3V0EA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 256-576(c363s)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
320
structure length
320
Chain Sequence
b'MRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 102
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0eA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0eA01
2OUDA 5K9VA 1XXPA 2HY3A 4Y14A 4JBCA 5BZXA 3U96A 1NWEA 2NLKA 3EU0A 5KA8A 4HRFA 4GRYA 1BZCA 5KADA 2I6OA 2HB1A 3QCLA 3EMUA 4QAPA 3S3EA 2QDCA 3F99A 1YN9A 1OETA 1PYNA 4R0TA 1U25A 2OC3A 2I3RA 3CWEA 1YGRA 4DGPA 2I1YA 3QCMA 3D9CA 1OHEA 5KA1A 2HXPA 3I7ZA 4OHIA 5M43A 2CM2A 5KA7A 2B4UA 3MMJA 4KI9A 3F41A 4JMJA 3ZM3A 3V0DA 2FHCA 2I4HA 1PH0A 3NMEA 3QCHA 2I6IA 5HDEA 1D5RA 3D44A 5K25A 3QKPA 1YFOA 3BLUA 1ZCKA 2CNEA 3ZM2A 1WAXA 2HVLA 5K23A 4GFUA 3D1OA 1OHCA 1T4JA 2OZ5A 3S4OA 3N0AA 1V3AA 3A5JA 4Y2EA 3EAXA 2QBPA 4D3QA 5GTJA 1G7GA 1C84A 1XM2A 2P6XA 2NV5A 3O3LA 4NYHA 2QBSA 4DGXA 2I5XA 4TVVA 2F6FA 4J51A 2H04A 2BGDA 2NT7A 1VHRA 3F9BA 3V0GA 2I75A 4HJPA 1OHDA 2CNIA 2AZRA 3A5KA 5KACA 1BZHA 1KAKA 1OEVA 2VEXA 2FJMA 2PBNA 3EB1A 2PA5A 1GFYA 2J43A 4QBWA 2F6TA 1L8KA 2I6JA 3O4UA 4HJQA 3GXHA 3S3HA 2NTAA 4QBEA 3OLRA 3MOWA 5MMZB 1LYVA 5EHPA 2J72A 4ICZA 5AWXA 2DXPA 4RH9A 5EHRA 4OHLA 2CM8A 3QCEA 1JLNA 3O4TA 1PA9A 1ZZWA 4OHEA 1PXHA 1PTTA 1FPRA 3S3FA 4WOHA 2ESBA 2HC2A 3D42A 1ZCLA 4R0SA 4D3RA 1Q6SA 2J44A 4BPCA 3RGQA 2I6MA 2BGEA 4GRZA 1PA1A 3QCIA 2HNPA 2I4GA 4NNDA 2FJNA 1PTYA 3QCBA 2JJDA 2QBRA 3ZM0A 2FHBA 1X24A 4RH5A 4ERCA 1Q6TA 4WU2A 2B49A 1R6HA 3ZMQA 1RPMA 2VEWA 2Q05A 1T48A 1PTUA 1OEMX 3QCNA 1NZ7A 3GXGA 2H4GA 1Q1MA 4B04A 2B07A 4RI4A 2YA1A 4GS0A 2FH7A 1M3GA 2IMGA 2PQ5A 2F71A 2R0BA 3V0HA 1Q6NA 3F9AA 3AWGA 1A5YA 2F6VA 2SHPA 3O5XA 5KA3A 4RDDA 3QCKA 4RHGA 1AAXA 3OMHA 3SMEA 2H4VA 3QCGA 4GE2A 3ZMPA 3RZ2A 4ZN5A 3RGOA 2CMAA 4S0GA 1RXDA 1YTWA 1JF7A 1Q6JA 1I9TA 4GE6A 4ZI4A 2J16A 3F81A 2HCMA 1OEUA 2VEYA 5BZZA 4WU3A 4YAAA 2OOQA 5KABA 4BJOA 4QUMA 2A3KA 3CM3A 4KYRA 1EEOA 1C85A 2QCJA 3D1QA 1YTNA 1G4US 3QCCA 2I3UA 2B4OA 1OESA 1YTSA 4GWFA 1GWZA 1C83A 2HC1A 1YGUA 5KA9A 2CJZA 4MBBA 2F6YA 2ZMMA 3H2XA 5KAAA 3EZZA 2VEUA 5KA4A 3M4UA 4H1OA 4OHDA 2J71A 1WRMA 1OEOX 2F6ZA 4NX8A 1I57A 1C86A 3PS5A 3I80A 1G1GA 4IKCA 1QZ0A 1ONYA 3QCDA 5BUGA 4I8NA 3B7OA 5KA2A 1KAVA 2CNHA 1PTVA 1XRIA 2YOCA 2H02A 1U24A 2QEPA 2NZ6A 1LARA 1NWLA 1YZ4A 2I42A 1SUGA 4RI5A 2GJTA 2F46A 1Q6MA 4RKKA 2F6WA 2HNQA 5K24A 5IBMA 1ECVA 3BM8A 3BRHA 1G4WR 4PVGA 1ZC0A 3AWFA 5K22A 1G1FA 3SR9A 3QKQA 4NWFA 4AZ1A 2FHFA 1WCHA 1C87A 2QBQA 4JMKA 3O4SA 1C88A 5LXQB 1T49A 4Z6BA 1QXKA 3AWEA 1J4XA 2PSZA 2BV5A 2F70A 2ZN7A 2PT0A 4YR8B 5I6VA 2CMCA 2B3OA 1P15A 1L8GA 2CM3A 1G7FA 2I4EA 2B4PA 3V0JA 4JNBA 1MKPA 2AHSA 1U26A 4GE5A 1YWFA 2G6ZA 4H34A 2E0TA 1I9SA 5BX1A 1FQ1A 2BZLA 2GWOA 3QCJA 2CMBA 2J17A 5K9WA 3V0FA 2B4SA 2YDUA 1BZJA 5IBSA 1NO6A 2J73A 4GFVA 4D3PA 1NL9A 4WTYA 2MBCA 3I36A 2QCTA 1LQFA 2H4KA 3LJ8A 2C7SA 2J16B 2WGPA 3MOZA 2CFVA 3RO1A 1XBOA 2NT2A 3ZM1A 1YPTA 2RF6A 4QAHA 4NWGA 2Y96A 2G59A 1G1HA 5J8RA 4ZRTA 2BIJA 2GP0A 2H03A 3ZV2A 3S4EA 1NNYA 4KYQA 2CNFA 2C46A 2M3VA 3D1HA 3S3KA 3V0EA 1XXVA 4R30A 3V0IA 3BLTA 1FPZA 2QDPA 1ONZA 2VEVA 1Q6PA 4QUNA 2Q47A 2PI7A 2CM7A 5KA0A 3QCFA 2CNGA 4PYHA 4OHHA 2Y2FA 2QDMA 1EENA 2P4DA 2I6PA 2A8BA
chains in the Genus database with same CATH superfamily
1BXAA 4JG9A 5D1XD 1A7NH 3GHPA 4KUZL 4ETQB 1VFBB 3NJMA 3GJEB 1KTLB 1SMDA 1EEYB 4LLYB 1LP9E 5BZXA 3UTOA 2COVD 3V9FA 3HIZA 3HJ0A 4BSWA 1OOAA 4EDWH 3W9EA 4EI5A 1NFDA 3P9MA 1C5DA 3B3IB 4NFCA 4GRYA 1XCWA 1SHMA 3P4LA 5FHBH 3MJGX 1K3IA 3FNKA 2QHRL 1PFOA 2CLVA 1G7PA 1EQWA 1THCA 2XTJC 5HI4D 3AACA 1AHWC 2DEYX 3HPJB 2BNQE 1MCFA 1AXSA 4LDLB 4X8JA 2D7QA 1S7UA 1I7TB 3LQAH 2WVTA 5GGVH 1U41A 5I1EH 1Q94B 5EBGA 4LKXA 5M43A 4FI8A 3I6SA 3CHPA 1BF5A 4DW2H 3MBEB 1O9WA 3WLBB 3T3ME 3ZM3A 1UT1A 5PCYA 3IDYB 1ZLUK 4OF7A 4X7SL 3RFZB 5CN2A 3ARDD 3WLWC 2GC7C 1MLCB 3D39B 3IU3A 2J6WA 1JGVH 3D44A 1Z1WA 4N5ED 3SKOA 2CHNA 3DMMA 3L5WA 3P2TA 4FE9A 1FG2A 3VG9C 5C07B 5C0CE 7FABH 3ZM2A 2WYIA 2YZ1A 3NSYA 5CJXA 4DN4L 5KVDH 4FL4B 3ULVL 3GMQB 5EU6B 4QAWA 3E8UH 4IRZH 3DSFH 6PCYA 2VDNL 3M8OH 4Z7VE 5HVHB 4XP1L 2ESVB 4XP6L 3WIFA 2J20A 1Z3GL 2JK5B 2NXYB 3PWNA 4L9DA 4FFWC 3N1QC 2QQNL 3TCTA 1TTBA 4Z8FL 5BRQA 4BELD 3VJ6A 5CLZA 3LNHA 1C84A 2E7MA 4N8PA 4JFOA 5C8JB 1L9MA 4TVVA 1CC3A 3KYKL 4QRUA 3MA9L 5K9QG 2Z34A 2EDOA 3ARFA 4UAGA 5TDNA 4LPVA 3L2NA 5IM7B 5A5FA 3OR7B 1FI8C 2X2UA 4Y4HB 3SYCA 5CP3H 1PZ2A 4L37B 5GJTL 3SE9H 5E0QA 2YZ8A 3Q5YA 3QZMA 4HCRH 4GXVL 4N0RA 5DEZA 3VA2C 2YXVA 3FONA 3GSNB 3QZLA 1A9BB 3OPZH 5E2JA 1F2XK 5E2UH 5I0YA 1E4WL 4GINA 4Z7IA 1AKPA 1DJGA 3C08L 3HG2A 4LSQH 1E0DA 5E8NB 3Q3GA 4LCCA 2BNUA 3BLBA 4PJ5B 4AG4H 5ADOL 5F88B 2YKKA 3WHXA 3MOWA 4E2OA 3DX6A 4JGUA 5LN4A 5TPWL 2ENPA 3GEWB 1R0AL 3ABMB 3U1SL 5AWXA 1UXWA 3QJQB 3L95B 2HPTA 1L0QA 2IANE 1BZOA 3QFDB 3SO3B 4BFIA 3VXPA 2C9AA 3T4YA 5LG6A 4F8QA 2ZX5A 1JGEB 3F6JA 4NQUA 5JIIA 4JJ5B 2B1HH 2YK1L 4PN6A 1ZZWA 5J3HD 2LU7A 1WAAE 4PJDF 3SDDA 2PWHA 1CXKA 4AEIL 1QVOA 4ZNEE 5KYWB 4AZUA 3RVXD 1IL1B 1W72L 4N2MA 2RCSL 3EHBD 2BHUA 2QQKH 5KYYB 3TO4B 3M46A 2BW5A 1HOCB 5ITFA 4KY1L 4A63A 4KDVA 3NCJH 3P30H 4WHTB 1B9KA 3KPRA 2E27H 1W72A 3EF7A 2HNPA 3F7LA 3NK4A 5I5JA 1NKRA 4JN1L 1BEYH 1UKQA 4XMUA 4N8VG 3ABKB 3QP3A 1MCQA 2EVFA 2D2CC 1COBA 2V7HA 3T0EC 3ZM0A 2G60L 1UWXH 1UEMA 1AQDA 1OP5K 4AJYV 3HFMH 4JGJA 5IMKB 3NN8B 5T1MA 4XPFH 2J8UE 1OF0A 3HC0B 4GFTB 1JYNA 1EGJL 3BH9A 4J6RH 3RNQB 1UWFA 1D7DA 1VFUA 1TJMA 2YD1A 4R5XA 3KL3A 1Y6MR 2ZNXA 5EO9A 1ZLSL 1AGFA 5HHME 5EA0H 3HC4H 4MBOA 3QORC 3C2AH 1RULH 4MCMA 2V6HA 4HK0B 4UM9B 1V10A 4MCZB 1NZ7A 3PREA 8PAZA 3FF8A 1EGJA 4XPBL 5DQJA 5AVRB 5H94B 3S3BB 5E6ZA 5F6HI 4JPIB 1LEGA 1KOAA 1D7BA 1NMCB 1A4BA 4PJ8A 4AOFA 3APNA 2H0FA 2NUPA 2AXGB 3QIWB 1M3GA 2AABH 5B7EA 2PTTA 1I1AB 1CL7I 1O7DC 3AREA 4R0LA 5T3XL 4TF4A 2R0BA 1ZA3B 4AQ8A 3F9AA 1I3RB 1HCVA 5B3SB 1H3VA 2ZOKB 2Z92A 2DQJL 1FNSH 2Z0BA 4J3WA 5D71H 1S7SA 2BSED 2ENQA 2X5PA 4JO4H 1QFWL 3LCYA 3PWPA 4ZFOL 4I3SH 1CF1A 5DD0L 5D1ZA 3BPNC 1JHKH 5HBBA 4PTUB 1XBDA 3OF6D 3CV5A 2VMEA 1WO2A 3RZ2A 4MZ3A 4GRWH 1RZ7L 3FTGB 3PGFH 2CUMA 5BXFA 2BIPA 2F1BA 5DQDH 1T83A 1WSST 4PV8A 5FO8B 2Q7YB 3UYRH 2CLZB 1GL4B 3B2DC 3MLZL 4WUUE 4OU3A 2E5EA 3RGVA 4ZFOA 2W60B 3CPLB 5K9QI 1TEYA 1U8HB 2Z4QB 3L4TA 1F58L 3RWJA 4J3OF 2WBJC 4FQXD 2A3KA 1NCBL 3CM3A 3MZGB 4IQHA 3BVVA 3KG5A 4U6XA 4MA3B 2YS4A 1AVAA 3QCCA 4R97C 2NY6C 3SPVB 5FFLA 3X11A 1ZV2A 4MAYA 1OSYA 3FU7A 4FQPA 3HG1D 4P57A 4GWFA 2W5PA 2HC1A 1Z3RA 3H3KA 1ZLVK 1UT2A 3S4SG 4I0CC 3RDJA 4NHUB 3N3EA 4OIAA 4AV0A 2I7OA 2VC2B 2ZAGA 1Y7VA 2DAVA 3AJ7A 3BWUC 4QWWC 3TZVB 4PJEF 1DBKL 1ZS2A 4P9ML 3RY6A 3RVXC 3UG5A 4N6QA 4L05A 2P5WE 5AAMC 5CF3A 1VFAB 4ZQTA 1PMYA 5J06A 1T5XB 1IZJA 2BZ7A 2H32A 1OEOX 1MY7A 2UWEF 5FYKD 5SWSD 4KZEL 1KG0B 2PWGA 4FQCL 4NZFA 4E9YA 1IGML 4AEHL 3ALWA 1U91A 2BY3A 2O4EA 4J8QA 3MMEB 2AQSA 1JDCA 3C6LB 1TKWA 3F3HA 4H26B 1LXMA 5D4HA 2KZ1B 3VDAA 5FECA 1CLZH 1MRFH 2GIXA 4BDVB 2VUKA 5HTSA 1U2HA 3CDZA 1KJVA 3MV9E 1LARA 2YD5A 4NC1C 3SCMA 3GKWH 4FQ2L 3SE3A 4DEWA 2I42A 1SUGA 1M3JA 3KBEA 2D9CA 3UZVA 1UAGA 4RI5A 3P9LA 4L23A 4Q8BA 5DLMH 3T0WA 2VN7A 1WICA 1XO8A 1ZDSA 3MOQA 2YXMA 3H55A 3PNWB 4PVGA 5AL8A 2XWBA 3TEXA 4FQQB 4L48A 4B97A 3PDOB 3KVPA 1A4AA 4U33A 3E38A 3NAAL 2VXQH 4FQHA 1E5AA 3LS4H 3FUDA 4MAUH 3U9UA 1ZHBA 1YRKA 3R19A 1OLZA 2PXYC 4I85A 4POUB 5I1DA 3WHE1 5FYLD 1E50A 1I9RL 4LDEB 3B3BA 3TLRA 2VZUA 4IGBC 1QATA 1JGVL 3EYUL 2IH1B 3BI9X 3LYRA 3QI9C 2XN9D 4U0RC 4RGNE 4Z6BA 1S8DA 4LVHB 4HUXA 4M4PA 1HXYB 4YR6A 1F45A 2R29H 4XVTH 3ZE2F 1HNYA 3B34A 5IIEB 4OZFH 3ATBA 5E8EB 3WS6A 4DOHE 3TBVB 2MOGA 3DUSA 3TA3B 2CMCA 3C5ZA 2DKUA 2YPVL 3SDAB 4BRVA 1DVFC 3VNZA 5F3BA 1EEHA 2WZ0A 1E6JL 2F19H 4PJIA 2FIKB 3W57A 5H4ZA 1NC4D 3TBYA 3B4NA 1FZMB 5IJKA 1FGSA 2AEPL 2ID5A 4IRZA 4YSAA 4OV5A 1YWFA 4HKXB 2XFGB 5T5FL 4UILH 4AYBA 2YPVA 2EECA 1EXUB 1MEXL 2IAND 3WV0A 2VZVA 3UJJH 5FEBA 2ZCKH 5C0RL 3MVNA 1R5WA 3COOA 4QOKB 5D7JA 1NO6A 5AW3B 5ADPH 4LSTL 1WT5C 3SPCA 3C6SA 5T5FA 3WKMH 4AJVA 1PLBA 4KRNA 3C60B 5DWUL 4JM2A 3N44F 5CNHA 3CX2A 2BPBA 4QXUH 1AR1B 2OI9C 4BD4A 1JN6A 1IGJB 1CXHA 4IRJC 1GIGH 4OFYD 4P9HL 3CHXA 4P2QD 1C9SA 2GJ6A 4NRZA 4MMXB 4AV5A 4FLSA 4HJGB 15C8H 1IB5A 3PAVA 4A2LA 4WW2F 4IRSB 1WS8A 2FBRA 2XC8A 3TH2T 4DN3L 4HCRA 4HZ1A 1G1HA 2VM4A 4GKZB 4PRHB 5IOKA 2GP0A 3O3AA 1KEMH 1CLOL 1BQSA 4R7DA 1GY1A 1LO5A 3T09A 4Z76B 3LRHA 1FAIL 2EEAA 2BSTA 5DHMC 3S37L 4GW1A 5I74B 3BN3B 5G5DA 5K69A 4RWYL 5IW6B 3CVBA 4LFHD 1M7IA 5I17B 5KSAB 1CQKA 1F11A 1YCSA 4PWJA 3V0EA 3O6LL 3L7FA 4OZHE 3RWCB 6TAAA 4NN7B 1Q6PA 4W9GC 1ZHKB 4DKAA 1DUZB 1PG7H 3HI6H 4MB1A 4NDMA 3MV7E 1HINH 4HAGA 4JANA 1VPOL 2AK4B 2VTFA 3RZCB 4N3TA 1F2QA 4ACTA 1ZE3C 3REWA 3ULUE 3QCFA 2CNGA 2G75B 2BC4A 1SUHA 2XG4B 1CFMA 3MKKA 3D3VE 5LNDA 2JKJA 2FJSA 5C0BA 4NNYA 4UZSA 2VDPB 2UUDH 1CWVA 2L4OA 4YXLH 2C4FT 3MUGA 1M9WA 4RAUA 4BE5A 3U96A 4BFNA 2ZSWA 1JRHL 5GS0C 4YQXL 3BVUA 1J8HA 1GS7A 3KM2A 3QNYA 4WVRA 5EUOE 4ODXA 4YL9A 3RUGB 1CD1B 1JPGB 4G8GD 1OSZA 4FN0A 3EGDA 3CXDL 1M1XA 2FWOA 1QSFB 3UJIH 1TFHA 4HBCL 1PLGH 5DU7A 5E8PA 4JM4L 1LEIA 4JY6A 4ABVA 4JO2L 4Z6AT 1DLHA 4KTDH 1U8CA 4LF3A 4I3GA 5EEYA 1F1DA 3I75A 4ESKA 2YQ3A 3P0VH 1RZGA 4JJHA 4JRWA 3NMEA 5INDB 2MCG1 3QCHA 3RVUC 1GMIA 1R3KB 4JUTA 2YRZA 4JHUA 1SPDA 4JDZB 4NM8H 3LZQA 1XAUA 5J6HA 5J11B 5L88H 1YFOA 3N0PB 2QFPA 1F42A 3W0WA 3D0LA 2OCJA 3PQYD 3OWEA 2CM5A 4JO1L 3VO0A 4UOW0 3MLRH 4HKJB 1ZA6B 2N3JA 3BKMH 3EH4B 1BAFL 1DHKA 4TN9A 3UBGA 1BVKA 4DGIH 2HT2D 3D1OA 4GMTL 3GSNL 4GUOA 1NCDL 4N0YL 4P23B 2Z4TA 5D7LE 1A6WL 1JK8B 2TSBA 5DURB 1HI6A 4GP5B 3VH8G 4FZ8L 4R7LA 1W0YT 4Y2EA 2R0KH 4NYLA 1QRNB 2Y25A 3LIZH 4KKRA 4KROC 3EJTA 3MRLB 4NAMA 4OCXH 4CADA 1HQRA 4D8PA 3G6AA 4IIZA 2WP3T 5AVSB 4U05A 5DR5L 1ROWA 3OZ9L 5IV2A 2K78A 5B39B 5CEXB 2BGDA 1CLYL 4F9LA 3IFOB 5A6MA 1QR1B 2WLYA 2KL6A 4LLQB 1NCAH 4OZ4A 4PBDA 4XCCL 5KANG 3HUJF 2PYFB 1ECZA 2ENYA 4FXLA 1DJYA 3IXAA 4H20H 2HRPL 4FXGA 4PRID 3QXUA 1E4KA 1I8MA 2VDLB 1TMQA 4A66A 5IP4A 5K1JA 1VFMA 3MCKA 3RIFF 2OP4H 1MVYA 2LOEA 2WQ8A 2J43A 4MD0B 3L54A 3TF4A 1T7VA 4GIAA 3TNMB 5MENB 5HYSB 2DMGA 3QFJE 4APQC 2PCPA 5CCJA 2DY2A 3JVGC 2LT9A 5IROC 5IESH 3ZO9A 3TN0C 1EHKB 4UB0L 5DJ8B 2G5BA 3NDZE 1CVSC 4QF1A 4EN3A 1NL0L 4ZTPL 4HOMA 5J56B 3OXRA 3HMXL 3K2UL 1QKZL 4Y7OC 4Q6IA 1P4LA 1LLAA 4TNFA 4L4TA 1IZKA 4R2GD 4MSWB 1Y1DA 3F5WA 1CDHA 2OM5A 1P4BL 1JNNL 4XPTH 2O5YL 5EN3A 3QAZC 2WBKA 5BRZE 4KK9D 4AL8C 5I8EA 3HMXA 1KC5H 4L3EB 1NKOA 3PRZA 3VMPA 1KELL 4Q9CA 2ESBA 5GGVY 3V5DB 4ZAKB 4UQ9A 3DROB 4YHNA 2X40A 3QHFL 2VL5B 2GSGB 3C8KA 4OD3H 1G9MC 3PHQA 4BKLB 3EG9A 1ITBB 3GMOA 2EILB 4ZK8A 3ES6B 3NFPA 1BBDH 4GBXD 1YN7A 1OGTA 5DZLA 3QIUB 5DJYB 3AAZB 4HEPG 5D2NB 5E51A 1CXEA 1EJ8A 1HILB 1RIVH 3M1CA 3P0GB 1J1OH 4KO9A 4P5MB 4B9YA 3DGCR 2XIDA 3VWJA 4U6VH 4OZGA 2ZF9A 3RQ3A 5HJ3A 3STZA 3EJQA 4RH5A 1FC2D 2CRZA 1U6AL 2F7IA 1XFPA 1HHHB 1NMAL 4HKZB 2LU5A 1K8DA 1WD9A 4KNSA 3AU1A 5DJ2B 1P84J 4AQAA 4L2YA 2I9TA 4ZTEA 3MRDB 4TKWA 3L17A 1TQBB 2HVKA 2VISB 2BIMA 4N2KA 2Q05A 3NFSL 4K5MA 3TT3L 1MCWW 4OBRA 3P73A 4B60A 5IUCA 3K81A 1GRWA 4KX9A 5EF0A 2OBGA 2ZNWA 3GXGA 2IO5A 1N19A 4HZAA 5F7DB 4WCYH 1LDSA 1F6AB 1T20A 4W4OA 1FYHB 1ZE3H 1F4XL 2YA1A 4OJEH 5I2IA 1YMMA 4GS0A 2BOBA 4NGHL 3TCXA 4NPYA 3PU7A 2WJ7A 4M43H 1UUNA 3X3FL 4M7LT 3MUHL 1JCKA 3FCBA 1Q9LA 4IEFB 3UMTA 3CFQA 1DSFH 3ARVA 4Z7VF 3WN5B 4ZZFA 5IOPA 2ODIA 4NLHA 1G7HB 1MWAL 5GHWH 4WWPA 3ZDXB 5GS0H 4HJIA 4I2XA 3KYNA 5TQ2H 5DA4A 2Y66A 4OD1L 4CDHA 2F5BL 2WXNA 3JT2A 4JKPH 9PCYA 3O4OB 2VOSA 1A7RH 5BVPL 2WZ6A 5E5MA 4BEIA 5KTEL 4E5XB 2JLLA 4JVUA 2B2XH 2KQNA 3EDFA 3OKKA 2WZ5A 4J3VA 5CINL 5DD5L 4ZMOA 1P53A 2DL9A 4FP8H 2HFEB 2ICWA 3NZUA 4XT1C 3TU6A 3WIHL 3O3EB 4WSJA 3CPUA 3D05A 1B0RA 4WWOA 1P7QD 5I30L 1RUPL 2UXTA 1BG9A 2DLTA 2ILLA 3PL6D 3QQ3A 4YIQA 3VRJA 3VVWA 1AI1L 1JV2A 3MJ8A 4K5NA 4QYOA 2ZCZA 1RVFL 3CC5B 4NQXA 4BJOA 1ZANH 3NESA 3S3SA 3O2DH 3GK8H 2YPLB 5KANI 1TTAA 3EO0B 3D3VD 1F0LA 4NHCL 3WKNA 3WIHA 2CO7B 2QCJA 3QIBD 5EFIB 5TQ0H 5IB4A 1G4US 2HWZH 4PI2A 4M62L 1KN2H 2UXVA 3NSFA 1KCRH 4XC1H 4PYGA 4Z7UA 3SDXB 1JZ7A 1O5ZA 5CMAB 4H88H 4JRYD 3L3JA 3PAZA 3DDGA 3WKYA 4DO5A 2XVGA 5IB1B 1FGVL 3Q01A 4BUBA 3OL2A 2E7LC 2FEEI 2H41A 4FFYH 2WLZA 5HHOD 3PWLA 4GKNB 1U8OA 3AG2B 2QVIA 4ELKB 4UQAA 2PO6D 4Y5XB 3VFUA 1T1XB 2FX9L 4G3YH 3IJ8A 3VGEA 3W1ZA 2Y7SA 1KCLA 5HVWA 5JNYA 3MRFB 3ZYJA 1NM9A 2A83B 4KKLD 3HNSH 3NABH 4ABUA 4JFHD 3O3DB 4LOEA 4HWNA 3KWTA 1WAAF 2NY0B 5DC2A 1ZWIB 2JCCB 3EBGA 4KMQA 2CGRL 5AOMA 2H5UA 1U8QA 2JMRA 4YSOA 1ZJAA 2VLRB 4ZW8A 1OT1A 2XYCA 1BM3L 3VYOA 4FXKC 3AQXA 4GS7C 2KPWA 4PRPE 4TVPE 1PTVA 3BP4A 4ODSH 1I3GL 3SGKA 4CVXA 1ES0B 5E56A 3QO1B 3OAUL 2ZUTA 2X4UA 3U7AA 4W6XB 3H9SB 3ZKSD 4KHTL 5FYJH 4YDJB 4Q9QH 1SDDA 1UH2A 3SKNA 2XWEA 1BX2A 1XIWD 2CJTA 4FNSA 3UDWC 5KSBB 3D12B 2Y2TA 4F7PA 3S88L 2UX7A 2WCPA 4EI5B 1G1OA 4OZFG 1HXMA 1WFIA 1URIA 1OARL 3PXJA 1UZ6E 2VKWA 2L7QA 1E7VA 3FTXA 4NPJA 4QRQA 1HSAA 3NTCL 2GC5A 1X5JA 1YMHB 1F18A 4G43B 4UT7H 2J8UF 2E7BA 1E4HA 2Y6SC 1PZDA 2BX5A 1JUFB 3UTQB 3KPSB 1NBYB 4TL5A 2BDNL 1OAKH 2ZWZA 5DI8B 4GW4B 3C9NA 4YX2L 3GSQB 3LRSA 4P99A 2OX5A 4U1KB 1FNFA 2Q3XA 5DHEA 4JMKA 2FYVA 3AQDA 3LB6D 5IHZB 4LSRH 4XPGL 4W6WB 4ZSOB 1NC2D 2JFCA 4YUEH 3S36X 2FGWH 3RP1A 3NCYP 3QO0B 6FABH 3KAAA 4QRPE 3HNTL 2HFFB 5DCCA 2K9UA 2BV5A 4HGKC 3Q5TA 3ZDZF 2YN5A 5FXCH 2OYPA 2WPGA 3SGDI 1SJVA 1JVOA 4AL8H 1WCQA 5CLXA 1RMFH 4OUUB 4A7SA 5C7XL 3CMGA 4YDKL 2LU3A 5KVFH 1SYVB 1Q9KB 2DIAA 4FG4A 2WVUA 3UZQA 2ATKB 2F5AL 3U7WH 1HQ4A 2G3XA 4KUCD 1QLRA 4DP7X 1TFPA 3HE6A 4N86A 1ZT4B 4GRLC 3QFJD 5BV7C 2ISDA 3PP3H 4KKAC 5HGDB 3RL1A 3MRMA 2J4WL 1VJSA 4RZCB 5DMGC 1V7ML 3IDJA 2NW3A 3GSRB 1OM3H 3WIFB 2G6ZA 5BX1A 2R51A 3FB5B 1FQ1A 2NXZB 3N43B 4EUPH 5IFAL 1N67A 4TMPA 2JF1A 2YWZA 4EAEA 4LZKA 4M03A 1KGCE 1ZGLA 3OJDA 2J17A 5FUCE 5HHPA 5A3IC 1YNTA 1YEJH 5BS0E 1FO0B 4ZMXA 4M6NL 4KK8C 3LIZA 1DQDL 1U3NA 2YLKA 2IDSA 2L7UA 3BZFB 4MJ5B 4ZS6D 4L9LA 1N0XH 3ARUA 3OKOA 1YN6A 3AT9A 5KUKA 1GQQA 1AOHA 1KPRB 1O0VA 2FJHA 2C7SA 4MA1C 2EEDA 2UUPA 1SM3H 3WJJA 2XNAA 2YQGA 1IUZA 3Q44A 3A6OA 1EMTH 3DETD 4JFDE 1NUNB 4QRRB 4MVBD 5T3ZH 1CICC 3AG4B 4HXAH 5BZDA 2XV2A 5C0GA 4F9PA 2HA1A 5I8KH 1VKXA 5J8RA 3T6WA 3M6DA 2HPOA 2K7PA 5HDQL 4POYA 3AADB 4KKLC 4FKHA 1BBJA 2VW7A 2YGPA 2F54B 2EDHA 4HDIB 2ZX6A 4I48B 4J3BA 4MMZC 3S4EA 1IGTB 3JZYA 1RU9H 4HIJB 2BNUB 3TVMA 3IM1A 2VAAA 4WI0A 1X6LA 2IQ9L 3MX0A 1GGCL 1R17A 2PKDA 2PUQT 4P46C 5SWQA 4RWHA 3MLXL 4A6YL 3X12A 4N8UA 3VAEA 2Q47A 4HPOH 1M7UA 4JPQA 4MTMA 4BXSV 3KPOB 3WO4B 4ZDHA 4E41E 1TJHH 1HZHL 5F7KC 4GAYA 3L3GB 2W0PA 1EENA 1OAZL 2FJUB 2WXQA 4NQEE 3KJ4B 4UNVA 4YSDA 4A6YA 2IV9A 4JZJC 3QDMB 1RUAL 4LHUA 3LXBA 4AI7A 4X83A 4CJ0A 3UAJA 4C59B 1RIHL 3K72B 1C7TA 3QUKB 4LCYB 4JB9H 5KA8A 4YOKA 1J0JA 4XRCA 3U7YL 1ORQA 3S4SB 1GA2A 5C9KA 3ML9A 5SV3A 2CM6A 4QAPA 3VFGH 3I6GB 4BWWA 3AG3B 1XD0A 3R0NA 5D93C 1KULA 3ENEA 1EJOL 4G1MB 4GAGL 4GW5B 4JREC 1BZ9B 4N25A 1NFDE 1PYWA 1T4KA 4YO0A 2DMHA 2K6WA 3BH8B 4WNQB 1E9QA 1JCVA 2PR4H 2Z7WA 5FWQA 3S34L 4F3FA 5E8DH 5T1DH 1P31A 3E3QC 4HFWB 1NA8A 2VXVL 5HYQA 2LV4A 5HHXL 1BQHA 5KA7A 2B4UA 4KI9A 4WHDA 2NNAB 2ZF8A 4A37A 3DVGB 2EIEA 5AB1A 3ZRSA 3V4VH 4TSAL 1KF9B 4FI7A 4UOW1 1Y6KR 2ZYHA 2NY2C 1BD2D 4Z78B 3O2WL 1DBAL 2CNEA 1E90A 2ZCLH 5E1AB 1F4YH 4Y9EA 4ZMNA 1ZVSA 5B21A 1PCXA 2JSFA 1NMBH 2FUQA 4MNQB 4M7LL 1WIOA 1XB6A 3WS3B 1TCRA 3QBTB 5JO5A 1I53A 1ASPA 2R27A 5CFAA 3CVHH 3BZDA 3L4VA 2ICWJ 4F2MA 2P5ED 5EZLA 2WNKA 3L08A 4R7NB 4GKSB 5E4EC 1UM4L 2AC0A 4EQ3A 2DWXA 3CFDB 3W9DB 3KYAA 1IM9D 2DQEL 5DS2A 2QBSA 4CBZA 4DP0X 4CDGC 1EAJA 2V7NA 4R4NC 4GI8A 4NKQB 1UB6A 1SXSA 5MEQA 1IT9H 3BVWA 3NH7H 4X4XA 3OLEA 1KXVC 2FUTA 5BXFB 1VHRA 5AVWB 2VXTH 5FKAA 5AZEH 3ULVE 1F5WA 3L3KB 1CTNA 5KW9H 1N6UA 4G6ML 2GITB 5AALA 4C8XA 3L2LA 4AXWA 3ARBA 3ESUF 4HKBA 1MZYA 3DI3B 2YEZA 4XCNB 1U8PA 2H1PL 2PBNA 3GRWH 3QPQC 3LPWA 1FFQA 1M05A 2IAMB 1PNCA 3B56A 1EUUA 2OW6A 1QSEB 1JK9A 5JIQA 4OT1H 2EVJA 2GCAA 2I6JA 3BMVA 4NO3B 5DEGA 3EDEA 4KXCA 1I3UA 1RI8A 5DMIH 3GXHA 4HQQL 1B2WL 2CJSA 2XQ0A 3S3HA 2OULB 3DRTA 1ZLEA 3B9KA 3P11H 3CDFA 2GFBB 2P8LB 5MHSE 3OLRA 5DJXB 3OG4B 5SWZA 1Q0YH 3TP4A 3VGDA 1QNIA 4JFYA 1K2DB 4ALAC 1TTUA 2YUXA 4B53A 2HAZA 5BV7H 2OMYA 4OZHF 4PJFB 4X7TB 4JFEB 1CXFA 3CXFA 5D7KE 1XBRA 3M07A 1NFIA 1MIMH 1NLDH 3K8MA 5F1OB 1N8ZB 3FSVA 2CDGA 3U4EB 2QR0B 4CVLA 1W8NA 4HUVA 1QQDA 4CKQA 5GGQL 1J88A 1KTJA 5AOZA 3ULUF 2VERA 3B9DA 4R90L 5CD5D 5L2JB 2X2HA 1B3IA 3AY4C 4PLKC 1ORSB 2PYEA 2OCFD 5F9AC 5T33H 1KCSL 1FRGL 4EN2A 4P5TC 1A14L 3NRQA 1AGEA 3KLDA 3OAZH 4JPKL 4WWKD 2EUZA 4IU3B 1IQWL 1ICTA 1NM4A 2X9YA 5IVNA 5ID0B 5CLYA 2CKBL 1UQSA 2BW4A 4U1JA 1RHHA 4PEEA 2A0LD 5FFOA 2EXYD 3ZKMC 1TZAA 1J1PH 2QFRA 2EACA 3G5ZA 5HY9A 4WI7A 2YD2A 3SQOH 3HHMA 2XZCH 4LSPH 5IREA 5EUOF 4HAFA 2IC2A 1PLAA 3MRJA 1DVQA 1U95A 4BFGA 4ZOCA 1DQMH 2AJVH 2RALA 4WI5A 5GJSL 3UZVB 4HZLB 3C8HA 4HFUL 2CKBA 1A0QH 3UTZB 3CVIL 5CEZH 4P3CL 1OE1A 4XN5A 3E80A 2OMXB 2YAMA 3LVEA 2X4OB 3KPRE 3LKPB 4J3TA 3QXDA 5FCSH 1MLBA 2WUBL 1OE2A 3ZDWA 2VQUA 4WNJA 2OTPA 4FQJL 2EUWA 3D2TA 1UB5A 1ACXA 1FCGA 4MS8D 3QUXB 3GS0A 3ZMQA 1MNUL 2X42A 5EEWA 2PP9A 4QXGL 2BNRA 5DJ0B 2CK0L 3Q9PA 1DN2A 1EFXD 4R83A 1UCBH 4GLRH 1VZGA 1MW2A 4M93B 4PG2A 5I1JH 5IEHA 3V4UH 4DP5X 2H4GA 1NOAA 4XCFL 5IJDC 1AR2A 3TBSA 4OM1H 3MNWB 1FDLH 3RWGA 2UX6A 1TZIB 3U83A 4HUXB 1AP2A 4E9LA 2LTQB 1NGYB 5AAWA 1VB9A 1OHZA 2C3WA 4XBPA 4JZNB 4NKMB 1M6OA 3HB3B 1MI5A 2ZPKL 5CKAA 5FR3A 3TFBA 3UTSE 5KN5A 3VFMA 2OK0H 3V0HA 1NUGA 5D70L 1A9EA 1XGQA 3AB0B 3HE7B 4ENZA 5CWSA 3ZTJH 3MV8E 2VLKA 1NAMH 2NY7H 1CL7L 1DE4B 2P7TA 3OR6A 4GUPB 2ITFA 4G9DB 4AQEB 2BS8A 5JPNB 3BDXA 1EEZA 5BUPA 3DV4A 4GB9A 1HDMA 3S96B 4GQZA 2FEJA 3L5XL 4RDBA 2QVKA 2MQ3A 2MWCA 3LEVL 1FE8H 3PCYA 1TJGH 5DF0A 1UACL 2B5IC 2I9LA 2VLJB 4G9FD 2JJTC 4JFFD 2R56L 3RB7A 4YHIA 4Z7QB 1CB4A 1U8MB 1UKTA 4LIQH 5C0AA 1AQKL 3RFRA 3W81A 4YSQA 1RFDH 2B0SL 2IQAA 2N1KA 3CIQA 3PWPE 5D7IE 1QABA 1R5WB 4IKJA 2HCMA 2VEYA 3HFFA 4GQ9H 5T3XE 43C9B 1PZ3A 4UAOB 3FU5A 4E41D 1FZJB 1OIOA 2ZKXA 1WPCA 2E9BA 2R0WH 4WY7L 3HHSA 2WLHA 5EN2A 4BK8A 5D1QC 4NQED 1KYUA 1WZKA 2BJML 4HIXH 2VGLM 2GK0B 4HJTA 1AY1H 2P46B 3WGVB 5J8OA 4LLDB 1IKFH 2DYPD 2Y07H 2GJ6B 3S3PA 3L3OB 3VRLE 2EQDA 1CIDA 1MDTA 5TE6L 4Z7AA 3GUTA 3WFCL 4D9QE 3CK0H 2YJQA 4DGYH 4DESA 1NCCL 1J11A 3CXHK 5TFSL 2SEBA 2JQAA 1OGAB 1CZ8H 3VH8B 1V7NL 4AJWA 1ADQH 5FGSA 3BKYH 2CHWA 1PZBA 3IDIA 3PHOA 2GHZA 3EJUA 2WXIA 1IC1A 1MFCL 3GDBA 2LAGB 1H9DA 5A16A 3NT0A 2FYYB 5AYUH 4TOYH 4H8WL 1PSKH 3D9AH 2W95A 4FFTA 3WGUB 3MROB 5K39A 4D7PA 3LKSB 5ACMA 1OAXH 4H0LC 2MPVA 4UIMA 1HCYA 4UNUA 2NPLX 3D18A 3V7AG 2XQYA 2VDML 1M42A 1YY9C 4NNYB 5JIKA 4KGLA 2AEIT 4KOCA 4G80B 3WNPA 4NM4L 4WQOA 2WJPA 4AYSA 3WFZA 3QCZA 5BQ7B 4P4KA 3BWZA 1V27A 1FPTH 2AANA 3RB5A 1JMZA 2AS5M 4OGXH 4IOIB 2BIIA 5JUEH 1DQVA 2H2PC 4NLAA 5HDBB 3ZHLA 1ECVA 2MCAA 3DMMD 3MNVA 4J3OC 3RWFB 4DAGH 1ZC0A 1FN4A 1XGZA 5F3HB 5I18L 4JZOB 2CBTA 5KYNA 2NY5L 2V5YA 3F62A 3VXMA 4FADA 2CO1A 2ADJA 3B2VH 1ZV5A 4ALAH 4UWQB 1CGSL 3GT6A 3N06B 1W0VA 3FQRB 3IJSA 3QEUB 4JDEA 4L8SB 1Z5YD 4EUPG 4JE0A 4JHWL 4MXQD 3K6OA 5JW5B 1TENA 2ITEA 4M8UA 2I5YH 5I76B 2HTLC 2VWEC 4C83B 1TPXB 4N8VA 5CJ5A 3BEWB 4IOFC 1QFWM 3P0YH 2WOYA 4G82A 3P77B 4JDTH 5TDPA 2JIXA 4JNXA 1UWEH 1T22A 5JOFA 3V4VA 2NY1D 1AO7B 2BRRH 5E2WH 3VXSB 3X14B 1A3QA 1QMUA 2D7PA 2FTAA 4C56B 3D85B 2AK1L 1QEWA 3FN0L 3QULB 2KBGA 1MFUA 1G1CA 4A68A 2CM3A 3D0LB 1NCHA 4JNBA 2Y1ZA 5IMLB 4HV8B 2CJ3A 2WXHA 5IJVA 4GE5A 4OIIH 1FL5B 2DICA 1CFBA 1ZOXA 4PWIA 3WIAA 4DGWC 1OQOA 3L3DA 5FOBB 5K1VA 2GWOA 4MQSB 4RDQF 5B1BB 4M6ML 4PJIE 3D69A 4U1MA 4XNAA 5FK9B 4NQVA 2Y22A 4XI5D 1J0YA 5FA4A 4X6DA 5EMYA 1FL3B 3KH3A 3MI6A 2YXWA 4E9TA 2J73A 4QHLA 1WVZA 4PUBL 3ZTNL 1A3RL 1A6TB 5LAXA 4N90E 3UZEA 2XTJB 1XSIA 2MPAH 2IPKA 1KYOJ 3L45A 4ISVB 1SJHB 4XMZA 3SKJH 1AHWB 1ERNA 2OYMA 4JFWA 4ATWA 4Z7OB 3NFNB 1H3UA 1F3JA 4JBSA 3Q48A 3IXTB 5KZCB 1IVLA 1JPST 3MJ6A 4JQVC 3ZMNA 2GAZB 4TSBL 4G6KL 1U58B 4QRAA 4NCDA 3QRGL 3OC5A 4RRPG 2GSIA 3TBTA 5HGHB 4X9YA 3QG7L 1H0DA 1KJ3H 5IF0A 4N2LA 1VEMA 4Y5YA 2AI0H 2WXGA 5KBKA 4S1RH 3WXVH 1NPUA 1PG7X 4Y1SA 5IB5A 3R0MA 2ZD0A 3QJHA 4OSUL 4XGZA 4ERSL 4Y4FA 2FO8A 3P9WB 1PZCA 2I07B 1LK2B 3VFWB 3M45A 3VG9B 5JIDA 3H1ZA 4QF1B 3CVCA 4R5TA 5ICXB 3GBNH 1D5IH 4PIRF 2GJPA 4NQCB 2D3LA 4LEBA 2E8ZA 4M61B 1MHHA 3PF2A 2Q20A 5AD0B 3V0WH 4PCSA 1JHTA 4RCAA 4OFQA 4RBPH 5KSUB 4IDLA 1JXFA 2QGDA 3RDTA 4OKVA 4MFHA 4M8VA 1CFVH 5EO1B 4FGMA 4JG0L 1CD8A 2A6JA 4XXCA 3NGBC 5IBLC 1WWCA 4OHHA 1DZ0A 1PVHA 2PPFA 2OSWA 3F7KA 1K4CB 3NIFE 4XN1A 2WC7A 5EU3A 1XXPA 2HY3A 4F92B 2G2NA 3LRMA 3WD5L 3PYCA 1SY6L 4A7QA 1MKFA 4H7VA 3BUYB 2Q9OA 5BW7C 1MG3C 3MLTA 3UFIA 4HHGA 3UTSD 2OR9L 3GSVA 4V2BA 5LWYL 1GW6A 5CSZA 3EDKA 4G7VL 2D7TL 5ANMB 2HKFL 3MV8D 1QAWA 3QEQA 4Z1PA 3MXWL 2BK8A 1XGPA 1SY6A 3V6ZB 3QQ9D 3REVB 2ZOTA 1JTOA 3RL2B 1MRCL 1BQ5A 3BE1H 4OFKA 2YGOA 5J12C 3DIFA 3MDJA 5E9AA 2A4CA 1EHAA 4FHBD 1J8HE 2YGVA 5C09A 2NUTA 3CSTA 3U4BL 5JMOC 1BF8A 3ZL1A 2DN7A 2XWJA 5IR1B 1MDAA 1AQ8A 3OGCA 1OHEA 1Z9NA 1Z9LA 1IJNA 1SVCP 3D4CA 1OK0A 4WW2C 4EBQL 3T65A 3EW3B 3NCYS 4K8RD 4OI8A 1II4E 4HU2A 4AY0A 1EXGA 2Y06L 2I6IA 1W0WA 2ED8A 3P73B 4BFKA 2FL5B 2O6DA 2VCOA 2KMWA 1XZ0A 5F7WC 1BOGA 4EIZC 5C6PB 1F1AA 4RETB 3ISRA 1J86A 5EU6E 1MREH 1K3ZA 2XWTA 4HSAC 1U3ZA 2FATL 2BSSA 4GKOA 5F6HJ 4BWTA 5BVJA 1WF5A 5I19L 4K15A 4FNUA 4NERA 1JNLL 2EKSA 1RERA 4OZFB 1BFVL 1AKJB 1RLWA 1IFHH 2QPUA 4KZDL 3QPXL 1ED3B 3CMOH 1FFOB 3JV0A 5F7EL 2CLRA 1U3HD 3W0WE 3L81A 4ZUVA 3I02B 1JPTH 3H2PA 1SLWA 1EZSA 1D5ZB 1IC7L 4FYRA 4J3OH 3ZYIA 2Y7MA 1EAQA 4NYHA 4KOBA 4XC3L 3Q9QA 2APFA 1DQTA 3Q1EA 3QC6X 5CZXC 5D9SB 5I15H 1I9JL 2ALAA 1XF3A 1Q1JL 1RHFA 3BT2H 1U4EA 2WY3B 3T0EB 2VSMB 2O6CA 4YIQB 1V5JA 1JZFA 1PAMA 3MXVH 1NGPH 3EDJA 3FO1A 4ZJ9A 4OCNC 3B5TA 1U4FA 1OEVA 1HU8A 1KY7A 2FJMA 4P2OA 1ILSA 5ABAA 1FNGA 3EOYG 4AWJC 1OZUA 4OTXL 1Z9MA 5HYJA 3IJYB 3SE4C 3KLAA 2VW4A 5E03A 1G7IA 3ZN6A 4F7TB 2R1XA 2RACA 3LS5H 1YEKH 3QORB 3ZQ9A 2O6FA 4X80H 3FMGL 2FT8A 1UJ3A 1FYTD 3D7PA 2WTPA 1ZEAL 1ZVNA 1PEWA 3VFVB 3F85A 4XNBA 4AENA 4M9OA 5I1KH 2DQDH 1ASOA 3HN3A 1WCBB 4MNHB 4UTBH 1KUMA 2WSDA 4PJAF 1GGBL 1P84K 2Q2EB 3B7YA 1HH9A 2DXPA 1IAOB 2HJKA 3MR9A 4OR1A 2EE0A 1YEIH 1G7QA 2APSA 1PX8A 2NR6A 3EH2A 3SN6N 2HXAA 1BREA 1SJEA 3E2HC 4I77H 4QPEA 5CR1A 4ZUSA 2XIBA 4MCYA 4PRNB 4MAZA 2VM3A 4NZDA 4P3WA 5EORL 4AQ1A 2NMSA 2VDKH 1LGVA 2MNWA 3ZHFA 1U93B 2GCYB 5FS5A 1HAUA 4KNTA 1CFTA 3BKJL 4KKNA 3LN4A 4WTWA 3ZKXC 3RGHA 3D42A 2VQTA 1TZHA 3WO3B 3RWDB 2ZXEB 2V8MA 1M4KA 3BPNB 4L4TE 1NCWH 3GBEA 1EO8L 1IAKA 3BP4B 1P1ZA 4F8OA 2CH8A 3T2OA 4CVXB 1GXEA 1SBSH 1QD0A 1S5IL 4ABWA 3B2UC 2R7EA 4RAVA 2Y7QB 3MRRB 2Z64C 2ZUUA 5EZOH 1NSNL 3VFRB 5GRUH 2E74C 3RWEB 1T0NA 4Z77A 4KX7A 3RA7L 5IG7A 3GJFA 2OXGA 4U49A 5HHNB 4MJ6B 2WBJB 3O4LB 4QTIL 3SPHA 4JY5H 4Q74A 1PGRB 4XE0A 1NFDF 4B7LA 2CAKA 1D9KA 5J5EA 4QRQB 5HGAA 1SEQH 1HL8A 1NBCA 4Y19D 4R97B 2NY6B 3D2UB 5DRNA 2QSCH 4JY4A 5FF6B 3P4OA 4TNEA 5JPMA 1ETZB 2NX5A 2M1KA 1PTUA 3ZZSA 4L8DB 3ZUCA 2CIKA 4LCIH 3CX5K 3S48A 4GIPD 3VYPA 3BJ91 2JKSA 4GSXA 4NC2B 3QUZC 4G6FB 4BZ2L 1J1XH 2Y6TE 5CGYC 3IJHA 4N90D 3STBA 4NQQA 4YFLF 1X4XA 1KBGH 3OX8A 2GTWB 1L9RA 4TRPL 3LZNA 3ILQC 1V8HA 3GB7B 2HT3C 4M7JH 2UYLA 3QAQA 2GVYA 5KVGL 1LNUB 4EKXA 5ISZA 3O9WD 1KFAH 2PCYA 2M83A 1MW1A 4DTGL 1PW3A 1IQDA 4BZ2A 3ZYOA 4OM0H 2NLJA 4NXKA 1EK3A 4WEBL 3DTXB 5EU7C 3GTNA 5E1IA 3MV11 3DVIA 1XCQA 3E6FB 4MJ4A 1UA6L 4BSVA 4AYGA 1YMME 3H42H 2DBLH 1P2CA 2FCBA 5JW3H 3QCKA 2E6JA 4MJID 4P05A 1NANH 4XP5H 5DJZA 5IKCA 4LLUA 4CMHC 4BQ8A 3MRCB 3RL1B 3TJEH 2B1AH 2PW1B 2ZOUA 3NSCA 5E99L 3TBWA 3KR3H 4EVNA 4FZEH 3VW3H 1AZUA 3ULSA 1BQLH 3BFWA 2XT1B 3HVNA 5SV4A 3W39B 5C70A 4FG2A 2EEBA 4Q9RH 3GSUB 4QHNB 1S7RB 4I2XE 4KQ4L 3KCPB 2BVYA 4W9JC 3VB9A 1U36A 4XNDA 3ULVF 1YNTB 4AKPA 4NZRL 5AOJA 2V9TA 4OCLC 4TUJB 1GS6X 4YAAA 1DL7L 1HE8A 3HZMB 2X38A 3G6JA 2PWFA 3MRBB 3B1TA 2FLBT 3CH1A 1E65A 4KYRA 3OLIA 3L1FA 2E75C 4DZ8A 4FI6A 4LSVH 1WBZA 5I75C 1T5WA 2B4CC 1FFPA 2PXYB 3O3BB 4XBGA 5E94B 4ZX3A 1ZTXL 2W9DH 1JPSL 5F9OL 3ZIMA 3QDGA 4Y2OB 3T6XA 1INQA 4S1SL 1JXGA 3MBWA 3QS2A 2F8XC 5B4MD 1CGYA 1UWXK 4AVKA 1GWZA 3VB8A 3E6HB 3BIKA 4IGBB 4N0FA 1QPKA 3HS9A 3LQZB 2Z31C 5HYEA 4HPHA 3IDNA 5C0GB 1E5CA 4U0RB 5EULV 4HLJA 1JHLH 1OPGH 4EI6B 4X6EA 4MD4B 4Z7UE 2J6EL 5DEFA 4X98B 1HHJB 4CC1A 1J5HA 2OMTA 2FEEL 1G9NL 5CCKL 5AKVA 4YEFA 3IETA 1DVFB 3QZOA 3MBED 3FO2B 4FERA 1L9SA 5J9PB 2PPCA 1LO3L 1KWKA 5DVLA 1MAML 1QHPA 2J6EA 4WI3A 3KPMB 1OQXA 1YA5A 3D39D 5AAPA 3BSHA 1U8NA 2EDRA 1CFSA 2DW5A 4MXWH 5JZ7D 2CHZA 4I5BB 5IHUL 3IPFA 4CA4A 1FFNA 4GO8A 1E3FA 4FTVA 4IBTA 2UY6A 5C07D 3CHQA 4MNGA 4HVBA 4JMXA 3QJSB 1VEPA 1NWLA 5EU6D 2OXHB 5IK3A 3T0XA 3I50H 4HGMA 1BQRA 5SX5K 1H3TA 4V1DB 4CRPA 5I1IL 5HHVL 5F8RC 2ESVD 2Z0UA 3FSOA 3UROR 2NXYD 4KKBC 1GOHA 4D2NA 1YJDL 3BAKA 5GGTH 1IARB 3BQUA 4Y1AB 2NDFA 3ARGC 1G1FA 2OI9B 3AM8A 2J1YA 4IRJB 1JPFB 4TULL 1NCTA 4D3CH 3T77B 3HOGA 2AMUA 2EH8L 1RZIA 3CN4A 2IDCA 3BYYA 4B3VA 1NBVL 4LASL 4Q58C 2E9GA 4KRPC 4UQ2A 4LO9A 1J12A 3GMPB 4MQ7A 5EPMA 4AE1A 5IVXA 2Q0ZX 4ZZKA 4I9WD 4F58H 1L6XA 4DGUA 4IJTA 5J13C 1WAPA 1IBGH 1WFJA 2HUEA 1U8IA 2NY3C 4HEPA 1PTZA 4K7PL 2FQGA 4Y4HD 1MQ8A 1MREL 2BMKB 4XNYL 1RUML 2CBOA 1IAMA 2R1WA 2AV1A 1CDGA 4QHUA 4GUCA 2WLIA 5D5MA 5HSFA 4YR8B 1UH4A 3QUYA 1DBBL 3AVEA 5AWNL 4J3XA 2Z7UA 4PRBA 2NCEA 2G3ZA 4HEMA 4YLBA 4HS3A 5DS8A 3ARTA 4OJCA 4X5QA 4PJ5D 5JHLL 5CGBA 1AS6A 4LEXL 1C5BH 3TYGL 4AEEA 3NEOA 1E6OH 1NCJA 3QHZL 4P2CG 3C2SA 2DQTH 1XX9C 3BW9A 4JRXB 2ADFL 3LZFH 5G4OA 3VI3A 3RBSA 4D0BB 5LQBL 4UT9H 3ZZLA 3MHZA 4Y5VA 3JTSB 4X4YB 2X6AA 4P4RA 1BZQK 3ROLA 5JHLA 1I1FB 1QA9A 2ENJA 3EYQD 3G5VB 4YNYB 3T71A 2XVBA 3HKZA 5EU4B 1NTDA 1OCZB 4F33B 1KIUA 1QBLL 1KJMA 1OP5H 3L8QA 4K3JL 1Z9SB 2X87A 4ZS7H 3STLA 1E27A 5B1AB 3QCVL 3DX8B 1NH6A 1DJIA 1MPAL 2H26A 1B2YA 2J2ZB 3O6FA 4QRTA 4LLMB 3TO4D 5AVYB 3QW9A 1WEJL 3SIKA 1TQUA 3K2KA 2FZ3B 2IPTH 4LESA 4O9HL 5LCVL 3G5YA 4ZXBC 2EEFA 5JXEA 2G59A 4HS6B 4PY7A 3VRLF 4Z5RB 4XNUL 4YN3A 4UT6H 4F7MA 1UM6H 3W38A 2UZXA 4U1SA 4WFHE 3BP7A 4LBEB 2H03A 2OZNA 1JD9A 2X70B 1XEDA 1VHPA 3D6GA 5I1GH 1B0GA 4IMLB 5CCGE 5LCVA 5FX3A 5I6PA 3BDBA 2QADC 2HT4C 3IDYC 4W70A 2FAUA 3KNBA 5LGJA 3BAYA 2VR6A 1FVCB 1E9PA 1EZLA 3JWNC 1PY9A 5HD8D 1JFQH 4FRWA 2DQCL 4QR7A 4KJPC 5LB1A 1X4ZA 3CDGB 3BKCL 4LPUA 2UVFA 2AK4E 4QUNA 3THML 2A74A 4G8IB 4YHOH 1R3HB 3NQIA 4ZT1A 2WKGA 1PIGA 3IMTA 2FR4B 4UM9D 1G0XA 5KA0A 5C2BH 3KPQA 4FNLH 3FCSB 2BFVL 3FFDA 1AJ7L 4HXBH 5T1KA 2Y2FA 4RI4A 1B3JA 3K4AA 2TRYA 1HOEA 5IHWA 1H3XA 1S7WB 2Y7NA 5EZJA 4RMRA 4XBEL 3QDHA 4KROB 3NJVA 3QIWD 5I73C 1GZQA 1P7KB 3A24A 2DWDA 2FWLB 3EUUA 1I1AD 4A7TA 5DHVA 1H6FA 4RFEA 3GMNA 5DD1H 1A6UL 1YEDB 2DMBA 4X6BA 4NRXA 4GKLA 1RPKA 5DUBB 2D03L 5KSVA 3QA3B 4HUCA 4UDTA 1D6EA 5D8JL 5L2KA 1Y6NR 1LMKA 1CE1H 4PLNC 4KDTA 4M1DH 3KWXA 5B3NA 2OKMA 1J18A 2EIBA 3FRPA 1PYNA 1YAZA 2IG2L 3ZMRA 1N6QL 5JXAH 5EC1B 3JQOB 2CDEA 1RKRA 4HA1A 2OL3H 1ZLVH 1Q9OB 3QZWA 3SDCD 5KA1A 3GSXB 1PX3A 1UT9A 4KKCD 3I7ZA 2FB4H 3L7EB 4OHIA 2B08A 3RX9A 3MC0A 3VI4B 2ZJSH 4UV4L 4APQB 1X7QA 4ONFL 5D1XA 4ANWA 5I1HL 5H37G 1OP9A 1VGEH 1U21A 2V17H 2VERN 2NY4C 4UMSA 3TN0B 3PJSA 4J3OG 5B8CA 2N4IA 4JKWA 2MJWA 1R46A 1YYCA 5D4JA 3U1PA 1A4KA 2EAEA 2W9EL 4IS6B 4O2EA 3KL0A 3QCUH 4MB5A 4AQOA 1LVEA 4G70B 2CXKA 4PJHA 3KYOA 3FT4A 1FLRL 4XBPB 4AYID 3IU4L 3NZSA 1H3PL 5CIPH 2MCPL 1N64L 1BVLB 3KDMB 4OJFH 1P0SE 3WE6A 1QRKA 3UTTB 5KBNC 5F70A 3F00A 2DQUH 5HPMA 3A5JA 5KEZA 3HN5A 4NSKA 4GAAA 3TZVD 3ZUNC 2XPCA 1AIFB 3ATEA 5D2LE 4PJIF 1XF1A 1ZS8B 5GRZA 1MCWM 3MCLL 3ARDA 4AVHA 3CSGA 3I6KA 1ACZA 2AEQH 3TO4C 1RJYB 1U42A 5E1GA 5JHDE 4RVBA 1OF2A 4KV5E 3MRKB 4YHIB 3T8XB 3IJEA 4EUPB 5CZVH 1MJ7H 3HZKA 3C6LD 3IMVA 4Y8DC 3VD4A 2BP0B 5GS3A 2WVVB 2OQJA 2IH3B 2K8MA 5C9JA 5J1AB 5ILTH 5IGXH 3NIDE 3OB0H 3TBCA 3LEXA 4QJ5B 1JZJA 1X5LA 2D3JA 3QUMH 4L8BB 1CK0L 2VDOB 3T2NL 1PKQB 2GY7B 2O5ZL 4JM2F 3BAEH 2R4RH 1HHIA 1KXTA 3P4NB 4Y16B 3ZSTA 4M6OL 4RQQA 3APFA 3O8XC 2E7DA 5DK2A 4KMTL 2XWXA 1IGYB 2Y5TB 1J5OL 4BUCA 4L1HA 4NO5A 2ZUQC 3FO9A 3IJ7A 4RGNC 5IBTH 4CW1A 2X4NA 4PJ9C 1T66D 4WIQA 1DBML 5EEXA 3FT9A 3GUTB 2VDQL 2H2SC 1AANA 5AW1B 2WW8A 4NFDA 3F8UB 4QCIB 5ETUB 1AC6A 1PD0A 2ZTBA 3BZ4B 3MBXL 2X4RA 4CKVX 3EOAB 4GNKB 5ACZB 3C5SB 2BZCA 1YQ2A 3SKMB 5ID1A 3FOMB 2CM8A 1A1OB 1LO2H 4KXDA 2Q8BL 2VXSL 3G08B 5ESQA 4JDVB 5F21B 1JLNA 1PA9A 4MKMA 4JPWH 1UYWL 5I66A 5IEKB 4YHMH 1JVLA 1SUJA 3UYPB 4NO2B 3U4KA 1K5NA 1I1AC 1UKSA 3VE0B 1XAKA 1QFUL 5HI3C 4TQEL 3NIFF 4WDIB 3VNYA 1A64A 1JDDA 4HIIA 4O58H 3T3PB 1MY5A 2W9LA 5H35A 3LKQB 2AZUA 2R2HB 4KC3B 2CWRA 1KLUA 3TA3D 2FO1A 1ZJBA 1DR9A 3LNFA 4CGTA 5SX4H 3SDAD 3LMJL 1C08B 2PYEE 4NUMA 2WP3O 1AG0A 4MYWB 5GZND 2Q87A 3TWCH 3QCIA 1G0DA 5I82A 4DIXA 3MYJA 3VFTA 2P48B 4OLYL 4IU2B 1D5MB 4RGOL 1KIRB 3TCLA 3V4PH 3MRQB 5K9OA 4GO9A 3NZHH 1NEZA 1ZT7B 4KVCH 5KOMC 4ODUA 1WIPA 2XV0A 4LXFA 2OYLA 5E4AA 5KJ7E 3KZ8A 1T0MA 3L4UA 1R6HA 4A39A 3DV6A 4XMWA 4EOWL 3FQTB 4QOKD 2VEWA 1F90L 5D72L 3KYMA 4XH2B 2BS9A 5C3LD 1OEMX 5FW7A 4UIKH 2VJ0A 4POZC 2ZWYA 5DUML 1GJIA 1A3LL 1AR1D 1ROCA 1WFTA 2P9RA 1CT8B 4OFIA 2EVIA 1PKOA 4LP8A 4F1ZA 4ZD3H 4TLSA 4GAJH 3PYZA 2BNRE 3FO0L 4PRAB 3GZQA 3OPUA 2CBQA 2KPNA 1NDTA 1GCYA 3F7VA 3GSWB 3OSKA 4IRSD 4PJ7B 4N24A 4UQCA 4YSRA 5EOCH 3V4VB 3AQYA 2Q76B 1OB1B 4M02A 4X6CB 3ULUC 3OLDA 3Q6GH 1XR9A 2FLRT 4HJJL 4XO8A 5CBAB 1TITA 4X9IA 3WDIA 4FXKB 4GS7B 3VXOA 1TU2B 4JFTA 1UADC 2EDFA 1AAXA 2WNGA 3LKOA 3TH3T 5T1LB 8CGTA 1MI5E 4OCYH 5C6TH 1VZHA 1ZD6A 3NEXA 3CJJA 2EYSB 3SMEA 2H3NA 2GJRA 4PCYA 5KSAD 3C6LC 1DZBA 2YGQA 1CFNA 4R26H 4EO5A 4XMLL 4OFPA 2P3YA 2JFHA 2VLKE 4Q0XL 4WO4C 3CVHB 3FUJA 3FQWA 2CQVA 2EIJB 4U1MB 4CVUA 3UPCA 2AK4D 5C0FA 2J16A 3RZCD 3FDWA 3GTVA 4LARL 5FA4B 4KJQD 3I2CH 1DDHA 4NJAL 4TUOA 2GBTA 1SEBA 1I7RB 1LE9A 1XGRB 2MHAB 4Q56A 3VG0L 3TIEB 4E9XA 1EEUA 4ENED 4KK5D 2O1AA 2YA2A 4QJ4B 4WV1A 5C0AE 4XNQB 4G6AC 2MQCA 4PREB 4TUKL 1MF2L 5I6OA 2BSEA 3HW7A 4GRWF 4LLVA 3TO2B 3FB8A 4JFXB 2EDNA 1R3IH 3DI2B 2AQPA 2PCXA 5BMFH 4JFQB 4YJZL 2VN3A 2VMFA 2BVPB 4GMSH 3KPNA 4HYTB 4KQ3L 1RUQH 2R9HD 4QTFA 2NQDA 3OF6A 3B8YA 3H2XA 3QJFB 2UZYA 2EDMA 3L1OL 1QLEL 1QSFD 2Y3NA 1DBJL 1I7UB 5F1KC 1JGUL 1V3JA 3BP5A 4M48L 1JL8A 1USZA 5AW6B 1D7FA 1DJHA 2XWCA 3BSZL 4NKDB 4YXKL 4PJXA 3BFOA 1WRMA 4FQXA 1C86A 1JWMA 5ESAA 2HCZX 3ZE0B 4UQBA 1N2RA 1FBIH 3V2AR 4GRLB 3QCDA 2GPZA 5BV7B 1RJLA 4GFXA 4L2LA 4U3SA 4HOXA 5GZNC 1ZY9A 1UOLA 5IT2L 5AEAA 3BSZA 1N3NB 2WTOA 1G43A 1LP9A 5F72S 3RX5A 4D9LL 3HG1A 4LRIC 3B7UX 3GMLB 1UWGH 3HBGA 4U1HA 5DMKB 1BFTA 4I0PC 4Y1TA 2QT6A 5TH2A 5FYKL 3H9HB 1N6VA 5KSBE 1FORL 1IC4H 3B6SA 4JPSA 4YSTA 4K3EH 3C12A 5INCA 3TIDA 4JFZH 4XO5A 4ZMAT 2HNQA 4YPGA 3PPEA 4L29A 1KBBA 4P59L 2IFGA 3GYRA 3MLSH 2J88H 4P23D 4WW1A 1JGDA 1RXLA 2ICCA 3BRHA 1YEHL 3NJGA 1WA2X 4N9GB 3WTWA 5I0DA 1SLXA 3IE9A 5SWSA 3GPEA 3ZXAC 1A5FH 4LGSB 4MA1B 3C60C 3KPSE 4K3HA 1QRND 4BUGA 4AV4A 2P42B 1IGFL 2OMVA 1S7VA 4KPHL 5D4IA 3FZUD 4F80A 2W07B 3HI1B 3SJVB 3L1GA 1BGXL 1C87A 1CICB 3DYPA 2DM2A 4PJGA 1S9VA 5IHHA 1CF8H 5DD6A 2R2EA 4OZGF 2IFFL 3FB7A 2PTVA 5PAZA 2E6PA 4ELMB 2QQQA 5JHDD 4KKQA 3WJMA 5CHNA 1ZRUA 2GIMA 2X2JA 4MMZB 1SJMA 5EDXA 3VXME 2BVOA 1J4XA 3S5LG 2A9NL 1L7IL 2G3NA 1AD9B 2AAVA 5F71A 4NUJA 5EOQH 1TETL 4P46B 3DIDA 3TJHC 3BZ5A 4Z7VA 5FYLL 3ESVF 5I74C 3GPSA 4BH7B 2JJWA 4L3AA 5I8OL 3S8FB 1P15A 3UTPD 5MEND 2PW2B 1OAYL 4HJSA 2V2WA 3K6NA 3JZ7A 3L9EA 4Z0XA 1L8GA 3TT1H 3SE8H 3VD0A 5C7ZA 3IAPA 3WOVA 4N0CC 4UANA 2ZOLA 3APMA 1KNOA 4WJKB 3U36B 2GBUA 4NT6A 4NZUH 4Z7WB 4PLJD 1P9MC 1USQA 2XZQH 4OJDH 5LBVA 3L6FA 4XCYB 3EFFA 3ZKND 2RTTA 2WWMC 3QCJA 4JZJB 4EZJA 5F7AA 2KDYA 2CLRB 4AM0Q 3KBHE 4IDJH 4QO1A 2EDLA 3HMWL 1I31A 2XN9A 4DP9X 4IKIA 1NAMB 1JI2A 4UYPA 4BCZA 4NKIL 2W65A 2OAAA 5IBSA 2HVBA 5HJDA 1HX0A 4OLXL 5I1CL 4UINL 2IWEA 1RZ8A 1TVHB 2FEDC 2KI6A 1RSFA 2I85A 2Y36L 3DOHA 4L3ED 1AIZA 1E7UA 3ABLB 4Y2LA 1NL9A 1MJJA 3GMMA 4ZAKD 5D93B 1ZVHA 4QY8B 1EAPA 3UO1L 1HKLH 1HNGA 2GQHA 3BLKA 4QTHA 2NDGA 4X6DE 1YQVH 2C34A 5C08B 3LKNB 3QGVA 4NUGL 4DKFH 2NT2A 1A2YA 2HFGH 4GRMA 5E6YA 1EZVY 1GKOA 5MEOA 2GKIA 3QIUD 2L7EA 2X4TB 4XHJC 3QUMA 3RAJH 3H0TA 1FF5A 4LPWA 1YNLL 4MWFB 2ZG2A 2JXMA 1G7IB 1H15A 2H1XA 3CFCL 4JAMA 5DDHB 2F53B 5EU5A 3U9PH 5DMJB 4K5LA 2V2TB 2IANA 1FNAA 1YYLH 2O30A 3HA0A 4JG1L 3JTTA 4K07A 4Z7UF 2H4EA 3ECQA 4XO4A 3ULUH 3VWKC 1E8CA 1TSHA 2NY2B 5A40E 1XH2A 2WIIA 3HAEA 2APWA 4JFUA 2K3HA 4KBPA 2EZ0C 1M2VB 1A7QH 4GQPH 3VD5A 5KVMC 5EC2B 5CILL 4ZNEA 3VA6A 1HWGB 1SRDA 1G7QB 5E8OB 1T1ZA 2VORA 2CD0A 4MA8L 3N85H 4OFYA 2XY2A 2HP4A 3C75A 4N9OB 2O61A 2CM7A 4WTQA 3BGFC 4ELDA 2H0JA 4P2QA 1IVTA 4JR9L 5HVFB 2OMWA 3B7SA 2QDMA 4BH8A 5J6SA 3DX9B 2QKIA 2F15A 2VE6A 2MH4A 5E4EB 2DQFA 4JBCA 2HJLA 5I0VA 2VH5H 4HUUB 4PTTA 5J6GB 1EANA 3PP3K 2F8VA 2VMDA 4IK6A 3EJYD 3K5RA 1BZCA 1GGIH 3U46B 1ACYH 2IWFA 4DUWA 4B9FA 4LK4A 1G6RH 1X9RA 4XNXH 4JO3L 1HEHC 1QFOA 3IDGA 5EHFA 4IYKA 1EEQA 2QQLH 1NGZB 2CGYA 3BOVA 5IBUG 4Z77B 3DX7A 4OZIA 2BVTA 4HJ0D 3BT0A 3EJJX 3FFCB 4O2CA 3GHEL 2M2DA 5GZOD 1ETJA 5FHAH 3IKCA 4PS8A 1F02I 2AQTA 4O51B 5DVOA 2OSYA 5C0DB 5TJWK 5KYXB 1BEXA 2AKRA 1JWUA 1JNHB 3QEQE 5E6RB 5LLIC 4CSPA 1T1YB 2QPSA 4FKEA 3QRFM 1D7CA 5D6CB 2F58H 2FHCA 4DEUA 2I4HA 4U6HB 4P8QA 3F7PC 4RMWA 3JWOH 5C09E 2YPLD 1BJ1H 2IWKA 3NJHA 4ODVL 5EUKB 3T4AA 5DUPH 5IY5B 2CR3A 3GHBL 5F96L 1I1YB 1KPUB 2G30A 1I8LC 1SMOA 1QUPA 1YEWA 1YEGH 4A2DA 2JVUA 4G8GA 3RVVC 4X5LA 1DQQB 3FKUS 2EDBA 4CMMA 5I0ZA 1BMZA 3LSOB 2QZ5A 5ISZB 5BQDA 3JWDC 5A6LA 3GM8A 4J1UB 2P52A 1L0YA 4DKEL 2AQ1A 2BOCB 4WFED 1CS6A 2VDOL 5GRXG 4HWZB 3NIGF 4DHLA 3GXMA 1OT4A 2WHVA 3G7TA 1BG1A 2OZ5A 3S4OA 3ZE1E 4P5TB 4FG6D 1ZK9A 4GP4B 4K2UH 1L7TL 1JOIA 3GMRA 3KXFB 1CUOA 3U4AA 1FUNA 1O6SA 3EO1A 1AGBA 3UABA 3CSPA 3LJ3A 3O41B 1GZPA 3OKLB 5CD3B 1BFOA 2A9MH 2HLFC 2XQYK 1N0LB 4P2RB 2JB6A 2NY0D 2AAAA 1GHFL 5A2AA 4A1RA 4K9EC 3F9BA 1JGLH 2DWTA 4BK4A 2VLRD 3CLWA 1VGKB 4NNXA 5LGHH 1JTTA 4UNIA 2HX9A 1MCOL 4QXWA 1LILA 3QIUC 2WGXA 3OZKA 4FHKA 2AXHA 3PWVA 3PQYA 4WU7B 4HIHB 2JQMA 4YHPA 4H40A 1U8JA 4N4YB 4WZ9A 4Y2DC 2ATPA 3TFKC 1T1WA 2JTDA 2APBA 4R3SA 1R3IL 4NWTH 3L5IA 3D33A 3H9SD 4JRFA 2NYYC 1PQZB 2WYTA 3VACA 2ZWKA 3ZYZA 1H8NA 4DZ8B 3T8VA 2X7LB 4UUJB 3D0VA 2C1OB 3D30A 4L1DA 2XFXA 3BJLA 1EHXA 4XVUC 1C8QA 4WI2A 5AENA 1H6TA 4PG9A 5EHPA 2UZIL 4MD5A 3Q6FA 5JQHC 5HYJE 4G71B 2N0KA 1QO3A 3KPSD 3T0BA 3RJQB 4PRIA 1EFQA 3LRKA 2XRAH 3P54A 2X2IA 3QG6B 1I7ZB 3QDAA 3MOBL 1IEAA 5FV1L 4PJDB 4RRPA 4X5WB 4AW7A 4AE0A 4FFVC 5AVTB 5CXPA 1E9OA 5ICZB 2BXZA 3UACA 2AM2A 3R06B 3JBG7 3N9GH 1A6VL 1YYMH 3EYOB 1QUNA 2MTPA 2QZQA 1J9SA 1P4IL 3JWNG 5BJTB 4BFBD 3LPFA 4X99A 2ZP9A 5FYJU 2B5IB 1KJ2H 5FUCC 3JV6A 5I1LA 5E9DB 1A1MB 1D2PA 2TAAA 5I1AB 2XZAL 2YSSB 4BV1A 3HNVH 4ONGL 5DJDA 3M1BA 3QCTL 1CR9L 2MTAA 2A2QT 2I4GA 1E30A 1KDIA 2AXFA 4EXKA 2G4EA 5CBEA 5HXMA 2ARWA 1IGIL 2JH2A 1MFDH 3X13A 3OXSA 1XH3B 2KLRA 2NXZD 4WK2B 4ODHL 2CDFB 3WFBL 4FOMA 3EGSA 4AGQA 4EI0A 1INDL 3WTTA 1A7PH 3O81A 2NZ9C 2FQEA 4I4WA 3LNDA 3V52H 4FLRA 1E3XA 1ZIAA 3SOBH 4QRSA 4ZUWB 1T21A 1XF5B 4FQ1L 5IB2A 3MU3A 1R6VA 3O0LA 3BUQA 3MGTA 2BVQA 3EO9L 2A6DA 1OP4A 4RFNC 1BIHA 3HR5B 2OMZA 4AM0B 1OAQL 2WANA 1DSYA 5F1SA 2VZ1A 4NN5C 4IOSD 4P5KA 2G3MA 5E6IC 1K4DB 1YY8B 2ZX9A 4GBXA 3INUH 3T6ZA 4DPCX 1WAEA 3FU8A 1UG9A 5D7SL 3QDJB 4N2IA 2XICA 4DFIA 4DUXA 4QRRD 3POHA 2NX5E 2HX8A 4MX7A 4J4PD 3DOSA 3WTXA 4PP1C 3QVAA 1IE4A 2DDQL 2W81C 2F68X 3FQUA 2PP8A 4J7RA 4XZUB 2WLMA 1FJ1B 4R8WH 1T7XA 2XG5A 3UDWA 4AZ8A 1TTCA 2F54D 2R0LL 2SHPA 1AZBA 3RPBA 3RILA 3ESPA 1IGCH 4ANKA 3DPBA 1DANT 1W78A 2ZG1A 3ZR5A 3EOBA 5D2LF 2V2XB 2EDEA 4URKA 4UOZA 4PJBE 3KL5A 1P6WA 1VERA 2APVA 3KWWA 3RIAK 3QXAA 2YKLH 4ZMTA 5I6KA 2CMAA 3RLSA 5IQ7H 3MOAH 3MA7A 3S35H 4F24A 1V3LA 4KV5F 4L4VB 3ROLB 1NIEA 5KVGE 1IU1A 2GK2A 3F81A 3TPUB 1G6VK 1MH5B 5IVZB 5EBMA 1OY3B 3NIDF 3KE0A 1ZTMA 3DO7B 5MP6L 4EI5C 1NOFA 1CLVA 2XN1A 3VTAA 3QDMD 3SBPA 1MHCB 1ZDQA 4PGDA 5EIVA 5HGBA 1YTNA 3V0VA 1XTMA 1FAKT 2Z9TA 4DZBB 3AU0A 5IMMA 2ZOWA 3BGAA 4KU1A 4WI8A 4BKTC 5ITBL 2C3VB 3SHSA 3GLZA 1GAFL 2OTWB 2P8MB 4UV7L 4X2UA 2W0FB 2F0CA 3G6JE 4OD2A 3MJ9H 5E23A 4N26A 2IXQB 3GGWA 4O2FA 5EO0B 1FZKA 5KAAA 4U1SB 1R75A 2ZP0T 2VEUA 2CALA 4UU9A 1EZVX 3QDGE 1P7QA 4ZO6A 4PJEB 3PL6A 4OLZL 4TVPH 4IBLT 4JFSA 2G5UA 2Z8WC 3N04A 1QTYT 1FZOB 1OTSC 3HC3H 2UWEB 1WH0A 3BPOC 2EH7H 3BQVA 3O2VH 3D3VA 1ZHLA 4PIBA 4WENB 4YC2C 3PS5A 4NXSA 5JR1H 1D5XB 3QIBA 2F74B 1ZTXE 3IFNH 1ONYA 4AUYA 4FYSA 2FO4A 4Z23A 4CAGA 4L5FL 2E46A 1OPOA 2EXWC 4K9EH 1XRIA 5CJXC 1NDMB 1FIGL 4JRYA 1J9CT 2BSBA 3RRQA 4WK4B 1S9YB 1U24A 5EIIG 3NRSA 4ZW7A 2VDKB 4ODWB 4OCSL 4MNQD 2NOYA 5HHOA 2ODHA 4DCQB 1XGUB 3RWHA 4YSUA 4ONHB 2PO6A 2W1NA 3RI5K 4KVNL 2QLVB 4WFGD 3Q8CA 4JHZA 4BK5A 3ULVC 4PWHA 4X5PA 1RIUL 4AX3A 5BOZG 5I6MA 5J57B 1UA7A 1HWHB 4C4KT 4E68A 4FTVE 12E8H 4MNGE 4AMKL 5FUOL 5LXGL 4RGMC 3A6CH 3WNMA 1ND0A 3QK0A 4G11A 1LD9A 3H9YA 3MLYL 4HJ1A 3ARFC 4NX0A 4R4BA 5TDOB 1S3RA 4XAWL 1ZSDA 2JTYA 3VXTA 4TS6A 1JZDC 1KN4L 5K9JH 2RGSA 1YAIA 5KS9A 4LMQI 5T5NG 4BINA 2YEVB 1X5GA 1GCFA 4MDJB 2QLYA 1HVXA 2AZAA 1FH2A 2J5LC 4X6FA 1TTRA 4CVWA 3ZE2B 1KGUA 5HHQA 1XIWA 4TNWF 3M86A 3MREA 5IVXE 1LO0H 1SHXA 2IAMD 3DUUB 2PT0A 3GI8L 4B0MB 2HTKC 4OB5L 4IKNA 1AZZC 1QSED 4LCCC 5FKPA 2HVJB 3CFBB 1QWUA 3EXLA 4HJEA 2YMXH 2QJDA 4GG8B 4CC4C 4M1GL 2JJSA 1QASA 4N22A 3KYOB 3R4DA 2XETA 3V0JA 4G7QB 3WMSA 3VXNA 3NGBB 5D5ME 3BHBB 5F1IB 5ESVA 4M4RA 3UIZA 3WFDH 1PD1A 3VXUB 3GIZL 1ESOA 4FQIH 2E0PA 1NUFA 4X5XA 4WI6A 4DPAX 2DWEB 4JFED 5DRXA 5L9DL 5JDSA 3CUPB 3SDDC 4HEME 4URTB 1CU4L 1RJCA 2AJXH 2AJ3A 5K9WA 3MVSA 4XXDB 3LHPL 4KZ0A 1HEZA 4ZFGL 4F15C 1RZFL 4N28A 4NKOA 3ML8A 2DLFL 1B4JH 1FH5H 1JI1A 1WWBX 2YUWA 4TQHA 3N44B 4WJ5A 3VI3E 5DT1L 4WTYA 2Y7LA 2FK9A 5IFHL 4NUPA 5LAPA 3VFSA 1LQFA 5KJ4A 3GJFK 3QWQB 2P24A 2C1PB 2QL1A 4Y9FA 1NJ9B 2QHLA 2EIZB 1JE6A 4PPTA 3QFJA 3WSQH 1GPOH 3RTQD 2PMZA 5FUZH 3VDBA 1R5IB 4KTEH 4MA7H 4N2EA 4WW2B 3MJ7A 1H8LA 25C8H 4UOJA 4J2QA 4XOBA 1F6LL 1S7TB 3PG2A 3GRBA 2E47A 1KIQA 4LCUA 3SGJA 1HAWA 3RKPA 3VXRB 4P3DA 5E2VL 3Q2VA 5FCUL 1GTNA 3PGCA 2VMJA 2A9CA 1LQBC 3X3GH 1XV8A 1K6QH 5C1MB 5E2TL 4ZO7A 3SY6A 3QUXD 1NIBA 2OS7A 5E9NA 1A8ZA 5DZVA 4PB0L 4XN7A 4ABQA 4XNMB 35C8L 3FCGA 4PWEA 3BYTA 3T2PA 1TJXA 3S5ZA 1M3IA 3BMWA 2EEXA 2X4SB 3NJNA 1Q1PA 4PJ8C 1N7ML 2LLLA 2P4DA 3VTMA 2A6IB 1SHSA 2JB5H 4NWUH 3AREC 3O11B 4R0LC 5DHYB 2OUDA 3KCWA 4XNZC 1CFQA 1WTLA 4HIIB 3OAWA 5DHDA 5TE7L 3HB3D 3QEGH 5JQ6L 3UEQA 2R69L 3HI5H 4JHVA 3VSQA 4WKZA 2IBZY 1J9RA 3HE7D 3P4MA 4JFVA 5ANME 9CGTA 1KEGL 4G1EB 5D1ZC 1KJ2A 1T89A 1U2CA 6PAZA 2HLEB 3R1GL 4KUZH 4K5PA 3TV8A 3EJZC 4YSCA 1OL0A 1R19A 1RSYA 2IMNA 4Y4KD 2QDCA 2IADA 3ZTCC 4HK3J 4QF5A 2R69A 1OETA 1T83C 5ALBL 4DP4X 1EHNA 2VLJD 3BZEB 3RKDD 1AH1A 3RGVC 4DGPA 1JG9A 1HYSD 3MTRA 1YC7A 1UWYA 2QHRH 4LEOA 4HGWB 3V5KB 3V8OA 5L2KE 2LHAA 5I5RA 4W9ZA 5I8CB 2NCMA 3BUTA 1MG2C 4J8RA 3CLEL 2QVMA 4KK6D 3GO1L 2EVGA 5IB3A 4MQXD 4PCKA 3BRGC 1MCHA 1Q38A 3U6RB 3EYVB 1WITA 4LLWB 4MAYC 5JHBA 3WMPA 3CDYA 1L5GA 1I8KB 2ADGB 5DJAB 1MFMA 4G42B 4X7SH 5D1XE 1NFAA 4OVUA 3AZUA 5JOFB 3E2HB 5L7XL 1JF1B 1IEBA 3NJKA 4GXFA 3KBPA 5C0EA 2X10A 2X6UA 1UM5L 4GG6A 1MRDL 1TQWA 3L9YA 1I85A 4AIXA 3RY6C 3F12B 3PHSA 4NENA 2QGBA 3US9A 4YHLL 3ZQXA 3ZKXB 5ES4B 3VFNB 1V3AA 1JXKA 1OGAD 1DUYA 4UI2A 4DN4H 5EH1A 3ULVH 5AYTA 4PJHE 2FJFB 1UZ8B 2Q6WB 4RBPK 3UXFA 3FUKA 3CAFA 1NINA 3E9UA 1G7GA 2VDNH 3GBML 4XP1H 2P6XA 4TNVF 2VZ3A 4XP6H 1Z3GH 3P2DA 4NNPL 4FEMA 2GJZA 5A2CA 1PDKB 3H3BC 3HN8A 2QQNH 2R39A 4Z8FH 2ITDB 1BD2A 2I75A 2YEQA 1P5VB 2DRUA 5CSBA 1XGTB 3HUJB 4TTGA 3NJJA 2NZIA 2WWKT 1FL6B 4PGEB 4YDNA 3SCMC 3SE3C 2EYRA 1EDHA 3S5LB 2YC1A 3IRCA 3KYKH 3MA9H 3FQXA 2VIRA 4X6DF 1KY6A 3AW5A 3F84A 3PWJA 2PA5A 3I9PA 4FABL 3HVDA 4FLQA 2WAHA 3BD4A 5AW9B 1MFAL 1OD9A 3QQ4A 4YDVA 5GGRA 4FMVA 2P5EA 1JZ2A 4ZODA 2K1MA 5GJTH 5FGBA 2C9PA 5E6SB 5I16B 4GXVH 3QUZB 4U1IB 4I9XA 3V6FB 1IM9A 4OUOA 3UC0L 2DB8A 2EINB 2W0LA 3MLWL 1XCTA 4I3RL 3TOPA 1E4WH 3VRIB 4M93C 4E42B 4LCWB 2ZUYA 3BD3A 3C08H 2HG5A 2VR7A 2YBGA 4Z3EA 1P1VA 3FAWA 4XTRD 5GS1A 3U0WL 5ADOH 5LJYH 3V6OA 2MEJB 2G9HB 3TNNA 4PR5A 4HWEL 1QPPA 5DZNA 4MDIA 5TPWH 43CAA 1R0AH 1PXHA 3U1SH 3NZ8B 4HS8L 5TF1L 2QELA 4PGCB 3SZ6A 3DVNA 3WS6C 4ZTOL 1X6NA 3KPPB 2YOAA 1BXUA 3C5ZC 1J0KA 4CMHB 1W91A 1AXTL 4U3SB 4Y9GA 4D3RA 2YK1H 2DH2A 4JGNA 5H2BA 5D1QA 3SBWC 5JPNC 4AEIH 1TO5A 1AO7D 3BDYL 3VXSD 3SQBA 3FU6A 1OCOB 2VITA 3ZRFC 5IJKC 1W72H 4C56D 2XI9A 3D85D 4S2SB 3Q1SL 5KJRL 4QDIA 2OSXA 2RCSH 2IJ0C 2JI1A 3QNZA 3RIAF 1A9VA 3HCVB 2FWUA 2VJXA 2AJYL 3D52A 4KY1H 3SY0B 3X1GA 5DC4B 3BRFA 2BNQB 2X89D 4IJ3C 1LEKA 1MIEL 4LOUC 5D7JC 4WU2A 2OMUA 5I75B 4JN1H 1A1NB 1YDPB 2WO3B 3L3IB 4YE0A 2D7OA 2VB5A 3NOIA 1VESA 1FCCA 1T2QL 2ICEA 4JM2C 3WL9A 4XWGL 5MEPA 2XKSA 2G60H 2FVNA 1UVQA 2R23B 4WWKA 3CFKA 2Z31B 4K7FA 3DWTA 3JV4A 1J05A 1J9TA 3TM6A 3ROOB 4N2AA 2XTJD 3PFQA 1EGJH 2WXJA 1N59A 1NBZB 2OL3B 4FMKA 5CHNB