3V0EA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 256-576(c363s)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
320
structure length
320
Chain Sequence
b'MRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 102
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0eA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0eA01
4JMJA 5EHPA 3F99A 2GP0A 2PBNA 2AZRA 5BX1A 1L8GA 2AHSA 4YAAA 3EMUA 3H2XA 5KA2A 3ZMPA 2I3UA 3ZM1A 3MOWA 4GE6A 4WTYA 1A5YA 1FPZA 1OHDA 4R30A 4OHEA 1T4JA 4RKKA 2H4GA 2CM3A 3QCNA 1P15A 1C83A 1AAXA 2QDPA 2H03A 3QCKA 4WOHA 4MBBA 2B3OA 3AWFA 2VEVA 1J4XA 1R6HA 3BRHA 2J72A 2SHPA 4J51A 2P4DA 1YN9A 2H4KA 2J43A 1C85A 3D44A 4DGPA 4YR8B 1T49A 3QCHA 1OEMX 2CFVA 3QKQA 2QCJA 4Y2EA 5AWXA 3QKPA 2F6VA 2ZN7A 3BLUA 1Q6NA 5KA8A 1BZCA 1U25A 1KAVA 1G7GA 2FHBA 3NMEA 3U96A 1BZJA 3AWGA 1Q6PA 2CMAA 1L8KA 3ZM2A 3F41A 4TVVA 1XRIA 4WU2A 1NL9A 1XBOA 4PVGA 3S3EA 2A8BA 4RH5A 3ZM0A 1C84A 1Q6SA 2QBRA 3I80A 4KI9A 5BZXA 3MOZA 2OC3A 5K25A 4OHIA 3S4EA 3V0IA 2I75A 2YOCA 3I36A 2J71A 2IMGA 1GFYA 2PQ5A 1Q6JA 4GRZA 2J73A 1YPTA 4RHGA 2B4PA 5KA4A 4ZN5A 5I6VA 1M3GA 1WCHA 1RPMA 2H04A 1WRMA 2Y2FA 5KA7A 4ICZA 1PA9A 4H34A 4I8NA 1G1FA 2CM8A 3RZ2A 4D3QA 2Q05A 2WGPA 5KA0A 3RGOA 3F9AA 2I1YA 4ZRTA 1ONYA 2PSZA 1C86A 1X24A 3D42A 3M4UA 4R0SA 3OLRA 2CNGA 3D1HA 3QCGA 4QUNA 3BLTA 2R0BA 3ZMQA 1JLNA 2HNQA 2NT2A 4QUMA 4GFVA 5IBMA 1XXPA 2G59A 4GE5A 1LYVA 2I5XA 4KYQA 2FHFA 2HB1A 1G1GA 4DGXA 4D3RA 3V0EA 2I4GA 1LQFA 1Q6MA 2FJMA 3QCMA 4RI4A 4WU3A 4NWGA 4Z6BA 2I6PA 3D1QA 4IKCA 2FHCA 2NLKA 4BJOA 1PTVA 1YZ4A 2B4SA 2OUDA 1PXHA 1ZZWA 1C87A 3ZM3A 3V0DA 2F70A 3S3FA 4RI5A 3D1OA 2ZMMA 3QCJA 5J8RA 3O5XA 1YGRA 1ZC0A 1FQ1A 4GRYA 1V3AA 2YDUA 1ECVA 2HC2A 3GXGA 1KAKA 4ZI4A 2H4VA 3SR9A 2GWOA 5K9VA 2CMBA 2I6JA 4QAPA 4QBWA 2OOQA 1OHCA 1WAXA 1QZ0A 5KAAA 5M43A 3V0HA 1ONZA 4GFUA 4NWFA 1PTUA 2G6ZA 2FH7A 2VEWA 2VEUA 1D5RA 2QBQA 2QEPA 2HCMA 2Q47A 3F81A 2YA1A 1PA1A 3B7OA 3QCIA 4JBCA 5KA1A 3CWEA 2QDCA 4S0GA 4AZ1A 1GWZA 3O4UA 1G7FA 3QCBA 4B04A 1JF7A 1RXDA 2BV5A 2NV5A 3A5KA 2I6IA 2E0TA 3RO1A 1MKPA 4Y14A 5K24A 5KA3A 2B4OA 2F6FA 3QCLA 4NNDA 5EHRA 3RGQA 2M3VA 2F6TA 2ESBA 2OZ5A 1SUGA 1PTYA 2BGEA 2PA5A 3O4SA 4RH9A 3S3HA 3D9CA 1G4WR 1XXVA 2MBCA 3EU0A 5LXQB 2NZ6A 3N0AA 1QXKA 2CNIA 3S3KA 2CMCA 1VHRA 2C7SA 2J16A 1PYNA 2PI7A 1YGUA 2I4HA 2RF6A 4D3PA 3QCCA 5BZZA 4PYHA 1BZHA 1Q6TA 3QCEA 1YTSA 2PT0A 2CJZA 2BIJA 2VEYA 2I4EA 3V0JA 1I9TA 1YTNA 2QCTA 3EAXA 3BM8A 5KA9A 1NO6A 4GE2A 2GJTA 1NWEA 2B49A 4RDDA 3EB1A 3F9BA 4QBEA 1OEUA 3A5JA 1ZCLA 2HNPA 2HC1A 1LARA 3S4OA 1I57A 1NNYA 1OESA 1PTTA 2NT7A 5K9WA 2B07A 2CNHA 2QDMA 1ZCKA 2I42A 5K23A 4H1OA 1OEOX 2I6MA 2P6XA 1C88A 4HJPA 2CNEA 1EENA 4GWFA 4OHHA 2I3RA 3O4TA 4NX8A 2JJDA 2QBSA 4QAHA 1OEVA 1EEOA 3OMHA 2CM7A 4OHDA 1YFOA 3QCFA 4JNBA 1PH0A 2Y96A 3SMEA 1I9SA 3I7ZA 4R0TA 2CNFA 2FJNA 5HDEA 5GTJA 2C46A 3CM3A 4JMKA 2H02A 3EZZA 5KADA 1U26A 5MMZB 2BGDA 1NWLA 2DXPA 4NYHA 2F6ZA 3V0GA 2HY3A 1T48A 4OHLA 1U24A 4HJQA 5KACA 1Q1MA 3AWEA 1FPRA 3PS5A 2F6WA 2A3KA 3GXHA 3QCDA 4BPCA 2J17A 2HXPA 5KABA 2QBPA 2BZLA 2CM2A 3ZV2A 2NTAA 2J16B 3LJ8A 1OHEA 2J44A 2HVLA 4ERCA 1G4US 1NZ7A 1YTWA 3O3LA 1YWFA 1XM2A 2I6OA 5K22A 4KYRA 1G1HA 2F46A 3MMJA 2F6YA 4GS0A 2F71A 3V0FA 1OETA 5BUGA 5IBSA 4HRFA 2VEXA 2B4UA
chains in the Genus database with same CATH superfamily
5E51A 4AM0Q 5LBSH 1D7DA 1UENA 3S5LG 1NKRA 2Q10A 5HDBE 4YHLH 1KV3A 1ZLDA 5ALBL 5C86A 2K3TA 3S0PA 5LGHL 4ELMF 3OC8A 2BP3A 4XMTA 5C9KA 3PL6A 2P44B 3EBGA 1KENH 3LIZH 4XX1G 1JWSB 3WHE1 1VLXA 2H0JA 4GE6A 5DHMC 1I9IL 1KTRL 2HG5B 1GOFA 2WLIB 3MYJB 5HGHA 4OFYD 1I85A 3BQVA 1JPGA 4EZMA 1M2VA 1T04B 5J12B 1NCUA 3P77B 4TLTA 4UTAA 3T4YA 5EUOA 5HHMB 5DGRA 2LAGB 3DJ9A 4JHWH 4P2YA 2P8PA 3UTTA 1CL7I 3WS3B 1LVEA 3KYKL 2WWKT 5HXMA 2QDPA 3O41A 1IGMH 4CVUA 1O9WA 2XPZA 3NBNA 2Q7NA 3HJ0A 2IPKB 4K55A 5EU3A 2DH2A 1GQYA 4H1LG 1M05A 1PZUB 4LRIA 4Y9FA 3CQFA 2K45A 4Z77B 5F7DB 3WGUB 1UM6H 1T4KA 1RUQL 4KRNA 4OTXL 3UTQB 1YNTA 4XNAA 5M94B 3EZ8A 1HK6A 3TWCH 1J0HA 3K4DA 3IU4L 2BY0A 1BIHA 1VFBA 2NXYB 1ND0A 3EJYD 1IQDA 4L0PB 2E27L 4URTB 2GC5A 1UKSA 4B9FA 2PO6D 3HFMH 4XVJL 1XCXA 4PRIA 3QKPA 2FJGA 1DFBL 2P49B 1PBYA 2HKFH 3K72A 4OAWB 2F6VA 1LHZA 1Q6NA 4ABQA 4I2XE 3G5YB 4EXKA 1VHPA 1PJ9A 4QNPE 4L8SC 1FG2A 4MNHA 5DYOB 1WCBB 2AEWA 5TFSL 5EB9A 1YN6A 4H5SA 1NWOA 4U6YB 3N6YA 4HQQL 3QUZD 4PGBA 4KZEH 3ECBA 3VFOA 1P5VA 3N44B 6FABH 2XT1B 4P57B 4YXKL 3S3EA 2Y66A 2MHAA 2P8LB 3QA3B 1MI5E 4KUZH 5DURB 3SO3C 3WHXA 3WKYA 4RH5A 2ZICA 3GMQB 3UBXB 5D1XE 5E00A 5G4OA 4DZBB 1AKJB 3TF7C 2KZ1B 1R3HB 5ALBH 2EYTB 1FO0A 5B38A 2E6QA 5LGHH 1TR7A 5CFHA 1B0RB 5FAAA 2VDRB 4Y5YB 2UWEB 1S7SB 1CJYA 1UH4A 2XN9B 2I75A 4U31A 4P46C 4U1GC 2JJTA 5I6NA 4QRPE 4KKRA 5E8OB 1WIUA 2O93L 3TESA 2BOBA 3CZUB 4BFGA 5MI0C 5DEFA 1I9IH 1FAKT 3U1PA 3DK0A 1AGCB 1NCAL 2ESVD 3KYMB 1Y18A 3T2LA 3HMWL 1F11A 3H0TB 3F7YB 3MRLA 4WJ5B 5D7KD 1RPMA 8FABA 1IL1A 4BRJA 1WRMA 2NDFA 4AGPA 3KYKH 1K4CA 3CLFL 2BC4B 5ICXB 1PA9A 2Z3FA 4MBOA 3QJFA 4KJYA 3O4OB 3EH4B 2J25A 3MJ8B 4FDWA 4MJ5B 3ULSB 2FH8A 3QWRD 4DF9A 1ADQA 2EDQA 1X9QA 1BZDA 3EYFA 3NVQA 3VSUA 4MZ2A 2RA1A 5FGSA 5IEHB 2YAPA 1MFCL 3TZVA 4FLSA 1RUQH 2R59A 4OTXH 4W9EC 2WN3A 4M93B 1R0AL 1I7ZA 4WW2A 3A24A 3HRPA 1X24A 4HMEA 2KQNA 3UAJD 4XWOD 1MJ8L 1NDMA 4NN7B 1AO7A 3D1MC 1DSFL 1ZT1A 3IU4H 2WIIB 4JGMA 1NEZB 3A23A 5AUMB 2E27H 3T3PB 2NT2A 2ATAA 3AFLA 1PZAA 3OKDB 1QQDB 4XVJH 4G6AC 1MHHA 3P30L 1DFBH 1USQA 1PAZA 2WVUA 5LGKA 2X4QA 5DLML 2W9DL 1YUHB 4ZZKA 2OTUB 3OHMB 4OCLC 3STLB 1EJ6A 3QS3A 5TFSH 2DKMA 1SM3L 5DD1L 1FIGL 2PCPA 4MSWA 1QBLL 3KS0J 3NJXA 4HQQH 1OZUA 4L29A 1HE8A 1A1NA 5CN1A 4XMXA 1I7TA 3VGAC 2NY5C 2FWOB 3ARDD 1OAQL 3BP6B 1HOCA 4QRRD 3V2AR 2WTRB 2EIKB 4YXKH 1M9SA 3FUEA 1VADB 4XMZA 1MCBA 1OSZA 3DETD 2H8PA 3QFJB 4NC0B 4C12A 4XMVA 2GAZB 3RWEB 3CCHA 4P4KC 2KPNA 3BSZA 2B4SA 4AK2A 3L45A 3ZM3A 5DSCB 5JPMB 4BUCA 2OCCB 1GOGA 4JN2A 1YMHA 1F86A 4AGLA 3ULVD 1TUPA 3FO9A 1VFOA 4BZ1A 3BRFA 3UFIA 2JELL 3DX6A 4DKEL 1Z9OA 2XPCA 3P4OB 2WKOF 2XXGA 2PYED 2ED6A 3HC2A 5B8CA 1NCAH 1XH2A 3HMWH 4FJZA 3CVHA 4HMCA 2BY3A 4UANA 1AZUA 2BNRB 1NC2D 2VYRE 3PNRB 5BQ7A 3CLFH 5FFOA 1OW0C 4JFDD 4WEUD 5CEXB 2WVTA 3JV0A 4UBDC 1HWGB 2IGTA 4ELMB 2EIMB 2EDMA 3SYQA 3G9VA 2C1OA 4GIPD 4L3EB 1UWGL 3VG9C 1ILUA 1MFCH 1IJNA 3SE6A 4K9JA 4F91B 3RWGA 4MS8C 3D0LA 1KTJA 4Z0XA 3TJPA 1R0AH 2VEUA 1QI5A 5B3SB 3UYRL 5AG9A 1MJ8H 1A1MA 4KVCL 1XGYL 1INQA 1LO2L 3ZMNA 2DAVA 4OW6A 3KH4A 2VABB 1E4KA 3P30H 4W9JC 1NOAA 1LEKB 5DLMH 1HCZA 2FJSA 1GW0A 2G75B 2HVKA 2W9DH 5I6MA 3Q1SL 5E2JA 1PSKL 3NCYS 4GRMB 1RHFA 1G7FA 4IBQA 3ARXA 5DZVA 4Z3HA 2TRHA 5HGAA 4OFDA 2O5XL 4Z78B 2EUVA 1U30A 1T66D 5G4NA 1ORQA 2ZOLB 1ZY9A 3VA6A 5IR1A 1Z32X 1SM3H 5DD1H 5BXFB 1PZ3A 5GS0L 1FIGH 1XGRB 1QBLH 1G7PB 5A2BA 1QEWB 1R3JA 1PQZB 3FK3A 3PV6B 2XNAA 5JHLA 2WP3O 2F6TA 1OAQH 2VZ1A 1JXKA 1U95B 4LKCB 5LDUA 4JM2A 1U91A 2LU3A 3CZNA 2Z65C 3NDZE 3U1QA 3QEQD 1WFMA 2J5WA 1N8OE 4IRSB 4JGJA 3TPUA 2PLTA 3MRCB 3D2UD 3IMUA 4W9KC 1YPZA 2ZUVA 3ZX1A 2P24B 4OLZL 2XETA 1Z9SA 4Z95L 2FK9A 1B9KA 5C0IA 1P84J 4GUPA 1IM9A 5FYKL 1X5GA 3CVBA 3QRFM 2FJHA 3LRSA 2MCPL 4EZJA 1K2DA 2JELH 3NCXA 4DKEH 3VXQA 3OR6A 5C6PB 1JIBA 3FCSA 4ZQKA 1MCEA 4L4TE 5CINL 4WO0A 1F58L 3SDDB 5TQ0L 1MSPA 3BDYL 1PZ2A 1F97A 5DO2D 1WAPA 3N41B 4KOBA 3MRKB 2B49A 1CD9B 2VKXA 3TBVB 1JXJA 5IB1B 1T03L 2E46A 1IVLA 5I66A 2WCSA 4FCHA 1F4XL 5LAXB 1RUML 4WFFE 4P5TB 5INDA 3VD4A 3EYOB 4UNVA 1UWGH 1YJDC 3O3DB 3TT1L 3LV3A 4PP2A 3GSWA 5E4EB 1OK0A 3VMOA 1KCBA 3UROR 4M6ML 3BAEL 3UYRH 4X6DA 1YHPA 2FQEA 4XRCB 4YE4L 1YMMB 3GTVA 4HEPG 2I42A 4KVCH 1XGYH 1ZE3C 4X98A 2J2ZB 3UCQA 4P0DA 4IKKA 1MHEA 2OAAA 2AXJA 2WQUA 5HI4D 1X9LA 5FLVA 3O4TA 2VMDA 2DWEB 1EEZB 5HPMA 5F44A 4O4YL 3OKEB 5F88A 3Q1SH 3KXFA 1B2YA 1PSKH 4UQ3A 5F0JB 1NDGB 4GG6F 5CR1A 1EXGA 3VI4F 2VLKA 2O5XH 2AXFA 2B8OT 1SY6L 1JOIA 4K5PA 5KYUB 3PWUA 1ZXQA 4WW1A 5DJ8B 5GS0H 2OMBA 1ZGLA 1J9SA 5E8NB 4LFHD 2BS9A 3AG3B 3G6DL 1B2WL 2AK4B 3TU6A 2BIHA 3B2UD 3L2NA 3NIDE 2JB6A 1BF8A 2D7NA 2ZSWB 4P2RA 3W5NA 4A7SA 5I73C 5CZKA 2IWEA 3KR3L 3P69A 2XTSA 3K4ZA 2V7NA 5C7ZA 4YSPA 2WXLA 4Y1AE 3AT0A 3OKMA 4OLZH 5BJTB 3RFZC 3DX0A 5I5RA 4QF1A 4QXUL 4Z95H 1NC4D 2OL3L 4QLWA 2YPKB 3OXRA 5FYKH 2D3LA 4IYKA 4V33A 1NKGA 2MCPH 4H8WL 1L0PA 2EXYD 3NGBB 1KCKA 2F54B 2XG5B 1TQBC 5CINH 5AB1A 1E8CA 1AC6A 1D6EB 3NZHL 1HAWA 4P2OB 1F58H 4LCYB 3FRUA 3KG5A 1JZIA 5TQ0H 2BZLA 2EO1A 5KABA 4HJSA 3P3SA 3BDYH 2OXGB 2EDEA 3HPLB 2FT6A 2XUWA 2YEQA 1W0WB 3MGOB 5KVEL 1DN2A 1PD1A 2VW7A 1T03H 1GZPB 3MV8D 5AYTA 3QQDB 4ETQA 1KJ2A 2D03L 1F4XH 3IFNL 4X0NA 5KWYC 1RUMH 4NSKB 4TN9A 3IJ7A 4FJYA 5I8CA 1YNKL 2YD3A 1BYPA 2PXYD 1HSAB 3A22A 1DJWA 3TT1H 5LJYH 1HX0A 2OI9C 3L81A 3BGAA 1F1DA 4NUGL 4EE2A 2X05A 3W11C 3WFHB 1OTSD 4HWBL 4MDJA 3B7TA 4M6MH 3BAEH 5DJ0B 5IROA 4FG6D 4APQC 5EHPA 1OLLA 2GP0A 4JFWA 2XVKA 4XOCA 3L4CA 2PBNA 2B4CL 3NEEA 1THAA 5HGHB 1JPGB 3C60A 3T9WA 3RTQC 5EU6E 4MHHI 2PWFA 1VF5C 4O4YH 1SMOA 2GFBA 3FB5A 3UTTB 3DPDA 1HC1A 1Q0YL 2NR6D 3K81A 3L3DA 2F7OA 3MU3A 4P07A 5DZAA 1ZTMA 2WQ8A 5F0PB 3BVXA 3S36X 4KH2A 5E4IA 1SY6H 1UA6L 4XP5L 3QT2A 1D5BA 5EU3B 2YXMA 1A6AB 5CD3B 5EFIB 4G42A 4X4ME 3OAYH 2H3NA 1TEYA 4XCEA 2AQ2A 1CGTA 2NY4B 3F7LA 3G6DH 1B2WH 1T4KB 1BX2A 3OX8A 5AW9B 2CM3A 1RZKC 1G1KA 2FR4A 2NTFB 5T3XD 4YSDA 2H7WA 3QJQB 2X4NB 1UB5A 2H03A 1LK2B 3T1FA 1U3ZA 2J4WL 1B4RA 4XBMA 2VN3A 2B2XL 3KR3H 2FEEI 1HEHC 2H32A 5E6IC 3O2WL 3MV01 3R06A 2NYYD 1VFBB 1IQDB 3V7AE 2YPLD 1XGTB 1JNNL 1WFOA 2JKTM 3IDJA 4PRIB 2TSBA 2X4OB 2JXMA 2FJGB 4QXUH 3MI6A 3QIBB 3K72B 4JQVC 4F2EA 1FZMA 2OL3H 2GIXA 1DO6A 2C3XA 2C1PA 3KBPA 3OAYK 4PRBA 5B1AB 5D1ZA 2A0LC 1I8KA 3L5XL 4H8WH 4WHCA 2FVNA 4LF3A 4L4VD 1FG2B 2J43A 2B39A 4DGPA 5BO1L 3RDTC 2FECL 3FTVA 1Y6MR 4DP9X 3GTTA 4Z7VF 4H5SB 2DIEA 3IBOA 3T4AC 3V6FA 2CFVA 3QKQA 4PGBB 3VFOB 5AWXA 1UZ8A 4J3TA 1P5VB 5KVEH 1JYNA 1BEYL 3KPQA 5FO8A 1JZ7A 2B77A 3NABL 3IDIB 3U4EA 1P4IL 4R8WL 3WHXB 5BZDA 2P7TA 2IANA 4F7KA 5C07A 1RIHL 2D03H 3IFNH 4HIJA 2BW5A 1WAAA 2H9GB 4OR1A 1I8IA 3QNFA 1YNKH 3F05A 4XB3A 1CI3M 4JAMA 1WZKA 5B4MC 4PH8A 2WW8A 3QQXA 3E8UL 4R2GD 5DQ9A 3QO0A 4NUGH 4NQEA 4F7TA 2YUZA 3WG7B 2JTDA 3NK4A 4HWBH 1CS6A 1X7QA 2C34A 4XOAA 3VFNB 1UQSA 5J5EA 1S9VA 4ZAKA 3ALWA 2BOBB 2C26A 3ULUL 4QCIA 2XPGB 3AREB 5F0MB 1LEGB 5GS3A 2B4CH 1MCJA 2XFXA 3ESMA 3WJJC 2PWHA 3TBCA 1Y18B 1L9MA 1VSCA 4E42A 4M5YH 8FABB 1RKRA 1IL1B 1T0OA 5ICZA 2XV6B 3RZCC 4WO4D 4F37F 2WXGA 3QIWD 3QJFB 4KJYB 4ZFZA 1EX0A 5D8JL 1UA6H 1GFYA 4XP5H 3VGFA 1WJ3A 5E1QA 5D1XC 3SDCB 1B6DA 5EOTA 1BVNT 2DTSA 4PJ5E 3TZVB 2QVIA 3HNSL 2OR7A 1P3DA 4OQTA 4NRYA 1I7ZB 1SQ2N 2YBRA 2YLKA 4Y9EA 2J4WH 1GGBL 1MFEL 1WEJL 4F7PA 1AR1C 3T2NL 2B2XH 3HUJE 1AO7B 3MCYA 3ATAA 4FXTA 4RH4A 3STBA 1IZJA 3O2WH 4K5OA 4JQIL 2Q05A 3CQQA 3TCXA 4AJVA 4ZODA 4WJG3 3BUYA 4NZDA 5HP5A 2UUOA 1QWHA 1Y0LA 4NI3A 1JNNH 2L3BA 1MHHB 4AGQA 1AXTL 3VI4B 5FCSH 3PIQA 3WO4C 3NZSA 1I75A 3EGSA 1D5XA 3GC3A 3L5XH 3LXUX 3ESPA 2XV3A 4K7PY 4N0CD 3V4VL 2XZQL 1A9VA 4BA8A 5LO7A 5BO1H 4IQHA 3MRPB 1S6NA 2HNQA 4QUMA 3QUXD 4GQRA 2PCPB 4W9IC 3K6OA 3B6SA 1A1NB 3HLAB 4H8UA 4WAFA 1I7TB 2G59A 1BEYH 3WIIL 3P73A 1HOCB 1W91A 3RWFB 2P5WA 3NABH 3CFDA 4BBWA 1P4IH 1UURA 3A6CH 3GI9L 1MLBB 3JUYA 4R8WH 3VM5A 4OUOA 1OSZB 4XXWC 4PBWD 2H8PB 1RIHH 4P23B 3FFCA 3NEOA 4L8SA 5BQDA 3OXSA 4NWTL 1LQFA 1T7YA 1PZCA 2XIDA 4AMKL 5EF2A 4MXVF 2VDKL 3T0EE 3HG1A 4H0LC 1DLHB 3IFPA 4MCZB 2W07A 1ZS2A 3VFMA 3GBEA 3KPSB 3E8UH 4WKZB 5EZPA 5HI5C 1QVOA 4PJBF 4MNQD 2LU7A 4OZHE 4PQXA 5J6HB 3ETBF 3GZQA 3NJVA 2OW7A 2EDHA 3WTVA 4HJJL 2DLTA 1ITBB 1IV8A 3ULUH 3MUZ1 1HXYA 3DX6B 4TLKA 3VQMA 3BYTA 5B8CB 3W81A 1HE7A 3VFSA 1OAYL 3KGRA 3BJ91 4FFTA 3NZUA 2VDPL 4TL5A 1AG0A 3NP3A 4IJ3C 4B9CA 4LLVA 2B59A 2CCWA 3WLWD 3NRFA 3V0VA 5BQ7B 1QKZH 5IQNA 5JMOC 1M53A 4P3DB 4P46A 4HOZA 1GJUA 4PP1D 3IJHA 5DZOA 5L2KA 4WEMB 5D8JH 4A04A 1RSFA 4OKDA 2J6EL 2VZTA 3E6FA 3ESUF 2F0CA 4KJQC 3QUYC 5E03A 3H9SE 3I9GL 2OM5A 4K4KA 3CX2A 5F6HJ 4WQOA 3HNSH 3RWGB 1HN1A 4L2YA 4EI0A 1WAXA 1MCIA 5C0BB 4Z0XB 2N01B 3S8WA 4AV5A 1WEJH 1MFEH 3V0HA 1A1MB 3T2NH 1L3NA 5HHMD 4AENA 1EV2E 3I6KA 3UJJL 1INQB 4JQIH 3QUMA 3S96B 3N1QC 5IEKB 3VH8B 1NH6A 3ECUA 4OCNC 5DO8A 1AXTH 2WQWA 4NQCD 2HVKB 3GDBA 3HS0A 3RKPA 2WPGA 1G9NL 5GXBB 2A7BA 1X6LA 4R4FL 1S5HA 1ZVYA 4HBCL 1CXEA 5HGAB 3CG8A 2Q47A 5D7LD 3V4VH 1H3TA 4BV1A 3AROA 1HEJC 3LD8C 5AKTA 4R84A 5IR1B 4PRPE 2RCSL 1F6LL 2YBGA 4HW6A 4UOW0 3BAWA 5D2LF 1BYNA 1FI8C 1GR7A 1KGYE 1JHKL 2XNAB 4WTZG 1EVTC 1J86A 2Y7LA 3WIIH 5L0QC 2ICWB 2WQRA 1R9FA 2JFHA 4B04A 2J1XA 3N0PB 2FO8A 3GI9H 1I8MB 3UC2A 1TEGA 1PZSA 4JM2B 3G04A 1J18A 5K9QI 1QMUA 3F7VA 4NWTH 1CFNB 1SZNA 5B1JC 4CKQA 4AMKH 2VDKH 1A7BA 3R19A 5BRPA 3VXRA 4XT1C 3MX0B 4N0FA 1YPZB 3DIDA 1GYUA 4JO2L 2VUKA 4TOYL 4LVEA 2AJXL 4Y19A 5A6MA 3RGQA 1NDTA 4HP5A 4OZ4A 4RNRA 5KBNC 2VDML 4D8OA 5F7WC 4GUPB 3SGJA 1X5IA 2CCVA 4Z7QE 4Q2ZB 3UDWC 4HJJH 3BFOA 1K2DB 3US9A 2EDNA 3VXQB 3RBGA 2FL5A 4Y89A 3E38A 1OAYH 3D6GA 5DURD 5C70A 2E9GA 2VDPH 4P4KA 1N5YL 4LMQE 1I1RA 1AKJD 4IM8A 4PLOB 5AZ2L 4UILL 4WHYH 2WLNA 2LLNA 1LO4L 4WEBL 1BZHA 2V2XA 1Z6JT 1R34A 4PJHE 5I66B 3ABGA 1EEUA 3ZHNA 2J6EH 4K15A 1MHCA 2XN9D 4NC1E 1N6QL 3I9GH 3D25B 4R4NC 3V5KB 5IOPA 5KA9A 4PD4J 2H2SC 4PP2B 1ZWIA 3OZLA 1SN2A 4OIBA 5IHWA 1XEUA 5KBLA 4K3GA 2XWBA 4IKNA 4O02A 2FT8A 3B3IA 1OW0A 3B8SA 4X98B 3UJJH 1WGOA 4KKBD 4HCIA 4UDTA 4JFEE 1IBGL 1TPXC 1MHEB 4CMMA 4OI8A 4H8QA 1O5ZA 2OYPA 3QEGL 5IJBC 3G5WA 5HPMB 5F88B 4FG0A 4ZUWB 4UQ3B 1C12B 1G9NH 1U58A 1ID2A 3KXFB 1H6UA 2QKSA 3MLXL 4NAMA 4R4FH 4HBCH 5I19L 3N42B 3HAEA 2AXFB 2AJVL 3LN9A 2I6MA 4I9WE 2OZ4L 3O3EA 2BSSA 3PWUB 4WW1B 1G9HA 2RCSH 2AQ3A 3L9EA 1HH9A 2DQDL 1G6RB 4GMTL 1JHKH 2VW4A 2YPVA 3BESR 4YSUA 4LMQI 4WHYG 3R8QA 5K9OA 4GQZA 4P2RB 3F7KA 1FNAA 3U0PB 3KM2A 5GS0C 1SDYA 1RZIA 3GHEL 5D55A 3HG4A 5I16B 3IU3A 4I3GA 1BVKA 2V7NB 3SMEA 4Q7DA 4N0UB 3RVVC 3OKMB 1I9SA 2CNFA 3NPSB 4JO2H 4MXQC 4QF1B 5IB4A 2AJXH 3MTXA 4TOYH 3SJVB 1SXAA 3P4NB 2VDMH 4KJWC 3FFDA 2VQ1A 2ADFL 2J8OA 1J0ZA 3OWRA 5JOFA 1ZHBA 3C09B 5IVXE 3T3MF 5EZLA 2WUCL 3B9VA 4YN3A 1NGXA 4XN2A 1CQYA 1EAPA 3AG4B 4MX7A 3MCLL 2DI7A 4JDEA 1TJHL 1H5BC 3QFJD 4TVPD 4U1NB 5AZ2H 1INEL 1N5YH 4KKAC 4UILH 4JFXA 1LO4H 4WEBH 4UOJA 3QZNA 1UD2A 2B15A 3G5XB 3G6AA 5E5RB 3D8MA 1N6QH 5I8CB 1AXIB 3MLUL 1CGVA 2WC7A 4JLRB 2ROYA 4W9FC 4JX0A 4XNYL 5J7CC 1JYVA 3LZLA 4AZ8A 4QWWC 4EVNA 5HHOA 4YC2C 2R29L 4XE5B 3OKOA 3PWPA 4RX4A 2VXTL 3ATDA 3OLDA 4JKKA 4RFNC 3DX4A 4P2QA 3CZGA 1IBGH 3ZHDA 4GXFA 4L9LB 2F46A 4AEFA 4B3EA 3C60B 3UADA 3GLZA 2WY3B 3QEGH 4PV8A 2CA4A 4DP8X 2GFBB 3HW7A 1DYZA 5CLYA 2VR6A 2QQNL 5DRWA 5F96L 3MLXH 5AW6B 3D08A 1PCSA 2CKNA 4YHPB 4GXVL 5F7LB 5I19H 1G1OA 2AJVH 1S7TA 4H0IA 2WKLA 2OZ4H 1IRAY 3ILEA 2V9QA 2JJVA 2FSEA 5D7JC 5J56B 3GUTA 2FJFA 1J8HE 2VM3A 2H3NB 4GMTH 3OX8B 1BX2B 3LN4A 2HTKD 2FR4B 3I6LE 2R69A 3B9AA 1UB5B 3QZOA 4OKVA 3T1FB 3GHEH 5F70A 1AD0A 5CO1A 1P4BL 1W8EA 2JJWA 2AMGA 4U3SA 3R06B 5HYJB 5I1LA 2FYYB 3WGVB 2LFEA 3LEYL 1GCYA 4W9HC 2AVFA 5J9PB 3Q2VA 5BRZE 2D2CC 2C1PB 1RCYA 1DQML 2UVEA 4J4PD 4UNTA 1V05A 1IAII 3S5LA 2IF7A 1O6TA 2ADFH 5T33L 4LF3B 1A21A 2CPUA 3WNMA 5D2LB 2WUCH 1VGKB 3RWDB 2EDLA 1YECL 4JVUA 3VACA 5C0CA 3MCLH 3U82B 3V6FB 1TJHH 4TNWF 5MEOA 2AEOA 4N2MA 1INEH 3OGCA 1UZ8B 4UMSA 3RFZA 4IRSD 1IC5L 4KDWA 4H25B 1SF3A 5FO8B 4CVMA 2KQMA 1YEIL 3GXTA 3U4EB 2DYRB 2YQ2A 1DTUA 1HS6A 3KWVA 5BZDB 5D7IF 2IANB 3N2JA 5GS1C 5LGJA 2MEJB 2X5OA 1OE3A 3EDDA 3BQUB 3RGHA 1BXXA 3MLUH 3MRFB 2BIMA 1F3JA 2IFFL 1ZS8A 5DQ9B 1FHGA 3QO0B 4HV4A 4NQEB 1A6ZA 4XNYH 5F9JA 4IKJA 4F7TB 5I82A 3HKFA 3L4YA 3RL1A 1U25A 3SDDD 1UQSB 5B3JE 2D7OA 1S9VB 2R29H 4H1LA 4ZAKB 2VXTH 4MD0A 1NGZB 4QCIB 2X42A 2EYRB 1KSRA 4PJDF 2XFXB 3H2QA 4E42B 6PCYA 4W6WB 2A3TA 2YD9A 3CVDA 1K3ZA 1XF5B 5ICZB 3BP5B 1WWBX 3MNVB 2QQNH 2VL5A 5F96H 1JZ4A 3OB8A 4NZRL 4GXVH 2B4CC 4M6NH 4ZFZB 4HJGA 1ZTXE 4Y0GA 1DJYA 4I18B 3W37A 4APQA 1C84A 1Q6SA 3KWXA 5I24A 5F97E 5EWIL 5EOTB 3LNEA 5J1AA 4KZCA 2Z6FA 4KHTL 4TTGA 2VN7A 3RTQA 3V0IA 1U3HD 3AT8A 3N40P 4NRYB 2YBRB 4MA8L 2MTPA 2N1KA 4PW9A 4Z18A 5C97A 5EC1A 4ODBD 4F7PB 2OK0L 4TLSA 2PQ5A 4KMLB 4M43L 1BFSA 1P4BH 1IAIM 3BUYB 3R8BB 3LEYH 3ISRA 5I6VA 1FC2D 5IBLD 1AXSB 4NLAA 2ZP0T 4H40A 3PIQB 1DQMH 3T6QC 5T33H 3EGSB 4EDXA 4J12A 2DQUL 4XMPL 5GS2D 3ZQWA 2VXQA 2C9UA 2GQHA 1Q9OA 4DFHA 1Z0NA 2PP8A 2X44D 4WI4A 1YECH 1PZ5A 3KW8A 5ANHA 3CH8A 4X6CA 3FXIC 4Y4KC 3RGOA 4N5ED 1FFOB 3S3DB 3BP4A 1AHKA 1IC5H 5CEZE 1SLVA 5DMYA 2VITA 3WAJA 3CZFA 1KTLA 1YEIH 3C12A 2P5WB 4HD9A 4JQVA 3VXOA 1S78C 4CN4A 4KJPC 1UACL 5F6HI 3FFCB 3C5ZC 1BF2A 4RMBA 2CUHA 3LB6D 1U8KA 2ZONA 3GKWL 3V5DA 1I3GL 1U21A 3HG1B 1LP9F 4HAFA 4MZIA 1SXSA 2GK0B 3IFPB 5D1QC 3VFMB 2IFFH 2BW4A 2I5XA 4GSRA 2GCBA 3WE1A 4AEHL 2VZUA 4G8GD 3ZKQD 4P2OD 1IKOP 1H6TA 3QORD 2PPCA 4RRPM 4JJOA 3VRIA 3BLBA 3SO3B 3SQOH 4DESA 3DRTA 4YFLF 4IMLA 3VFSB 5C71A 4FQHB 2PETA 1WD9A 1N0LB 3SE9L 2A77L 3O2DA 3QCMA 3EUUA 4LLVB 5DMKA 1LO0L 2E8ZA 2B59B 2FGZA 3NJHA 2ZXQA 4GIOA 1P5UC 4NZRH 4U1GB 2FIKA 2GJJA 3IJHB 5DJ2B 1UT2A 4GBXC 4CMHC 2BLFA 3E6FB 5MI0B 3ECQA 3FUIA 2Y2YA 2FUTA 2XXCB 3Q3GB 4HZAA 5EWIH 3K2MC 3MBXL 3WJJA 2E0PA 4KHTH 2GJ6B 3RIAK 2F70A 5I17B 4UI2A 2DWSA 3TL5A 4NKDB 4MA8H 3NESA 3MJ6A 1U8LB 3GMRB 4QKTA 2OK0H 3RZCA 4HUKB 3BJLA 4M43H 4QO1A 4HS3A 5LBGA 5DMJB 5IMKA 4CBZA 1IZKA 4QRBA 4KQ3L 5D1XA 3QULA 1VB9A 2FLRT 5IB5A 3X12B 4NIKB 2YD0A 1QHPA 4N5UA 3N5AA 3BPOC 4QTIL 2WSKA 1FYTE 2DQUH 1JGDB 2NY4D 4XMPH 4HCFA 4YHZL 3SD2A 4FEMA 1I1AD 4LSSH 4CAGA 4ZZFA 5FW6A 1U8NB 1XF1A 3GSXA 4AH2A 2FBJL 2X09A 2DM7A 4GW4A 2KHAA 1AS6A 2NY3B 2VERN 1Y07A 3LHPL 3ULAB 4WUUA 1INDL 4KNSA 4MA3A 4N3UA 1QSFD 1UACH 4PRID 3F81A 3KPNB 3G04B 3QIBD 3F7VB 4J8RA 1OT2A 3QCIA 3GKWH 3VXRB 3W0WE 4N0FB 3RX7A 4ZFGL 4S0GA 2FWSA 4QLRA 1WS7A 3MRIA 4W9DC 1IC1A 2EVJA 4OZ4B 4RNRB 4AEHH 3QCBA 1HOEA 1LWHA 1KGXA 4IRJA 3VGAB 2NV5A 4XXWA 3LRKA 4TF4A 5GGRY 2H26A 2WXFA 4E9YA 3QWQB 2D7PA 5GRVL 3U4BH 2FL5B 3VI3E 1FL5A 4BSWA 1RJLA 3NCEB 3SE9H 2A77H 2DM3A 3FQNA 5FHAL 1W2KT 3S8GB 4OJAA 4TNEA 1LO0H 2ESBA 3VU1A 4ZSOA 2CBQA 3ASOB 3OQRA 4JHBA 2PTVA 1EEYA 1SHXA 3QC5X 2QZQA 3ISWA 2EE9A 1R19A 1S5IL 4RWYL 2C9XA 3GRWL 1MDAA 2IALA 5FO2A 5ID0A 1X5KA 3FT4A 1MHCB 2NY6C 3KLAA 3O6ML 3H9YA 3DV6A 2CMCA 2IH3A 2HN7B 3GEWB 2WXJA 1PYNA 3MBXH 1YGUA 2I4HA 1OPGL 3ARED 1ZWIB 3OKLA 3SGEH 3IFLL 1QLRA 4O02B 1NIAA 4XBGB 3SOTA 2IXQA 3DARA 4U7KA 1B9ZA 5E5LA 2MQ0A 1I3VA 1NPJA 4EN2A 4OF0A 3I75A 1M1SA 2X89A 4UDTB 5CAYB 3NCMA 4KQ3H 4CMMB 4O2FA 3COOA 3QUYA 2NY2C 3EJZD 4Y88A 4OJYA 1CE1L 1JK9B 2ZG2A 4R3SA 2HH0L 5FF6B 3VG9B 3TXAA 2HJLB 4JPQA 5AOLA 4FC3E 3SDCD 2PABA 4QTIH 4ONHB 1WWWX 5HDBF 3NFPA 2CK2A 1Q90A 3HAEB 1I53A 1N0XL 3WUWG 1T2XA 2AHIA 4YHZH 3O3EB 1DVFD 2BSSB 2ZJSL 4UV7L 3KGUA 2ZXWB 3NSJA 1G9NC 4NC1C 2F68X 3DGDA 4BFKA 2FBJH 4JZOA 3WO3B 4M56A 5AWNL 4WRLA 3TT3L 2NNFA 5JIQA 2DBLL 4POZC 2MCAA 3IMVA 2CNHA 1L9SA 3L3IA 4GRWH 3LHPH 5K9OB 4GI8A 2Z8SA 1INDH 2UYLA 3UTZA 1UJ3A 3WS6C 4H1OA 2X4UB 1RZIB 4LLWA 3IU3B 3ZOAA 3LQZA 3PAUA 3U7WL 3FTYA 4JRYE 2A1WL 4ZFGH 3D4ZA 3HLKA 1VFUA 2K9FB 3IRCA 3NA9L 1WPCA 4FQXD 4BXSV 5IB4B 2QBSA 5PAZA 3ESNA 2FX9L 2AKRA 7FABL 4C4KO 5K5YA 3TBYB 2QVTA 3OMIB 3PUCA 2IGLA 2WZ6A 4LEBA 4J3VA 3VX0A 5JOFB 1ZHBB 4LCIL 4MCMA 5EZLB 1NGXB 1EAPB 4BQ8A 4MX7B 5B1JA 1J5CA 4WGWB 4HC1A 4JDEB 3NSYA 4G9FE 2ZWKA 1JPFA 1R3KA 3C8KA 4P23D 5FHAH 5CZVL 2MSPA 4OZIE 4HEPA 2WV3A 1XBRA 5KADA 3HHRB 3ESVF 2ITDA 5C1MB 4HKZB 3KPSD 1S5IH 4RWYH 2WLKA 4IIZA 5DVOA 1HHHA 1FFNA 1QR4A 3GRWH 5FYLD 3UDWA 1LP9B 3J07A 5DEZA 5JA9A 3O6MH 1EO8L 1L5GA 2VRAA 3HMXL 5E99L 2A9AA 3NPZB 4NFBA 3WNLA 1OPGH 3CUPA 2VLMD 3MJWA 4QNPF 5GRVK 3HE6C 4TM9A 2XSKA 1U4FA 5KJ4A 1I8LA 3BPLB 4RWHA 1MHPL 2YD8A 4AZ8B 4FTVB 3IFLH 1U24A 4WTXA 5KACA 1UXSB 2V2TA 3UYOD 4EVNB 5HHOB 3GJFH 4PJ6A 3KVDD 4L0YA 3K6FA 1XO8A 1LGVA 3OKOB 3PWPB 3O0LA 2CPCA 4I1RA 4P2QB 3TIDB 1U33A 1YUKB 4Q9CA 1W78A 5DHVB 3ECVA 2CM2A 2R23B 1KYOK 5G55A 2HRGA 1CE1H 1AZVA 2DD8L 3LKOB 2HH0H 3IRPX 5GPRA 3GIVA 3SGDH 3VYOA 1KWKA 3ZV2A 4PV8B 3PXHA 5E6RB 5DRWB 2W8CA 2BNQE 1VRSA 2H4EA 4DGYL 4LLAA 4ERCA 1N0XH 5K39B 1H8LA 5GGVY 3ZE1B 1S7TB 5BV7L 5IESL 1S9XA 5F6IC 5C0BD 3AG2B 4QGTA 2ZJSH 4H88L 4UV7H 5EN2B 2OMTB 3OKKA 4C56A 4ZMZA 2FSEB 3GJFK 32C2B 4IBWA 2GSIB 4Z7UE 1KT2A 5BUGA 5HDQL 3D85A 4L4TA 5AWNH 1HH6B 2WO3B 1KYAA 2Y7MA 3LN4B 3TT3H 4ZUTA 1BQHB 2DBLH 4G7RB 5I15L 2MNJB 1VKXB 3P3RA 2YIHA 5GZOD 4OKVB 2UUDK 5I0YA 4GKZA 1XCTA 2IBGA 2YK1L 1AD0B 4K8RC 1ZV9A 4NC2B 1GZQA 4AQEA 3LPFA 4U3SB 3U7WH 4N8VG 1ZIBA 5I1LB 4WSJA 1KB5L 1MG2C 2A1WH 5KUMA 3NA9H 2HMID 3ET9F 5C0AE 3KDMB 3T77B 2EEAA 2FX9H 3CDZA 7FABH 1TQCC 3VE0A 2CIKA 4U3HA 5E6ZA 1ZD6A 2PR4L 1XGQA 4LFHG 1MLCB 1NAKL 1F6AB 5MENE 4LCIH 1A8JH 5GGTL 4R96A 1MFBL 1MH5B 1T2QL 4OGXL 3QRLA 5I73B 5C0CB 5AFAA 3P0GB 1MCPL 5MEOB 5CZVH 4E41D 4FG2A 2JV6A 3RFZB 1BQUA 3TEZA 4BYHA 4LPTA 3RUGE 2F00A 2APVA 5DD0L 4YGVA 1LE9A 4PBDA 1FL6A 4NYLB 1EO8H 3HMXH 3Q48A 5E99H 5F7YC 1TQBB 1MCNA 1F3JB 1JF5A 1UG9A 3GWJA 2NNAA 4N2NA 4FZ8L 1H5BA 4QT5A 3ZTDC 5F9JB 1MHPH 2YEZB 2XJLA 3F3HA 3RL1B 2SHPA 1FN4A 3O45A 1Q94A 3R7RA 3EXLA 1C85A 3BPCB 4BUHA 3BPNB 5FYJD 2IC2A 1YY8A 4JQXC 1AG6A 5AAMC 1T7XA 2BCKA 2WBJB 2QCJA 1KB3A 2XN1A 1XIWC 3PGFL 3WEBA 2DD8H 5DRZB 5E4AA 1VA9A 1LQBC 2OI9B 3AQYA 3GSQA 5BMFL 4MMXC 2VL5B 3TA3D 3TH4T 4KK5D 3A3YB 3V6ZA 4DGYH 4FFWD 4RGOL 2EIZB 4KKLD 1G7GA 1HTYA 3L1OL 5IESH 2FHBA 5BV7H 4UF7C 3ZRCC 2V9RA 4APQB 4MASA 2VZVA 4QPEA 4H88H 1L8KA 3GDCA 4HLJA 2BSRB 1PKOA 3P54A 4H8PA 5HDQH 5IVNA 2MOQA 3RTQB 1KPUA 4YSOA 5CIPH 4HIEA 1XBOA 1EHXA 1I3RB 4IOSA 1F8TL 3SPVB 3WENA 3WELA 2YK1H 1LO5A 2WSDA 5KN5A 3DXAA 3OWEA 3C8HA 1ASPA 3RPBA 2JCCA 1KB5H 4PJFE 2BZCA 2CR3A 2XYCA 3QUZC 4N2IA 5D7JA 1WO2A 4NXSA 5HDBB 3NCJL 2GBTA 3ZU8A 4KXZH 4W81A 3MXVL 3QR2A 3RJDA 1NCWL 2IBZY 3RKDD 1GSKA 1SY6A 3VFRA 2PR4H 4FNQA 1VCAA 2UXTA 3U2IA 1NAKH 5AD0B 3HNVL 2ENQA 4JFFA 1Q9OB 2ZG3A 5GGTH 1MFBH 1T2QH 2W0PA 4OGXH 2J73A 2HSIA 3ARTA 3HG2A 3FTXA 3KWTA 5IUCA 3MHZA 5E6IB 3ZLQC 4P2RD 1YPTA 1MCPH 3UG5A 1RLBA 4DO4A 5IHHA 1ZLUH 1M3GA 3BP4B 3VXMA 2Y2FA 3K71B 1G9ML 1Z9MA 2V7HA 1SF5A 4GQQA 4AMXA 5DD0H 3SJVD 2I9TA 1NLBL 3RZ2A 1E8YA 4G3YL 2WGPA 3V5DB 3RDTB 3CZEA 2X6MA 4CW1A 4QJ3B 2OL3A 1CLVA 3T4AB 4GSDL 4FZ8H 3FOMB 1U9KA 3LPWA 5C0GB 2HFEA 1ZLUK 1WD8A 4NB7A 1ACZA 2JFGA 2E8YA 3VRIB 2MQ3A 5GS1A 3ARWA 4YQXL 3DOSA 4W6XB 3NA4A 1JLNA 1ZCRA 1PKQE 4Y8DC 1U3YA 2IDSA 1XXPA 4PJIE 3PGFH 4CUCA 4F5CE 2EADA 4UTCA 3RQ3A 5DMKB 5BMFH 2F7RA 3RI5K 4XGZB 4RGOH 4XWOC 2FIKB 3UAJC 3FNKA 3L1OH 4QHLA 1D7CA 1L9NA 5IMOB 1DQTA 4I2XB 5FPIA 3VXTB 3MA9L 3HBPA 4LHUB 2JKSA 2Y36L 4TUJA 2NT0A 4XXDA 3H8NA 3VQLA 1W80A 2Q2LA 4HWBA 3D12B 5A2KH 2PWDA 5L88L 4X7TA 3IFOA 3BVUA 4DUWA 3SKNA 1F8TH 5IREA 4TUOA 2XKNA 2QSCL 2Q86A 3RZCB 5J0BA 3ARYA 2IAAC 2FHCA 2B08A 4QO1B 3TLRA 2EEFA 1N2RA 4LSRL 2LVCA 2J1YA 4P9ML 3DTUB 2YSSA 3IN0A 4FI6A 4XTRD 2YD4A 5D1XB 1BJMA 4XN9A 2NSXA 5J11C 5DVPA 2I60L 3AABA 2YXFA 3NCJH 1EPFA 3IETA 1CLYL 1ID5I 2BZ7A 3MXVH 1NCWH 1Q0EA 5J8RA 2WJ7A 2HPOA 3D50A 4UM9D 4CSPA 1P7KA 2YDUA 2WO2B 3HEIB 3HNVH 3II1A 1AR1B 2R1WA 5ABZA 2PWEA 2GWOA 1TMCB 2B20A 4QXGL 2I6JA 4AH2B 4JY6A 4RA3A 4LPWA 5HYJD 4ZOCA 1G9MH 4GW1A 3ULVC 4UM8A 1JPSL 1ONZA 1NLBH 3PWNA 4G3YH 4O2CA 5DTFA 4KO6A 3GM0A 1H3VA 2VDRL 4C83B 4LHQB 3BD5A 3BIBX 4GSDH 3MRIB 4Y4KA 2J56A 3JV4A 5D5ME 4BHUA 1W8OA 2J1KA 1MCKA 1KBGL 3ZRFC 3TURA 2X12A 1MFMA 3G9AB 4KO9A 1FDLL 3KPRA 2WBXA 4U3CA 4YQXH 1SMAA 3HI6L 1SUJA 3C5ZA 3RIFK 2IJ0C 5DGQA 1FL5B 5DDHA 1MVYA 3NIDF 4A7UA 1RJLB 3HUJA 2F1AA 3OMZA 4M8VA 3X2QB 3CXDL 5TGBA 1E4XL 3FQNB 1U8OA 1AIZA 2FWUA 5D1QA 4JMNA 4ODVL 3O4UA 3BQUD 1PEWA 2G3ZA 3FTSA 3NTCL 3WIHL 3WXVL 3DV4A 3RU8L 3CE1A 2RFXA 3A5KA 5I6LA 3TFKD 3AXIA 1COBA 1P7BA 3RWIA 5ID0B 3D3VE 3MV7A 3KLAB 3ZE0E 3MA9H 2CHWA 2Y3AA 2Y36H 1X5ZA 4ELDA 3V0WL 1E2VA 4PY8J 2Z93A 1SUGA 5L88H 1EEQA 1NPNA 3OKLB 2Z34A 4IJ3B 4N2OA 1QLRB 1XWVA 2KDGA 3QQ4A 3D9CA 3MNZA 2QSCH 1P5UA 1NCIA 1HHGA 2IXQB 3MRHA 3CDFA 3FUNA 4LCWA 1T66C 4LSRH 3TEUA 1OXYA 5TDPB 2CNIA 4GBXA 1DQIA 2ED7A 1QFUL 4P9MH 4PVNA 5E9AA 4W6YB 4WTZA 4HKBA 3ZE2B 2R9HD 5HBBA 3QUYB 3CTTA 3OV6A 4WFHE 4G59C 4KTYA 2I60H 4D8PB 1GMEA 4R3SB 5I30L 1CFSA 3RNKB 1CLYH 3QWNA 1IBFA 2BSEA 2WLYA 2YA2A 3GGWA 5BPPA 3X11A 5K59E 3AS2A 5DHXB 1J5OL 3D34A 2EO9A 4LSUL 1ZXKA 1I9JL 5CP3H 1MY7A 3E7JA 4QXGH 3T04D 4JZOB 4Y1TA 4BFOA 4QRFA 5EO0A 4N2KA 4BH8A 1A6TB 1JZ2A 4XCNB 2ZTBA 4G80A 4TXVB 3FSAA 3BX7C 1EUUA 4ODTL 4TVPL 4J3SA 5F72S 1JPSH 2UYLB 3UEQA 2B1AL 1ADWA 1DJZA 4RZKA 1LD9A 5AW2B 3PQYE 2VLJE 4LLWB 4N2DA 5DMGC 2NQ3A 3VGDA 4MJ4A 2G3XA 1UWYA 1JSYA 3JYCA 3LD8B 5K9WA 4MKMA 1SNRA 2VDRH 1UD3A 3MVNA 2RQEA 4GRLD 2IWFA 5E1AA 2AKRB 2WBWB 5L0QB 1KBGH 3V4VA 3FTGA 5D7SL 3X1NA 4PWHA 1TVHB 4PRHE 4GH7B 4OJCA 1FDLH 3KHQA 1GTFA 3HI6H 2VIRA 2P5WD 2ADIA 2APBA 1MCHA 3Q6FB 3TC9A 4XO4A 3IDMA 7PAZA 3CXDH 2A74C 1E4XH 1R3KB 5GSRA 5DVNA 2WLZA 4AYEC 4QAHA 4XE0A 1P6FA 1OEVA 4ODVH 2Y1VA 5JA8B 2LGNA 1RJZA 3NTCH 3WIHH 3HG1D 2ITDB 3ILPA 1UVQA 1HESA 1G7HA 3RU8H 3WXVH 1KACB 5I5IA 4GMSL 1HHHB 3FU5A 3H3PL 4ICWA 2WXIA 2YZ1A 1L5GB 2WXPA 3IJSA 1BM3L 3V0WH 3FB8A 1BBJA 4L23A 5E1HB 3F58L 4AG4L 3CUPB 4PRPA 4X6DF 1HJBC 1Y6NR 4QY8B 3EZZA 1F90H 1F3RB 4OT1L 5KSBE 3T8VA 1P4LA 2OPCA 3UBXG 4BZ2A 5G2NA 5F93C 4ABVA 5TH2A 3WTXA 4NCC1 3QIUD 3S3PA 2F7IA 1HQ4A 1F4HA 1QFUH 1HVXA 3F84A 5DVMA 3RPIA 1I31A 3INOA 3FC8A 1T1YA 1PIFA 5I30H 2P28B 3GSRA 4WI6A 3BWZA 5FA4A 3B2UC 3ZUNC 3AU1B 1R6VA 4G1EA 3JWDL 1P7QA 3I85A 2HAZA 4LQFL 2J6EA 4HS8L 5D4JA 1NWPA 2GJ6D 4NX0A 1J5OH 4B9ZA 3EH5B 1A1OA 1S9XB 2FAUA 4LSUH 5DJ6A 2QDVA 1I9JH 4LIQL 2K8MA 3QCDA 3OKKB 2YJQA 4RMVA 4C56B 4ZS7L 3CH1A 2VUYA 3E80A 4X4KA 4JFZL 1SXZA 2ZQKA 4L4TB 4XNMA 1BFOA 2VR4A 2ZWSA 3NIFE 5IW1A 4TV3A 4ODTH 4TVPH 1JF1A 4BRVA 2B1AH 4GKZB 2EXYC 1XCTB 3OJ2C 2F8XC 1RHHA 1GZQB 3OLGA 2I6OA 2WXHA 3LKNA 4JREC 5C09A 1IE5A 1TZIA 1ETZA 2J7LA 3IMRA 4MTMA 2F6YA 1R3IL 1WBZB 4TQHA 4N6RA 1JPST 3RP1A 3CDZB 4LBEA 2CIKB 3ZY7A 3QDAA 5D7SH 1SVBA 2CO7A 3AC0A 3HPJA 3C6SB 3ULUE 4PTUA 2BPBA 1NEZG 3WS6A 3DJRA 3I9AA 5DFWH 4R96B 2NY3D 3KLDA 2PXYC 2D9QB 3MJGX 1G7MA 3O0RL 2VQ4A 3B9KC 3OJVC 4P06A 3ZDZE 3O4LA 3GSVA 5KS9E 1OGPA 4PGEA 3NAAL 4N1EA 1WHPA 3VXRD 2YAOA 1QRNA 4K7PX 4GMSH 3OR7B 1FPZA 2EZ0D 3H3PH 2KLTA 1AAJA 1LE9B 4HETA 1P9MA 4BKTC 3ZT7A 3AT9A 2KH2B 5ISZE 4JPVL 1BM3H 3OD3A 2XA8L 2DB8A 3BEWA 4I0CC 3KWUA 3U25A 3HHSA 3F58H 3VXSE 2MNWA 3BUIA 4AG4H 1H5BB 1GA2A 1WFUA 4QT5B 1HXMA 4HJTA 3T1WA 4OIFA 4OT1H 4U2YA 2R0ZL 2NR6C 3FQRB 3O45B 2R4SL 1Q94B 2EVIA 4D0DA 1OY3B 1V3LA 4DN4L 3NIDB 1ESOA 4HSCX 4RFEA 2B3OA 2CHNA 2BCKB 1KOAA 1RAMA 43CAB 4PG2C 2BHFA 4JRXA 2EABA 4YSAA 5I6PA 2CBTA 3HFFA 1DBKL 2Q6WB 5M95B 2AITA 3GSQB 3HE6A 4ICXA 3JWDH 4PJCA 2X53A 4LQFH 3B2DC 4HS8H 4AQ8C 2GC7C 3WHE0 1T5XA 1DSWA 4YK4B 3RFRA 4UQ2B 4YC2B 5JDSB 1A7OL 4P3WA 4LIQH 4HIHA 1F3DH 2NYYC 2MOGA 4RFNB 2D0FA 4OZHF 5T3ZD 4X5WB 3GXIA 5E2UL 4ZS7H 3NJNA 5J3HC 5HSFA 4JFZH 4AV4A 2FWLB 2EH8L 4UBDD 2CM6A 3BLUA 3LYRA 1CFVL 1URIA 4UQCA 1L9QA 2FQGA 5IBUG 4A2DA 2DM2A 4P04A 1ETA1 4KK6C 4B9PA 3MBEA 3UTSE 2UZXA 3VCLA 4RQQA 1JZEA 1LO5B 5KN5B 2ETWA 2F53E 2JCCB 1LL1A 1MVUB 1SHWA 1R3IH 1V3KA 1CBJA 5D7JB 4G6ML 4WU2A 4FZEL 4N2LA 4JZJA 3BVTA 4L18A 3L1FA 4LPYA 2IDTA 2ZOOA 5CXPA 2KMWA 4RMQA 3VFRB 1YEGL 3MVSA 3VSQA 2WXOA 4JFFB 3MO1A 2C4XA 4V11A 2HT4D 3O0RH 3D39E 1FGNL 3FQTA 4HIIA 3U7AA 4LEOB 4X6BB 3NAAH 4HUVB 4QR7A 2V7HB 1QPPA 1ZV5A 2RHEA 3IPBA 3MC0A 5SWZE 5I0DA 4ZMXA 1SEBA 2HXAA 3LPPA 4DCQA 2I9TB 4KKCC 1CYGA 3CV5A 4JPVH 4ZYKB 5DYFA 2XA8H 1KIUA 1KCVL 4CW1B 2A6IB 1BIIA 2OL3B 4PI0A 3IJ9A 3J27A 2D4DA 4MCYA 2H04A 2H3XC 4NO3A 3S3JA 3SYOA 2R0ZH 2R4SH 4U2ZA 4DN4H 3PHOA 1QUNB 2DL9A 5GS1B 3CXHK 1XT5A 4L1HA 2N4IA 1R5IA 5PCYA 3D18A 4CVXA 1NGWA 2EDJA 2H41A 2OZNA 4MJID 4XPHL 5CU9A 4P4RB 1OGAE 1EWHA 5KA0A 2NX5E 3LZRA 4XB8A 2DKUA 5AVVB 2Z8RA 4OFYA 2A9ML 1DBKH 4IU3A 2CRIA 3ML9A 4E9WA 1WLHA 4CNIA 3WNKA 2AQ1A 1UYWL 1FPTL 3N04A 1MZYA 4EI5B 4QRUA 1SOXA 4FERA 1U6AL 3L5JA 1MCFA 1PNCA 1F5WA 4QHLB 2YQBA 1KGWA 3EYUL 4WWPA 1A7OH 5ESQA 1WBXA 5C92A 3BZ5A 4FTVD 5DK2A 3PWJA 5IBMA 3IYLW 4XBPA 2CBMA 4TUJB 1E8XA 4JQXA 5E2UH 1Z1WA 5AAMA 3RZWA 4XNQA 3CPLA 4U1LA 4JE0A 3EJQA 1RU9L 1XIWA 4X5PA 2EH8H 2V3DA 3IWVA 3IFOB 3NCYP 4MQXC 1CFVH 3DA0A 5KYXA 4DGXA 2XKNB 4MMXA 2ZKYA 2Q86B 4YHIA 1PZBA 4B53A 1I4FA 4RAUA 4A7GF 4PJGE 1BZEA 4N87A 5FKAB 2P5ED 5JUEL 1ZLVH 2YSSB 3KZ8A 4JBSA 3QUXC 3UP6A 4ATTA 4NQXB 4MAYB 4R5XA 1Q6MA 1F18A 4G6MH 1JV5A 4FZEH 4PJHF 4KK9C 3IETB 4WTQA 2PN5A 2YHGA 3FH7A 5E2VH 3UBHA 3S9DB 4Z6BA 4FA7B 1R46A 1BAWA 1YEGH 3DX9A 4ACPA 4NO2B 1P7KB 4H26A 4K0OA 2X4TB 4XZ4A 4BUQA 5HYSB 3ZXAC 4N86A 3UG4A 1UJTA 1UGKA 4CADA 2JJSC 1G0XA 5DS1A 2B16A 2YAMA 1FGNH 7TAAA 3MCG1 4KKNA 3QUZA 4LL4A 1ZLVK 4DERA 2AQTA 3INUL 3CVIL 4HX1A 3C5SA 1T20A 4UM8B 5DZJA 4PY8I 1MNNA 5AKVA 5BS0E 4LQ1A 2R7EB 3RB7A 5JQHC 4HK3N 3PWNB 2VGLM 3ZMRA 5DTFB 1QSED 2X10A 4W4NA 3D33A 5ACZA 3FQUA 5K9VA 2DZEA 3MJ9L 5GRWA 1KCVH 4HK3J 1BJ8A 1TEFA 3IDYC 4HJ0D 3T6ZA 4BM7A 2ATPA 5MERB 3CBRA 3PRZA 4PB9L 3K6SA 1EHLL 1B3JA 3JV4B 4X4XB 4M8RA 2P1YA 2ZWZA 1E27A 5EF1A 1UZGA 4PJ5B 5KAAA 4OBSA 1DDTA 4G1MA 4TSAL 4AJ0A 2OMVA 1MW2A 4YBLB 1JZHA 2OJEB 2Z92A 3C5ZB 3QC6X 4K23L 5E95B 4XPHH 5IHBA 2W65A 5DDHB 4OM1L 2VMEA 3HUJB 1T5WA 4AOFA 4ODSL 4OZGA 5TGBB 2OSXA 2ZNXA 3J8F7 2ESVA 2A9MH 1U8OB 5D1QB 5AW7B 2IG2L 4S0TD 3OKYA 1UYWH 1FPTH 3L2MA 3A5VA 3FAWA 5C9JA 1ZSHA 4NPYA 2V2WB 1U6AH 4QYAA 3Q8BA 1K5WA 3SDXA 1AI1L 1T6VN 3WJMB 3EYUH 2N7SA 3RWIB 2QQQA 4BZYA 3PHQA 3QWRA 4QEGA 2X3CA 1SFHA 2Z93B 5E8DL 1GWZA 3TWYA 4HD5A 1RU9H 5MEPA 2F2HA 4EIBA 3KLSA 4QI3A 2HZHA 3WEAA 1SHSA 5IVXF 3WI9A 2WBJD 1YN7A 3MCKB 1DR9A 3QQ4B 4CGTA 3MNZB 1ULVA 2IFGA 3UABA 1P5UB 4B5EA 3T0DA 2I6IA 1RZGA 5ADOL 3UAJA 3MRHB 1WA1X 4GBXB 4RIRA 4ZNEE 3W11D 4CMHB 1E50A 2CO6B 5JUEH 4HKBB 2F6FA 5FXCH 2VDQL 3CU7A 4M6AA 4ZJ9A 1CFSB 1UM4L 2FBOJ 1AGFA 2YD6A 1HAUA 3Q2CA 2CGRL 4WSKA 3X11B 3BZ4A 1XXVA 4YBQD 3WEXA 4DK5A 1TO5A 1OIOA 5DJDA 1H3UA 4C13A 4KDTC 3S3KA 4U7SA 2X6UA 1MUJA 2VKWA 1CPUA 1OCCB 5DJXA 1G1YA 1T21B 1NOLA 4BH8B 4V1DE 4X83A 2X2JA 4M4PA 3INUH 3CVIH 4QRRA 2Y3NA 3BPOB 2BVTA 5CGYC 1DZBA 4ORGA 2XWCA 3QZMA 4NO5A 3DROA 4OGZA 3MJ9H 4KVPA 4R9HA 5FYLL 3BM8A 3QEHA 3HJEA 1EHLH 4PB9H 5DXWA 4NUJB 4A38A 1GZHC 1MEXL 5F0LB 5JHBA 4FFVC 2QGDA 5E6ID 5J13C 1E5UI 3FTGB 3BSHA 4FXKC 1K6QL 1RK7A 4TSAH 5JDJA 1ZCLA 2Q7YB 4X4ZA 1U36A 4K23H 5AYUL 3E2HC 2ADIB 1TFHA 3Q9QA 4U1MA 5SX4H 4M7JL 3ABZA 2NT7A 4OM1H 1EJ8A 3FOLB 3IDMB 3LKSA 3CN4A 4HUNB 1FLRL 4ODSH 3UPCA 5GSRB 4JKNA 4DH2A 1OB0A 2IG2H 2CO1A 4K73A 2R51A 3FBQA 4UYQA 2QEJA 2QDMA 4GG6E 4UT9L 3RDTD 1JD9A 2H3KA 4P2CG 3ILPB 1UVQB 4LO9A 3CFNA 2P6XA 1KCLA 1CT8A 3GRGA 5A43C 2SODB 4U0RC 4UDUB 3IJSB 4JG0L 4JO3H 3RWJB 4LLYA 3FB8B 5E8DH 1BBJB 4PRPB 4QHKI 1OP5H 3OMHA 3WUWA 4KFMA 2AAVA 4OHDA 1QPXA 1GJWA 1W6LA 1VEPA 1FL3A 1GGUA 5TH2B 3B2XA 5ADOH 1HQ4B 4J3OH 3L95B 2C7FA 3EG9A 1UASA 1MAML 2NY6B 3RPIB 2VDQH 5LB1A 4PR5B 4NN7C 1KDJA 2X6CA 1UM4H 5FA4B 1MWAB 3ZL2A 3ARBB 2CGRH 3QWOA 4G1EB 1P7QB 4LHUD 4M48L 3TBWB 4B9YA 1MCQA 4OD1L 1H8NA 5AL8A 5BVJA 1XSOA 1OP5K 4ZMVA 4XH2A 1JJUA 3DVNA 4Z7QB 1IGIL 2K1MA 4TSBL 2KPWA 1KGCE 2VC2L 5JHLL 3LNGA 1KB9J 3DPBB 1HSBB 5B3JF 2W5PA 4RDBA 2NY2B 3P4LA 1TSRA 1SLWA 1MI5D 5IW1B 3CBKB 3HCVA 4HJQA 2CU9A 3WFCH 3P9MA 4PLKC 5D1XD 1JF1B 1P6WA 4GPVA 2IAMC 1KLUA 4W93A 4HPHA 2H0EA 2V5TA 3R4DA 4K9EC 43C9A 1RHHB 3H2PA 3LZFL 3LKNB 3GXHA 2EDBA 4OI7A 1WS8A 4YGAB 1TZIB 3OAWA 1OCRB 5JW4Q 5FYLH 4LAJH 4NEHB 1OO2A 4W9LC 4N6RB 1MEXH 3H7BA 4QRPD 4X42A 3UGUA 1XH0A 4FI8A 5CILL 3S36L 1K6QH 3WTUA 2Q7AA 3WCYA 1V27A 4ENED 3HPJB 1NZ7A 1SBBA 3VXPA 1TOXA 1S7QB 4PTUB 5GGRA 1UH3A 3B5GA 4C57C 4IGBD 3PUUA 5AYUH 4J3OG 1UUSA 1ZHNA 4CVWA 4M7JH 5J8OA 2KDYA 4H0HB 3MMJA 4QOKE 4RBPH 1FLRH 1IO4C 3GSVB 5FYJL 5CMAA 4GUQA 2VEXA 4JFEB 4PGEB 2BVOA 4L48A 1F00I 4AQ1A 1EAQA 4UT9H 4P5SA 4GKSA 1SYVB 2OTWB 2XYBA 5BW7A 1AQHA 1JWMA 1GRWA 2WJ5A 1PX3A 3F99A 4WI9A 3FCBA 5E9NA 4QHUA 1RJYB 2FATL 2AZRA 4Q6IC 4JG0H 4KQ0A 5B22A 1W0VA 4AGNA 3BW9A 2A9CA 2HT2D 3FH8A 1XCQA 2A74A 5H8DA 2I9LB 1TJMA 3KL3A 4RBPK 5SWSE 1C8QA 3BP7B 4FKEA 2NZ9D 2ADGB 4HV8A 4D0DB 5T1MA 1U8QB 2IQAA 3SODB 1A6WL 3K1KC 4RFEB 4ZUVA 1EJFA 2OMWA 1MAMH 1LILA 4B96A 2HLFD 4R7LA 4Z6AT 4JRXB 4E5XA 3TEXA 2HTKC 3V9FA 3HE6B 4M48H 4F9LC 3GRWA 3NCCB 2DMCA 2D9CA 4OD1H 4N8VA 4IS6A 1R5WA 1BBDL 1T5XB 4KKZA 4MZ3A 2Y07L 3CD4A 4YPJA 1IGIH 4TSBH 5HYQA 4MQ7A 1G6RL 5CFAA 1GYCA 4EN3C 4GSUA 3JWDC 2VC2H 3HRZC 5IVXB 5JHLH 2JFFA 2VEVA 2C3HA 4J3UA 1NTDA 4K71B 3ARRA 3D2TA 4J4PC 5ANME 5IVZA 4KJQD 3QUYD 1YN9A 5E7FA 3B3BA 4YSQA 4AY0A 1U41A 3SKMA 1K8IA 3G6JE 2UZXB 3VCLB 2XBDA 1E9OA 3LZFH 4C58B 1DVZA 3OZKA 5F6IB 2WXQA 1NMAL 2QHRL 3LXBA 3W9EA 1CGWA 1OGSA 1NZRA 2Y7QA 2KKQA 3L3KA 4LDLB 2NW2B 4NKOA 1MY5A 2VR7A 4IRSC 2MCG1 2Y23A 1QTSA 3B43A 5FIEA 5CILH 3S36H 3LJ3A 1CFQA 3L7FB 3VYNA 3VD2A 2EICA 2A4ZA 5D7EA 1YAZA 2MOVA 2AI0L 4BXVA 3U96A 5GHWL 1XDTT 1OP4A 3IXTB 3ATFA 3PXJA 4HDIA 4LSPL 3MO1B 5KYWA 3MFFA 2ILLA 4NQDA 3ZM2A 1A6VL 1E9QB 3DHUA 3VH8G 4FAAB 2E9IA 2EDFA 5ERWB 5FYJH 3T0BA 2XZAL 3FQTB 4NPKA 4XCFL 5JIDA 2ZWNA 3IK2A 1O7DE 5INCA 1TQCB 3KH3A 4UOQA 2CLZA 1SEBB 4DCQB 5EU5A 2DQMA 2FATH 5BUPA 3WY4A 2FH6A 4N2CA 3MRJA 3MKGA 2H5UA 1KIUB 1KPVA 2PXYA 1BIIB 4QRTA 5FM5M 3B9KA 2RIKA 4EQ3A 2R8SL 5TE7L 1FV1A 1J8HB 4NUQA 4AL8C 2J8HA 3APCA 5DUBA 1F6FB 3ZDYB 1AMXA 3PABB 1S3RA 3FF8A 3PHOB 4RAVA 5J06A 1X9RA 4CVXB 1R5IB 5E4EC 1A6WH 3D18B 4OY9A 1NGWB 4PCYA 4Y16D 4GRZA 4RHGA 1IIIA 5C3IA 4JHAL 4GKNA 1YEJL 3QDJE 1NICA 3QXVA 1I3UA 3LZPA 1X4ZA 2UVFA 1ED3A 3EOAB 4U1SB 4YSRA 4F7CB 1U3HC 2Y1AA 2NR6A 4EAEA 3HMXA 1BBDH 3DIFA 5GRZA 2HYMA 4UAOC 5ESQB 1WBXB 3VGEA 4TL4A 3AG1B 3PWJB 4ZW6A 1G6RH 3IM1A 1RPQA 4I0PC 5IB3B 1CZ8L 4XNQB 3CPLB 2QFPA 4PG2A 3K8LA 1XIWB 2AQPA 1M71A 1H3WM 5IBLC 1FGSA 4TQIA 1KBBA 2VOSA 4F37K 3NOIA 4F3FA 3VI3F 4MMXB 4P99A 4YHKL 4UU9A 5ENWB 3D5OF 3REVA 3A6OA 5CHNA 1I4FB 4RAUB 4AQ8A 3C9NA 1BEXA 1JGEA 4MXVE 4UQIM 4DVRH 1NMAH 2QHRH 5KANG 1HI6B 4TS6A 2YPLA 3H42L 1U92B 4OJFL 2CDEA 3W82A 3VXUE 2X4PB 4Q6YA 4UNIA 3WJLA 3SZ6A 4LAQL 5DUJA 3SGEI 2DMGA 3MLSL 5FUZL 4L4TD 2AI0H 4QRSA 5F3HA 5GHWH 5J4MA 4LSPH 3SY6A 3LB6C 2Z7ZA 4X6EA 1A6VH 2WNGA 3JTTA 1J0JA 2IQ9L 1M3JA 3FTWA 3O8XC 5A2AA 2W9EL 5CIPA 3UZEC 2XZAH 3TVMC 4XMWA 3QUZB 1TETL 1BFVL 4LASL 4XCFH 4GQPH 1NANI 2O26U 4N2FA 3GEFA 1UA7A 2X5PA 3C5SB 1T20B 4WFFD 2N0KA 3QORC 1ZT7B 4BH7A 3SN6N 4Z3GA 1IAMA 3GQFA 1DL7L 3QZWG 1DUZB 1DE4B 1T83C 4DP4X 5TPWL 3K2IA 4PGJA 2C5DC 3BUPA 3FQUB 5C2BL 1PXHA 3GBLA 2ATPB 3K6SB 2R8SH 3D1OA 4JM0A 5TE7H 2C3GA 1DANT 5DQJA 5A2FA 2ZMMA 1YA5A 1E27B 5EU7E 3RY5A 3QSKB 3SYPA 3RVVD 1BF5A 1PMYA 1XBDA 3EDJA 3ARZA 2Z92B 2CWRA 1VACB 5FDWB 2D3NA 4JHAH 2J8UA 1V10A 1YEJH 2EKSB 2VLRE 4HSQA 4S11A 5AVUB 2VTFA 3ZIYA 5I1DA 4KJWD 1CE6A 5C08E 4ANXA 1RQ5A 5LCVL 3DVFA 2EUXA 3GXFA 3K74B 3GTNA 1S4IA 4PJFA 3F7PC 2N7AA 2GTZA 1FH2A 5M43A 2EAEA 3MROA 3QUHA 5KVFL 1A7NL 4PJ8D 4PRAA 2NRDA 1CMOA 1IVTA 4KKAD 1IBDA 3PHQB 3KNBA 4Y7OC 5ECGA 4XO8A 5GGUB 1CZ8H 3MGTA 2K6ZA 2AANA 3GHBL 5MEPB 1S9WB 4HPYL 3CFJA 4RSYA 3IDUA 1A14L 4PJXE 3FB7A 2E47A 3VO0A 1E6OL 4TUKL 1AC0A 5E9DE 2IDUA 2VH5L 3RVWC 4FYTA 3MUJA 4AE1A 4YHKH 3L4WA 4Q9BA 3GUFA 4BK4A 2D31B 1ZSDA 1RZGB 3PHSA 1MAJA 4Y1AD 4OZIF 4LVNC 2QPDB 4KQ4L 5TF0A 1I1AC 4RIRB 3FSVA 5JR1L 4QWWD 4IBVA 1YO4A 4M1CC 3H42H 3NCBB 3H9ZA 4KU1A 5C8JA 4OJFH 1AGFB 2R2BB 5HHPA 4LAQH 1ZK5A 1G87A 2L7JA 4PS8A 4WIQA 5TE6L 1CYXA 3BZ4B 2JIXB 1OLZA 3MLSH 1HL5A 5FUZH 3WEXB 2MMXA 1RP8A 2D8KA 4X99A 5I1CL 2AJ3B 3MLRL 5FGCB 1NGQL 1NMCB 2E74C 4YSEA 3QXUA 1YG9A 2IQ9H 4QGYA 2ENYA 4XN5A 2YD7A 2W9EH 5DVKA 5HHNA 2NW3A 2BSTB 3QUXA 4DP1X 5DJXB 1EAJA 1TETH 1BFVH 3HNTL 1A6UL 1S9YB 1SFDA 1T3FB 1PKQA 2GITA 2HLAA 4LASH 3SGDI 1IGTA 1KJMA 4HF5L 4RH9A 2HJKA 4G83A 5GRXG 4QRRB 2R1YA 5C0EA 4A6YA 2PR9A 3Q8AA 1A22B 5D7JD 4MMYA 3CK0L 3GINA 2NZ6A 2AXGA 1XD0A 2A4EA 2XXMB 2UXGA 1RUAL 3N0AA 4ORGB 2F8IA 4YE0A 1DL7H 5TPWH 4NO5B 3DROB 5C2BH 4H44C 1VHRA 2HA1A 2C7SA 5CJ8A 1CC3A 3ROOA 4PYHA 4W9ZA 3AS0A 3T8XA 4MNQA 3PNWB 3MYZA 1CXFA 3WKQA 4YSCA 4Z7UF 2F8OA 3IT8D 5AAPA 1IAOA 3OLIA 5IQOA 4U1MB 5AALA 2Z91A 1Y1DA 2ZYIA 3ZL8A 3CFIC 1KFGA 2VAJA 1HL9A 3U9PL 2ZKHL 4GT0A 5LCVH 3SKUD 1TENA 4AKOA 5GIRB 3WDHA 4FNPA 3PJSB 3QRBA 5MHSE 3A5JA 3A67L 5KVFH 1A7NH 3BWAA 2YGPA 1E4WL 4KX9A 1RUPL 2JQMA 3S35X 3VGHA 2EDWA 4X4YA 2QSVA 4LLYB 1OKEA 2EVFA 3CSGA 3OL2A 1JWSA 3GHBH 2YC1A 4NUPA 4HPYH 5E4OA 5ITFB 5JLZA 1A14H 3SDCC 3WUWB 1E6OH 4TUKH 4BIKA 2OSYA 4UQEA 5DVLA 2VH5H 2NQDA 3MYJA 2WLIA 2ZXAA 1T04A 4MMZC 2Y67A 4J28A 3P77A 1A4KA 4KQ4H 1DVFC 2H1LM 3KL5A 3NSFA 3GMNB 4IBZA 3EG9B 5D6DC 4EI5D 5JR1H 2CNEA 3WS3A 3RUGF 3SPCA 3JZYA 5G5DA 1CXKA 5C0ND 1IM3D 3QQ9D 2CBPA 3W0WB 4JPSA 4NQCA 1ML0A 3HB3C 3QJHB 1UD6A 4PJAE 5TE6H 5F9WC 5BVJB 5I1CH 1ACCA 3MLRH 5D7LA 3RHWK 1NGQH 1G4MA 4ONGL 5KOMC 4AQZA 1PLGL 2LHAA 2G2PA 4AT6A 4FQXC 3ATEA 5GTJA 4JO4L 3CLEL 3CZJA 2H2PC 3T0AA 2BVYA 1A6UH 3HNTH 4LSVL 2WXKA 4XNDA 4XAKE 4HF5H 5BCAA 4FF9A 4MAYD 1PLBA 1RZFL 3CK0H 1N6UA 4XO3A 1QWUA 1XF2A 4Z7WE 1BSIA 2K9UA 2P80A 1RUAH 3L3OB 4P49A 1AS8A 2WNKA 3SYCA 3V0GA 1XQ4A 3MR9A 2F19L 3L13A 5FKPB 3Q13A 1DQKA 4S1DD 5F3FA 4XNZC 4YDNA 1UD5A 1N68A 3D3VA 4JKPH 3HE7C 4LB8A 5DYOA 4GFXA 1T5KA 1WCBA 4N2GA 2XLLA 2X1WL 5CNHA 1U2YA 4ZFQA 4U6YA 2DQFA 5CP3A 2I5YL 3VXPB 2VAAB 4NP9A 4Z5RA 1F13A 4HOMA 5LKNA 2ICEC 3MLTA 2F6WA 1R3LB 5JQ6H 4JJHA 2NDGA 3QPKA 3QA3A 1AFVL 3U9PH 2Q76A 2ZKHH 2F58L 4KROD 5CMAB 5LG6A 2BVOB 2D3JA 3UBXA 4Y2NA 1AKJA 2IBZX 2J21A 1T0NA 4KXZI 5SX5H 3VSTA 5F9OL 1GZHA 2EYTA 4YVUA 3A67H 1SYSB 1JWMB 2E7BA 3MNDA 5ABAA 1E4WH 1RUPH 1B0RA 5D9SA 1XM2A 4CILA 4N90E 4QHUB 4YDKL 4Y5YA 4PJ5D 2XN9A 3IE4A 3P4MA 1W0VB 1S78D 8PAZA 3BW9B 1XCQB 4E68A 2A74B 3C5ZD 4PJEE 1IGFL 5T3ZL 1F3DJ 4A63A 3GXPA 3D87B 4ZMPA 1AGCA 3U79A 3T65A 1AHMA 2I07B 4G7QB 4HV8B 5T1MB 3KYMA 2PWGA 2YUWA 5SX5K 3O6FD 5CD5C 2IQAB 4MAUL 5F9AC 1FNSL 4BKLB 1UHVA 1QUPA 1GXEA 2HLEB 2OMWB 3PQYA 2BC4A 4MYPA 5ICXA 1NLDL 3WIHA 4E5XB 4NENA 3ULSA 4JHUA 3BDBA 1UCBL 2L4OA 5GZOC 1FJ1A 4N8VB 2HUEA 4HHAA 3RX9A 4IS6B 1R5WB 5IVOA 1VERA 1RPUA 3QNZA 5H35B 4R30A 1QNIA 4ONGH 5HYQB 1MFDL 4MQ7B 2R2HA 1PLGH 1JWUB 4G72B 1M6OA 2YPVL 5I6OA 4JO4H 3CLEH 2FX8L 4LSVH 4FE9A 4MB5A 1A9BB 2ZSVA 5DRNA 2WIIA 4F8TA 4XPBL 4G9FB 1NEZA 1HWWA 2XRAH 5AUMA 1RZFH 5D7IE 2WP3T 1VJSA 3SKMB 4PJIF 5DC0A 2HRPL 1EMTL 1PX4A 3K91A 3E9TA 2F19H 2BZDA 2A38A 3T08A 3VG0L 3W9EB 1Z3GH 2Y7QB 3L3KB 4NKOB 4Q56A 4LZKA 3V55A 1R6HA 1EQWA 2DLFL 5C6WH 1VENA 1CFQB 1SXNA 3NN8B 5M7QA 3QG6A 4X5LA 2JCWA 2I5YH 4KK8C 3BDXA 3D7PA 2IAMA 3L9YA 1T49A 4HDIB 4OCMC 3FF7A 2WNWA 3QCHA 3CZKA 4NQDB 1XF3B 3BP6A 2Y72A 3B2PA 3GSOB 2WTRA 1E67A 4QYOA 4JNXA 2JQZA 4JREB 5HVWA 3OBAA 4G6FD 1AFVH 2XVGA 3ZKSD 2F58H 2ROXA 3IAGC 3PYCA 3QFJA 3QJRB 1E0DA 1J12A 4FQ2L 5JO5B 5KA8A 2QFRA 4J23A 3EDKA 3QHZL 1OP9A 2GAZA 4P9HL 1S7UA 5F9OH 4U1KA 1EERB 5F2FA 2CLZB 1I8UA 2QVMA 4G7YH 4G8EB 5JPMA 3KM1A 4YDKH 3Q06A 3F41A 3KL0A 2BNQB 1ZIAA 3MRJB 4A2HA 4C4BA 2KBGA 1ILSA 5FWQA 1BYOA 4E36A 2PXYB 4NUMA 2DJ4A 2OA9A 3B9KB 3NJMA 3BVVA 3PDDA 1IGFH 5T3ZH 4X7CC 4D7PA 4I88A 3TA3C 5JXED 1AQDB 1FLTX 2Z9TA 2Z4QA 3VX1A 1FUNA 4MAUH 1G7QB 1FNSH 5DD5L 5ICUA 3KLKA 4L05A 1YJDL 3REWA 4AC2A 3GMPB 2OC3A 4Q6IA 4W4OC 1NLDH 4BFEA 1ED3B 1WICA 5CEXA 1JZJA 2R1XA 4ELMA 1KXQE 2W59A 3F62A 2IMGA 1NFAA 1UCBH 1AH1A 1V7ML 1MELA 4Y5XC 3UBFA 5SWQB 2FNWA 4TQEL 4PRPD 5SV4A 2HCZX 3DIFB 5A2IH 4MNGA 1N3NB 2V0AA 1MFDH 2YPVH 5MENB 2CGYA 5JORA 2FX8H 3S6CA 5IOKA 1NFDE 2V5RA 1M71B 3L5WA 2R69L 3UO1L 3LRGA 1FSKC 4XPBH 1W6WA 3RKDC 3T2OA 3UYPA 4DOHE 3RNQB 4F3FB 3LZQA 1QASA 3L3JB 4G5AA 4UU9B 4AIEA 1WDAA 4F9LA 1PVHA 2VABA 2ZAGA 5CHNB 1QLFA 5IUSA 3C9NB 3LQAC 3ARBD 1EMTH 1QG3A 1P7QD 3QBTB 3SB3A 1JNJA 3VG0H 4GRMA 2UWEE 2X1OA 4U7MA 5I8OL 3HN8A 3L7EB 3HRZA 4Z78A 2DLFH 1DVUA 2CDEB 2O6CA 5DUPL 5ISZA 2HUHA 4NKQB 1JRHL 1UWXK 3NH7L 3ZE0F 5BXFA 2X41A 4J4PA 3QQ3B 2NY2D 3FB6A 1G7PA 3I6SA 3PV6A 3BLTA 2IGFL 4X6EB 1KIPB 2Z35B 3JTTB 5J1SC 4GE5A 3F8UB 4LKCA 4QHMA 5L8KB 1VCBC 1JK8B 2XA3A 3NEXA 4HWNA 1UEMA 4FQ2H 4OLUL 4IRSA 1JDAA 4GSXA 3QHZH 4FMVA 2HX9A 4NM4L 4P9HH 1MCOL 3W38A 3UAEA 2TAAA 4BGLA 5AAWC 4BH7B 4YL9A 5IB2B 4X7EC 1QFOA 4X7FC 2DJUA 5FUOL 3KYAA 1OF2A 3QI9B 5CGBA 2QLYA 4DGIL 1SJMA 5K59F 3DDGA 1Z5HA 1K9TA 4EUPB 1FFPB 1NM4A 1ZJBA 2J57A 5F7NC 3PLYA 3UBXI 4JUTA 3SDDA 2P52A 4JFED 3T3PE 4HJEA 1EZVY 4L8BA 4BJOA 1B88A 4PJ7E 5DHVH 1NA8A 1AQMA 1RFDL 4PVLA 3CFEB 5DD5H 5KBPA 1ETJA 1YJDH 4KKPA 3SDYL 5I1DB 3Q6GL 5IB1A 1CE6B 3BWSA 3QG7L 3S3FA 1L9TA 4HJUA 5FM5O 4JMXA 3E6HA 5LAXA 4PJFB 1YQ2A 3OMNB 3MUGA 3OSVA 3EYOA 2AVGA 2B14A 4LSDA 5BOZG 4I9WD 4HUUB 1V7MH 4M3KB 4PRDA 4TQEH 4MVBD 2QGCA 2MPVA 2YZ8A 3KNBB 35C8L 4XTRC 3IRZA 5ES4B 1KMGA 4XRCA 1OHCA 2DPKA 3GI8L 3O3UN 2R69H 3CFJB 3GSNB 1GC1C 2J2ZA 3UO1H 3GS7A 3D39A 1QFHA 1QZ0A 1YYLL 1U3HA 3G08A 2IADB 2RBLA 2UXFA 5KSUA 4DPCX 4E9SA 1ZSDB 1ZA3B 3EOYG 3ZK0A 1HFUA 3HE6D 2QBWA 4RMTA 3LRHA 5CP7A 5SWZA 5IQ9B 2P9RA 3F64A 3OKEA 1CIUA 4X9BA 4K5NA