRIA 1CXEA 5JORB 2DQCH 4NAQA 4F57H 4L05A 5C09A 3JWNE 2CCLA 1HQRA 4KI5D 3A24A 1OTTC 4IDLA 3RZCD 1P9MA 3L8QA 4PUBH 3CFIC 3PF2A 3F05A 3D0LA 4RX4D 2IV8A 2J8OA 1AS7A 4X4XA 3EADA 5ERWB 2X1WL 1P7KB 5FIEA 1A25A 2BMKA 5IBTL 1HWGB 2ZKMX 3DA0A 2AABL 3AAZA 3LIZA 3UJTL 1AFVL 2CK0H 4G6MH 2PWDA 3LPWA 4QF1B 4AWJC 1KJ2B 4L4JA 1A3LL 3ZE1F 1CGSH 2EABA 1UB5B 3X12A 3V4PB 1UWGL 8FABA 4ORZC 4DFIA 1ZSDB 3SOBL 2BVQB 3OLEA 2BVEA 3NCEB 1VKXA 4AV4A 4IBQA 5DRWA 4YO0A 3LIZH 2O5XH 3IDIB 5ABAA 1JI1A 3DJ9A 1PD1A 1YNTA 3IJEA 1W0YT 4JFZH 1U36A 3IJHB 1L7IH 1IEAB 3R1GH 3G6JF 4GO9A 3D2UA 4JGMA 4MCZB 4DERA 5BRZE 3UTPD 2HUHA 2YAMA 4P23A 4PI0A 3RB7A 2AI0L 4XHJD 3W0WE 2RBLA 2XTJC 2C3VA 1H6FA 3AG4B 1BVNP 3S3SA 4QRPE 2BH0A 3MREB 5LGJB 3IVKB 3H9HA 3ZQWA 5E5MA 3QZBA 3VMNA 3HC0B 1ZT4A 2D9CA 4Q7DA 3S36X 4AMXA 4F1SA 4PJGF 3IKKA 4MRBA 4YNYA 1DBBH 3S34H 2C9RA 3NFNA 1ZHLB 4AH2B 1IC5L 3N3EA 5DVPA 3NQKA 2BGEA 4LGSB 5T3ZH 4MJHA 3MA7A 3P0YL 4JFED 1Z3RA 5AVRB 4Y2EA 4ALAC 4Y1TA 4UBDD 4GS0A 1R6VA 2B9BA 1LQSR 3CZJA 1H8OA 3QCCA 3FF8A 2DQIL 4ZO9A 4ODXB 5E5LA 3QH3B 5J8OA 2I1YA 4FXGB 3KZ8A 5EEZA 4PJIA 4RGNB 3MZTA 4H0LC 4AW7A 1S7WB 1MIMH 4GKSB 3SKNA 3QC6X 1F58H 4M93B 4P2CG 5EU6B 4HJ0C 2WBJB 1T1WA 5D8JH 4YLQT 4AGOA 1FCCA 4R7DA 3WO4C 2DWTA 2HH0H 4JVWA 4XMWA 1CLYH 1EAQA 4G5AA 3T6QC 5CD5D 3L7FB 1IE5A 1JLNA 4ZQKA 3IJYA 2IAAC 5K9WA 2AMGA 3AWEA 3L6FA 2DS4A 3O3DA 3GNML 1HJCA 4CVMA 2R7EA 1HXYA 2IPUK 3WKQA 4XMTA 5I30L 2AITA 1OT2A 1BXXA 4DP5X 4I0PB 1UXWA 5E6ZA 5E00B 2LU4A 2WUBL 1E3XA 1ZT7A 1QLRA 3M1BB 4PIRF 3PL6C 3AWFA 5EN2A 2C9PA 4WWKA 2EICA 4LLYB 2YMTA 4HJUA 1L8KA 3D1HA 3LAFA 4G6AC 2UYLA 3HE6C 2BRQA 1BXAA 2NSQA 3MMEA 1TLMA 3EJYD 2CH8A 4X5LA 4O5LL 1A1MB 1TMCB 3QI9A 5CHNA 5B1KA 2WO2B 1AZZC 3OZKA 4LHUB 2EKJA 4WI2A 1PTYA 3GXUB 4APQD 4DOHB 4HWZB 2ZKXA 1DLFH 4WLCA 4XN7A 5SX4H 4KV5E 3RJDA 2E47A 3NMEA 3U79A 5A6MA 3UPCA 2EIZB 2F5AL 4X5RA 4NX8A 2YPKA 1SDDB 4JRYE 2EIKB 3Q43A 2VKXA 4GXUM 4R0TA 2OMTB 1O5ZA 2MBCA 5AVQB 5CZVL 2WBWB 3FB6A 3I02B 4MD0B 1NMBH 4M1GL 5EO1A 1PMYA 4NJAH 5D7SH 1EJOH 4NX0A 2E9BA 4FCHA 2XG4B 3L95A 1LEGB 3SDXE 5KBNC 1T1YA 1YEEH 2MQ0A 1A6ZA 5I5RA 3UZVA 4ZMWA 4DETA 2OJEB 4ZMOA 1C5BH 1EAOA 1KJMB 3K74B 2IGLA 2P8PB 3SOTA 1EUTA 4LLWB 2Z31C 2FHCA 1RIHH 3OKMB 5CJ8A 5CR8A 1QLEB 4YN3A 4NRYA 1D5ZB 1H0DB 1OW0A 4QRQB 2MWCA 1M7IB 3BGMA 1RUAL 2K3TA 1QAWA 4KX7A 4PJHB 3QCMA 3ULVF 3HHSA 2EIEA 1V8HA 3X2QB 1TQSA 1OAUL 3QDAA 5DZNA 2F58L 3G08A 2IH3A 2W0PA 2OOQA 2NLKA 1RVFL 3JYCA 2FYVA 3HG2A 1QBMH 1RZQA 2OR7A 1SJEA 2OQJB 4RAVA 3REWA 2B59B 3SN6N 3BXNA 5MI0B 3VXUB 1BMGA 2XVLA 1JXDA 3W9EA 2AGJL 3TOPA 3K2UL 3STZB 4KVCL 1A6VH 5GGQH 5JOPE 3S3KA 1QD0A 5MEND 1NM4A 3ILDA 1PCSA 3KPNA 5IMLA 1B4TA 4EIZC 3TN0A 1XM2A 4QBWA 3OTTA 1PKQB 1PFCA 1H3GA 4M5YH 2BIMA 4OGZA 2WLMA 4PMFA 4KRPB 4DK6A 4PREA 4L3FA 3B1TA 2DTSA 4PJBF 1RZFH 32C2A 2NY6D 3PPEA 4XC3L 3T6ZA 3TBTB 3BWSA 4CNIB 3FQ1A 4D9LL 2ZSWA 5HHNA 1N59A 4XPFH 4IKLA 2PR4L 1OGAE 1FPRA 3MX0B 2IPKB 4I89A 5CJQL 1N4XH 1MAJA 1G7HB 3AG1B 4OB5H 1MRCH 2YQ2A 1DO6A 1ZA3A 1GXEA 1QTSA 3KNBB 2DYRB 1JDCA 5DRZA 5E51A 4Q89A 4AENA 5C09B 1EBPA 1HQRB 5DI8A 4AMKH 1IQWH 3IPFA 4MXVF 5EORL 5L6YL 2ZOTA 4WCYH 1P7QD 1MCLA 1TJMA 1XEDA 1FHGA 5ESAB 1L6XA 4HX1A 1G0YR 2BMKB 4MZ2A 3LS4L 4HVBA 2E8YA 4V1DD 2ADFL 3G6JE 4N85A 2ZX7A 5JPMA 2F0CA 3MVNA 4ZYKA 2F53D 4Z76B 2VMDA 2GJ6E 3SPVA 3TNMA 4H34A 2HWZL 8FABB 1WZ1H 1WEJL 4LGRB 4FTVE 2ED7A 4HETA 4QTHA 1V5JA 1FL6A 2EILB 4LOUC 4XXWA 5D7LE 1C16A 2NOYA 4DGIL 4PJGE 4PMEA 3CWEA 3BMWA 2ICWJ 2VM3A 2GTZA 2XNAA 2UAGA 4XAWH 5D93B 1YNTB 3I6GA 3O5XA 3IJEB 1G7IA 4XODA 1TVBB 3TO4B 4PN6A 1Z1WA 4HHWA 3QCEA 3CZUB 3C60A 1FLRL 4LK4A 3BSZL 2GHZA 1B4JL 2F8OA 2MSPA 3T77A 4LHQB 5AL8A 3VGEA 1FORH 4JHAL 4M7ZC 3IMWA 1KT2A 5ANMA 2EIBA 1T83C 2Y7QB 3FCBA 3QW9A 4RZKA 4FG0A 4OVVA 1IL1A 3H9HB 3QPXH 1MREL 3IDYB 2VDRB 1F00I 2Y3AA 1HINH 4IOIA 3P3SA 4W70A 4A6YB 3VO0A 2ICWA 4QOKB 1JHLL 4YNYB 5C0BD 4RWYL 3O6MH 4U49A 5TD4A 3UJIH 4CC4A 5I1IL 2CNEA 1B2YA 1N0XH 3NZ8A 4K71C 4M5TA 2WKOF 3S98A 4OCNC 4CC1A 3MA7B 1OXYA 1RJLA 3BVDB 1XL6A 2BNRE 3O6KL 1X6NA 4TVPH 1NCBH 3X3GL 4PGJA 2ZTBA 1QKZL 1WZLA 5J13B 3IKCA 3E6HA 4PJAE 3D4CA 4BWWA 5KW9L 3QZWG 3INUH 4NNYA 1Q0YH 4ABUA 5F7HA 2VQTA 1XO8A 4PTTB 5G4MA 3FT4B 5E9DE 2NY3C 1A7QH 3EO9L 4Z7VA 1Q9KA 2IAMB 3IE4A 2EDQA 5C70A 3DXAE 2M3VA 4PB0H 5K9JL 4GUPB 3QUYB 5DJZB 3RIKA 4NO2A 5FYLL 3B1UA 4KZEH 2XXGA 3VFTA 2WZAA 5IIEA 4ZD3L 5EZLA 3IJYB 4OCRH 2X0VA 1A7NH 4DKFH 3U0WL 3DUUB 4TLSA 2R0BA 1FNLA 3L6FB 4DW2L 3ARFB 3TT1H 2WXIA 3CLEH 3CN1A 2YFNA 4GOSA 4H5SB 5GRVL 5BQDA 1S9VB 3K1DA 4G8IA 3VD1A 1F4WL 1SYVA 2P7TA 5DJ0B 1S3RA 1DQJA 1UXWB 3BP4B 3FULA 4GBXC 2A6IA 3TLRA 4IKKA 4WUKL 2BLFA 3UG3A 3QJHA 4Q6KA 5EN2B 4PFEA 5TE7H 3SGEI 3QDGD 2K70A 3QWOB 2UYLB 4F80A 1HYSC 3MMEB 3QO1A 2XC8A 3U4BL 3QRLA 1ET8A 3QI9B 3QO0A 1F56A 3GMOA 3MV8A 3NH7H 5CHNB 1A66A 2V9RA 2WLZA 5F9OL 4JHWL 3W5NA 1IZKA 4LP8A 1OSPL 3WKYA 2FECL 1RULL 3ESPA 1T7ZA 1AKPA 2ZCKH 4IRSC 5B7FA 3GDBA 4FZ8L 2VDOL 1AGDB 4Q0XL 3ZL4L 1J8SA 3FQNA 4LQFL 2VMEA 2MCMA 2AQRA 1BIIA 1JF1A 2PPAA 4FE9A 5CJXC 4YPGA 5EO1B 4KZDH 5JNYA 4U1GC 1X4YA 4JFQB 4WV1C 2JKWA 2ARJA 3I3EA 5GHWL 1RU9H 1CFTB 1UVQB 3UZVB 4WK2B 1VDGA 1MHCA 5MEQA 4ZUUB 3WEBA 2KI6A 1OWWA 2XHNA 2H1LM 1MHEA 1YN9A 3ZM1A 2NLJB 5E2UH 4GKLA 3ARZA 3BUPA 2OULB 3FN0H 2FX9H 5FR3A 4L29A 4WUUB 5K59E 4WJ5A 3GBEA 1TQTA 3K4DA 1HHGA 1S7VB 1WFOA 5T1LA 3JWNH 1P4UA 1T0NA 1UGNA 1HHIA 1UT2A 4OIIL 3RUGF 2FWOA 3QUKA 4B9YA 1FC2D 1J05A 4MNQD 3QDME 4X7EC 1U8CA 2VDQL 3BXNB 1JI2A 2VEUA 3MLXL 4NP9A 3NJVA 1UOVA 2PW1A 2QSTA 4F9PA 3W9EB 4B96A 1EBAA 1C08B 4JFOA 4NOFA 3PABA 4MQXC 4F3FA 3C5ZC 1MH5B 1G6RB 1KOAA 4NWTL 4RIRA 3BFOA 4RMSA 3HVDA 3SE9L 2IWFA 1QEWA 2DMGA 1DUYA 2CBOA 4PJ5E 3ZO9A 2R56H 3T0EB 1JK9A 1IILE 1FNFA 1TYJA 1CR9H 3IWUA 1Q0XH 4IW4C 4JFHD 3KLLA 5BRZA 4U2YA 3DC0A 3OAYK 3V6FA 5LAXA 5IFAH 2DQCL 1XH2A 3W0WA 5EULV 3T8VA 4F57L 3S4EA 2Z3FA 2X70A 4QRPA 1AMXA 4M4PA 3CC1A 3ZBMA 2F7OA 3EMUA 3C6LC 4IMLA 1D2PA 1SN2A 1ORQB 2AXGA 3G5VB 1PD6A 4JVUA 5I6VA 1ZA3B 4PSRA 3CGTA 4EUPB 1NKGA 1L6ZA 5DRZB 3E2HC 3AREC 3L4VA 4YVNA 5ELIA 2X3CA 1F2QA 2CK0L 4G6ML 3H9SD 3HRZC 3FN3A 1CGSL 2P46B 4M6OH 4L3EB 2XX0A 4PU2A 2IALB 2X4RA 2WZPD 2VAAB 2WNKA 4WFHE 2H5UA 2O5XL 5F21B 3KJ4B 4J2QA 5F1IA 4FD0A 3VH8A 3DX6A 2F74B 2E9IA 5FUOH 2O5YH 3MV01 2L7EA 3CZFB 4JKWA 4BKLB 4ZYKB 2XA8H 4F7TA 4MBBA 4JFZL 4GG8A 4B27A 3TNMB 1SPDA 1L7IL 2X6AA 3MOZA 3MUGB 3DRTB 4D7PA 4ILDA 3NRPA 4IBSA 1C16B 3AS2A 4OM1H 2R59A 4F5CE 4JRXD 2OBGA 3S5ZA 5BVPH 1VLXA 3N43B 2ITCB 4JM2F 1KB9J 4G71B 3FCGA 3KPMA 5CILH 5TQ0L 4GP5B 4BV1A 4HSCX 3I6GB 4WEBH 3WG7B 1IC7H 1L9SA 1T7WA 2APXA 4TQHA 1DBBL 1I9IH 3DETC 4L37B 1VHRA 2CO3A 1U95A 3S34L 5HDQL 1XF5A 5FHBH 5GISH 3RJQB 1DQDH 1KT2B 3BH8B 3D39B 5ANMB 1SHMA 1F3RB 2VN5A 2C5DC 4F2EA 1WRFA 1QRKA 1IL1B 1UQSA 4I4WB 2NR6C 2WINA 3RHWK 2ICWB 4JMJA 3L9RA 3ZT7A 3H7BA 1EDYA 1FVEB 4L1SA 4GE6A 3WMQA 1EO8H 1NCGA 2XPGB 1V3MA 2VXQA 1C7TA 1BJMA 5KBLA 1MIML 2P8LA 3A4DA 5B22A 1F58L 2EXWD 3CM3A 1JGVH 1E8YA 1RJLB 1WTLA 2MQCA 4ZX4A 5CP3A 2Q87A 1I9JH 4MGXA 3TBBA 4JRYA 1QFUH 4HIQA 1CDUA 4Y5YC 1FNSH 2HH0L 2PO6C 2VLJD 4XGZA 4XH2A 5IQ9A 1CLYL 1I8LC 2VXQH 5F1KC 3E6HB 3RWHB 3TA3A 1FGSA 2V9QA 1ZLSH 2BW4A 2PWEA 4QRRE 1JZHA 2YWYA 5T1KA 3SDXA 4HHAA 1BVNT 3MNZA 4JFUA 4EUPG 5J3HD 3MQIA 1KLUB 3R7RA 1S78C 2JIXB 4MD4B 2DIEA 5H8DA 1MFEL 4NO2B 1JVOA 3VFTB 2VR9A 2QMJA 2R0WH 4G42A 4LCIH 4W4OA 4KI1A 4Y4FA 5EZLB 1R5WA 1WBZB 1JG9A 3ISWA 2FWLB 3O41B 4PGEA 1ZGLM 5CAYB 4Y2DD 1OCWH 2AZAA 1U91A 2B5IB 4DQAA 4AGNA 3WTSA 1X9QA 4MMZC 3S8GB 3OL2A 2DMKA 1C87A 1K3ZA 1H8NA 4G8IB 4HS8H 5F88B 5IB5A 2P7TB 1CFQA 1KG0B 2I9LA 3AB0C 1G43A 2YARA 1DQJB 1DQIA 1TU2A 1UA7A 1W8EA 3H85A 4KKLC 5IKCB 1KXVA 4G2AA 3SPGA 2A6IB 1PZ5A 5EOQL 4BA8A 1DLFL 3QJHB 3QORA 2QFPA 5C2UB 5KVEH 2P80A 2WYHA 5FDWA 2V7NA 4Z7NF 5G5DB 4ORGA 4MWFA 4QXGH 1OPOA 1SOQA 1MI5B 1OALA 3LHAA 2XQYK 3TYFA 1UYWL 2FLMA 3ZKMC 3GMOB 3MV8B 4I7ZC 4C55A 1C84A 1EEYA 5KSBF 5D7SL 4NJAL 1NMCB 1S9WB 4XCNA 1XB6A 4MYWB 4AQZA 3QHTC 4TSBH 4E41A 4QJ4B 3MBEC 2PCXA 4FKKA 2R69L 5C7XL 4EN3B 4F91B 3KEDA 3Q3GB 3PWUA 4LPWA 1RIHL 3OJMB 1X9RA 2ZG1A 3VB9A 1OGAA 1JF1B 1GOGA 4YPGB 4XAKE 5K1NA 2WXMA 1ACYH 1JZ3A 4QAPA 3SE6A 4NO0A 1B2WH 3JWOC 1NOAA 2Q3ZA 1ED3A 3UG4A 3P3YA 1A6AA 2CIKA 5MEQB 1S7QA 4UIKL 3EOYG 4X8JB 3FONB 4EVNA 5JW4Q 4H88H 1QBML 4Z5RA 3GIVA 1T04A 1MHEB 5HYQB 3H55A 2CR0A 1MY5A 2GEEA 2UXVA 3MV9D 5I5IA 4GS7C 4CBZA 1OZTG 4WJ5B 4RGND 5JZ7C 1U3JA 3NAAH 1FV1A 2A9BA 3G5ZB 4NQXA 2OA9A 1HHIB 3QQ3A 3N85H 1IGYA 2FWOB 5A16A 5EU6D 3G6JA 4U1NA 3CZGA 1J05B 2WBJD 3OKEA 1MLBA 5EEVA 1EPFA 3WMSA 4M5YL 4AVHA 4M56A 4X4ZA 4HV4A 2GJ6A 5DFVC 3BEVA 1RZIA 4KFZC 4NC0B 3V7MA 3SJVB 4FTVA 5FYLD 2QQKH 5D7LA 1K8IA 3PABB 1AZRA 5CWSB 2NY1D 4N4YB 1WQVT 4HG4K 5KA3A 4F3FB 4PJGA 4RIRB 1TPXB 2ID5A 4RDQG 1TKWB 2A9MH 4XPFL 5JW3L 4I3RH 4HUWB 4HGMA 1KSRA 1CLZH 1DUYB 4TVVA 4UDUA 1GGCH 2ZT9C 4FJ6A 3CFJB 2F1AA 2AV1A 3OBAA 1MRCL 4P2AA 4G8EA 5DJ6A 3W37A 3VXQB 5BRZB 4GE2A 1Y07A 2X6MA 5LAXB 2LV4A 3HG5A 3MRBB 3MO1B 2OTWA 4LGPB 4KY2A 5DTFA 1FDLH 1NC2A 4JPKH 5C2BL 3OX8A 3BJ91 5FGCE 1GJIA 1PEZA 3OKYA 5GJSH 2D2CC 4XVTH 2VSDA 1E43A 4J3OC 2OXHA 3KH4A 5F1SA 4ANXA 4JR9L 4K3GA 1HE7A 4LHUD 1MCFA 4KPHH 4JY4A 1UGKA 3IFPA 4Q52A 2J72A 4AVJA 1HHKA 5HHME 3OJVC 3Q8AA 2BNRA 1JHKH 3QDHA 5K24A 1ONQA 2VXSH 5FECA 2HJKB 4YHYC 1WT5A 2YJQA 1WZ1L 3ALXA 4PJAA 3BAJA 4LIQE 2X4RB 4LKCA 4YDLC 1YC8A 1THAA 1Z9LA 4K7PX 5IHLB 2CJZA 1ZY9A 5E9DA 1VZGA 4WW1B 4WI3A 3L48A 3OB0H 4F7TB 4FQCH 3ORJA 3DTUB 1KIQA 1ZPUA 4UZUA 5IBMA 1T2QH 1FORL 2VLRE 5D1QD 4EQ2A 1MVFA 1WHOA 2XN9D 4AYEC 5C9JA 2I7OA 3MLSH 5TFSH 4C54A 3K80A 1J6UA 3EYSH 1HINL 5E8EA 2C46A 1ZMYA 4S2SA 2XKUA 3MJ7A 2H32A 5I74C 3O6ML 4OY9A 5G2NA 3WBDA 1U95B 2GITA 2W92A 1XF5B 4H40A 4AEHH 3TIEB 3ZKXB 5IW1A 1N0XL 2F9BT 2OMXA 3AADB 5IHZA 2CHZA 4ZXBC 3VXUD 4PTUB 3FO2B 1GA2A 1PY9A 4TVPL 1IARB 5H4YA 2J5LB 1KV7A 5B39G 4YSEA 5B8CB 1AHMA 2J6EA 3Q1SL 2DJMA 2HTLC 4OLVL 1NCBL 2H32H 4PD4J 4M3KB 1YTNA 4KVNL 3MRKB 5F9WB 4KUZL 3X11B 1I7TB 1DJHA 3B56A 1XF1A 5FYKL 4G1MB 4PWIA 4FQQA 2Y96A 4NBXB 2WSKA 2P8LB 3MCLH 4HK3N 1FL5A 4N25A 3ROLB 1OOWA 2HKAA 3WIIH 2J6EH 1AIFA 1WICA 2CXGA 3RAJL 1EHKB 3K8MA 1FI8C 4JRYB 4PB0L 5DVMA 3D2TA 5FO8A 1KLFB 3NSFA 1G84A 1PX4A 5IB2A 4J8QA 5IQ9B 4KZEL 2BHZA 3T8XA 1BWMA 2F6VA 1J0HA 2WLLB 2IOIA 5LJYH 2WLIB 2GT9B 3WFZA 4OCRL 2BJMH 2CCWA 2CO7A 4XNXL 5CCKL 1I9SA 2AQSA 2GTWA 3LRSA 5T1KB 2FLBT 4HHAB 2AQTA 3WNPA 3CLEL 2P5PA 4XBEL 3D85A 3S96A 3PREA 2IMNA 1XSJA 3BVNA 1CB4A 2V5RA 2X12A 4HGKC 3IMUA 5C09D 4NC1E 1TTRA 3P9LB 4C47A 4ZW3A 3KLAA 3O2VH 3UDWA 4A68A 4G42B 2L7JA 1GHFL 1UXSA 4PGEB 4S1DC 5I5JA 5C07B 4FHBD 1Y6KR 5EZOH 5I18H 4W81A 2LR4A 3QIBA 4ISVB 3CFDB 1G1YA 3VRJB 2CMCA 2AVGA 5KVGL 2YQ3A 1OWRM 2GEQA 1TU2B 4OKVB 3NT0A 1QR1B 2F6TA 5E1QA 1PX3A 3QDMA 4N0CD 3FT9A 5ACZA 3QORB 5C3TA 5FUCC 1ZRUA 1G9EA 2OR9H 1QW9A 4JY6A 1PEWA 1EAPB 5I9QB 4N5ED 1GTFA 4ORGB 5IJVB 1P2CA 2R2HA 3EBHA 4IIQA 1BGXH 4OCYH 1OLZA 4Y16A 1FQ9C 4Y2OA 3TBYA 4LVHB 4ACTA 2FHBA 5AW6B 2C7SA 1CXLA 3P69A 4PJ5A 3MV11 2EUZA 3CSFA 1XF2A 4Y4KB 3D2UD 4KUCD 2J20A 3KS0J 4RESB 3N50A 2WLJA 5FA3A 2Y0SA 3E9UA 1RU9L 1LEIA 1I9RL 3QS2A 4P23D 1Q6TA 2GK2A 3PWUB 4FYTA 3QJXA 5T3ZD 4N2FA 3LS5H 3SCMC 5E2UL 3E7JA 3FN0L 5IQOA 2AQ2A 4PCYA 3B5TA 5D2LF 1SF5A 5C0ND 4QHLA 4PVNA 2XFXA 5F7MC 1ED3B 1RPMA 1A6AB 4DN4H 1AZCA 1DANT 1XR8A 2K6ZA 2CIKB 6FABH 3D69A 3MJWA 4NKQB 2XY2A 3ARGA 5K33A 3FQWB 4Z5RB 3GIVB 4F7KA 1T04B 3HLAB 1IC1A 5A6LA 1EFQA 5JIDA 1BJ8A 2C7FA 2VLMD 3HFFA 1I1CA 3RWEB 1KJVA 4RRPM 5FCUH 4M5SA 3SE3A 3U6RB 1FV1B 4NQXB 3G04B 2D7TH 2JKLA 4N1CA 4NUJA 1IGYB 5A16B 5TJWK 4YHIB 3OKEB 3FO1A 5GZOA 1MLBB 4OD1H 3SODB 3X1EA 3PCYA 5EU4A 3D4GA 4HALA 3PWVB 2R56L 1WC7A 2JB5L 5D71H 1BZQK 2V5YA 3QNYA 1Q0XL 3C8KA 1CXFA 3IDNA 1SN5A 4ZDHA 3QFDB 5FHAH 5EIIG 3GZQA 2JELL 2NUTB 3HJ0A 5DZOA 1G0DA 3TBCA 2CGYA 3ZHFA 3O4SA 3LQAL 5E1GA 2DTMH 4PBVC 2PPDA 5DWUL 1C7SA 2DM4A 1E4XH 5DK2B 3S8FB 1GS6X 2W5PA 3FTZA 1OGPA 2AV1B 2NY0B 4G8EB 2D7OA 4U6YB 1XF3A 4FTDA 5ETUA 4WSJA 3STLA 2JNZA 3FUHA 3JWDH 3LN4A 4WWKD 2EUWA 3JV0A 3ZZ1A 3EGSB 4X5WA 3EBIA 2CNYA 3CFNA 2W8CA 5C92A 3QCTL 4I85A 5IJKC 2RR3A 4M3HA 4IMKC 3VD2A 3AITA 3BLKA 3QI9D 1Z9NA 2EYTA 3H0TA 3O6FC 5EPMA 5JO5A 1SM3H 4Z8FH 5I1AA 5GGVY 1VFMA 2G2PA 5DZJA 2YPLA 1HHKB 5FUOL 3QCKA 3FDWA 3MRMB 1G6VK 2XA8L 5E4AA 4BPCA 1QWNA 5KVDH 1CFSA 1MUJA 2NYKA 3UZQB 1ZDQA 4K7PY 2ITFA 3GSQA 4PJAB 4A37A 2ZF9A 2ZP8A 3AG2B 3DSNB 1AQMA 2GVYA 4OM1L 4DP2X 3SQBA 4QRRA 1E8WA 1ECZA 1NGYA 5BVPL 1YUHB 2YD4A 3AXLA 2KHAA 5DFTA 3SDCC 3UAGA 5CILL 4XOBA 3ABLB 4IJ3C 4KKBD 4MB4A 4N0RA 4DP0X 1IKNC 4QPEA 4XHQA 1MFAH 1DANU 1MW2A 2WYIA 3K6FA 3DXAB 5F6HI 1IC7L 1SLVA 1BLNB 2V2TA 5D1ZC 3PP4L 1I9IL 2B7DT 1KIQB 1JPTH 1OD9A 3LMJH 5GISL 1D6EA 2WN2A 3MRHA 3BH4A 4J4PC 3IWVA 3CE1A 3MPCA 3ULUD 1T3FB 2A83A 5ISZB 2APFA 3CSPA 2FEEI 5C9JB 3WTYA 3FT1A 1KNOA 4K0OA 5LN4A 3IMBA 4LOVA 2XRAH 5DFAA 4HUXA 3NSYA 1EO8L 2IADB 3LCYA 1BAFL 4RZCB 1W72L 4ANUA 5F97E 2OMXB 1MZYA 1PG7H 3I50L 4CSTA 3O4LA 1JGVL 1CICA 1C5DB 2YBRA 5IMOA 3L7EA 4PW4A 2ZYHA 1XIWA 4N1HB 2Q8AH 1FNSL 5D6DC 4Z78B 4LRNH 4GW1B 3TVMC 1BQLH 3KPQB 1BFVH 2FEDC 3QWRA 3MV7E 1Q9OB 5KUMA 2GW5A 2PN5A 1ZLSL 1KPRA 4G9DB 3TN0D 2RCSL 4S11A 3SO5A 3UP1A 3PGFH 5SWSB 3I74A 4AV0A 1FL5B 1WP6A 1TQVA 4Y5XC 2IH8A 4EPSA 4OV6F 5KYUB 5ITFA 1NCOA 5IJDC 3EO0B 2OPCA 3PDOB 4PRHE 4XOEA 5E03A 5F1NB 1VB9A 3AS3A 3T8XB 3SD5A 3FU8A 3FRUA 5TDNA 3Q9PA 3WFEL 2R0WL 5DZPA 4LCIL 4ENZA 3ATEA 1FSKC 5AVXB 3FMGH 1VERA 2ENPA 2FL5A 3MI6A 2CBTA 2HNQA 1BXVA 2GTWB 2CJUL 1UD2A 5DC0A 4XOAA 2BNQE 1WA0X 1D5XA 3J07A 4ZMLA 2MTAA 4L9LA 3NPSB 1QOKA 3S96B 4HS8L 4R90L 4ZIYA 2IG2H 5CJOL 3PIQA 4MAYB 5HD8C 5EBWA 4NXKA 1N64L 1YY9C 2UX7A 3T4AC 1UXSB 3QK0A 5KVEL 4P4KA 4FI6A 3RDJA 3IGKA 4OZIB 1HQ4B 4EZLA 4ZPVB 3RIAF 3QIBB 1P4BH 3IRZA 3MBXH 3SKJL 3AQXA 3B8SA 5FGSA 3VSQA 1OAKL 3GD1C 4Q9CA 2ZUSA 2I3UA 1UD6A 4GINA 4OUUB 1SJVA 3QG6A 4WEUD 5EA0H 3QCFA 4ETQA 1NDMA 4MX7A 5JLZA 2M8XA 3BLBA 4JY6B 1I7UB 3F8UB 3NFPB 4R2GB 4XCYB 3BAYA 3L4ZA 4FNPA 3B2UC 5F3BA 1YQVH 1P2CB 2R2HB 1PZ2A 2Y5TB 5D2LE 4Y16B 3TBYB 3QYNA 2WLKA 3OAUH 3BGFB 2XV6B 3MLTA 3N0PB 1L5GA 5G4OA 1ACYL 2ZF8A 5KABA 3C60D 2K8MA 5E8NA 3D18A 5FA3B 4JANB 2J71A 1B2WL 3UC0L 4Z7OF 1LEIB 4P5RA 5GGUA 5CZXD 4KK8C 4JKPL 3UYPB 3CFEA 5C0DA 1AHWC 4Y5VB 1DJIA 4LKXB 1LQBC 1N5YL 3MYZA 3P73B 4JG1L 1NBYB 5AYUL 3TT3H 1JWMA 1QRNB 2VZ1A 1G1FA 2CNHA 4KTDL 4QXUH 3L9YA 1XZWA 2UZXA 3NAAL 3GSNH 2K6YA 1IAII 4I1RA 4B0MM 4RSYA 3D69B 4YR6B 3L4WA 4ZN5A 5A6IA 3BKJL 2EDTA 4LLDA 5D6CA 1X6LA 5DCCA 3LEVH 1ITBB 2MMXA 2QVFB 2QQKL 2BRRH 3NQIA 3RRQA 1T89C 2YUWA 3FSAA 3Q8BA 4YOKA 3VXOA 3D44A 3F3HA 2ZZUT 3JZYA 2A9ML 4NUJB 5CF3A 4I3RL 3W39A 4GKZA 3LXBA 1IJ9A 4WW2A 3BAIA 1GGCL 5EU4B 5KZCD 4P5TB 2NT2A 1WC7B 3RIFK 4FYRA 4NM8H 2EUVA 3QNYB 4LIQH 1D5BB 3TYGH 5I66B 4ODSL 1JNHA 5EZPA 2F7QA 4ZUSB 2VLRA 4ZDHB 4O02H 2ENYA 4HUVA 2OLDA 1XTLA 1T22B 1FDLL 4JPKL 2NXZB 4BHUA 2EDMA 1GH7A 5GJSL 2B15A 3KLHC 5DYOB 1F1DA 1LP9E 2GIMA 3CX5J 1CI3M 4K23H 5CGTA 3CFBB 4NDMB 2VR7A 3QNZA 3P1VA 4KPHL 4N90E 3WTUA 3OMNB 5B1JC 3STLB 3A0OA 1EUUA 2EDKA 4FQ1H 4Z95H 4X5WB 1JHKL 1GPOL 1F6LL 2R29A 4H2AA 1G7MA 2VXSL 3O9WC 4XTRD 4ZRTA 3F9AA 4YHPB 1ZE3C 2EYTB 3H0TB 3MV8D 4NZFA 3ZM6A 3GBLA 5E2VH 4LVEA 4NI6A 1X5ZA 4KTEH 4U1LA 1I7ZA 5TQ2H 3KPOA 5LXVA 4E36A 4PVLA 2R29H 1GWZA 3BO8A 4HLZH 4EZJA 3Q13A 4XNMA 5FKAA 3DECA 3MHZA 4B7LA 2ZWLT 4FQCL 4P9HH 1CFSB 35C8H 5GJTH 1FGNL 3LNFA 3BLTA 3P0VL 4P5MB 3GSQB 3RNQB 1T2QL 2DJSA 4DPRA 4Z6AT 3P9WB 3V6OC 1H3UA 4BZ2A 4ZO6A 1A5YA 5F1OB 3ZSSA 3LN9A 4QRRB 3UTTE 4MMXC 4JJOA 5DZVA 2PR9A 4UT9A 5J1AA 5T3XL 5I16A 3GUTA 5IHUH 3MLSL 1AQKH 3LPOA 3UX9B 3I36A 2HVJB 2P26A 5D1XC 2XXCB 5TDPA 4EI5A 2B0SH 4LU5L 5D2NE 2G5RA 4BZ2H 4YE4L 4UU9B 1D6EB 4UM9B 4IDJH 4UT9H 2CUAA 1J86A 3MNWA 4MLIA 4CVXA 3BZEA 5CBAB 2CE6A 1J1XH 3RWCA 2DMBA 3B9KC 1KNOB 3TCTA 1GGBH 5T1LD 3SZKC 1C88A 3OLRA 4GQZA 1WWAX 2QADB 3T6XA 3RVTC 2O4EA 5EFIB 4LB8A 4X5XA 2FSEA 3MCLL 1H8SA 3MAWA 4YL4A 4K9JA 5G4NA 4HS3A 3LH9A 3WIIL 3AY4A 1HNGA 4U3HA 3SKMA 5JDSB 2CDGB 3UYRH 4LCCB 3QQXA 4KNTA 5H2BA 3FHEA 4L8CA 3UBGA 4BK5C 2DD8H 4LLVA 3IAPA 4GMSH 3EH1A 3CFCL 1ORSA 4ZO7A 4C4UA 2BJML 2AEQH 4NZRH 4C83A 4QEGA 1CGXA 3SQRA 5FM5M 5F9DC 4B3EA 4YSQA 5ITFB 5GRUH 5BRZD 3ZTDC 5F8RC 4H13C 2Y5EA 4UYQA 3ULVL 1KYOJ 3W0WD 5KJRH 1OTSC 3KYOA 5EF2A 3AWGA 4HWEH 4QRPD 4FQHB 3O2VL 5TDNB 1AR2A 3BVVA 1HEJC 5IOPA 5I19L 4G9FE 1SUJA 2FL5B 4P3DA 1T4WA 4YHML 3B43A 5AOJA 2VL5B 4BJLA 1PSKH 1HDMA 1RMFH 3VFMA 3DI3B 5EZOL 4QNPF 2J16B 4AUUA 1AGCA 3RWIA 4GAGH 1YEDA 1T49A 5L2JB 3PG2A 1GS7A 4PQXA 3KGTA 1XD1A 2GBVA 3PIQB 3S35H 2J55A 3QEQA 3QULA 2G59A 2CUIA 4AYID 4DGWC 1FN4A 2H4VA 1AP2A 5AVWB 2H6OA 3QKQA 3H56A 3BFWA 4YZWA 1BGXL 4J6IA 3MDJA 2FJGA 4EQ3A 4L5FH 2ZX8A 2W1NA 3IXTB 1ECYA