3V0EA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 256-576(c363s)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
320
structure length
320
Chain Sequence
MRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
total genus 102
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0eA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0eA01
2CM8A 3I7ZA 1G7GA 4NWFA 5K9VA 5KABA 3QKPA 2F6ZA 3QCDA 2F71A 1SUGA 2CNFA 1YN9A 1WCHA 3NMEA 4AZ1A 1T4JA 3CM3A 4OHHA 2J73A 2QBRA 1KAVA 2NV5A 1Q6TA 1ZC0A 2A8BA 4KYRA 2WGPA 3F81A 5BZXA 2VEXA 4H1OA 3LJ8A 1R6HA 3SMEA 2AZRA 1PXHA 2J17A 4OHEA 5KA4A 1KAKA 5KA9A 2F6TA 2FHCA 1PTTA 3AWFA 3EMUA 3AWGA 1I9SA 2GJTA 3ZM0A 5LXQB 3BRHA 1ZCKA 1U25A 1YGUA 4GRZA 4RHGA 1C87A 3ZM3A 3PS5A 3D1OA 1L8GA 2HXPA 1AAXA 1Q6JA 4Y14A 5K23A 4H34A 3QCKA 1Q6SA 4GFVA 3ZM1A 5HDEA 4ZI4A 1LARA 4OHIA 2FJNA 5KA3A 2GP0A 1G7FA 4B04A 2HNQA 3QCIA 4HJPA 4ZRTA 4HJQA 2B4SA 2JJDA 3F9AA 4MBBA 2FHBA 4WU2A 4GE6A 1XXVA 2QDCA 1Q6MA 4WTYA 2NT7A 2ZMMA 3EB1A 4KI9A 3B7OA 2F70A 1C84A 1LYVA 2G6ZA 1FPRA 1I57A 2HC1A 4D3PA 2YDUA 4RI4A 2H02A 2HB1A 4ICZA 1YPTA 2YA1A 3QCMA 2B07A 2J72A 1FQ1A 2I3RA 3QCNA 2OOQA 1Q1MA 3V0JA 3BLTA 2QDMA 1YZ4A 2BGDA 4D3RA 4D3QA 2QCTA 1XBOA 2B4OA 4QBEA 3RZ2A 2Y2FA 4HRFA 2CFVA 1PTYA 1XM2A 1T49A 1Q6NA 4QBWA 2NZ6A 1D5RA 1PA9A 2HY3A 4JMKA 4JBCA 2F6VA 2QBSA 2P6XA 2YOCA 2FH7A 3V0GA 2PA5A 2RF6A 2NTAA 1ONYA 5KA1A 3QCBA 1YTWA 4DGPA 4QUNA 1U26A 2I6PA 3QCFA 2BV5A 1XRIA 1P15A 2I6IA 5BUGA 2HVLA 2Q05A 1G1GA 5J8RA 2I5XA 5KA8A 1LQFA 1NL9A 1QXKA 1RXDA 1OESA 2H4VA 5EHRA 2J43A 1X24A 2H04A 4NX8A 2QEPA 3F9BA 3GXGA 2G59A 1ONZA 4YR8B 3EU0A 2B3OA 5M43A 2PBNA 1L8KA 3RGOA 5MMZB 3QCLA 3RO1A 4ERCA 3MOWA 3M4UA 1U24A 4OHDA 3EAXA 4GRYA 2CM2A 2P4DA 1YTSA 5IBSA 2QBPA 2CNGA 1OEUA 3O4UA 2MBCA 2AHSA 3BM8A 4GE2A 2CMCA 1FPZA 3D44A 4DGXA 4WOHA 3ZMQA 3SR9A 3S4OA 2NLKA 5K25A 1G1HA 1ECVA 1M3GA 3O5XA 3S4EA 1OHCA 4QAPA 5KACA 3I36A 5I6VA 1PH0A 4PYHA 1NZ7A 1A5YA 4WU3A 3EZZA 1J4XA 1EEOA 1ZCLA 2HC2A 3U96A 4BJOA 3F99A 2B4UA 1G4US 1C83A 1C85A 4BPCA 2QCJA 1VHRA 5K9WA 3GXHA 2VEUA 2F46A 5KA0A 4GE5A 1OHEA 1PTUA 4IKCA 4TVVA 4KYQA 4R30A 4Z6BA 2H4GA 2OC3A 3D42A 2BGEA 2BIJA 2I42A 2FHFA 3QCCA 1JLNA 2CNIA 2CNEA 1BZJA 2QBQA 3ZMPA 1NO6A 5EHPA 2ZN7A 3S3KA 4S0GA 5BZZA 3V0EA 5KAAA 5K22A 3A5JA 2CM3A 2I4GA 3RGQA 2F6WA 5IBMA 4R0TA 2PI7A 1YGRA 2R0BA 1XXPA 1GWZA 2CJZA 1Q6PA 2I6OA 3S3HA 5KADA 1OEOX 4YAAA 1YFOA 1PYNA 1PA1A 2H03A 2A3KA 2SHPA 1OEVA 1V3AA 1OETA 3QCGA 1G4WR 4JMJA 4NNDA 4QAHA 3N0AA 2I4EA 1WRMA 4PVGA 3H2XA 2CMBA 2I6MA 2HNPA 2GWOA 2I3UA 1I9TA 4RH5A 3BLUA 3V0DA 4RKKA 2B4PA 2I1YA 2VEVA 3I80A 2J16B 3D1HA 5GTJA 1RPMA 2CNHA 4GWFA 1MKPA 2CM7A 4NWGA 2I75A 2C46A 1T48A 3S3EA 2VEWA 1JF7A 3F41A 3V0IA 2H4KA 3MMJA 4OHLA 3V0FA 2Y96A 1EENA 4RH9A 5AWXA 2Q47A 3S3FA 3D1QA 2VEYA 3QCHA 3O4TA 1QZ0A 3ZM2A 3ZV2A 1G1FA 2IMGA 4ZN5A 1NWLA 2E0TA 1OEMX 4GS0A 1BZHA 1NNYA 2J71A 2J16A 4NYHA 4Y2EA 1C88A 3QCEA 2J44A 2FJMA 2F6YA 4I8NA 3O3LA 2PQ5A 3MOZA 3OLRA 2F6FA 4GFUA 2CMAA 5KA7A 2HCMA 5BX1A 1YTNA 4QUMA 4R0SA 3OMHA 2QDPA 2DXPA 2OUDA 3A5KA 1GFYA 3AWEA 2PSZA 2ESBA 2C7SA 2OZ5A 4J51A 1BZCA 1YWFA 4JNBA 1PTVA 2I4HA 2I6JA 4RI5A 4RDDA 2B49A 1WAXA 5KA2A 5K24A 3CWEA 1OHDA 3QKQA 3O4SA 3D9CA 2M3VA 3V0HA 2PT0A 1ZZWA 2NT2A 1C86A 2BZLA 3QCJA 1NWEA
chains in the Genus database with same CATH superfamily
1ETZB 3WKMH 1CGWA 2R56H 4FXGC 5ESQA 3H4HA 4OIFA 4ZTOL 5C1MB 1L5GA 1CG9B 1S7UA 1GOHA 4NWFA 4I18B 1P3DA 4D9QE 4LB8A 3UJTH 2NTFA 2C1PA 3EZJB 1CICC 1MVYA 1P84K 1AGBA 2BVQB 1SJHA 3BJ91 3NZHH 2QMKA 4L5FE 4PJBE 4ECNA 4FZEH 1YN9A 2UUDH 5DQJA 3PCYA 2BSTA 5F7AA 3BEWA 5INDB 1OTUC 2IANE 1JRHI 2ADYA 1M05B 4Y2DB 5JPNA 3KZ8A 1T89C 3ABLB 4FTVB 2ZPKL 1IRAY 3REWA 5ACZA 4WV1C 3L4XA 4WY7H 5KBDA 4I48A 3GJFA 3BGAA 5SX5H 1ZEAH 3P2TA 5EHFA 4GBXC 5BZXA 5GRVK 2X88A 1ACXA 1HDMA 4P2OB 4KKLD 4LHUG 1WC7B 3TF7C 4P06A 4LEOB 1SXAA 3GSWB 3BIAX 3NIFB 4Y1AD 3IRZA 1SHMA 3GMOA 3FSWA 1RUMH 3E7JA 3DX3A 3ZKXB 3NTCH 2XTJC 3GJEA 1IEBA 4GRLB 4N26A 4HDIB 5TDOB 1EXUB 3MNVB 2YOAA 5EU3A 1UJ3A 1RFDH 3QIUC 1HFUA 4TL5A 3V7AG 1K3IA 1QW9A 3HNSH 5JQ6L 5T5FA 4G9FB 1JPFA 3B5TA 4WFFD 3SY6A 4Y2DA 2EC8A 1X9RA 4NQDA 5JPNB 4WHYH 1QNIA 1PLCA 5F7MC 3ROOA 4RNRB 12E8L 3BEWB 5INDA 3DUSB 4HEPG 4X8GA 5GS1A 4RFEB 4LIQE 3HE7D 4PV9A 5FFGA 2FB4H 4LP8A 3QJSB 1CFMA 3QXWA 5J6GA 3SPJA 4KVCL 4H26B 4EZKA 5IHHA 3AXLA 4RIRA 4I0PA 2WO4A 3NP4A 4ZI4A 2A9BA 5I6XB 3FZUC 4LP4A 3WOVA 4Z7AA 4WK2B 2H47C 2UZIL 3THMH 4Q0XL 1LO3L 2MQGA 3KL5A 1ZSHA 3RFZC 4JRLA 4L8CB 1PZAA 4TRPH 4TNEA 5LGHL 3DX9A 3MFGB 5F21B 4HJQA 3U9UB 2AGJH 1YYML 2Y0SA 5KJ4A 2ITEA 2OKMA 4P5TC 1A6ZB 3MVSA 4WU2A 1KCVH 2VR5A 1HVXA 2Z92B 3RTQC 5CF3A 5IVOA 2N4IA 4GSUA 3D18B 1T22A 2DD8H 2GI0A 2VJ8A 4X4YA 2C34A 4M03A 1KXQA 1VFMA 3BKCL 4FHJA 5I8CA 4WUUB 1RZIA 1BD2D 3OHMB 3C08H 1X5MA 3EFOB 2E9GA 4TPRL 3OLEA 4UTBH 1N0LB 2HB1A 5DUBB 1R4XA 2JB6A 4Y5VB 2ATPA 4HMEA 3LS5L 5KOMC 5IROD 3SYQA 4UQCA 2HLFD 3WFEL 3KCPB 3LEVH 2J72A 3T8XA 3C6LA 3QXTA 4C4KO 4YBLB 3HVDA 3SOBL 3BLTA 1ETA1 1NEPA 2E75C 4GSDH 1JTTA 1BAWA 1CYGA 1BF8A 4OJCA 1R3HB 1YZ4A 1JI1A 1AZBA 1AOZA 3RP1A 3FCBA 3EJTA 3ETBF 4JO2L 1H3VA 1KC5L 1F8TL 2PMZA 1U8OB 4APQC 5KSBE 5IB5B 4XMZA 5D55A 1SMAA 4ZSOA 1IKOP 5GS2H 4W4OC 4JFPB 1NAMA 3OKKB 2NUTA 5T5FH 5I9QC 3DHPA 1DBKL 2FL5A 1XCWA 2VZTA 4PB9L 1RV6X 4HOZA 2H3NA 3CX2A 3VXUB 4BGDA 2VDLH 1FC1A 1O9ZA 2WXRA 3L45A 1X4ZA 4BZ1L 4XH2B 3BE1H 3T0EB 2WOBA 3TN0D 3ZZSA 1OSEA 4F8PA 4L29B 3QI9D 1HCYA 3KPRD 4QOKE 3MV8D 4HD9A 1JF5A 2XVKA 4WGKA 5HYEA 4KJPC 2XPYA 4R7NB 2CGRH 4W4NA 4NENA 4FL4C 4J3OH 4U05A 5KA1A 2A9NL 4NKOA 1YTWA 2Y36L 3ABMB 4HU2A 4LSPH 2I6PA 5DQDH 4HWEL 3VGAC 3IJ7A 4M48L 4I3RL 2RR3A 4NZDA 5F3HA 3PP4H 4GT7A 3OKEB 3MA7B 4FMVA 1G1GA 1ADQH 3SE6A 4CA4A 1URLA 4XO5A 3T2NH 3ZL1A 1CLCA 2ILLA 3C6EA 2YHGA 1XGUA 3T65B 1RKRA 3LRSB 2YXWA 3MOBL 3TT1L 1FCCA 1MHEA 4FLQA 4QOKD 4XNDA 1N6VA 5ISZB 5IFJA 4QY8A 4JFDD 2HFGH 4E9RA 3V10A 1ZAGA 1ESOA 2AI0L 2X4RA 4G6JL 2BW5A 4JZNA 5C07A 2DMHA 4O2CB 1P6AB 5E6RB 5C0AE 1KWGA 1NAMB 1Q1JL 3OKKA 1HQ4B 5DSCB 5CP3A 2I9LA 2OTUB 5TFSL 2JTYA 5KSBA 4HZLB 1OGAB 4L3EB 4UT7L 2E9IA 2GJ6B 1G0DA 5MMZB 2YSSB 1FN4A 2WK2A 3U7WH 4TVPE 4WU5B 3IFNL 4MMZA 3RFZB 4UQIM 5C0ND 3VXTA 4ERCA 4TNVF 3UO1L 3OLGA 1KB3A 1HEHC 2APSA 4KJYB 1BFVL 1A64A 1S8DA 2JQZA 2ZKMX 3GZOA 3ZE0E 43C9A 2EVHA 1IBHA 3CC5B 3M7OA 2CIKA 3WSQL 4U1MA 4A63A 3IDYC 1MPAL 3NGBC 4LVEA 2F54D 1HWHB 3O0RL 1MNUL 1GRWA 2YS4A 1KCSL 1G5GA 1VJSA 5C9JA 5ESAB 3TBTA 3V52H 3U2SB 2JFGA 3IN2A 3BCDA 2CDFB 1PLBA 2JIXA 4NQCA 3CLFL 3WE1A 1A6UL 1PY4A 3B7UX 1RQ5A 2C9UA 4LSUL 3EBAA 3OMIB 4GQRA 4NQCE 4LNRA 3MRNA 2NLKA 2F18A 2FJHB 3LKOB 4BIKA 2YQBA 3BRGC 3I6LD 3U1PA 2OL3A 2X5PA 2BJMH 1SYSA 4BWWA 3SBQA 5GZNC 4MDJB 3SKOB 2H32H 3Q1SH 5KACA 5SX5K 1IMHC 4KQ3H 2J56A 3CFCL 5K9QI 4MYWB 1HXMB 1L9MA 3E9TA 5DXWA 2MOGA 3FQ4A 1K72A 4JPWH 4PTUB 3QORD 3N42F 1NC2B 1MFDH 1E9PB 2BNQB 1SY6H 1T0NB 2X4PB 5IQNA 4EN3C 3RY5A 3BXNA 1R3JA 2B8OT 2J88H 4R7DB 4F58L 4V1DA 5E94A 1F3DH 2LLNA 3IJ9A 1TJGH 5D4IA 1YAZA 2DMKA 3M88A 3ZMEA 4BBWA 3ATEA 4HGWB 4KO9A 3WDJA 4TQHA 3VFNB 1SEBA 1A0QH 5HGBA 2JIXB 4WJG3 4ZX5A 4OI7A 3K1DA 4HXBL 2MJWA 1TQVA 5EZOH 1TTRA 3QUZD 3PWLB 1DQDH 3QNXA 4Z6BA 2Z1PA 3T4YB 1ZE3C 3EYOA 1MCQA 2BGEA 3P0YH 4QO1B 2FHFA 1I85C 5DRWB 1E4KA 3Q48A 4ISVA 5I1HL 2AJVL 4GSRA 1AZRA 1EEYA 4QTHA 4IQHA 4DCQA 5E70A 5CINH 3QWOA 1B4TA 4Y7OC 3A5JA 5FFLA 4HH8A 3JT0A 4X8JB 2XWXA 3QUYD 2CA3A 5D2LB 4E36A 5JA9A 3ME0A 2R0BA 5CM1A 4FXTA 2VLLA 2WXKA 3LKNB 5T3XH 1HOCB 4FS0A 1UZGA 5KADA 1XGYL 3AM8C 3DXAB 5JXEC 3DMMC 5C92A 2ZIDA 4FFVD 3L6FB 4AWJC 1SEBB 1PYNA 1YJDH 3S8WA 5I18H 1IKFL 3BCFA 1XGPA 2DQUL 2HJFA 2PWHA 3IGFA 3M1BA 1NFDE 2XQYA 4NO0B 3F7VB 3VGDA 2J1YA 2P48B 1XGRB 1JPST 2J25A 1R3JB 1AIFA 1AZVA 1F00I 2HFTA 3N0AA 4PG2C 5E5LA 4AV5A 3QZOA 3H2XA 2G60H 5HP5A 4HUVA 4NM8H 1E2ZA 1VKXB 3UAEA 3MRLA 4KXDA 2FCBA 5HYSA 4U6VH 2F61A 2XUWA 2YGQA 3BZ5A 3TJHD 3NVQA 1UM6H 4K7PL 3WEBA 3I80A 1PG7H 1RSFA 1T5XB 1X7TA 2B0SH 4FRWA 4GRMB 5LB1A 4QAMB 5JIDA 5E99L 5EO0A 3UBXA 3BFQG 4DP9X 3SDAD 4HJGA 3UEQA 4XPTL 2QVKA 4KBPA 1DEEB 4NYLB 5CEZD 2CM7A 5B39B 4XBPB 3U0PA 4GXVL 3DLQR 4DGYH 3D3VE 4QGTA 2C46A 1G5AA 5EH1A 3DRTA 2D3NA 1OGTA 4IGBA 3F7YA 2E7HA 3QCZA 5J57B 1X9LA 3FUKA 4ALAC 3V8OA 3CHXA 3V0FA 1C5BH 2VH5H 2GTZB 3QJQB 3KYNB 2R0KL 1CL7I 4PJEF 4MJIB 3K72A 4QMEA 3DX0A 2EDWA 5DRZB 1BZDA 3UZVB 3QDAA 4H1LA 1EUUA 3EG9B 1U3HC 3MBED 2FJGB 4KO6A 1AQ8A 1R5IA 3S48A 1KB5A 2ZKHL 2Y5TB 2Q3XA 3FBKA 4A7GF 1P4LA 4JFFA 1FFTB 4C8XA 1BXXA 3HR5B 3K74B 4BK8A 4Y4FB 2V3DA 3VFWA 5LGJB 4RGMC 3SE9H 3OJ2C 3UPRB 5JDSA 1QI4A 3JZYA 1U95B 1OAXH 5GQBA 2J6EL 4TQPA 1AJ7H 4P23D 1G1KA 3GLZA 5IHBA 4Y4KD 5KSAA 1SM3L 5JO5A 1HNGA 5HYSB 1QFUL 5AOJA 4KQ4L 3V0AC 3KVPA 3SZKC 3C8DA 3ATAA 1BQSA 2OW6A 1PU0A 3BGFB 1E6OH 2W95A 4MXQD 3IXTB 4JPIA 3D7PA 3HC3L 5I5IA 2OAAA 1VPOH 2DXPA 1J8SA 2O6EA 3HZKA 5KSVB 3CCHA 3MN8A 5H94B 3IMWA 4Z7NF 1YWFA 3QZNA 1AD0B 1XD1A 2VQ1B 4C4UA 4H88H 3VD5A 3GK8H 1DBBL 1CZ8L 1EAQA 2NY3B 2H1PH 4UQDA 3PDOA 5DQ9B 5DURB 3VXME 4GMTL 4XI5C 3GI8H 3CHRA 1DQML 4TLUA 3HC4L 3S8FB 2M3VA 3AY4A 1N0XL 4H8WC 1QWUA 3LEXA 3PHQB 3OZ9H 4G7YL 3SZ6A 5BRZA 1N6QH 3KPRA 4RDQG 2K6WA 3BQUC 3WNKA 5F96H 1RJCA 3ELQA 1MCSA 5DFWH 4PG2A 4L4TD 1ROWA 3QCDA 1R47A 1VERA 3AGVA 1YYCA 3Q8CA 1UJTA 2DJMA 1AXSA 1G4RA 3PYCA 3VFWB 2WWNA 4X2UA 2NV5A 1UZ8B 3EGXB 1QRNA 4WK4B 4IRJD 1RZQA 4N5ED 2XT1B 3UBXI 3FCSA 3V7MA 5FKAA 3ULVH 4YHOH 4QRSB 1NA8A 3FT3A 5HDQL 3GB7A 1A65A 3CAFA 2A9DA 2OI9B 3DURB 1G1CA 3P3TA 4H0LC 5D7SL 4GNKB 3Q05A 3G6AA 5I6XC 2EH8L 3BZ4B 2C4FT 2COQA 3FTZA 4OLEA 3FPYA 1HHHB 1IGMH 4B27A 2UWEA 2O5ZH 1I3GH 3RY4A 5FO8A 4M1CD 5C97A 5FO2A 4X0KB 2VLRE 3AMLA 5LXQB 2XI9A 4JO8A 5EO9B 1S78C 1P4IL 3QNZB 4PRBA 4GB9A 4LOUD 5JHLA 4H0GA 1U8MA 2E7LA 2AABL 2HJLB 3L5JA 4R90H 4MVBC 3I2CL 4Z7WE 1IAKB 5HI4D 1JZ8A 4NN5C 4HWNA 3N40P 5DMKA 5ELIA 4Z3EA 4N0YL 1EAOA 2IPUG 1YN6B 1F4XL 4QXGL 3ARBC 5HDEA 5DRXA 2E3VA 2EO9A 1OF2B 4MD5B 1NWPA 2Y5QA 3RWFA 4TUOB 1Z9MA 4EOWL 2IPTH 3HE6C 1FZOB 2EIBA 1OARL 5JW4M 3TBBA 1P69B 1TQWA 2XKNB 1MFVA 2A4EA 5GGVH 3IRPX 4M9OA 4PV9B 2PPCA 2EIJB 2WBJA 2WCPA 4DP5X 3QRLA 1Y1UA 5BMFL 1L9RA 3PHAA 5HHVL 1Z0MA 3MRMB 4PWIA 1XXFC 1CL7H 1HQRB 1YEDB 5E6IC 4CVWA 3NBNA 5DWUL 2CHDA 5IBTL 1P7HL 3MUGA 4I48B 4FG2A 1R33A 2BNRA 1JWUB 2GPZA 1QNZL 4ICZA 3K6OA 4PRDA 1Q0EA 1JZ7A 1IJNA 1D5MB 1MCPL 1FFOB 2QVFB 3L3OA 3QORC 4NN7C 3T09A 3EUUA 3T0XA 3OQ3B 5KYXA 3C6LB 4ETQA 1AHMA 5CSZB 2R2HB 5DQJB 4S1RH 1A1NA 2R56L 2NCMA 4R83A 3X1NA 2VO5A 3B37A 5EU5B 4OJYA 5I1IL 5JHBA 5EIVA 2OM5A 4ZODA 5HI3D 1D6VH 4LRIA 4ZUSB 5HGBB 2A0LD 3IEAA 2OMVA 4LEEA 5ISZA 3T0WA 1U41A 4LCCA 5ENWA 1N67A 4LCWB 2WNKA 2AITA 3ABGA 3OL2A 2XZCH 3U9PH 4MJ5A 1A3QA 4G7SB 1ZGLA 4HUCA 5H2BA 5LXGH 4WY7L 4HRFA 3FC8A 3QUZB 1BYPA 2CO6B 2J2ZB 3WNPA 1IAII 4ZTPL 1XB3A 2PW1A 2BP8A 3PWVB 1CGXA 1F3JA 3ARDC 4XMWA 4L0PB 1T49A 2QTEA 4P49A 4XNYH 2JKTM 2HH0L 2EEDA 4RCAA 1NIDA 1S7SA 5ICZA 1YPZE 1TU2B 1CUOA 3GZQA 3BAXA 3AFLA 2WCSA 3CH1A 3CXDH 4C47A 4XBEH 2BHZA 2EIEA 3BHBA 2J55A 2F6VA 1SQ2N 4FMKA 2ZX9A 2FH7A 1NLDH 1LM8V 3AY2A 3V55A 5F9WC 3QCBA 3OKMB 4RFEA 1MXDA 5CAYB 1U26A 3Q2VA 4HEMA 4OZ4B 2Q0ZX 5JIQA 1BIIA 1BMGA 1KXQE 2K9FB 1M7IA 4OU3A 1WBZA 5BUGA 1NQBA 2Q05A 2EEAA 4ETQB 43C9B 1NMBL 4M3HA 4WEUD 4PWHA 5KS9F 1X4XA 5E2VH 4JHVA 1RIUL 1TMQA 4Y5VA 1CMOA 2DQFB 2WSKA 1BJ1H 1NCDH 5EFIA 2QT6A 1OESA 2YSTA 4UBDC 2EUWA 1CFTA 2Y72A 4NX8A 4AQOA 1EANA 1F58L 3I9GL 1C16B 4HV8A 3W0WD 3HC0A 1FO0L 2CK2A 3H7LA 3I9AA 4MCYA 1IO4C 1ZLEA 3V4PA 3OZKA 3S35X 3OKMA 4GAAA 1ONZA 4E9VA 5E9DD 4M4PA 3OXSB 1KLUA 4I9XA 2ZQKA 3GNML 4JQIH 2R8SH 3ARGC 5HVFB 4FHKA 4ZSOE 3NFNA 3VFNA 3TN0B 1MHCB 2XQBL 2UX6A 1UWXH 1TT6A 3QA3B 1BBJA 2JB6B 2LFGA 1FH5H 4GKNB 4ABVA 3O4OB 4DGUA 1H0DA 1WGOA 4ODUB 3ZDXE 5E8PA 2YAPA 5ERWA 5HJ3A 4KVNL 5SWSA 2ZOUA 4OF6A 3C08L 3UABA 5IY5B 4NKIH 4YH6A 3C5SA 4NC1E 5C7ZA 3VFTA 2FZ3B 3CZGA 1CXLA 5D6CB 1UKQA 2I85A 1RZJL 5CJXA 3QFJD 2YUXA 2YPLB 4M8QB 1H15A 2FATL 3FQRB 3L13A 5I73C 4LVOC 4HH9B 3EJSA 1NKOA 2Z7WA 3MRNB 4BXSV 4DGXA 5AWNH 2R7EB 2CK0H 4LCVA 4DP2X 3WS6C 4PJHF 4CVXA 5I16A 1JD9A 3CVIL 1DL7H 4Z95H 4Y2NA 1A7OH 2C5DC 2F19H 4YO0A 5D93B 1F8TH 2E9BA 4OCSL 1NM9A 5E1AA 4EIGB 2EEFA 5JO5B 2XBTA 4M43L 4GW1A 2C7UA 4PJXA 5SWSB 4KJWC 3RJQB 3HA0A 5I6VA 2XG4B 2NY4C 4N3TA 2P5WA 2WLHA 3KYKH 1H3XA 3BUYA 5E8DL 2ITDA 4F93B 3TNNB 3L95B 1DUZA 2XG5A 1KGWA 4ZUTB 1F1DA 4QKTA 3UTQB 4XGZA 2CZNA 4JO1L 1Z1WA 4ZXBD 2VXTH 5HHOD 3JBG7 3KBEA 2EDXA 4PWJA 4BJOA 3TJHC 5DU7A 3WMPA 1NFKA 1G4US 2PNDA 2BVUA 3E3QE 2L7JA 3GXHA 4A7UA 1EO8L 3FFOA 4KNQA 1XTMA 4HALA 4JO4L 2CBQA 3ZDZE 3OKLB 4NNYB 1P4BL 3S3PA 1ZLVH 1W7KA 1WBYB 3CPLA 2V7HB 4WO0A 2DPKA 5JW5A 2DEXX 2Y36H 4LSPL 5DMIH 1AP2B 4DEUA 2UYLB 1QHQA 4RQQB 4JB9L 1G0YR 1JMZA 4I3RH 4KFMA 1MZZA 1YC7A 1SOSA 2L0DA 3U1QA 4ISVB 2EIZA 5F7DA 3SDXA 4NFBA 2COVD 4QI3A 4Q7DA 1DLFL 3FO9B 1NO6A 3DX7A 4ZX6A 5EHPA 1RUPH 1BSIA 3BVDB 5FR3A 1H8NA 2CLVA 4Z78B 1TJHL 2IMNA 4KK8D 3HG2A 4FZ8L 2XXGA 3W1ZA 3QZMA 4QLRA 1NPUA 2ZF8A 3FU3A 4XTRD 1BZ7B 5IHWA 5KSAC 5CJQH 2W1NA 4XAWH 3VD3A 4EUPB 1NBQA 3EFFA 2IFGA 2PTUA 1L7TH 2VZ3A 1Z9SB 3AS1A 2AI0H 3QIWC 3GMPB 4PP1C 4WHDA 4ZFOB 4UM8A 1UD6A 4J3XA 1U36A 3L3OC 2WZPA 3UIZA 1MQ8A 2MMXA 3PYZA 2YXMA 6FABH 1SGKA 1OGPA 1TZIA 1N64H 1HEZB 4KQ0A 3UG3A 4FG0A 4JM2F 3EHBD 3IKCA 3MLXL 5IEHB 4UT7H 1KYAA 4B7IA 5FM8A 3GBDA 4WJKB 4P46B 4X5QA 3P11H 4F8OA 1PCXA 3COOA 3NSYA 5M95B 3DMMD 3VGFA 4RH5A 3WNJA 3S5ZA 3BZEA 1MIEH 4NLAA 1SDDA 4F7EA 1CO1A 4X7SH 2ZYSA 3QCTH 4RGOH 4E68A 2PO6D 1EAJA 3HZVB 1MPAH 4LHUB 4X6CF 3DBXA 4GWFA 5FUCE 3JWDC 1JTOA 1VENA 2VISA 4OFQA 1XTLA 2X2UA 3FF8A 4ODTL 4EXKA 2IV9A 4FEIA 4ONGL 4A2HA 5E2WL 2J1XA 3EO9L 5DUPH 3FB6A 4XMUA 2PWGA 2DDQH 2XWRA 1VACA 2DM4A 2YMXH 3MKGA 4LSUH 2VEWA 3S3EA 3C60C 3L1FA 3V5KB 1WISA 3UZEC 4HP5A 4D94A 1NBVL 4NUGL 3CVHB 1CURA 3ZDYB 1OALA 3F12B 3B2VH 5B7FA 3K2IA 1GHFL 1WC7A 1NLBL 1SBSH 2IAMC 2NY5H 3BUQA 4H44C 4PJHB 4ANUA 5IW1A 2ZSVB 2HFEA 3CN2A 1ZHKA 3BQUD 1WZLA 2VMCA 4DGWC 3GM8A 1MCBA 1UA6L 3IKCB 3RA7L 2WANA 4P2QA 4GSXA 3C6LD 4JX0A 2P80A 2NRDA 4LL4A 4F7PB 1IIKA 3TZVB 4X99B 2J88L 4CRPA 1N8ZB 4Y4FD 5KVMC 5C0FB 1XH2A 3QIBD 4ZQKA 1IAIM 2VSDA 5JXEA 1QPXA 4MXVE 1ZHNA 5G55A 1A0QL 1V54B 1YG9A 1YEIL 4XMTA 5E08H 2RGSA 3D2TA 4Q9RH 4F15B 3ZQ9A 4YLBA 1IQDA 5DO8A 5HHOA 3VXNB 1YNLH 1FL5B 4OFVA 3CMGA 5BRZD 2WKLA 3K6DA 4PG9A 4KVPA 3TO4C 1OSZA 2CMAA 1CD8A 3CVHH 5FDWB 2P24A 2XIBA 1RIVL 2A3TA 4JEGB 5AD0A 3DURA 4TNFA 5IHUL 1A1OA 1J88A 4R5XA 5JHDB 2PW2A 2WUCL 4TXVB 4XNMB 3GMMB 1A7NL 2GUOB 5LNDA 2WVVA 4Y16D 3LKQB 5CINL 1XSKA 3S96A 4PJ8C 3G6DL 2KH2B 4XP5L 1XH3A 1WD9A 1WAXA 1KG0B 1MCOL 5IFAH 1Q4NX 1L9TA 1N12A 4NNXA 4JY6A 3GO1H 4X99A 2DWSA 2DQCL 1UXLA 3F12A 4PRBB 1P5UA 4H25B 4UWQB 4GP5B 1HJBC 5CO1A 1DCLA 2VABB 3WFCL 1QBBA 5FM5M 4AYID 4E9SA 3AW5A 1AOHA 4KGJA 5AW6B 4PH8A 2G4GA 4YVNA 1A4KA 3KPTA 3FQUB 3D3VD 1I8IB 4JDVB 4JL1A 5BRZB 3E8UL 3P40A 4CJ1A 3BP7A 3II2A 5EC1A 4RDQF 5MP6H 2JFHA 3QKPA 4N2NA 5DZ9A 3IU3A 3NIDB 1S5IL 4I88A 3ELAT 1QZNA 3C09B 2F71A 1SUGA 4NCC2 3CFDA 4CN6A 1O6VA 3D06A 3Q2NA 4AZ1A 1T1WA 1AR1D 2J73A 3LB6C 4L8BB 2XN9B 4G9DA 4FA8A 2P8MB 5B39A 5CEZH 1LWHA 2KKQA 3IE9A 1QBLH 3O8XA 3W11C 1WZMA 5ID1B 3LSOB 3SD2A 4TSCH 3GHBL 4PJBF 1AZNA 2E7BA 5KSUB 2IALA 2ISDA 4AUYA 3X1GA 4HIEA 3Q01A 2VZVA 4DKFH 1BBDH 4M5YL 1FL6A 2OMWA 3KJ4C 4JY6B 1CXIA 4ONHA 4DT2A 2E74C 1P6WA 1S9XB 2ED7A 4IMKC 5F1IB 3H9SA 5TF1L 4ALAH 1H5BC 3B3BA 2CMRL 3NK3A 2F6TA 3FT2A 1TPXB 5K39B 2DL9A 1XXDC 1FGVL 1JHTB 1X7QA 3D39E 3OGCA 4FNLH 1NIBA 3FFCE 2ZUVA 3BUBA 1ECYA 3DOSB 3KYOB 4G6KH 2YUWA 1EMTH 2QVTA 3QDGA 4ODSL 4Y4FA 1DQJA 1PKQE 4NAMA 3HZMB 5EO9A 2OXHA 3QDGE 5IMLB 1T83A 2YPLD 1FNGB 2ZNWA 3CXHK 5JXAH 4O02L 2X09A 5EU5A 4GKZA 4OGXL 2EO1A 5E00B 1RP8A 2H5UA 2LV4A 1W72A 2VERN 1PW3A 1KIUB 3ARDD 3SE9L 2H9GA 1CXHA 5EZLB 1KB9J 3GSXB 1JSYA 3B7SA 3U9WA 1P9MC 3UC0L 3S2CA 1JYNA 2EH7L 3GIVB 1D2PA 5KA3A 1DDTA 2DJ4A 15C8L 1G1YA 2FO4B 3TO4A 4FTVA 3SN6N 3TEYA 4C12A 3QK0A 4OV6F 1G9NL 4ZMTA 1U8QB 4UNTA 2HT4C 1RK7A 1XF3B 3FRPG 3G5ZA 3WS6A 2G2NA 3NCBB 3K4ZA 3Q44A 4L3AA 4H0HB 3WFBL 3PQYB 2WBJB 5CD3B 2YD1A 4QXVA 1KCBA 2QGDA 3QFJE 1ES0A 4H88L 1BV8A 2G75B 5CJ5A 4Z0BH 2EO7A 4DK3A 2P4AB 5IB1A 3R0NA 4UQ3B 2X4QA 3NCJH 5DJXB 2B7DT 2KHAA 3KLAB 3GXPA 1HIML 1PFOA 4M62H 5IOKA 2Z0UA 3I74A 2GBAA 3VI4A 5JOEA 4IBSA 4PCSA 4PUBL 5IF0A 5T3ZH 4M00A 5TH2B 1Z9OA 1XF2B 2NW2B 1G9MH 4UUJB 3SPVB 2XJLA 5FUCC 5JYLA 2WQUA 3DUUA 2CU9A 4P5TD 3VQ1C 3BYYA 1EHAA 4YHZL 5C08D 4NO2B 3SY0B 1G6RL 1FWXA 3UZEA 5AUMA 2GCAA 3VAEA 5C0AB 4NHUB 2R29H 4PJ8B 1FVCA 5F7EH 4ZXBB 5C09A 1CBVL 1XH1A 1OP3K 3MRPB 5ITBL 3ISYA 4N2EA 5LWYL 5GJTH 2OMVB 4TUKL 5I0XA 3L2MA 5MEPA 2XIDA 2V5RA 3POHA 2WXNA 4WKXA 3TV3L 1E4HA 4U3HA 1KNOB 4OSUL 1CDUA 2YPKB 1QKZL 4DGIL 2XPGA 4NZJA 4NWUH 3VTAA 3BISA 4FQLL 1YDPA 2OL3L 3ARQA 2F0CA 3BW9A 2NZ6A 4M9PA 2AV7B 1SJVA 4EN3D 4F7MA 1C08B 2OX5B 5CIPB 4EI6B 1T1YB 2VXQL 2CLVB 2O5ZL 3T4YA 2Z1KA 3OGOE 4UQEA 4HXAH 3PWUA 4YNYB 4KPHH 3MRJA 2RAMA 3MRHB 1CICD 1EAPA 1LEGB 3WTSA 2JI1A 5A6LA 2VW4A 1FG9C 4M8UA 3O45A 4HZ1A 2XTJD 2MCPL 1J8HE 1UACL 2Q3ZA 4LLUB 1DO5A 5I0YA 3TURA 1JXJA 1D5ZB 3QDJE 1GOFA 4AGMA 4G59C 1YMHA 3QI9B 4R90L 4IMKA 5MEQA 1NCBH 1U3HA 3ZN6A 2AQNA 1S7XB 4PD4K 3OPZL 2WSPA 1E6JH 2Y3NA 4XBGB 3HI6L 5GZNA 2WLJA 1KCLA 3A5VA 3AUWB 2I5XA 3VWJC 4BHUI 3SBPA 1KYOJ 4N0YH 2JJTA 5DJYA 5E2UL 5IBUG 5KOVC 2DLIA 3GRGA 1QXKA 5B22A 4MB3A 4AC2A 4A04A 3GI9L 4UOZA 1JUFA 2CM5A 1B6DA 4PGZA 5ALBH 4EOWH 2H4VA 4KGLA 5L2KD 3K91A 2OR7A 3QJHA 4LPTA 4YEFA 1SJEB 1CYXA 2XBDA 4CDHA 3LQZA 5CSGA 4MAYD 5GJSH 3BSZA 4PS8A 1QO3A 5C6PB 4UTCA 1SOQA 3QRBA 3CHQA 2KPWA 4OD2A 3O3BA 4ZS7L 3BT2L 4BUHA 1NCIA 3CV5A 5HJDA 5AKRA 1PZBA 5JOFB 2DW5A 1W0VA 3O2WL 7PAZA 3ESMA 3QIUA 4MFHA 3ZT6A 4CSSA 1ACYH 1D5MA 3K8KA 4GKNA 1KJ3L 4MA1C 2X05A 4WU5A 5EOTA 1FBIH 2RMNA 3HN5A 3INUL 3EAXA 1ZT7B 4N2GA 1S7XA 3H42L 2HMID 3QQXA 4P46D 4IRSA 3Q9PA 2OL3B 4OUUB 1MCPH 3AJ7A 3QG7L 1ORQB 4GUCA 1MREH 2XVGA 1CVRA 5DHYB 2XJAA 2APWA 4JPVH 4JDZA 2MBCA 2Z35A 3A4AA 3D87B 3K5RA 4HW6A 1UD5A 4MXVF 4OR1A 1G7PA 2JKNA 3THML 2R27A 3F7LA 3D9AH 1KPRB 3KEHA 3MYZA 4Z7UB 3TTYA 1K6QH 1AC6A 2OJZH 1MIML 3LDBB 3H9YA 1P4UA 2E46A 3HMXA 1CD0A 5IOPB 2AGJL 2YN3A 5SWZB 2PSZA 3MCG1 1A14H 1BQLH 4JJ5A 4U1MB 1NBYB 2GSGB 3T65A 5DK0A 3RZCA 3BDBA 1S7TB 3KPOA 1WFMA 3CDZA 2GK0B 4G1EA 1VDGA 3US1A 3NRQA 3U82B 3I36A 4MS6A 3ARPA 3TPUB 1EV2E 3LEYL 1X5HA 4ES9A 1T0PB 4NUJB 1M2OA 4ZTPH 3TOPA 3ARFB 5EEYA 5C0IB 1AO7D 4QHUA 4UTBL 4OUUA 2BSCA 2G3XA 1NZ7A 3CN0A 4NBZB 4WU3A 1WK0A 2BW4A 3LH8A 2YEQA 5B1AB 5CIPH 1TLMA 1R0AL 2HC2A 2B4UA 5T3XD 4CU7A 2A83A 5F3BB 1C85A 2QSCL 3TYFB 4IOFD 3QIUB 3ULUC 1P5VA 1FNHA 3S2AA 2IAMA 2D31B 5JW4Q 3SDXE 1CE1L 2HT4D 4HS8H 4HSAC 5IVZB 1OGAE 3BD3A 4P46A 4XVSH 3FN3A 3F2LA 3ASWA 3HRZC 3X3FH 4M6OL 2WKOA 4NN5B 1W6WA 2HVKA 4YOKA 2QBQA 4ZNCD 4Y4KB 1JNHA 3PF2A 3T4AA 4APQA 5DS1A 2ARJA 3QFGA 2ZICA 4K3JL 2B4CH 3S37H 2DBJA 1EEZB 2YMTA 3RQ3A 3UBGA 2W92A 2MOQA 3INOA 1OAKL 4X5WB 4Q9CA 1OW0A 2CM3A 1AQDA 1OP4A 2C9SA 3X12A 2PI7A 4QHUB 4AUUA 3UFIA 4I5BB 4P2AA 3BE1L 1ASOA 3Q2WA 4LPUA 2CJZA 1NDMB 3ME0B 5I73B 2XN2A 3O9WD 5ALCH 1RZKH 5KVGE 5I8OL 4P2QD 1I75A 1U8HA 4JRYB 3U4BH 4PIBA 2UZXB 1A6AB 3WTWA 3VG9B 2DYRB 3IK2A 1PDKB 2Y6TE 3QQ4A 5A3ID 4L18A 2QEJA 3LRHA 2ICCA 4NC2B 3EW3B 3QJFA 3FYEB 2DQDH 3VX1A 1TYJA 4JG5A 2CHWA 2SEBA 4MMYA 1YMME 1QQDA 2I3UA 3CMOL 5AZ2L 5D7JA 4KVNH 5GSVA 3O9WC 4LLDB 2XZQL 4U6YA 2FO8A 2YLKA 2NT0A 3UPAA 2I1YA 5EBLB 2VEVA 3FCGA 1NCWL 4DVRH 2VDKH 4D9RE 1C5CH 2R23B 3TX4A 1S9KC 2WYTA 1J48A 4PB0L 3UL4A 1JN6B 2V3EA 4HUWA 3FU7B 3BAWA 1ZEAL 2R0LH 1MKPA 5IV2B 2WYHA 5F0MB 1H6EA 4HJJH 5CCKH 2NY4B 5KN5A 4NWGA 1CFNA 2X87A 4G6JH 2EZ0C 2VLMD 1SLVA 1HZHL 3P9WB 4N8VG 3U6XS 2QZ5A 3FRUB 5EUOF 1JGEB 2EDNA 3MTXA 1DJZA 4G6AD 4JY4B 3VVWA 1ZRUA 2IGFH 1A7OL 2NX5B 1CLZH 2Z0BA 4PS4L 2E56A 3L7EA 3V7AE 1R3LB 4TNWK 3CFQA 3QR1A 4D9LL 2ID5A 3VWJA 4RH9A 5B7MA 3PPSA 4KUZH 2ZG2A 5D2NB 1EFQA 4NYLA 2VXSH 1X6NA 4Y5XB 1KGYE 3NIGB 3PWJA 4W6XB 4L9LB 1HH9A 3KYKL 5E8DH 1DBMH 4KKLC 5FGSA 2AJYL 3U30B 3ZQWA 3VD4A 1LP9F 3OWRA 4N3UA 4S1SL 4TTGA 1S9WA 5CP7A 1T20A 4P48A 4LVNC 3DI2B 1FYHB 4XWGH 2GT9A 4PRHA 3IETA 3KH3A 4NYHA 1DE4A 1J05B 4M5ZL 4OCWL 4AE1A 4IU2B 1IQDB 3FT9A 1CU4L 2FJMA 5FCSH 2VN4A 3E6HA 1MHHA 3LZNA 1ITCA 5SWSE 4CW1A 4JO4H 4FQIH 5DZLA 4ADJA 1Q0YL 1QLFA 5EO1B 5LCVA 5EUKB 4OGQC 4LIQH 4N90E 2UZIH 4YBQD 1S3RA 4RMWA 4UU9B 1I9EA 1YTNA 2DM7A 1E4WL 3QULB 3QIBB 4X6DB 2EXWC 3Q06A 1RL1A 3KPLA 4GRWH 4KQ3L 5FK9B 5EZPA 5KVGL 1MJ7H 4W4OA 5K1VA 4YSTA 1C1EH 1U8IB 4OZFA 4LLQB 3ZMNA 2CJSA 3RRQA 1E27B 2IFFH 5FXCH 2CXGA 2ROXA 1I7UB 2DEWX 3FB5B 3FTGA 2PYEA 3FUJA 3QIBC 3CFIC 5BVJA 4JLRA 1AS7A 2CWRA 3UAJC 4A7VA 3VWJD 5BZWA 1E9OB 4PJ9D 4PGEB 4D0DB 4G8GD 1KJMA 2RQ8A 5FA3A 1FG2A 3NZSA 4PRHB 3C6LC 4Y16C 5C0NC 1ZZWA 4BFBD 3BFWA 4Z9KB 4PVMA 2M2DA 3FL7A 3HTLX 3VO0A 3WFEH 3L3GA 4AL8C 5I1CL 3CDCA 4OQTA 1N64L 2H1LM 1HH9B 1FNFA 1ZTXE 4E9YA 3MLXH 3WUWB 1VGEL 1AHWB 3X1FA 2Y5EA 3P4NA 4R5TA 5FK9A 3P11L 4KKNA 1FNGA 5F6HI 2X5OA 1FZKA 4YEEA 4ZPVB 1OCWL 3QULA 4H8QA 4IBTA 4BA0A 1KV7A 1Q94A 4PJFA 4RGOL 2KYIA 2V9QA 3FCTB 5GZOD 3NSCA 4OZGF 1ZC0A 1VADA 2A8BA 4HC1A 4I77H 3FOLB 2X3AA 4GW4B 4N68A 3STBA 3TNMB 2V7NB 4MX7B 3F81A 1J18A 1MKFA 3LSOA 4MJID 1JXFA 3RVXC 3B3IA 2VC2L 1R6HA 1BMWA 3SMEA 5F93C 4WI5A 4PJHA 5EIIB 3NCYS 5KVDH 4ONHB 4JFFD 1AYRA 5ESQB 1GCFA 4OCNC 2NY5C 4Z3TA 4OLZL 1WAPA 2VQ1A 3UJJL 4NHCH 3QEQB 1FIEA 1IL1B 1H3GA 5L8LB 5CGYC 5J3HC 3LRLA 5F6IB 5ID1A 4NPJA 5BXFA 4JZJC 3BN9D 1OPOA 2J4WL 2Z31A 3L4VA 4PGCB 3RGVD 4F8TA 1JNLL 1ZCKA 4QRPE 3PJSA 3QUMH 4GRZA 1OAQH 3BSZH 3ULVE 1QR4A 4N28A 4BSWA 4Q9QL 1TEGA 4X9YA 3ORJA 1F6LL 3IF1A 5I15H 5E6YA 3ARED 2PYEE 5K23A 5DGQA 4YVUA 4G8EA 4CVZA 5G5DB 2N1TE 4H34A 4R9HA 4X7TB 1W72B 1LNUB 4GFVA 3SDAA 3VXSB 1KBWA 3FTXA 4IBQA 3SE8L 4ZUWA 2X1WL 1DVQA 4K8RC 4MMXB 1OY3B 2D7TL 2WGNB 5L2KE 3CZJA 2DKSA 2IH3B 2X1OA 3HCVB 4FYSA 3EG9A 5F7WC 2D7MA 3RX8A 4KKCC 3P4MA 3ZRFC 1YN7B 2XPCA 3TBSB 3M8OH 2XWZA 5GS0H 1G87A 4YC2C 2CR6A 2AV7A 5F7YC 4O58L 3SO3B 3V2AR 5HPMB 1T0MB 4ZRTA 1CF8L 4AIOA 4IDJL 5EU6D 3JWNE 4BFIA 1T4KA 2RA1A 1L0XA 4GEJA 1ZA6A 4C83A 1I1AA 1WA2X 4RAUA 2HLFC 4KK9D 1MCOH 4PJAA 1FZOA 2VRKA 1EZUA 1OCZB 3B9KC 3NAAL 4LFHD 5JQIB 5EBMB 4N0UA 4NCC1 1E8XA 4YHLL 5JR1L 2IALB 3RHWF 4D3PA 5D71H 1O0VA 3MROB 3EO1B 5BOPA 4P3CL 1YPTA 4LAQH 5D1XC 4PJXF 3M17B 3TXAA 4PY7A 3JYBA 1JFQL 3BSGA 4YGVA 5J6GB 3GM0A 1YLBB 3P2BA 4OAWA 3PL6A 3TBWA 2I3RA 3D3VB 4L1BA 1UASA 1XF2A 3VFTB 1R3KB 5EOCH 1S5IH 2QDMA 2FGWH 3ZL4L 3QCUL 1GY2A 4TOYL 5ICXB 4L48A 1IM9A 1XR8A 3PV7A 5JNYA 2WIIB 3Q8FA 4YHPA 5AYQA 1BBJB 4WFHE 4JM0A 4ZUWB 1RZ8B 5E9AA 1JZHA 3CH8A 4NUQA 4GUOA 1TZOA 3V0VB 1XGUB 1H8SA 1L0QA 1R3IH 3VXUD 5I75C 1F41A 1VCBC 5DD3L 5EZJA 4LDOB 1F4YH 3LZQA 5H4ZA 5T3ZD 3CFJA 1BBDL 2Y66A 4IKNA 4LCUA 4B9PA 1NCTA 1KPVA 2DMCA 1UEMA 4JAMB 4MMXC 4WW2A 5LN4A 1CGYA 2DM3A 4JBCA 2FJFB 5CZVL 3RU8L 5HBBA 3OKOA 2FBOJ 2KPNA 1AKPA 5IVNA 2I9LB 2OTUA 3L95A 1F3RB 2JB5H 2ICEC 2A9CA 1KN2H 4TM9A 2NR6D 4ZX3A 3QQNA 5SX4H 1FO0A 1JZ2A 4DGPA 5INCA 4QUNA 2CIIB 4M7JL 3OAYH 3RUGA 2L8AA 3C5ZD 5E5RB 3SGDI 1P15A 2I6IA 4R2GD 4O02H 1SYVA 5EOTB 4AEIH 1I7ZA 2FYYA 2Z65C 1INEL 3FQWB 3AB0C 3MBXL 5J56B 3VXUA 4O2EA 5GGQH 5JW3H 1LK2A 2V37A 3QJHB 4X4MA 3E2HC 2PP7A 1PMYA 3RZCD 4OZFH 4NDMB 4QGYA 2VDPH 5EHRA 3DX7B 4AMKH 3OJVC 1E0OB 2MTAA 1X5LA 4I3GA 3REVA 1I3GL 3DUUB 8FABA 4FNPA 1QSEA 4Z7QF 1SJEA 4RGNB 4V2CB 2V3FA 2QPDB 1FL3A 4X9HA 1G9NH 4NPYB 2DKUA 3EU0A 3HS8A 1OWWA 4L4VD 1LK3L 4L1TA 2WP3T 2HPTA 4N9OB 5ENWB 5C6TL 3QSKB 1PNCA 2YARA 1AY1L 2OR9L 4XH2A 3QA3A 5DJ8B 4H26A 1D7FA 1J1PH 3GHEH 4HWBH 1RP9A 4FYTA 4AUJA 5IW6A 3ERXA 4YDMA 2YBRB 3OSVA 3QJVB 3OMNB 2QKIB 3PL6D 3WN5A 3QNYA 4JS7A 3CN3A 1JZ4A 2XNAA 4Y4FC 5I1LB 2JVUA 2BWQA 4YHNA 3U36B 3NJIA 4XVTH 5G4MA 3GD1C 5I1KH 2WINB 1EJOL 3V4PL 1JPSH 4ZFOL 4U6TA 2PUQT 5SWQB 5IFJB 5CHNB 4YHZH 4GE2A 3B7TA 4ODXA 4KMTL 3QEGL 2YPKA 4HIQA 1C9SA 1MJ8H 1UADC 3NCXA 3QS3A 1J8KA 1NKRA 4L4VA 3MUJA 1MFCH 1HSAB 4WUUA 1XAUA 1ZANH 3AT0A 4CW1B 3CFEB 4G7VL 3K71B 1N7ML 3EXLA 3HB3D 4MNQD 4WKZB 2N3JA 3FU9A 1VAHA 4M6NL 4LARH 4FLRA 4P05A 4OSUH 1CR9H 2ATPB 2LLLA 3NP3A 4NKDA 3BWAA 3WLBB 3X1EA 1XR9A 2CPCA 2NX5D 4UNIA 1O5ZA 4L0YA 3WMSA 1RVFL 4M3JA 3V4UL 5CZXC 2G5BA 2EDLA 5LJYH 2ZUSA 2VDKB 1IM3B 4X5PA 2X9XA 5GS1C 2ZCHL 4A38A 1EEQA 1E28A 2XN0A 3J2PA 4DO5A 5LBGA 4EXPX 1J9RA 5F89B 2VLME 4JHBA 3GBMH 4NQCB 3N5AA 1GTNA 1KBGL 1OAXL 1QFWL 4HLJA 3SKJL 1A02N 2VEUA 3FDWA 4KITB 4AKOA 3ZGHA 4RQQA 3IJHB 4HF5H 3KXFD 1Q0XL 3IDXH 4HPYH 4QNPE 4HUVB 3RVWC 3Q2CA 1CFNB 1RZPA 4D8PA 1ADQA 3QJRB 2XCMC 1DR9A 1GZPB 1NC2D 3NJGA 4JKWA 5E1HB 3MCKB 1M1SA 5LXGL 1BDYA 1N9PA 3S3KA 4WEBH 3KDMB 2NNFA 4L29A 3WFHA 4WRLA 3MLTA 4LKCA 5GS2D 2W0KA 5AG9A 3MQIA 3AUVA 1DANT 1U91B 5FO7A 2G5RA 3L9RA 1HL5A 4WV1A 3NN8A 1T04B 1GGBH 4G82A 1OK0A 1JG9A 3CXDL 2AK4E 4XODA 2K3HA 4JG9A 3VDBA 3BSHA 1HH6A 5LNGA 3QDMA 4B9JA 2X4OB 4IKKA 3P3UA 5GJSL 5B3SB 3EZ8A 3FSVA 4Z7VB 1RUAL 2C7UB 4UZSA 3T04D 3E8VA 3CFTA 1RMFL 1LTXA 3UTZA 2Z6FA 2GTWB 4HX1A 4XCNA 4XB7A 3PWPB 5T5NF 1A7PH 5IMMA 1V3KA 4MA7H 1J0IA 1TZHA 4ZS7H 4AYSA 2ZX8A 4I1PA 3L4ZA 4FF9A 1G4WR 1THAA 4XMLH 3FU5A 4UCFA 3FPXA 3RWGB 2I4EA 4L4TA 5J12C 4L8DA 4FAAB 2AERT 3IAPA 4DP7X 4KI1A 2AJSL 3D0AA 4NC1C 5DHYA 1I9TA 4FQ2H 5I19L 3FT1A 2D4FA 3LKQA 3WTVA 4YZFE 1UWFA 3RFRA 2HVJA 12E8H 1P6FA 4KRMB 3QHFH 5IJDC 5GTJA 4N6RB 1S7RA 1ND0A 5EOQL 1ECZA 2M1KA 4YHOL 3D85D 2WXPA 3O2DL 5HI4C 4LGSB 1UXSB 1KFAH 1QLFB 5EO1A 1G9NC 5AW5B 4JFDA 2XFGB 3N04A 3V6FA 2X6UA 4K55A 4JANB 4P3DB 1KCWA 4OZIA 3CQPA 4FQXC 3PFUA 4KUCF 2GEQA 1U8JA 1O6SB 2JKJA 4E5XG 5BW7C 4JFEA 4YN3A 4Y7MA 2HXAA 1ZHNB 4PI2A 4HIJA 5L4JA 2XA3A 1P4IH 3LX9A 5DFVD 1DQKA 1DZBA 1U8PB 2A2QT 3T2LA 4UAOB 2VR6A 1MFBH 3EDKA 4ZYKB 3V5HA 2GAZA 4YS4A 1TZGH 4G9DB 5FKPB 4ES8A 5EULV 5IMOB 2F8OA 3DO7A 4NQSB 2NX5A 4HWZA 4TLTA 3A47A 2BIIA 1FAIL 2XWDA 4N5EC 5F7BA 2BRRH 4R4BB 1DYZA 4CNIA 2F54E 4R26H 3EBHA 1OD7A 4HBCL 3MOZA 2NZ9D 4HS8L 5I5RA 1IT9H 3CDYA 1TCRB 1CYWA 3CVIH 5FDYA 1AE6H 5DHVA 3F5WA 1JWMA 4HBQA 3DBXB 2NZ9C 3AWEA 3G6JE 3TNNA 2NPLX 1U8PA 4RGNC 3N2AA 1M05A 1A1OB 3U7YH 3UG4A 1WZKA 4TVUA 4K3JH 3K72B 2VXVH 1G0XA 2AK1H 2B4CL 2OR8A 3HLAB 3X3GL 3CHSA 5KWYC 2ESVB 1CL7L 3GSNH 3FO1A 4D3CL 4PTTA 5T5FL 1MCEA 3DECA 4NQVB 1O6SA 3P0GB 4JK0D 4Z3IA 1G7HB 2VXTL 3QKQA 3A22A 4OCRL 3ZL2A 5ABZA 1RZKL 3AB0B 3BKYL 4LSVL 4BSVA 5D7KD 1U25A 1AQKH 5IVXB 1FGSA 4RMBA 4MTMA 2HX9A 1E4XL 1FFNB 5IKCA 1F6AB 3B2UC 2BH0A 1B4RA 1CFSB 2K8QA 3ARGD 3L3HB 4MXQC 2BFGA 2WQWA 2UZPA 4KXZH 4X0KA 3IJSA 2NTFB 4WI2A 1AHWA 5IF0B 3NIGE 3RY6C 4J3OF 1FGNL 4R4ND 4U33A 5F1NB 4I9WD 4FLOA 4M5SA 4UV4L 1QBMH 3HZKB 1KAVA 2DYSB 1JPEA 3HCVA 4TQ8A 4F7PA 4ONOA 1Q6TA 4GUPB 1MW2A 2DI7A 1M6UA 4M56A 1ODUA 1I8IA 2XZAL 1F18A 3KJ6L 4QYOB 3SDYL 1JAEA 3O3DB 4PB0H 2W9EH 4EIBA 3ZX1A 3C6SA 3DTXB 2AQ1A 2PTTB 3QUYA 5AOZA 3RVVC 3D50A 3CGTA 3HAEB 2JJSA 1KIQB 1LDPH 3D2UA 2OK0H 4ZW8A 3JWNG 3BMWA 2HFGL 2PKDA 2E5EA 2WQ8A 4RISL 1DVSA 3AU1B 4CN4A 1ZLUH 2OMUB 3ZDZB 1DVFC 2Z8SA 2A0LC 3MV8E 3S9DB 1I9SA 1MRFH 5FV1L 3UACA 1AI1H 4LASL 1DQQB 4X6DA 3BPNC 3ULUF 2EEBA 4P0DA 4L5FL 3TA3C 4BCXA 3ZZLA 3EYSH 1GR7A 4GQZA 5EV7A 4HMCA 2H45A 4G8EB 4KHXL 1YMMD 3LIZH 3UG5A 2ARWA 2BSRB 3BKMH 3KWXA 4UYQA 4GLRH 4N2IA 1E8ZA 5HY9A 2WTRB 2EXTA 3PAYA 2Q7NA 4RA0C 1IZJA 4A68A 3O0RH 3EJUA 4WSKA 3ZTNL 1IE4A 2A74C 2QQLH 4N2KA 1ZJBA 4OHIA 4Y1AB 3RTQB 3WXVL 5A7EA 4R6UA 4GBXB 3PABA 3LIUA 1FHGA 2E47A 2HKAA 2X0UA 3O3AB 1WEJH 2IH3A 3B2VL 2HNQA 1G6RB 3EHBC 1MJUH 1QUNB 1QVOB 3FTWA 3EDFA 4XWOC 5TPWL 5FYLE 4OW6A 1RU9L 4HVBA 4OJDH 1WQVT 5KVGH 3GNMH 4JQIL 2VM3A 3VXSA 2OYPA 1GW0A 3VSQA 2P8PB 1K5NB 2DIBA 5AG8A 3DROA 2MHAA 4MJ6B 4WI0B 3WIIH 1Y6NR 3PLYA 4BFIB 4GE6A 3QI9A 1H3WM 2UXTA 1U95A 1KZYA 2VQ4A 2IWEA 4N8PA 1KT2A 4KO7A 5FFOA 4XNUL 1J0KA 4IRZA 4NXSA 3PGDA 1A9VA 1E5CA 5MERA 5E08L 1BPLB 1TNMA 2YA1A 3T3MB 3EGSA 5T3ZE 3ATFA 2HZHA 4X6FA 1A3RH 1HXYA 2VIRA 1QR1A 5J12B 2BM3A 2NXZC 4JQVA 4LOUC 2A38A 4FC3E 1PKQB 4QHMB 4YL9A 3S4SA 4Y19A 3SGKC 1OL0A 4N8CL 1HS6A 3W39A 2FQFA 2DLTA 2X53A 2EC9T 2OZNA 3Q8AA 1MFNA 4XWOD 5DC0A 3QG6A 1IM3D 3TJEH 3WN6A 1EHXA 1RZ8A 1KENH 5CUSH 1G7LA 4BSWB 2ICWB 1TG8A 4XC1L 4OCSH 4OJAA 2JI2A 1MJJA 3CJJA 5SV4A 1JGLL 2NY1B 5JLZB 2Y2FA 3GSWA 2XQ0A 3WNLA 2FE0A 4JBSA 2HTLC 2OMZA 5HYJA 5GGUB 5FHBL 4QRTA 4QRUB 4QRFA 1ZGLP 4JFXB 4NXKA 1MH5A 1UWGL 1KCKA 3JV4A 3KR3L 3FUDA 2WPGA 1IV8A 1WZ1L 5FYJH 4J3WA 4YJZL 1PJWA 1DBAL 1TSHA 2OX5A 5CIPA 4EI6A 4W9CC 3U48A 2EYRA 4OFYA 3RUGE 3WKPA 1MNNA 3IMBA 4O02B 3CVBA 4RZCB 4ELMA 5MENA 3PQYE 4U0RB 1YDPB 4LQFH 3X13A 1FFQA 1YEEL 4I3SL 3ZU8A 2ICEA 2UAGA 3QCFA 5IJVB 1YEFL 2G60L 3L6FA 4XX1E 1KEMH 2G75A 2NY2C 2AEQL 1FL6B 2D31A 2OMWB 2R29A 3NIFE 5H2BB 4H8WL 3WENA 1HZLA 4EUPG 3BKJH 3LH2H 4PJ9C 4G43A 1WUNT 1RUPL 4LOFA 5CP3H 5FYJE 3RTLA 4AENB 4L8DB 2ADJB 1H15B 2APBA 3PL6C 5DVOA 5E99H 3SDDB 3HN7A 1RLWA 3ZT5A 4PJFE 4JFXA 5JZ7D 3SPVA 4LCWD 3GTNA 5EA0L 3BWSA 4GXVH 3S5YA 3CFKA 1IGYB 2FWLB 3F9BA 4I0KA 4GAGH 4WTXA 2EXWD 2WN2A 4GQ9H 2Y22A 1SXSA 3O4LB 4XP9H 1CF8H 4QD2E 5IM7B 3ULAB 4F9LC 5M7QA 1JF1B 1WVZA 3BVVA 3CU7A 3PE9A 4MS8D 1JVKA 1FJ1B 1NOFA 3GMNB 2CUMA 1FLRH 1CBJA 5J9PB 4YO0B 3FT4A 2P5EE 1ORSB 1X5XA 4AYBA 5MEOB 4HZLA 5FYJD 1A6AA 4WGWB 4P2RD 4PJ7E 3U0WL 1EHLH 5IT2H 3ZTJH 4KY2A 3MOWA 4UBDD 2O5YL 3C9NB 3LVTA 1Z5HA 3SPCA 3CBRA 1WS7A 3JQOB 4ODWA 4S1DD 4OHDA 2CRZA 4JFFE 3NSFA 1J8HD 3OBAA 1EHNA 1AZCA 4YDJA 4HIJB 1R3KA 1E8CA 4JNXA 3W5MA 1QOKA 2QKIA 4NLHA 4AV0A 1KYUA 3MJ9L 4XXCA 3T6WA 1MCIA 3MX0B 5I1DA 1F11B 3QXVA 4XN4A 2XN9D 1YQVH 1AJ7L 4O5LL 3S34H 2WBKA 4LEXL 5CEXA 4ENZA 4H1LG 1I9JH 2HG5A 3KBHE 4FXKC 5IIEB 3M07A 3RL1A 1J8HB 1G9HA 1KXTB 1OQOA 1Z7JA 5F9WB 1UXMA 2ENYA 3N2JA 4ZFGH 1RZGA 2HLAA 3BUTA 1UQSB 3ISRA 1A47A 4L2YA 5HYJD 5C0BE 4EBQL 4P4KA 1GHFH 1HX0A 3GBLA 4FI7A 2GJ6D 4Y5XC 1ZXQA 3ILEA 4I2XB 1J9QA 2FEDD 4MDJA 5HHPB 2B16A 5ESAA 3SDCA 3U2SA 1ZS2A 2VW7A 2W81C 2XZZA 3ZIMA 3LZRA 4X6BB 4ACTA 4KOCA 3GK8L 4CJ0A 1IC5L 4MCYB 4Z5RB 4Z78A 1LK2B 3EBIA 1LWJA 1BW8A 2OLDA 3EZZA 1B2YA 4ZFZA 4HOWA 5CBEA 3HC4H 5T3ZL 3L5HA 3RWEB 5CZVH 5BOJA 2QPEB 4XCNB 2FNBA 2DLFL 3P9MB 1TQBB 4YWGL 1BWWA 4V33A 5KEZA 3BP4B 1IAMA 3VCLB 1S7WA 5KVEH 2VZ1A 2X4SA 1RIHL 1QSFA 1UB5B 2Y1ZA 3QPXL 4LOVA 4IKCA 5AAMA 1P5VB 3VTTA 4YHML 4JPKL 4NJAH 3LQAC 1JHLH 4TNWF 3EOAA 35C8L 3FFCA 2ENSA 3FONA 4ODBD 2FD6L 1RIVH 4YDJB 2OYKA 3ZTDC 3H1ZA 3WJMA 3MRQA 3TS8A 2P5EA 1FN4B 1L4IA 4BH7A 1TR7A 3KCWA 4OJFL 4AEIL 3D39D 5C2BH 5JXED 5CXPA 1BZJA 3KDMA 4M6ML 1PYWB 4LHQB 1QKZH 4TL4A 5HI5C 4DJMA 2AV1A 3GMQB 3QORB 4NN7B 2JFFA 3UAGA 4LHUA 3W9DA 5D1XD 3SYOA 1GSKA 2G9HB 5HDOA 1KWKA 2CBMA 4GFXA 4DESA 1DDHB 5I1LA 5C70A 4WENB 5IBMA 1HH6B 3G04A 1TQCB 4XVUC 1J11A 1XMWA 3DX6B 2AXGB 4ZFFB 1XXPA 1NBYA 2GSGA 5C07D 1TKWA 1DQIA 4TKWA 3PWNA 3MC0A 1XHHA 5GGTA 4GINA 2VMDA 1WUZA 3HN3A 3NFPB 4OZ4A 3BPLB 2VDMH 2XKUA 4HXAL 4UV7H 4BRJA 5LHDA 1PDKA 2H03A 3U4KA 5K33A 3BP6B 1CQYA 2VOSA 3UMNA 3D0LB 4H25A 4OIIL 5I1GH 1JPGB 3GZKA 3ZO9A 4P59L 3ZIYA 1RK0A 5ICYA 3FHEA 4ZPTA 3N1MC 1A9EA 3RX9A 3MRKA 5TDNB 1QTPA 1II4E 5IBLC 5JTWA 4HWBL 3VW3L 3IMSA 4E9XA 1UM4H 1KLFB 1E6JL 5KAQG 1SJMA 2WLIA 5C0IA 3DOIA 4K8RL 3FCUB 2EUZA 3DO4A 3WUWA 4QHKI 1V7MH 3RILA 2J16B 5A2IH 1S5HB 3HG5A 5CZXD 2ZPKH 3GTVA 5KYYA 2R0WH 3NGBB 1CWVA 1WCQA 1VFAB 1KTDB 4XPHH 4D8OA 4E9LA 4L4VB 5I1KL 1Y6KR 1VZHA 3T5WA 1NWOA 1KJMB 5FA3B 3SDXB 4L1HA 5DZNA 3VFOB 4G70B 1PYWA 2CMRH 5KSAB 2WLYA 1SRDA 4NBYB 3Q9QA 1ED3B 2DIEA 3GMLB 2H4KA 2GB2A 1I1CA 3I75A 2ZYIA 1A7QH 3B5GA 4F80A 4FI6A 4CC4A 2P7TB 5AVXB 3KGUA 2NT1A 2A7BA 2VDNB 1RFDL 3MOAL 4IRZL 1ACYL 5DA4A 2BMKA 4AQ1C 4IBUA 3CD4A 4QTHB 3DNKA 2D3VA 1XH0A 4ZMVA 1Z66A 2KLTA 4AVHA 2ODHA 3H42H 1NWLA 4P2RE 2X44D 4W9IC 1FFPB 4J3UA 5T33L 4BKSC 3QDME 4OZHE 2DQMA 1BZHA 1NNYA 4R4BA 4HUXA 3EYOB 5KYYB 3EYVA 2O5XH 2HT3D 4KVCH 3IF1B 3C12A 1Q9OA 3JVGA 5L8JB 1TEYA 2VTFA 4S1RL 3OLRA 1GGIH 2F6FA 3KPRB 4OGYH 3ABKB 4GFUA 4BUBA 4F15C 5DD0L 2HRHA 5BX1A 3ZKMC 3B7YA 1NPJA 1NEZB 4G7RB 1WCBB 4GG6F 2QJDA 1GKEA 3HZVA 2NYZA 4Y0GA 4FI8A 3QDJA 3KYAA 5T1MB 4NQED 3DYMA 5HGDA 3ZDXB 3MRGB 3TBYB 1AAJA 4LCYB 4UT9L 4DK5A 3R7RA 5ID0A 4F3FA 5CCGE 5L7XL 5KA2A 8CGTA 1QASA 3ZKSD 1I8KB 4BKLA 3BKCH 1ZVSB 2ESVA 2IAMB 3B2PA 1GGBL 2MQ0A 2TRYA 1I7RA 4MAUH 4XN1A 1XGRA 3NZUA 5AB1A 2W94A 1JZ6A 4PJFB 1RMFH 5D7JC 1A3LL 3GJFK 4R2GC 3WCYA 2VQTA 4FABH 4XPAH 3GF8A 2ATAA 1U8KA 1WYJA 4I4WA 4RGMB 3MZGB 3GBNL 4NQQA 1HEJC 3O11B 5DYFA 4BCYA 1G6RH 1YNKL 1AG0A 4AOFA 5HHXH 5IESL 4JCLA 3C5ZA 1NOLA 5F7EL 4KI5F 1I8AA 3T8XB 3MLZL 5FPIA 3QI9C 3LKPA 4YFEA 1CTMA 1L3NA 5E9NA 3CQQA 2GUYA 3G5VA 1OSYA 3EFDH 1BD2E 1UT1A 1IEBB 2H2PC 3DRTB 3NJJA 2G3ZA 4G2AA 4PJGB 4JM4H 1Y07A 2VUOA 3DIFB 1A3ZA 3H56A 2CG9X 3W56A 4X9GA 4J3SA 3O2DH 4Y5YA 3SGEI 2Z9TA 5B1CA 1KULA 2VDLL 1K3ZA 1EZSA 4RBPH 4MJ6A 4WI0A 3HS0A 3MA9L 4BGLA 4OHEA 3PNWA 2YRBA 4UM9B 5I8OH 4G43B 3QEQA 4Y16A 3FNKA 4H20H 1NIFA 4G80A 4K3HA 1BEYL 3JSSA 4XN2A 4UQ9A 3WXWH 2O1AA 3AQYA 1JF6A 1DO6A 1N59A 2OS7A 3J8F7 5AOLA 3WGUB 1PIFA 1KTBA 5KSVA 5DMJB 1YGUA 1WT5A 2VN7A 3ROLB 2WIIA 1I7RB 1X3DA 4LLYA 3QQ9D 3HJEA 5C9KA 4PJIF 4ZAKD 1NAMH 3G7TA 4HFUL 4E0RB 4J4PC 1I1FB 4HWBA 1T6BX 4AVIA 4NO2A 5K1NA 2VDKL 4NN6B 5IB1B 5BUAA 2F1EA 5I76A 4PJIA 4FQHA 2K78A 3CPUA 3KWVA 4AK1A 2HRPH 5IQ9B 4CUCA 3B9KD 3BIKB 4U1LB 1OSPL 2MFNA 3NT0A 3RY6A 4HBCH 4KFZC 1XBDA 2GFBA 4ZUSA 4P2QB 3BD4A 4BWUA 4H8PA 4OLUL 3QCIA 3P4NB 3ZE0F 3KPPB 2WTRA 3L3IA 3QDJD 2IANB 4JKPL 3ZBMA 5TFSH 1FYTE 2F19L 4KUZL 3ULUL 4ZOAA 1B0GB 2WOYA 4J4PA 2QDCA 3CHPA 1PEWA 2X9WA 4J3OD 1ZA3A 4FXGA 1PY0A 3KWUA 5BV7H 4KI9A 4PJBA 1YYLL 4OLVL 4A6YL 1IC7H 4F9PA 5C6WH 1JK8B 4LSTL 3FTYA 2MPVA 3AG4B 5CZRA 1FBIL 1ZLUK 5F9JB 1JZGA 4E41D 1VFUA 4JVUA 3T3PF 5KSBB 2AJ3B 1RZ7L 4G5AA 4OCRH 3PXLA 1QSZA 4U1SA 1CN4A 1SHWA 1LHZA 1QP1A 4YBHA 2D3JA 4PJCF 3HI1B 4HUNB 2EDTA 1MREL 4N6QA 2P42B 3VWKB 2DQHH 3SE4A 4UOJA 2YQ3A 5J7CC 2OP4L 4GIOA 1M3JA 4GMSL 4DP0X 3GHPA 5KVEE 3F6JA 1ULVA 2OFQA 4L2LA 3N06B 3O3DA 5CGYD 4K7PX 5I1AB 1OE2A 2F2HA 3SJVE 2A1WH 1U8NA 3ULUD 4J39A 2JMRA 4DZBA 1IGJA 1TFPA 1M7IB 4FFZA 2K6ZA 1FE8H 1I1RA 4OFDA 5CWSA 1D7BA 1GMEA 3RVXD 2ZCKH 3H55A 3US9A 1CI3M 3VI3A 1PKOA 1MH5B 5J6SA 3FTVA 4BZ1A 3FSOA 2JJTC 3RL2B 4PJGF 3LNGA 4PLJC 4F58H 4OFKA 3NSDA 1PA9A 1UYWL 1N4XH 4W9ZA 1LMIA 1BJ8A 4OJEH 4WO4D 3VI4B 3TH3T 2V17H 4O02A 3V0GA 4HIPA 4NJ9H 5F8QC 2GC6A 3TCLA 3HI5H 3C2AH 3IPFA 2FIKB 5H37H 1AI1L 4LASH 5K1JA 3RG1C 3VYNA 2GBUA 4OY9A 4Z3HA 3LK7A 1NGQL 2BP8B 4DN3L 1NAKL 3J07A 1C7SA 5CGBA 5H35A 3P73B 5JHLH 1Q72H 4X6CA 1SYSB 1R5WA 4M7KH 1I8LC 4M6OH 3QWRA 3SE3A 3WD5L 4P9HC 4F91B 3VWKA 4FA6A 1FZMB 5T1LD 3NZ8A 5I17B 5LCVH 2YQGA 3LZFH 3JTTB 1PD6A 2ZOOA 32C2A 3CZEA 5E8OB 1DVFB 2XX1A 4FFYH 3FQ1A 1MCLA 3R18A 5CLZA 1T03H 3PAVA 4QY8B 1VF5C 2Y2YA 3N43F 3ULUE 1X5IA 3HBGA 5TDOA 5JHDD 5BXFB 4PJDF 6CGTA 1ZHBA 5FOBA 2F54B 1NGPL 3TEWA 5T3XL 5E1QA 3EO9H 4F2ME 4Z7QE 4Z7WB 5AALA 1TIUA 5ADPL 3V9EA 2L04A 2VYRE 5E4AA 1RJZB 5JIHA 1OM3H 1QFWM 3LDBC 3MACL 2VQUA 2R0ZH 5E1AB 4I5BA 4YR8B 1WBXB 1JNLH 3R06B 5D5ME 2FIKA 3QUMB 5C07E 5M43A 2DOCA 2P46B 2DQEL 3N44F 1M56B 1BYOA 4Z3JA 5MERB 2WCGA 5HVGB 3SDCC 1UA6H 5HYJE 5D7IF 4DQOH 3BZFA 3K7UA 4D0CA 1A4AA 1J5DA 4F8NA 1SFHA 1L9NA 3HZYB 3TZVD 8PAZA 1AQMA 1H3TA 5KTEL 2YD9A 4GG8B 2GI7A 3AVEA 1EJ6A 4RZKA 4DVRL 2HT2C 2IPKA 3KLKA 3HR6A 3FRPB 4ZO8A 3VFMB 3MJ7A 1HOEA 6TAAA 5GGRB 1NFDA 4Q6IC 2ZXCA 5B21A 3IJ8A 3VA2C 1UZ6F 4NGHL 2EKSB 1IGFH 4WHTA 2IC2A 9PCYA 1I8MA 3RUGB 4GAYB 3PP3H 5AAPA 1YMMB 5DRNB 1FIGL 3HBQA 2ENQA 4HS6B 3D39B 3BM8A 4LSQL 3ALWA 5EMYA 3CLEL 5DO2D 4OBSA 3SR9A 2HJFB 4K15A 4NO0A 2EIZB 4UQ3A 1AKJB 5IVZA 2B1HH 4N85A 4LP5A 1FNAA 2NY6D 1NCUA 5EF0A 5LLIC 1M3GA 1C5BL 2VH5L 4Y2OB 2WUCH 4AQAB 3MV7D 3WLBA 3T9WA 1IAIL 1GGCL 2PXYC 1RUKL 4K3GA 4AQ1B 1T2QH 1P53A 2Q87A 4WO4C 5K9JL 5GISL 2Q6WB 1Y18B 2OMYA 1AGFB 3RWIA 2YAMA 4DN4H 2WB1A 1DZ0A 1JPGA 3BGFC 4LKXA 4PYHA 1Q90A 1OK8A 5E9DA 1O7DC 4S1SH 4TQEL 5EFIB 2QQNL 2FK9A 4LAQL 2RCSH 2YLHA 3EOBB 1R3HA 3JV6B 4AJWA 2GY5A 2OSWA 4F2MA 3NRPA 4YHPB 1MRDL 1AQHA 4HPHA 3IAQA 3T2OA 5IBLD 2VE6B 5SWZE 5M94B 1TO5A 1XVSA 2VMJA 3BWUC 5CILL 3FH7A 4U1NB 5D8JH 4KYQA 2L3BA 5SWZA 4TVSa 5E1GA 4I3SH 1CS6A 4RMRA 2GK2A 5SV3A 3WN5B 3GSVA 3V4LA 1IGTA 1YEFH 4IRSB 3Q7JA 5F1SA 3BZEB 3ARXA 3LKRB 2DJSA 2CNIA 3SDDA 1BF5A 2B3RA 4BYHA 5EEXA 3LH2L 2BOBB 4PRPE 2ZN7A 1ZTXL 5D1XB 3MMEB 3UYPA 1R3IL 2CO3A 1DSFH 3V0EA 1RPUA 2XWCA 1VFAA 2FX9H 2VR8A 1YECH 4UQ2B 2G3MA 1QWNA 5I28A 2RACA 3OTTA 4U0QB 5HGAA 4KKAD 3CN4A 1D9KD 4M5YH 2X1PA 1MG3C 4F92B 3FRUA 4J3OC 3RU8H 3FF7A 4RMTA 3EH3B 1PNDA 2ODIA 4OD3H 3RWHA 2R7EA 2WUBL 2P5WD 5KSUA 4IMLA 2K3TA 3PAUA 1J5IA 4ODWB 4L4TB 1ZMYA 5AVTB 4F37F 4G6KL 1H8LA 4M7JH 3QISA 5IK3B 3F5WB 3O3EA 2GHZA 4JM2C 4AEHH 1ZHKB 3BWAB 1JNNL 3TM6A 1IGIL 3F58L 3MV7E 3PWNB 4Q14A 4M1GH 4R0LA 3VRLE 4MQ7B 2JELL 2P5WB 4QTIH 3BZDA 4HLEA 5BZDA 4EAEA 3QDHA 4HUXB 4G3YL 1G43A 5FWQA 2OQJA 3MRIB 1NM4A 1RPMA 4M61B 3MLRL 3ULVL 2ADFL 1R6VA 2FX8H 3OLIA 4FYRA 3HG4A 1MF2L 1XZ0A 3H7BA 4N6RA 4KDTC 3PGCB 5HHQB 2L4OA 2FRGP 4NO5A 1JHKH 2NLJA 5T3XE 3DGGB 2UZXA 4AJYV 2CCWA 1TYRA 2BOLA 1GZPA 1IGML 3T2PA 5GHWH 5D1ZC 2X6BA 3HNVL 4NPKA 3GS7A 4FTVE 4M7LH 4OHLA 1AO7E 2YRPA 3AG2B 1J9CT 5DHMC 2N7SA 5D1QD 4AW4A 2GJPA 3NJHA 2WVVB 5F9OL 1THCA 3GIVA 1LO5B 5IK3A 1KPUB 1QLRA 2QDWA 4ZUVA 1W80A 2H6UA 4NRZB 4HULB 4JCMA 5CFAA 3O4TA 4NI3A 3RWEA 4JFQA 4NQSA 4XC3L 3V5DB 2AABH 4ODVH 3EIFA 2X2YA 5I15L 4WFED 3HUJA 3L4YA 4N9GB 4NUMA 5DZPA 1GH7A 4WV1B 2KZWA 2PCPA 5EDXA 1ZHLA 4P5KB 4XVTL 5HYQB 1WWWX 1G7JA 2Z7UA 4I18C 4BDVA 4IEFB 4DKEL 4XBMA 1GG4A 1EJOH 3DDFA 3KS0J 2W0LA 5D1ZI 4JFHE 2HVBA 2PPDA 4X80H 3TWCL 3AS3A 1NMAL 1RIHH 1NL0H 5I6MA 3L3JA 4JMXA 3RBSA 2MNUA 4XNBA 4WWKA 5I1JH 3EF4A 1GC1C 4BJLA 4CSZA 3K46A 2WIMA 2DM2A 2AHIA 4XP1L 5EU7C 2ZX5A 3SCMD 4OCYL 1FCGA 3TO4D 3A5KA 2VLJD 1PAMA 1DBJH 2B1AH 1RHHB 3FT2B 1CPUA 4JNBA 4XAKE 4RI5A 3L8QA 1Q9OB 3MUZ1 3TV3H 5JZ7C 1TKWB 3TT3L 1TQBC 3BUDA 2B3IA 4HKZA 3U79A 5I6KA 1V3JA 5IBTH 2VDOL 1FNLA 1L7IL 3FQYA 2BS8A 4P57B 1MFMA 4YHLH 5JR1H 1OHDA 3OB0K 3ZW3A 3LAFA 4UDTB 3DHMA 3DX8B 3CZSA 1WITA 2VZUA 3EF7A 4GO8A 4K2UH 3U83A 3V0HA 1XDTT 4RWYL 1KBGH 1E8YA 2VDML 1EEHA 4XXDB 4C57C 4F9PC 3TO2A 1EJ8A 1NWEA 5IB2A 4TLSA 3PGDB 3R8QA 3EH1A 1FV1A 4DTGL 3QUXB 5DD6A 5BV7B 2VDQH 1PZUB 3K2UL 3ARZA 3OLDA 1KJ2A 1BD2A 1KIQA 1Z5LB 3MLUH 4N2BA 4R2GB 3H54A 1YC8A 1KBBA 4PJEB 2IQ9L 1A6TA 4LSRH 5E00A 1QSFE 2WNGA 3QIWA 1VFOA 4GS7C 5AL0A 4L23A 2O6CA 3WIHA 3RI5F 3D52A 4KYRA 4XX5A 4AM0B 4GUPA 3DVIA 4A2MA 4YHIA 1KF9B 4LZKA 2PO6C 1F45A 2EE0A 5L6YH 1U8LA 2NDFA 3IDGA 3O0LA 4PJ9A 4BFKA 2P8LB 1N5YL 2PPEA 3IJSB 4RAUB 4XMKL 3A21A 1NOAA 2UXFA 3SQOL 3CZLA 2MCAA 2MQ3A 1RZFH 3W9EB 2DQGL 4GG6B 5JOPD 3NA9L 4ZO9A 4FFYA 2X89D 5F88B 4HKXB 4EMZA 3WKNA 1B6UA 4KX9A 5HPMA 3ENEA 3PWVA 3TP4A 4TUJA 5D1QA 2VZSA 1W0YT 2NNCA 2XTSA 1KN2L 4J28A 3EUDA 4HGMA 3ZSSA 3N1GC 1FPTH 2QPUA 5AB9A 3QHZH 3DPDA 5DR5L 3FAXA 5I2IA 4PJIE 2YD3A 2X4QB 1OIOA 5AW8B 3D09A 4OTXH 4FJZA 4PJEA 2ZNXA 4E9TA 1TQUA 3FO1B 4PS7A 5F0JB 2EP6A 3GRBA 4G42A 3VA6A 3MBXH 1FO0B 1X9UA 4RA3A 3GUTB 1M6OB 3QUXA 5DD6B 4I9WE 1SXBA 3FAWA 1RIUH 4PR5A 3IDNB 3V4VB 1OW0C 4MCZA 1WFOA 4N2MA 4NX0A 4XPGH 2B59A 1HK6A 1DHKA 3ARTA 2A9MH 2DJUA 5DD0H 2FJNA 4WFEE 4GRLA 1BVLA 1RI8A 1GAFL 3H4FA 3IFPA 2E7CA 2K8MA 4MA3A 4ERSL 4QYOA 3F65A 5IEKB 2ERJC 3KPSA 3NG5A 1AXTH 3C5XA 2R1XB 4PJAF 4B41A 2EXSA 4JUTA 3GC3A 2DWDA 4MBBA 3LRMA 2IANA 3CFKB 3RVTD 1BIIB 3MV11 2XPGB 3ZHLA 1QSEB 3MJ9A 3WHXA 1Q6MA 1TZGL 3IS1X 3QR0A 3MLSH 5F8RC 1W0WB 2Q20A 3OWEA 2ZMMA 2GFBB 2F70A 2VKXA 1FPRA 4NKIL 2OMUA 2HC1A 3R0MA 2YDUA 4AENA 3ECVA 4ZD3H 5F0PB 2H32A 2YEVB 3QEQE 2DRUA 3LHPH 1JWSA 2C3HA 2P5ED 4U6XA 4XOAA 2NY4D 3QCMA 4ELKB 4RFNC 2B07A 1YY9C 5A7BA 3A6OA 5JDJA 3H3KA 4CADB 4FCHA 5KJ7E 1USZA 2MHAB 1AGDB 1EZVX 2FATH 4HHWA 4OCXL 4Q89A 2ADIB 3IDIA 3MBWA 5E5MB 3ZQXA 4P3WA 1JPSL 5T1LA 3BAJA 1U33A 4G6ML 1HHGA 1QRND 1GY1A 5FB8B 3ZE0B 5HHXL 5IESH 3HEIB 2DIAA 2B2XH 3T71A 3SBRA 3IDMA 4OI9A 5D1ZB 4MJIE 3H9ZA 1ZANL 3WEAA 1ML0A 5AAWC 1XBOA 2DI9A 4I0PB 4O2EB 2FAUA 4OM1L 2DI8A 3P54A 5FYLD 3S37L 5K39A 1IGTB 4G80B 1PTYA 2P3YA 4DKDC 3TGXA 4YHKH 5HYJB 1RVFH 4FQPA 5J1TC 1OAUL 2XY2A 3QYCA 4DHLA 4Z7WA 3JWOL 3DSFH 4W81A 4KKRA 5TE4L 3PGFH 3WKQA 4AIXA 2XY1A 1WG3A 4X6CE 5FO9A 3O2VL 3P3SA 2J3SA 5ADOH 1OT4A 1CGSH 5DK2A 2NTAA 3FQNB 1W8NA 1BF2A 1D3CA 4C4BA 1IM9D 5F44A 4B60A 4TSBH 4FZEL 1RULH 4KOBA 1KIUA 1FGNH 4UINL 5ICXA 3VDCA 2Z35B 3BOVA 4Q52A 3UBXG 4AW7A 3F62A 4M7LT 4M6AA 4JG1L 3DI3B 3DVNB 5FCUH 3FHAA 3OR7A 1HXYB 1U8OA 1MAKA 1MRCL 1EVUA 2W9EL 1LQFA 1URZA 3IS0X 2Q8AL 1SHSA 4XXWC 4P5MA 4K07A 5CLXA 1WICA 3R4DA 3WJMB 1C5CL 2ITDB 4J3OG 4QHNB 3GSOA 1LO0L 1I4FA 4DK6A 4WFFE 3A67H 2KBGA 5KJRL 2OPCA 4PCTA 3NPSB 4JN1L 4OH2A 1IEAB 3NTCL 4HK0B 4BH8B 1NBCA 1MRFL 4LAJH 3SGJC 1A7PL 2NR6C 4PBWD 1IAKA 4ZZFA 4Y2DC 4WVRA 2JJVA 2PWFA 2JQMA 3MRPA 2VLRD 4BUGA 5B38A 3ES6A 3M7FB 1AMYA