3V0FA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), form ii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
331
Chain Sequence
GHMKASSNKRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 112
structure length 331
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0fA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0fA01
1ZZWA 2VEYA 2CMBA 4NYHA 3V0HA 2RF6A 1G7FA 1C85A 2BGDA 2NTAA 1M3GA 2B4OA 1U24A 1QZ0A 3OMHA 3N0AA 1NL9A 1OEMX 5KA3A 4RI5A 4NWGA 5KA7A 3D1HA 1NO6A 2J16B 3D44A 1YTNA 4GFVA 1G7GA 1QXKA 1PYNA 2CNGA 4KYRA 1VHRA 2CNFA 4Y2EA 1WRMA 2J71A 3F41A 4ZN5A 4GWFA 1L8GA 2CM3A 2PQ5A 1YTWA 3S4OA 1BZJA 1A5YA 3QCGA 4GRZA 2QCJA 3ZMQA 1ZCLA 4JMJA 5M43A 2PI7A 3D42A 3D9CA 2C7SA 1SUGA 2F46A 2QBRA 2H02A 3CWEA 3QCBA 2HY3A 2FJNA 3QCMA 4OHLA 1XRIA 2PT0A 1Q6NA 1J4XA 4H34A 2E0TA 3M4UA 2ESBA 2PA5A 4BPCA 2ZN7A 1ONYA 1YN9A 1WCHA 5AWXA 2I3UA 4S0GA 3ZMPA 2I75A 5BUGA 3BLTA 1YPTA 3S3FA 2IMGA 2QBSA 3QCHA 3OLRA 2HB1A 3S4EA 4ERCA 1G1FA 4B04A 2F6FA 3F9AA 4PVGA 1G4WR 1Q6TA 4TVVA 3F9BA 1T49A 2I4GA 2H04A 2F6YA 2I6PA 2MBCA 4NWFA 2P6XA 3ZM0A 1WAXA 1I9SA 3S3KA 2OUDA 4MBBA 2J73A 2B49A 1G4US 2G59A 3BRHA 4IKCA 2NT7A 1NNYA 1GWZA 2QDPA 1PTTA 3QCEA 1V3AA 2B4UA 2VEUA 1PXHA 4GE2A 3BM8A 3LJ8A 1KAVA 4R0SA 4H1OA 2NT2A 3AWEA 2QDMA 1GFYA 1YZ4A 1OETA 5GTJA 4GE6A 1RPMA 2I6IA 2F6TA 1FQ1A 1PA1A 3V0EA 2ZMMA 3EAXA 1Q1MA 4KYQA 4JMKA 2AHSA 4QUMA 3EMUA 2BV5A 3ZM3A 4Z6BA 3A5KA 3V0IA 1YGRA 3B7OA 5K22A 2YA1A 3RO1A 1C83A 5KACA 4JNBA 2SHPA 2HC2A 2H4KA 1XXVA 4J51A 1OHDA 4KI9A 2HXPA 2B07A 4D3RA 2A8BA 5KADA 3QCLA 3S3EA 4D3QA 2HVLA 1EENA 2Q05A 2OC3A 2AZRA 4NX8A 3QCDA 1I57A 4RH5A 2CM8A 3F81A 1PH0A 2QEPA 4OHEA 5KA8A 1Q6PA 5EHRA 4QAPA 4YR8B 1LQFA 1EEOA 2CM7A 1C86A 3MOZA 2I42A 3F99A 3QCCA 2F6VA 1Q6JA 4GFUA 1P15A 5KA4A 2B3OA 2J43A 2P4DA 5KA2A 3RGOA 2BIJA 2G6ZA 1U26A 1OHCA 3NMEA 1G1GA 1OESA 3D1QA 2VEWA 3I36A 2YOCA 5KAAA 3GXGA 2QBQA 3CM3A 3ZM2A 4R30A 1PA9A 3U96A 1FPRA 5J8RA 2I4HA 3V0FA 1NWLA 4QBEA 4QBWA 5I6VA 4PYHA 5KA9A 2J44A 2F71A 4RKKA 2I1YA 5KA0A 2J16A 3MMJA 2Y96A 4GRYA 4RI4A 4WU3A 4RH9A 5BZZA 4I8NA 3V0GA 2HNQA 4RDDA 5EHPA 2GWOA 3V0DA 2CM2A 1BZHA 3ZM1A 2Y2FA 2I6JA 3RZ2A 1ZC0A 4HJPA 2FJMA 3EB1A 1MKPA 5K9WA 4RHGA 1LARA 1YTSA 3QCNA 5KABA 2F6WA 3S3HA 4QUNA 5LXQB 5K24A 2J72A 2PSZA 3PS5A 1OEOX 2VEXA 1ONZA 4AZ1A 2I3RA 1LYVA 3SR9A 1D5RA 5KA1A 5K9VA 1XBOA 3QCFA 4DGPA 2CMCA 1NZ7A 2QCTA 2H4GA 5K23A 2NV5A 2J17A 2H03A 2OOQA 3SMEA 4OHHA 1JLNA 1OHEA 4R0TA 5MMZB 1G1HA 1NWEA 4DGXA 1C87A 4GS0A 2CNIA 2HCMA 3I7ZA 2CJZA 4BJOA 2I6OA 5HDEA 2FH7A 2CNEA 1FPZA 1ECVA 1C84A 3QCJA 3O4TA 1KAKA 3GXHA 3EU0A 3EZZA 2Q47A 1PTYA 2QDCA 4WU2A 1OEVA 3QKPA 2BZLA 3QCIA 2H4VA 2JJDA 3QKQA 2C46A 3ZV2A 4ZI4A 2QBPA 4OHIA 2F70A 1I9TA 1C88A 4WTYA 1XM2A 3AWFA 3O5XA 3I80A 2NZ6A 2PBNA 5BZXA 3D1OA 4GE5A 2CMAA 5K25A 1RXDA 2OZ5A 1BZCA 1YWFA 2I4EA 2DXPA 3QCKA 2R0BA 4HRFA 1X24A 1Q6MA 2HNPA 1T48A 4ZRTA 1JF7A 3RGQA 1T4JA 2I5XA 4YAAA 4D3PA 2NLKA 1AAXA 5BX1A 1Q6SA 4JBCA 1YFOA 3O4UA 2M3VA 2A3KA 1R6HA 2CFVA 3H2XA 4WOHA 2BGEA 2GP0A 3O3LA 2FHBA 5IBSA 1PTUA 3A5JA 2FHFA 2WGPA 4ICZA 3O4SA 1U25A 2VEVA 3BLUA 4NNDA 3V0JA 1OEUA 1ZCKA 2FHCA 2CNHA 4OHDA 4QAHA 5IBMA 1XXPA 2B4PA 1YGUA 4HJQA 1PTVA 2B4SA 4Y14A 2YDUA 3AWGA 3MOWA 2HC1A 2F6ZA 2I6MA 2GJTA 1L8KA
chains in the Genus database with same CATH superfamily
4KZEL 1RJZB 1YCSA 1MXGA 3ALXA 1O7DC 2ZXBA 1YNTA 3OR6A 1H15B 3QDJA 2GT9A 4PJXA 5ESAB 2WYHA 3HNVH 4JKKA 4DGWC 4GKNB 1MWAA 4GFTB 2JI1A 4MMXC 4LSRL 2GC5A 3VCLA 1EZLA 1M53A 4R97B 3V4LA 4RVBA 3TBVB 5KANI 4XB8A 4HEPG 4QXGH 3WAJA 1GKEA 1MRDL 2BIIA 2E9IA 1C5BH 2VDKH 3ISRA 2OK0H 2E7LA 4MNGB 3VG0H 4L8DB 5I1CL 4J8RB 3KLAA 4U1JA 4XBPA 2NR6D 4LPCA 1GY1A 2JFHA 3O2VL 5MEPA 4M1CC 1CG9A 4YWGL 3VWKD 2VH5L 3BWZA 2BP0B 3B2XA 3GXTA 5CILL 3D85D 4K7PX 5D1XE 5FHBL 3FQXB 4G9FB 4H20H 3FUKA 3OKDA 5HD8C 3ARDA 2FE0A 5DR5H 1P4BH 1CGYA 4LCYB 5DDHA 4CAGA 4GRWH 1Q9WB 1T03L 1AJ7L 2E59A 1HHKB 3DGDA 3LQZA 2NX5A 3U82B 5J9PA 3CAFA 1LQBC 3CLFH 4HJJL 4JZOA 2PPAA 5DJ2A 3L1GA 2BNQE 1A3QA 1XH1A 4YUEL 4GRZA 1OAUH 3UEZA 5HDQL 4MMYB 2ZG2A 4I18A 1QTYT 1UEMA 4PP2A 4GP5B 3KBHE 4KJPD 3AS2A 1DANU 2F1AA 3ZHNA 4QTIL 3UP1A 4FFWD 2R2CA 1MCOL 1YQVL 3N40P 4UUJB 3A4AA 3EHBC 4EDWL 5HGBA 4YS4A 1XGYH 4KC3B 3GT6A 2H02A 3LKRA 5K9QI 4N86A 2HT4D 1BZ7A 2VXSL 4FG2A 4OVVA 4JFDB 4YBLC 5CGTA 3VXMB 4UT9A 1MFUA 4XHQA 2X09A 5AVTB 3CTTA 2AJXL 2WLZA 3FCBA 3KPNA 3LZNA 1KYDA 2CHXA 3KXFD 1FO0H 4FP8H 1A6UH 4X7EC 4MJJA 1NM9A 2ESBA 4P4KB 5D71H 3V5KB 2X4RB 1RJLA 5KSAA 2F15A 4LSVH 1ZWIB 4RLDA 1CPUA 3VDAA 2VQ1A 4KJWD 4UAOB 4XN8A 5IR1B 4L5FL 3CU7A 2Y23A 3WY4A 3HI5H 2CUHA 5DS1A 1LO4L 4HP5A 2QQLL 1KCWA 4DGUA 1R3JB 2MOQA 4KVNH 1FJ1A 5IHWA 3UBXI 5FA3B 1AQDB 5TTRA 2X28A 2UXTA 2VYRE 4IBQA 3RB5A 2DAVA 4N8VA 3OLRA 1X5MA 3JTTA 5EOCL 4AMKL 1C5CL 2VMEA 3S6CA 3CSGA 1TJHH 1JUFA 1A6WH 3CFTA 3DC0A 4NOFA 4XZUB 3EYOA 4HIJB 1FI8C 3DHMA 4PGCB 3QQ3B 4GRLB 5MEOA 1FFOA 3KE0A 4MAYB 2WMPB 4H1LB 5AW8B 1AXTL 3PDOB 4JPIB 1CMOA 5EZOH 3RL1A 4Z7NB 5IROC 1OZTG 4RWYL 3F2LA 5DMYA 5IUSA 4Q9QL 3IS0X 1SJHB 4P5MA 1WCBA 3L3HB 5FYJU 2DTSA 2HTLD 3UEQA 1J05B 1HDMB 5CCJA 2JQMA 4I1PA 1XL4A 4PJEF 4U3XA 1K8DB 4FQ2L 2J73A 1MHHA 3MUGA 4OCRL 3DX0A 3EH4B 5C08D 2FL5A 1MOEA 2GABA 4KMTL 2CIKB 4OZGF 1V10A 4JFXA 3KL5A 1E40A 4KTEL 3VXTA 1U8LB 4GBXB 1B4LA 1PS3A 5DD0L 3BGAA 1QVOA 1V3AA 3D9AL 1LXMA 3LRSB 2B4UA 1Z2KA 4YOKA 1R1CA 4PGBB 3X3GH 2A9ML 2K8QA 1ZIBA 4PRBB 1K5NA 1KV3A 4P59H 2NY1C 5BW7A 3PV7A 2B16A 1X5HA 1YJDC 3REVB 4Y9CA 5IB1B 2RCSH 1Q0XH 3VVWA 4N24A 3SBPA 3MUUA 3VTMA 3V2AR 4LSPL 4MSWA 1HU8A 3MV9B 4XXCA 1G9EA 5HHPB 3EOTH 5DMGC 3KVDD 5GRUL 4JFTA 1P4IH 2ROXA 3PWLB 4XPTL 5HHMB 4L8SB 4ACTA 2UY7A 1S46A 4HF5H 3FB6A 1CVRA 3ZL2A 1OF2B 2TSAA 4JJ5B 4LOFA 1KV7A 4RGOL 1F4XH 1EXHA 2MHAB 3S34L 5L8KB 4JJOA 4GT7A 1UM5H 4UM9B 5GRJH 3WMSA 2IWKA 1JGUH 1KTCA 1W16A 1LVEA 3BZ4A 4AH2B 4LL4A 1JTPA 2CM5A 2MQ3A 5E4IA 4YX2L 4NPKA 4Y2DD 3RAJL 4UU9A 1I85C 1JWUB 4RISH 5DQ9B 5CSBA 2P8MB 4NUJB 3SCMA 5T3XH 2ICWA 2RGSA 5EU6D 1SNRA 3BVXA 1ZKAA 5JORA 3HG1E 1BQHB 2WYTA 3CXDH 3EFFA 1BV8A 5EOQL 1V55B 1F13A 3A24A 3RDTC 1L7IH 2QV4A 4BWTA 4OVUA 2PPCA 4F2EA 4F3FA 4K9EL 2WV3A 5J0BA 3QCDA 1FNGA 2WNWA 1MZZA 3CSTA 4P23C 3ILPB 3ZJAA 3K6SA 5DMIH 2O5ZH 2E3VA 4JANA 4OHEA 3QCVH 1ORQA 2ZXGA 1E6OH 1SGKA 3MPCA 3QXAB 3O0RH 2LQRA 1KLGA 4HETA 5D7LB 1JDDA 2AAAA 5EBMA 5GJSH 5BVJB 4DKTA 4ZMQA 3KM1A 3QCUL 1IL1B 2OMYA 2W94A 1H6TA 4FQXD 5FKAA 2LU4A 4HLEA 1M7XA 3RDJA 3S2CA 4BRJA 4X6EA 1XCWA 4OLVH 3MRIA 1KPRB 4QT5A 5J4MA 2P49B 3EAKA 5FLVA 3AVEA 4U0QB 4FLQA 2MCMA 5K1NA 4G8FB 5BQ7B 1V7ML 3UTQB 4H26B 2H8PB 2N1TE 3J8F7 3MGTA 4B9JA 2WQAA 3CDFA 2D7NA 1MCQA 4KI5C 1M9WA 1VA9A 2Q2LA 3V6ZB 4A1RA 1FNHA 4OZHA 2QPSA 4Z7UF 3SKUD 4QXUL 1U8MA 3LHAA 1DQQB 4Z95L 1P7QA 5CD5D 3N0PB 4IGBD 4M8QB 4N9GA 1Z9LA 4FXKC 2ED6A 3HN8A 4YSCA 5E2WL 2P46B 5TPWL 2IH1B 4KU1A 4Y4HC 5DTFA 2CKNA 2DLTA 3OQRA 5H37A 1E50A 3MLZH 5TF0A 4LEXL 1E8ZA 1KLFB 1WFJA 5AOLA 2XG4B 4N87A 3LS4H 3C9NA 1HH9B 3UYRL 1T3FB 1SOQA 2XXFA 1LEKA 1RLWA 1X7QA 3II1A 3DRQB 3A4DA 4HK0A 3F64A 5JHAA 1AZBA 1J0HA 2F08A 2GIMA 2PTTA 1GYCA 1YN6A 1R5IB 3AABA 3US9A 5E9DB 1T5XA 1KLUA 4OSUL 2XICA 1ZA6A 4FYTA 4BKLB 1NAKH 1CDCA 1EH9A 4HISA 2AEOA 2IV8A 3D2UB 4FN0A 4M00A 1A6VH 3U0PA 4HG4K 5D70L 2J8UB 4WFEE 4WFGD 3EB1A 2OYPA 5AENA 3FUDA 5FC9A 4UIKL 3QIWD 1A9EA 1PY4A 1OHQA 1LARA 3HC4L 3P1VA 2D3JA 2OL3B 5FGSA 3U1SH 4JKLA 1YTSA 5EEUA 4J39A 2BERA 2W65A 4MLIA 4XVJH 3UAEA 2BP8B 5DURD 3VI3A 3QUKB 1TQVA 4MDIB 3IGFA 2EVHA 3V0VA 3QT2A 1CICD 1KNOB 1U8IA 4Z7QE 4A7GF 4N2EA 1EDYA 2BSCA 3FRUA 3EO9H 1DBJL 5C2BL 5D1ZB 1KN4H 3VXSA 3ARWA 4ABUA 2BXZA 3LX9A 4PLKC 2Y66A 1XBOA 2NY7H 2X6UA 1AY1L 1KYOK 5JPMB 3H2QA 2A38A 5DJXA 4QF1B 1R34A 4PLJC 3IVKA 2BCKA 5IF0B 4HWBA 7FABH 5G4MA 4PFEA 3TWCL 1JD9A 2X7LB 5GGVY 3UDWA 4JO8A 4NQCB 3W5MA 5DSCB 5EC1B 4XTRD 3FCUB 1W9XA 3X14A 3SDAA 2WN2A 1C87A 1IM3A 4XMTA 4UDTA 4AGPA 2BX5A 4GMSL 4EBQL 1GW6A 3I7ZA 5C0IB 1QFWH 1QSED 3PV6A 3PHAA 3N42B 5PAZA 4V1DA 1RUPL 3U7YH 5F97E 3NFNB 1AOZA 5DI8A 1HL4A 1QA9A 1RJYB 1OB0A 4ZAKD 5I2IB 1CK0H 2UZYA 1KMGA 5HVHB 4FKEA 2K6WA 1QLEL 4BFFA 1LM8V 2Y2YA 1Y18B 3O45B 3PL6D 2EVGA 4OUOA 5LB1A 5KOMC 2Z31D 4O4YH 3QFJE 5BV7C 4PWJA 2WVSA 4LLWA 1MFNA 4X9BA 4NNYA 4F93B 2W80C 3IJHA 3V79C 3W38A 2ADYA 2V17L 1UCTA 4NWTL 4BZYA 4ZOBA 3P3YA 5GS1B 4L37B 1OTSC 3SDCD 1RZGB 3D7PA 3KGUA 2XNAA 2VR6A 3E0GA 4IMKC 4ZFQA 6FABL 4APXB 3ATBA 1EO8H 4PJHB 1TVBA 3HG0A 2JTYA 3D0LB 4F2MB 4FC3E 4HAGA 1F97A 4ZFOL 2IAMA 1E28A 4WU7B 1YWFA 1IAIH 3LV3B 5DRWB 1DSYA 2R0BA 2DLFH 2HNPA 2BS9A 4C13A 2L8AA 5T5FA 4Z8FH 1R3HA 1F4YL 1U58B 2XSKA 4K15A 3OJDB 3SDDA 1I8MB 3KYMA 4ZX5A 4W4OA 2NLKA 2FSDA 3IK2A 4XMZA 3OPZH 1QRKA 5HDBB 3VWKB 4LRNH 4EAEA 3NACH 2EXYC 3D85B 3PAZA 4LSQL 4QJ3B 4PJDF 2MWCA 5I75C 4JRXB 4HPOH 4M7KH 4DFIA 2CZNA 3IRPX 3B9KA 3R18A 5CSZA 2ITEA 2NNAB 2VN7A 2H32H 1ZHLB 1J5HA 2GEQA 5DF0A 5CWSA 4TSCH 2DV6A 2EIMB 5G55A 1GTNA 1XIWA 4GW4B 5IW1A 4ORGB 1BLNA 4D0BA 1OEUA 1U8PA 2FEJA 4NGHL 1M1XB 1NBZB 4ZTEA 5FYJD 4NQVA 5E94A 2L7JA 4QUOA 2B4PA 1FHGA 2CM6A 5GGSA 5KVEL 2EEBA 1Z9SA 2AQTA 3GXUB 5I6KA 2GK0A 5B1KA 4AZUA 2QQKL 3BYTA 1NKRA 4XNQB 2YXMA 3RY6A 1QBAA 5CLZA 5JW4N 2D31A 2XWXA 3RG1C 2VLLB 3BZFB 1BXXA 4UQCA 1AZCA 4LCIL 3E9UA 3H9SA 4JHWH 1R3LB 3DSFH 3DURB 4YH6A 3MKKA 4GKZB 4FABH 1AHMA 1CBVH 4LPVA 3KXFB 1J1XH 1B2YA 3FAXA 2NTAA 4QHNA 3MRPA 1P4LA 4QRSA 4FI8A 3RRQA 4HX1A 3MLXH 3CG8A 1FN4A 3SZKC 4PRNA 2ZYHA 2VDOH 3L9RA 3DK0A 5I19L 1JHTA 2E8YA 1KGCE 4OF7A 3U0TA 4XCFH 4MVBC 2QZQA 4YBQC 3QXTA 5KVFE 3ZE2B 4YSQA 5IMOB 1CDYA 1KN2L 3PNWB 2E7LC 1SDDA 1M2VB 5C9JA 3KYOA 3L5WA 1UD5A 1NO6A 3D44A 4G7SB 4QTHA 1VCBC 1BYNA 1MJUH 1C1EH 5EO0B 1EJ8A 1BF8A 2GIYA 4YJZL 3DJSA 3GMOB 4KYRA 3D4YA 4OFDA 5DC9B 1NCOA 4BFIB 2FBJH 3ARDC 4CDHA 4WQOA 3T1FB 4KKBD 3BGMB 3C09B 3L3KB 1NBCA 4TVPE 3W81A 4QLWA 1KGUA 1PKQA 4HKBA 5F7EL 3PDGA 4PP1C 3UPRA 1GA2A 2OXHB 1EEZB 4JFDE 4CVWA 3VXME 1RU9H 1PIGA 5MP6L 1ES0A 2PQ5A 2EXTA 4ANVA 1GAFL 3MBWA 2DJ4A 2XBZA 4J2QA 1N5YH 3MRCB 1GS7A 2H4EA 4I18C 4XPBH 2R69L 5E9AA 1A1NB 4UV7L 2M1KA 2ZKMX 4JX0A 3HEIB 4MMXB 4WENB 1INQB 1MH5B 4HS8H 2WB7A 1ZGLB 4Q6IA 4DAGL 1DCLA 1OE2A 1CLOH 5J6GA 1FO0A 2F46A 5FLUA 3TT3H 1ORSB 3L4VA 4NHCL 2FJNA 4GAGH 5L0QC 3SOTA 1XCTA 2DBLL 3QNYB 1A6TB 1IKOP 2WUBH 1SZNA 3LIZH 4I1RA 5I73C 1JWMA 4H44C 4JKMA 5GS2D 4HKZA 4CVZB 4WK4B 3MLUL 1N12A 3FH7A 4OIFA 3JTSA 2G3ZA 3O3EA 3ABKB 2ZG1A 1A21A 2YD0A 4JFYB 4WSKA 5TF1H 2EILB 4ZO8A 5I16A 3BP6B 4Z7NE 1R5WB 4XN5A 35C8H 4DP6X 3NVQA 5GRVK 4I7ZC 3T0AA 5JOEA 2X4PB 1DQML 2YAOA 3QYMA 2OX5B 4GEIA 4OCMC 4Y1AD 3RNQA 2OI9C 2ZX7A 1V27A 4NOBA 2NDFA 1MCJA 1FVCB 5H2BA 4LFHD 3KLDA 3SGKA 4HHAA 5J11B 3MNZA 4KJYB 4OCLC 2AXGB 4MNQA 3MHZA 5TJWK 3WELA 4DQAA 1HOEA 3CFEA 3FOMB 5LHDA 1UUNA 1FDLH 4PWFA 2LV4A 4WUUA 4WWPA 4HOZA 1HXYB 3N85L 3IFOB 5KWYC 4PGEB 2Z65C 4ZD3H 5DLMH 1WAXA 4OZIB 1KBWA 4Y2DB 5ENWB 1A7PH 3G9AB 5L2KB 4FZ8L 4AQ1A 1AR2A 5AVRB 2DQMA 3LN9A 4LCVA 4BZ1L 1JPFB 2ITCB 3CMGA 4FCHA 4GB9A 3N55A 1U41A 1VFOA 1NNYA 2PYFA 1W2KT 3HLAA 4LT7A 2DWSA 3GSQB 2R1YA 2VW7A 5D5MF 4Q2ZB 3EYVB 3FTVA 1P1VA 4K94C 1Z3GH 1NOLA 3LEXA 3ZTJG 4NLHA 2V4LA 1JPEA 5CD3B 3TNNA 2XZQH 2W59A 1XFPA 3DIFA 3EH1A 2BVPA 2B59A 1E4HA 1E9QB 5BW7C 1OB1B 1PQZB 4KZDH 2IOIA 3P77A 2TAAA 2J8OA 1JPTL 4Q52A 4HCIA 1YEDB 2WUCL 1NLDH 3RPIB 4NCDA 4XP9H 1YZ4A 1IFHH 1JYWA 4MRCA 2R4SH 3IXAA 3ZDZF 3OKNB 3K81A 4L3EA 3LD8C 4XXCC 1XZ0B 4CN6A 3FYIB 1MWAL 3Q6GH 2XXMB 1QP1A 1UH4A 5TH2A 5F70A 2C5DC 2HT3C 1IARB 1JNHB 2FEEI 3VRLF 2LE9A 3GI8H 4U1LA 1SLWA 1MZYA 4M4RA 4ONGL 1CFVL 5I18L 3QG7H 2P5ED 4FQJH 4H0HB 4AVJA 2H26B 5HPMA 5HHNB 2V2XA 1A6AB 2VM3A 5FHAL 4TRPH 3WLBB 5EZLA 1G9MC 1NOAA 1RUQH 2VZSA 4MD4B 4NQQA 2APBA 4DVRH 3V0IA 1YGRA 3RU8L 4IGBB 2R0ZH 4XI5D 3RO1A 4KITB 3K2IA 1C83A 5KEZA 1KCLA 4QPEA 2SHPA 4ZTOL 1HXMA 4EI5A 4M6AA 3DX8A 4N1CA 3RWEB 4K3GA 3SCMC 1VADB 5D7LE 1WBYB 4ZPTB 4G82A 5C3IA 1WS8A 2NY1B 1OWWA 6CGTA 5KSAD 1PG7X 5AQ0A 1KTDA 2MPAL 3S3EA 2A6JA 2Z7WA 3HI6H 2EQDA 1EA9C 1UWYA 4QO1B 4HUXB 5DVNA 2VXTH 2Q8BH 3O9WD 2JIXD 1QUNB 5CHNB 4FFVC 2XVKA 4Z5RB 5M94B 3CDYA 2B3RA 5JPNA 1PJWA 3ULUD 2MSPA 3QIWB 2QHRH 4XH2B 2DF3A 1RPKA 1PCSA 5DMJB 5KBLA 1P15A 3T8VA 4H7VA 1M7IA 4PV9A 1GSKA 2DYPA 2PYEB 4YQXH 3V0WH 2YPVH 4S1DC 1CT8A 1G7IA 4N5EC 4WFHE 4XBEL 5DURB 4CBZA 4GG6A 4CVMA 5SWSD 2KKQA 3H6JA 4OJEH 1WFOA 1OPGH 4PB0L 3BKML 2BIJA 1FZKA 3N9GL 4L3CB 3SE4A 3VRIB 1E0DA 4ZXBD 2PF6A 1LEIA 1QLEB 5C0FB 3AITA 1MAMH 1NQBA 3MV7D 2Z8WC 3NCYS 1QLRB 3LAFA 3NP4A 1WV7T 3NCJH 3CZGA 3GXGA 5IVZA 3WNPA 4TNWF 4AE1A 5EPMA 5I6PA 5E9DE 4G5AA 4HD5A 1L4IA 4P3DA 1JGEB 3FO1A 3RDTB 3WEOA 1GS6X 1A6ZA 4G83A 3NH7H 1ZPLA 3ULUL 4RGNE 1MNUL 1PL3A 2VR4A 4GXUM 2J8UE 2NUTA 1N8ZB 4OIIL 5CLXA 3QIBA 1K3ZA 1I9JL 4CJ0A 1W72H 5LGHL 1B2WH 1R47A 2X0VA 3OJ2C 1CE6A 4I48A 4ZFOB 2R9HC 2O4EA 5CP3H 5EORL 2EYRB 2VXUL 4OGAC 5GRXG 4RI4A 4ZK8A 3RILA 4WU3A 5BZZA 2IBZY 4Y9EA 4ZAKB 5GS0C 3PIQB 4JPWH 4ODSH 2ZKHH 3B9AA 3F58L 5CGYC 1J0IA 1IBBA 3IMUA 1J88A 1I8IB 1FC1A 2R1WA 3CXFA 3T71A 1TJIH 5DZVA 3VQLA 4QJ5B 2I6JA 3MKGA 3TPUA 3PL6B 2N59A 4DSYA 4HWZA 3TPKA 3BW9B 4NO5A 1MW1A 4PG9A 4S1QH 5KSUA 3CVDA 3MR9B 5E8PB 5HGGS 1CU4L 4LNRA 1I53A 3WKML 1CF1A 4I9WE 6TAAA 3N40F 2RR3A 5EOTA 4G1EB 2BRQA 3GMLB 4DO5A 4XO5A 4NQCE 4ZS7L 2B9BA 5DJCB 3VAEA 4BRVA 3C87A 2WSDA 1UASA 1XF5A 1ZJAA 4O2FA 3BI9X 1DQKA 2IV9A 2F5BL 5L6YL 2XWZA 3RURA 4C58B 2NMSA 3DA0A 1SYVB 1BGXH 1T4WA 2R1XA 3LRLA 3Q1SH 5CJ8A 1ZLWH 4QRUB 5B3JF 5KSBB 4IOSD 4M93B 3OLGA 5EO1B 5ACZB 2Y69B 4Y89A 4NRYB 3D39E 1XZWA 2R8SL 5F7HA 1PX4A 2D7TL 2YD8A 4I3RL 2YEZB 5CZXC 2AJYL 1NDMA 3H3PH 3QJQB 4PJIA 4QHUB 3UDWC 5J3HD 3GBML 2WLYA 3GKWL 5ESVA 1UWXH 3CC5A 1T21B 4XBGB 2F61A 3SDAC 5I0ZA 4Y4KA 2CNIA 4HFUH 2HCMA 3K4AA 1PLAA 1WZKA 2VUKA 4P9HC 5HHOD 4W9KC 2OTWB 4OT1H 1UWGH 3MRJA 3CDCA 1G4RA 2JKRM 2WK2A 3P2DA 2YMTA 1KENL 2IMNA 1JN6B 5AZEH 4YNYA 4F7CA 5K59E 4X5RA 1D2OA 3AJ7A 3APCA 3CHSA 3G9VA 4NDMB 4F2ME 3MV01 2P8LA 5FW8A 4WDIB 2R51A 3PP4L 1BBJA 5JYLA 2Q47A 4Y4FD 4U49A 3RIAF 5FPIA 3IDYC 1HK6A 4KK8C 3F6LA 4DESA 4JFWA 3CN0A 2P5PA 5E8NA 4C54A 2MRYA 5E2TH 2ATPB 5EA0L 1TKWB 3G6JE 4L1DA 1ZV2A 5J7CC 4ZI4A 1T5WA 1F0LA 5HDBE 1HCVA 4XC3L 2XBTA 1BEXA 5IV2B 5J6HA 2PBNA 4HDIB 2D3LA 2GJPA 4JFSA 3TH3T 4JRXE 5IEKB 2YBGA 1YYLL 1P7QD 4OJCA 1BZCA 1LK2B 3CIAA 2IBBA 2M26A 3ULVH 2JJUA 1XO8A 4JHBA 2R2EA 4XCYB 1U8NB 4WWKD 5DD6B 3W39B 3I74A 3MCLL 4FG4A 4Y19D 3WXWH 2LW3A 2OZ4H 3C08L 2WCPA 4UI2A 3ESVF 4U1NA 1UT1A 4M43L 3SDDC 1NFIA 3U2JA 1MHCB 1L5GA 3LQAH 3I6GB 4PJ7B 2MQ0A 1OQXA 3TEXA 4R2GC 1AACA 4PM1A 3PNRB 2H32A 2CFVA 2HX7A 3L2MA 2O6DA 2X0UA 4XHJC 2H1PL 3PQYD 4ONFH 1X4YA 2IIJA 2NY6C 5EFIB 2AHIA 4HPYH 3B9KC 4LGPB 1IE5A 1PAZA 5IBSA 2P7TB 1CGUA 2AVGA 1FL6A 3HOGA 2YK1H 4M5YL 1E8CA 1SFHA 5C6TH 4ICZA 1AP2B 1XIWC 4JM4L 2WXKA 1IBDA 2ZWZA 2FHCA 1MFAL 1E5AA 3HCVA 3HAEB 3BKCH 3JVFC 4NM8L 2AJ3A 5EBGA 4DKEL 4TVSa 1WA0X 2BSRA 1V8HA 3BJ91 5BZDB 1SHSA 2IXQB 2IPTL 1ZLSL 2OMZA 5FKPA 4NKOB 2ZKWA 2HA1A 2B4SA 4OF5A 4IRSD 1X5ZA 5EN3A 5C0FA 3TF7C 1PZ5A 2WQSA 3QZMA 4XNAA 3H56A 1OP3K 3OF6D 4XWOD 5GS0L 1KGIA 2CK0H 4X4ME 3VFOA 2VLRA 1JNLL 1YY9C 2C3XA 3LSOA 4ODXB 3ZKNC 5FFOA 2NZ1A 3O2DL 4X5WA 4J3OH 2X38A 1GZQA 4FQ1H 4P2QA 1A7OL 4J6RL 4Y1SA 3L5XL 4LPUA 3BH9B 4FNRA 2H2PD 4PBDA 5I75B 1TZHB 2J25A 3CDGA 3U25A 2CPCA 3HNSH 1MIMH 1UOWA 4G7VL 2BH0A 3TCLB 3US1A 4QRQA 2ZOUA 2F8IA 3FXIC 2J16B 3F7LA 1O7DE 3B2VH 4NHUA 4WO4C 2Y1AA 3TV8A 4M4PA 1OT4A 1JV5B 1W0VA 3UOAB 1RHHA 4XP1H 1B0RB 2QFPA 5PCYA 3D51A 4D9LL 5I8CA 1FIGH 3LPFA 4WKXA 3V6OA 3QJUB 3EYSH 1RSYA 3EZ8A 4WHDA 5DXWA 5B1JC 2F53A 2OTUA 4AKOA 3BPNC 5KYYB 3B6SB 5C09B 2K3TA 3BO8A 4DK3A 2CM3A 4RA3A 4AM0B 1I7RA 1DQIA 4OCSL 1L6ZA 1YTWA 1I8LA 2QTEA 4P05A 1Q0EA 2NXYC 3AAZA 3OR6B 2H2SC 2L7QA 1JGVL 3OAYH 1ZS2A 1GCFA 3O6ML 4HLZH 3VFMB 4MRBA 3MRQB 5D93C 4M6NH 3VD4A 2GT9B 4PJXB 1L9SA 5DVOA 1MWAB 4GQZA 2YGVA 1GIGH 4Q6IC 1SUGA 4NUMA 3LIZA 3O3AA 3OKOA 4HJ1A 3ZT6A 2QBRA 2CKBH 3S88H 1BD2D 2WAQA 2B1HL 3IN0A 3CK0L 1GYUA 4LXFA 4OY9A 3D06A 2J5LB 4AJWA 1CUOA 5ANMA 4F7MB 5HHVH 5K9JH 4YE4H 4UB0H 5MEPB 3MQIA 1MRFL 1QHQA 3EADA 4E68A 3GBDA 3FU0A 3IJYB 1JMZA 3WTTA 1QWHA 1Y6KR 2K7PA 3LS5L 4OLYH 3ARDB 1F41A 4D3CH 4ENZA 1YVLA 3NSDA 5DDHB 1GC1H 1I8KA 4KK9D 2A6KA 3EJPA 2UVFA 3LQZB 2VR3A 4XXWA 5J9PB 4OZIE 2R56H 4LBAA 3RTQA 3VYPA 5L2KE 2QBSA 1DFXA 3MBXL 5FV2A 3UTSA 2W60A 5AWNH 3EXJA 4HPHA 3OAWA 4WHTA 3QQXA 1DFBH 4JPQA 3P40A 1A4KB 1FNAA 5CEZL 2O1AA 1QYGL 3SGKC 2A5UA 5T5FL 1G1FA 3HN7A 1USQA 4PP2B 4MA3A 1LDPL 1AYRA 5HHXL 1CXLA 2XWBA 4ZUWA 2IQAB 2YA2A 3ME0B 2KPNA 2WWKO 3CC1A 1L9MA 4QLRA 4A39A 5FA4B 4N20A 4XPFL 3RHWF 2J1WA 5DJDA 3O6FD 3U9PL 3S3PA 1BZQK 1UXSA 4ANUA 2JJTA 1BZ7B 1X5LA 1WAPA 5IEHB 1COBA 3BP7A 3DDGA 3FBKA 2C3GA 4KY1L 4AQ1C 4EEEA 2VB5A 1F42A 2B7DT 4KKLD 4YDKH 1BP3B 5I71B 3E7JA 2PP7A 1UT2A 1F6AA 4CA4A 4TXVB 4HU2A 1RJLB 4L4TA 5I1KH 5KSAB 2JI3A 1AR1C 1G9NL 1BAFH 2O6FA 4WNJA 4XAKD 1I1AD 1UXMA 2QDPA 4U31A 2VQ1B 1KTLB 1KXTA 5DO2D 1W6WA 1AOHA 1MJ7L 2G3NA 4I3GA 3HZYA 3EJCA 4BUHA 1RUMH 2WVVA 2JIXB 1FJ1B 3S4SA 4RRPG 3OG4B 3TVMA 4ZMLA 1CD1B 2OI9B 3SE8H 3Q48A 4N8VB 4ODWA 5EU3B 1DO5A 3JTTB 3OX8A 3HNVL 1E4XH 4JM2D 5B39G 4ZMVA 5JIPA 2X4QA 2V33A 1OK8A 1BVOA 1OF0A 3DO4A 3LN4A 4G6JH 4Y5XA 2KMWA 3EYOB 2W07A 1JXJA 1ML0A 2ESVD 4OIAA 3ZBMA 2B4CH 4KK6D 4DZ8A 5MEOB 1IX2A 4N2BA 1C5BL 4M48H 3KPSD 1JYNA 3VG0L 3RL1B 4XNMA 2WLIA 5L2JB 4ATTA 2ATKB 2F6TA 1ZT1A 2C4FU 4KQ3H 4P5MB 3G08B 4N2IA 2EO1A 1R24B 4ZSOB 1OAXL 4QXTA 3WFDL 5D72H 5I0WA 2VSMB 2H0JA 2AJSL 1S7RB 3MUGB 4U2ZA 5C0EB 5DR5L 3UTTD 1P4BL 2VLJA 4PIRF 2D4FA 5E4AA 3L3OA 1JWSA 2GCYA 2FL5B 3EGSB 1Y1DA 1SBSH 4B95C 1VSCA 3GHEH 4QRAA 3OZ9H 3P2BA 4JGUA 1VESA 4JFXB 5FF6A 5GQBA 1G7LA 3BAJA 2DLGA 4MXQC 4EN3D 1EHKB 5B1CA 4WFGE 3ILDA 2YGOA 4Z7VB 4YHOH 4EI5C 1OAKL 2GKIA 5I30H 2L04A 3KYKH 2Y6SC 4CC0A 5MEND 1OAUL 1K5NB 5GRVL 3HE6D 4GINA 4D3RA 4JFQB 1C8PA 3VFGH 1QFOA 2HUEA 2PYEE 3RVWD 5KADA 4Z7QF 3WMPA 4BZ2L 1EERB 2ICEA 4XMVA 1NANI 3PAUA 4XVSL 2OC3A 4XPGH 3V4PL 2QV2A 4H4NA 4MSWB 4Y2OB 1XGYL 3MROB 1HILA 1G1CA 1TUPA 4XN9A 3F05A 4JB9H 2YWYA 1NMCC 2YPVA 4I2XA 4JO3H 3VFRA 1FO0L 2OW6A 3THML 4LQ1A 1ZSDA 3CBKB 4FP8L 1A6UL 3X13B 2IWGA 1OARH 2JKLA 3QCCA 3D25A 3SO3C 4F7KA 3V5HB 1D5IH 2EDRA 4LSVL 3FT2A 1U91A 4LDLB 3RI5K 3SQBA 1YYMH 4PJFB 1S7VA 3AT8A 5I15L 3BZ4B 4GAJH 3HI5L 2GJJA 1UA3A 2WC7A 3T2OA 4AUYA 3INUL 5T1MA 4UU9B 4KVNL 2WB1A 1DSFL 1DBAL 5CUSH 3F7YA 5AVYB 1AHKA 3SGDI 3LZQA 4OLZL 1A64A 3S5ZA 4LHJB 4WU5A 2ICWB 3ETSA 4I9XA 2EDHA 2WLMA 3GSRA 4B9YA 5JORB 1LMKA 1TJHL 3POCA 3EFFB 1FAKT 4L1TA 4NO0A 1W72A 2GVYA 5GZOA 3V0FA 2GBVA 1SXNA 2AQSA 4XN2A 5JZ7D 1NWLA 4F3FB 4KKPA 5CP3A 4QBWA 3ZUCA 2BC4A 4ZO9A 1FNGB 3QIBC 4JDEB 2J44A 1A7BA 4QOKD 4AEIH 4BGDA 2ZTBA 3EYUH 1X4ZA 3K6SB 4IIQB 4JANB 1T6BX 4KI5E 3HAEG 1ORQB 1CFMA 3P54A 1A4JA 2MQGA 4RX4A 1RUAH 1VFAA 2MOGA 4HBCH 2WIIB 4YLQT 1KLGB 3WFHA 3F7RA 4BD4A 1P53A 4QDGA 5EBMB 1MLCB 2X6AA 2K4AA 1PD1A 4QHPA 1G1OA 2OMYB 1QUPA 2XA8H 1ZRUA 1BX2B 1AGCA 4F58H 2ZPKH 3TO4A 1FA4A 3CGTA 4HIXL 1FCCA 3BDYH 3DVFA 4J3BA 3ECUA 1NEZA 3MRIB 4QT5B 3SBRA 5KVDH 5KSBE 1E3ZA 1N2RA 3BVTA 4XP4H 4KVPA 5KVEE 3X3GL 4BFNA 1XF2B 1MKPA 4R7LA 5BVPL 1FE8H 5EZIL 2R39A 1ASOA 3ZKMD 1JK9A 4TSAH 1DO6A 5HI4C 5JTWA 2UZXB 3OLDA 4QUNA 5K24A 1Q0XL 3B2MA 2XFXB 3D6GA 4OZHB 2DWYA 5CBEA 1MJJB 2OLDA 3RGBA 3DXAA 5AB0A 4ETQA 3MV8E 4UQDA 2BW4A 1EAOA 2Y07H 4HSAC 1P7QB 2R4RL 1WWAX 3WOVA 3LZRA 4B41A 2N1KA 3HFML 1OAQL 5IT2H 1VACA 4ODBD 1N68A 1HHHA 3EOTL 3DSNB 4I87A 4KBPA 4WWKB 1H3XA 4X6CF 1P4IL 5ABZA 4I5BA 4HF5L 4Y19B 1DQDH 3GDBA 4NZUH 5E1IA 5IFJA 2DMCA 3C9NB 4OCXH 5A2CA 2WD0A 3ZE0B 4N2CA 2J17A 1O6VA 1F4XL 2AK4D 1YMHB 3EOBA 3S36X 4HK0B 3NUKA 3OG6B 3L9BA 5GIRA 3T0WA 1G1HA 1YN6B 1NWEA 4YHYB 1S6NA 1T5XB 1KLUB 4N6QA 1JGUL 3STZB 1ZA6B 4C57C 2J6EL 5M95B 3CHXA 2QKSA 2EEFA 3ARVA 1J7VR 5TDPB 2GJ6A 2NY3D 1UB5B 3BUPA 5T3XL 1TTRA 1ODUA 1NSNL 5E00A 4P5KA 2YGQA 3C6SA 3QA3B 4K7FA 3HFFA 2W65B 1NDGA 1JBVA 3GJEA 4Q89A 1GXEA 3VI3B 1L7IL 2XY1A 4YEFA 5FOBA 1XSKA 2ENSA 3V0VB 1TEFA 2M2DA 3U4AA 4G43B 1N5AB 1T66C 4PI0A 5L4MA 4OKDA 4IRSB 4KO6A 2HFTA 1F86A 3VDBA 4X4ZA 3FSVA 2O5ZL 5DMIL 5DS8A 2HTKC 3MJ6A 3RZCC 3QKQA 4BUQA 4IRZH 2QBPA 4FX5A 3BISA 4PJ8D 4M9PA 4R84A 5J56B 4RAUA 3IVKB 1UWXK 2BCKB 2VISB 5BZXA 2UVEA 5DFVC 1F6FB 3B9EA 1DDHB 1CDJA 2OZ4A 4CDGC 1KEGH 2EDMA 2VMFA 3MBED 1BAGA 5E5MB 2IO5A 2YXWA 3FO0L 4NSKA 3SDAB 2AGJL 1IM3B 4LK4A 3QUYA 4S0HA 4TLKA 4HK3N 1H9VA 1JF7A 1DQLL 2AITA 4JFEA 3FQ4A 4D3PA 4EO5A 4K3EH 4MKMA 4G6AD 1AZRA 2EIDA 4BFJA 1QA9B 3QHTC 2H9GB 4H8UA 5T33L 3MUJA 1KPUA 2ALWA 1OKEA 1MELA 4ILDA 3OL2A 5CP7A 2V3FA 3MRHA 4UNIA 2GCBA 1PTUA 3E6FA 2QBWA 1H3TA 2K45A 3BXNA 3KGSA 4F37F 1CGWA 3MRRA 4LU5H 3HVDA 5CEYA 4LLWB 4KO7A 5G5DA 5L9DH 3LS4L 4MQ7A 2XKUA 4OF8A 3VMNA 5E70A 4JFZH 4JHAL 3OSVA 3SGJA 1R3KB 1XXPA 2UZPA 4TMPA 2W88A 1NCBL 4PAZA 4MJIA 1FNEA 4ONHA 2JB6A 3BAYA 4Y2NA 1TTUA 2YDUA 1TVBB 3ESPA 5ANHA 2I6MA 1SLUA 4Z7NF 4HJEA 5IQ7H 2IAMB 1E28B 1ZHBB 1A7NL 3L3JA 1KBGL 3W11D 1A3RH 3KPRD 1NBYB 4Y5VB 2CLZA 4I0PA 4JFHE 1IAKA 4PV8B 1JZJA 1TQCB 2CGRH 1NIFA 1IILE 1DANT 1S3RA 1MSPA 2PPFA 4N8VG 5A2LH 3SDDB 4ZZFA 1C85A 4GLRI 3WN5A 3HJEA 3R8BB 1F11A 4ZNEE 2SODB 4UMSA 4R2GB 5FYKH 4H5SA 1G5GA 1WRFA 2YHGA 3WFCH 2HFGH 5I6NA 2A0LC 3TCXA 5C09E 1XCXA 1T04B 4Y4KD 5I17A 1QNIA 2VABB 2QMJA 4LCWD 1MVUA 3BPOC 4BH7B 3ZMEA 2OKMA 2NNRA 4AGQA 5CSZB 1A5FH 2EE3A 1G7GA 1QXKA 2HVBA 4ZMOA 5CWSB 2Y5EA 1XIWB 3QDJE 3DVGA 3QEUA 4PJXE 4D0BB 1U8PB 7FABL 1WVZA 4NQVB 4YZFF 1RJCA 5E94B 3TESA 2XIDA 1G7JA 2WXFA 5KBMA 3ZR6A 5GGSB 4N90E 5F3BA 4TNVF 4AV5A 3V9EA 2P43B 5GZNA 2Y36H 3WE6A 3O11B 2D31B 4JVPA 3HMWH 1QFWL 3MRKA 1NUFA 4NQXA 1WAEA 3PWVB 2WKOA 1I8LC 1LK3H 3P3SA 3U7YL 2AZRA 4L4VD 2GB2A 2K1MA 4IRJC 3H9SB 3BRGC 2CKBA 1GRWA 5DZOA 2VJ0A 1CK0L 3H0TA 1QQDA 3QUMH 3D42A 1N64H 3D3VD 4ELMB 3FO2B 4QHNB 3MRPB 4QRSB 2GK2A 3C8KB 4ZNCD 4QRPA 2DM3A 4U7SA 5GGRY 2NW3A 5BO1H 3T0EA 1FN4B 2AC0A 4Q6KA 3GO1H 3JWNH 4GI8A 4DUWA 4GQ9H 1BF2A 2NX5E 2BY3A 1VEPA 3U0TB 1OSPL 4E5XB 2PPEA 1SDDB 3NSCA 5C9JB 3L5WB 4JL1A 1BQUA 1IZJA 3EJYD 3KWXA 1QWNA 4RA0C 3A6CH 1ET5A 4HHWA 4GRWB 2P9RA 3M4UA 2GPZA 3M1BB 3OHMB 4M6OL 1WWCA 1E9OA 3BLPX 2ICCA 4M1DH 4WTXA 4ANWA 1RV6X 3LZLA 2ZWKA 1ONQA 3QUZD 4WHYG 4S0GA 1HOCA 3S96A 3ZMPA 1PKQB 3LNHA 3BPNB 4HKBB 2DLFL 3UPRB 2EDWA 2ESVB 4EI6A 4XXWC 3EO0A 3DHJA 3OAYK 3VXUD 3RTQC 1P31A 3C5XA 2AV1A 2WXPA 3IFNH 3FU7B 1A9BA 1FFPB 3APNA 4LPYA 4IJ3C 5F0LB 3V4PB 3O6LH 3QEQA 3FU3A 3F9AA 4PQXA 2A6DA 4HFWA 1I1CA 1KJ3L 1Q94A 1OTUC 4M7KL 3UTTB 1AO7A 3A4EA 4Q6IB 4W93A 1FO0B 3CZUB 4NJAH 4PRDA 4F7PA 2B0SH 4KZ0A 3VFNB 2JJTC 4G6KL 5FAAA 3S3KA 1XCTB 1HS6A 4TSCL 4AYFA 2ZF8A 3L3IA 4D9QE 4OZFB 1OP4A 1ZVSA 1BFTA 4FQIH 1QI4A 3VNZA 5JR1H 3MAWA 2FLRT 3L95B 4HU8A 4L8BA 5MENB 3HE6B 4AL8H 2X70A 1GWZA 1JYXA 5IREA 3T9WA 3ZW3A 2O61A 2I7SA 4P3WA 5DS2A 3B7SA 3IXTB 3JTSB 1EAJA 2G2RA 3OGOE 4NP4H 5HGDA 3FQRA 2OR7A 2VEUA 1BBDH 1CE1H 4JY5H 3BIKB 2CJUL 3OHXC 5INDB 3TVMC 3RNQB 4JHWL 4ODHH 3DSFL 3TN0A 4BSWA 4FABL 1OT2A 2FJHA 3CVHL 4IU3A 5H2BB 1KIUA 3OSKA 4MHHG 3REWA 2ZOKA 4U3SA 4HHAB 4N3TA 3MLXL 3CZFB 3TL5A 4PJBA 4Y5XC 1NOFA 2VDOL 4MNQB 1HKFA 2J8UF 4UNUA 3ZM5A 1E4KA 3A6BL 3PFUA 1YEFH 3C5ZA 3P30L 5H37G 2I6IA 4CJ1A 1HZHH 5I1DA 4KNSA 1FQ1A 2IBZX 1MJUL 1C1EL 5EBWA 3VXOA 3FFCA 3Q8FA 4ZMPA 4PY8I 2X10A 1NC4D 2HYMA 4XP6H 4DZBA 5FCUH 3MRMB 2I27N 3IDIA 2OR9H 1O6SA 2PYFB 3HLAB 4Y5YC 2XPCA 1L7TH 3L3OC 4G5ZL 3CPLA 4NZTL 3GZOA 1AR1B 3M46A 4HGWA 3MOAH 2NYKA 2GTQA 2DQCL 3IE9A 2PLTA 4KAQH 4IOIB 2NY2D 2PWDA 4M7LT 4B53A 4LARH 3TZVA 3QJRB 4JDZB 3DIFB 3VI4A 4GAFB 3IMSA 2BVPB 4NQSA 2HXPA 2B59B 3ROOA 3BVWA 3RIFK 2DWDA 5DD3H 5BXFA 4C55A 4EE2A 3P77B 4TLSA 3GBNH 3NABL 5KVMC 4HS8L 4JCLA 2NYYD 4R90H 2ICEC 3IFPB 5JIMA 3AB0C 4MWFB 1CLOL 1CTNA 1TFHA 3AUVA 3IXAB 1MFDH 4PBWD 1OW0A 4L3EB 1A4BA 3MRBA 4BUCA 3BMWA 1Q6PA 2ENQA 1ZOXA 2WUBL 4GSRA 5TH2B 1VHPA 3M8OH 4U6VH 5KYXA 4KTYA 1KTRL 3AUWB 3X3FL 2HLAB 3OMIB 1TU2A 2OAAA 1KCSH 3WIAA 4ZDHA 4R26L 3ZOAA 1H8OA 3UZQB 2FT8A 4L9LC 1UXWB 1UC6A 2P4DA 4XZ4A 4KHXL 5HPMB 5A40E 4RZCA 5IB3A 2PN5A 3NIFB 1K72A 2XQBH 3EJZC 5F89A 1GJUA 3GSVA 5C6PB 3BSHA 5D2LF 3PABB 2Q86B 3PAYA 5ID0A 1HSAB 4J28A 4PIBA 3Q8BA 1HXMB 4LCUA 4EI5B 3PRZA 3DX8B 3Q8AA 4ORZC 3B2UD 5K59F 1F56A 1QO3A 3GPEA 3ZMNA 4KXAA 5I0DA 4GAYA 2OZNA 1QD0A 1G7HA 1KGJA 1N59A 3FQTA 1IFGA 4KJQC 4KGJA 3MLYH 4L4TD 4P2RA 4N0RA 1JL8A 2PW1A 2AK4B 1JZ6A 1KTDB 4HIHB 3GGWA 1EGJH 2HUHA 5GZOC 4QNPF 3O41A 5JQ6L 1OGSA 4XNYL 4ANXA 3VSQA 3WN6A 3G6JF 5F21B 4ZD3L 1XB3A 2IADB 1N26A 1TIUA 3QEGL 4O9HH 4R5VA 5DLML 3SE9H 4F7TB 9PCYA 2DDQL 4FCAA 2JSFA 5KG9A 2VLMD 5JPNB 2QGDA 2NY3B 3MREB 3UAAA 4OZHE 1VFBA 1FHNA 3I9AA 1JHLH 1I1YA 1PEZA 5FDYA 3UBXA 5IHZA 1DE4A 1M7IB 1RZKH 2QJDA 2DYPB 1U8CB 2XQ0A 1RMFH 3CMOH 4K5OA 4WW2F 1CT8B 1G7IB 3JWOH 3B9DA 3QR0A 1WPCA 4LF3B 4V2BA 3GNML 5I1AA 1ESOA 2WLLA 4BFGA 1Q38A 4B3EA 2FATH 2JCCB 4IBYA 3WNIA 2XZQL 5F0MB 1JHKH 1CZ8H 4MJ6B 4KUCD 4UQBA 2CUIA 1E5UI 2FH8A 4DCQA 1LEIB 4G80A 4ZIYA 4NCC1 2D7OA 3QCNA 1KB9K 2K78A 3FT4B 4PJ8B 3UAJA 4AG4H 4KZDL 1KJ2L 4XNBA 5IB4A 2YRBA 5EPMB 4MBRA 2YN3A 1NLDL 1NGYA 4J23A 4P3DB 1S9XA 3DHUA 1FH5H 1LYVA 4P3CL 3F8UB 3N04A 1D5RA 3Q6GL 5KA1A 3HR5A 3X17A 2CA3A 3QIBB 5I5RA 1E90A 2DKMA 4Z7OB 4WGWB 1Q8MA 5LUMA 3NCFB 5I1JH 3GI8L 3CSBA 1CE6B 4I48B 4WEUD 1MY5A 4FQJL 5D1QD 1JLNA 3VI3E 1KIQB 2IAND 2Z92A 3FFDA 3P9MA 4JE0A 1ZA3A 2KL6A 2WWMC 1NCDH 3WDIA 4PJ5D 1U3HC 5E2UL 2WZ6A 3OLEA 1HINL 2R1WB 1UFUA 3ARBA 5AW1B 2XT1B 4UTAL 4ZX4A 3MA9L 2CA4A 1U8KA 4I85A 3PUUA 3VXSE 4F9LA 3C5JA 3ARRA 4HWZB 5E5RB 3ARFA 5AOIA 4NO5B 4HJ0C 3RBGA 3RVUD 4APQD 4YDLB 2FUTA 5KSUB 5JIHA 1AS6A 1OSZA 4OIBA 4W9LC 3BH8A 1IGJA 3QJFB 2V3DA 4LNRB 3D87B 4PREB 3DX7A 5EOTB 5L4JA 3VGEA 1FUNA 5LQBH 3TIDA 1VENA 3T09A 4K0OA 1NMAL 3FT0A 1QPKA 3KWUA 1ZK5A 1ETJA 1U36A 2PW2A 1JZ4A 1NLBH 2NCMA 3OWRA 4IRZA 3HI6L 1N6QL 4O2FB 4PVMA 1XF5B 1KTKE 3ARGA 2MJWA 3CFDA 3GRWL 2Q8BL 3BKJH 3LDBC 2WTOA 1F3DJ 2EDJA 4ZFGH 1JVLA 4NZFA 1BFOA 1GMEA 2R1XB 2WP3T 3FUFA 1BPLB 3CFJB 3P4MA 4MHHI 4V1DE 2XTJC 2ZG3A 4ZQKA 3RL2B 2DL2A 5CFAA 3UC0L 2BIMA 3ULVC 3HLKA 3BWAB 3PY9A 1S9VA 1ZANH 3D34A 4EI0A 3AGVA 3Q06A 1CO1A 1XM2A 4H1LH 1QPPA 1E27A 4MLSA 3DMMD 3MTRA 2DQDH 3M7FB 2PKDA 1QAWA 3NDZE 4PMEA 5E99L 1NDMB 3I6LD 4PJIB 3MRFB 3SB3A 2PO6A 3HE7D 4QEGA 1NC2A 2B77A 1W0WA 3LQAC 3CC5B 4GKLA 5K1VA 4Y4KB 5DHYA 1T48A 4GW1B 3QUYC 4E41A 4DTGH 1AZUA 4PWGA 3FUEA 3KLLA 2UAGA 2VJXA 3EDFA 4PUBH 3NA9H 2DI8A 2XETA 3MRJB 1MAML 1OGAA 4B0MB 4KKAC 2LVCA 2QTVA 1ETA1 5FW7A 1GVIA 3MZTA 3LHPH 2Y0SA 1SN2A 1FH2A 2XY2A 4YNYB 1IC0A 5LWYL 1WBZA 5AW3B 2RB8A 2P8LB 3TO4D 3NZSA 4RQQA 5F9WC 4TSBL 3NH7L 3QNXA 3MRLB 5CEZE 2WNXA 3CIQA 1JZHA 1HX0A 3T4YB 5E8EB 2H6OA 5E8NB 4J3UA 4DP2X 1VGKB 2HG5A 5HDWA 1M3IA 2GEEA 2WVUA 1BFSA 1T5WB 2FSEB 4XWGL 3UZVA 3UJIH 3SGJC 1Q1JL 1XH3A 4NO2A 2Q0ZX 3UO1L 1J87A 3T6ZA 3DJ9A 4JPWL 2DPKA 5D7KE 5I8OL 2ZKHL 1IQDA 2XYBA 4ENEC 1IM9D 3UABA 4HSQA 1AFVH 1E5YA 3QJTB 5AD0A 4WRLA 1L8KA 3PE9A 2QPDB 4J3OC 4M7ZC 5BOPA 1HE8A 2FWOA 2QR0A 4XXDA 2R2EB 3HC0B 4I0PC 3LKQA 1CS6A 2XVGA 3DVNA 3QS2A 1BJ8A 3BFOA 1U8QB 1N7MH 4E9YA 1MY7A 4PTUA 5J06A 3K71A 1NFIB 3WN5C 2V2TB 1L5GB 4PRPD 3G5YA 5DRZA 3VYNA 1M57B 1WD9A 4G70B 3M7OA 2GHZA 2BJML 4QRTA 4WZ9A 2H32B 3QUZB 2WBWB 1PFOA 4Q9BA 1YC8A 1BEYH 1KJMA 4NQDA 1KTJA 3MCYA 2X1PA 3TU6A 5AAPA 5AYUL 3Q1SL 2YQGA 4B27A 2GJ6D 1PLGL 2N0MA 5CKGA 1PYNA 2N0KA 2CNGA 3H9SE 1Z32X 5A2BA 5A5FA 4OQTH 2CG9X 2MNWA 2CNFA 1UZ8A 1WGOA 2P4AB 1WRMA 3H8NA 4LPWA 3TV3H 4FMKA 2BSRB 3F41A 2N4IA 1Z5YD 1NL0H 3OKEB 3OVUB 1O75A 5FKPB 1KWGA 1JV2A 2HRHA 1CDUA 3RBSA 2YLKA 5GZNC 2DMBA 2R2BA 3KZ8A 3ZU8A 2VRAA 3QUMA 1GOHA 2BIHA 4G7YH 2C7UA 1UADC 4GRWE 5JLZB 2VLRB 1Z0MA 5EUKA 5C0AA 2B08A 2VDOB 3CCHB 2AFNA 3GB7B 4MJ2A 3FCSA 4X5WB 4OLUL 2F54D 2ERJB 4UDUA 2NXZC 1GZQB 4C59B 3P0GB 4P2QB 4PPTA 3C8DA 2GAZA 3EJSA 1KXHA 1NMBL 3NGBC 4FFYL 5J57B 2BVOA 1PKQE 3T0EC 4P5TD 1NCAL 2W91A 3FN9A 1OCWH 4IKKA 3C6LD 3PGDB 1GGYA 3AT9A 4UQ3A 4FA8A 4U7KA 3NFPB 3QJHB 4DW2H 4F7EA 3WCYA 3APMA 1GC1C 4BEIA 1W0VB 2Y06L 1RHHB 1HH6A 2PA5A 1MREH 3LPOA 2AXWA 4WWOA 1MEXL 3BUIA 3UXFA 1IGIL 2WO4A 4NFDA 5AWXA 2P3YA 5CLTA 3T5WA 1P6AB 3OKLA 3TJEL 2Z3FA 3CV5A 4HCRH 5BUGA 3ULVL 1ZVYA 4PLNC 2F53B 2ED8A 1YUHA 2NTFA 2NZ9C 1XF3A 2VSCA 4X8JA 4YFLI 1J1PH 2IMGA 4K5PA 3BO8B 4NXKA 2MTAA 5F1KC 4OGYH 4OD2B 3WXWL 5I24A 2FUQA 1I7RB 4NKIH 2Q5BA 2YQ2A 4AEHL 3LQAL 4XNDA 3AAZB 1Q72L 2X53A 4NC0B 4NZ8A 3ZQ9A 1F58L 3OR7A 1GOFA 4S10A 2Y5QA 2EDKA 5DLLA 4U6HA 4G8EB 5F1IA 3O3AB 1G0XA 1KIRA 3QNZA 4JN1L 2JKWA 2YD2A 3Q2VA 3VH8A 5D8JH 2YK1L 2DB8A 3P3UA 1B0GA 1OCCB 1KT2B 2XQYK 5DHVB 2YC1A 2VXVL 3GXFA 5C6TL 4CBPA 3Q2CA 3FTUA 3HZ3A 3S3CB 5ANMB 3JWDH 3UP6A 5GGUB 3LRKA 3V52L 4Q4IA 5FM4A 2X6MA 4A2GA 1A1OB 1FIEA 2IDTA 4K3JL 4MNQE 5J5EA 1XF1A 5JIKA 4JRYA 2Q76B 4QMEA 4TVUA 5GGTH 3SOBL 4PJAA 1JPSH 4WUUE 3T0VA 1XDTT 3DVIA 1K4CA 2YEVB 5B22A 1KJVB 2ZAIA 1MF2L 3GJFK 3S36L 5AYQA 2AI0H 5GS3A 3RTQB 4JKPL 3UTSB 4M61A 1QLFA 2V5YA 3EOYG 1ECZA 3TN0C 2B4CC 4AXWA 4H1OA 1CCZA 4IJ3B 4FQ1L 3K74B 3FN3A 3V8CA 1U3NA 1JBJA 5C7ZA 2ZNWA 2PXYA 4JQXA 4POZD 2Y7OA 1O9WA 2XWBB 5CCGE 5IGXH 5CF3A 3M6DA 2WZPD 1A7RL 1MIML 1MRDH 3LKNA 1E4KC 4HSCX 5D7IA 1JI2A 4ICXA 5JOPE 4AJYV 2EH8L 3C5ZC 4KI5F 4ZS6D 4IBLT 1LILA 5F7UA 4LQFH 4K07A 2ZMMA 3BP7B 1OTTC 1TDQA 4A7TA 2QADD 4XP1L 3O2VH 4KYQA 5CXPA 4YWGH 1G4MA 1GKOA 5CILH 3H7BA 4KX7A 5DJ0A 5DRNA 4AT6A 3RWIB 2D8KA 5IJVA 5I28A 1XGRA 5LJYH 5FHBH 1G7MA 4LLDB 5IW6B 4MKTA 1I3RA 1QI5A 3EYSL 4FLSA 4L4TB 4UMGA 4NQEA 1Z0NA 5FYLD 5KSBF 4L3EE 4FLRA 1KXTB 1T1XB 2APWA 3SJVD 1T03H 2EDLA 1M2OA 2OMTB 3O3DA 1JTOA 5IBUG 5AUMB 3U4KA 4ECNA 2L7UA 1KJ2B 3ZKSD 2EINB 4B7IA 2FGWL 4G42A 1WS7A 1IEAA 4HJJH 4OM1H 4YC2C 3TZVC 1LP9A 1S7XB 4NO3A 1OHDA 1MCIA 2DQJL 2YPLD 3BPLB 3S4SB 4M6ML 1UG9A 4LVHC 2IWFA 4YUEH 2NT0A 4M6NL 4ODWB 3B83A 2LLNA 1M4KA 4AQZA 3U1QA 4EDXB 2X4QB 3GMMB 5IFAH 3NIFE 5HI5C 2YPKB 3KHOA 2XZAH 2DQIL 3LN4B 3QJSB 3QQ9C 4QTIH 1BYPA 3OMAB 4YDJB 3KPOA 4W1TA 4Y5XB 5ERWB 1MCOH 2FYYB 5T3XE 1HEHC 5IVOA 2CKBL 1YQVH 3V6FA 2EXSA 4W4NA 4DZ8B 5ITBL 1RK1A 1OW0C 2VN6A 4H0GA 5GSRB 1VB9A 5HYFA 43CAB 5EHRA 4I3SL 3VO0A 3BN9D 4G3YH 2R27A 1FLRH 3DUSA 4XNMB 4DO4A 2CM7A 1IGFH 1T0PB 5HHVL 3MOZA 4YE4L 1T4KA 2AJXH 4UB0L 2P28B 3F99A 4NN6B 5FYLL 3WFBL 2EC9T 4QXTB 2DIAA 4GMTL 1EEUA 2J43A 4JKWA 2A7BA 2VIRA 1LYQA 5IQNA 5KAQG 2VLJB 3DGGB 2Q3ZA 4WSJA 2GCYB 1ZLVK 4CSTA 4L5FH 1HI6A 5JXEA 4OJDH 4TLTA 5FF6B 2WXLA 5I6LA 2JV6A 4AYSA 2WKLA 1KFAL 2WZAA 2R56L 4CNIB 4P2OA 2JB5L 4CADB 3ZSTA 4XNUL 3ZL4L 1EGJA 2Z93A 3LTVA 1J12A 1DFBL 3ZKQD 5A1AA 1H15A 1MCCA 1A3ZA 5EOCH 4AMKH 2BFGA 1NJ9B 4GKNA 3PWJA 2UV3A 1FPRA 2VOTA 2F9BT 1DVXA 4GG6E 2IANB 1CLZL 2X5OA 1QBML 1WCQA 5DYOA 4XX5A 3AB0B 4LRIA 4PJ5B 2HB0A 3Q44A 2R0LL 1AXTH 3PPEA 1HILB 4LKCB 4N22A 4MNGA 4L8DA 1EEQA 3FUMA 1X7SA 2E86A 3CPUA 4X9GA 4Q9QH 1UHVA 4I2XB 3L45A 1KFGA 2BP0A 1KCUL 3IDNA 4HMCA 2J7LA 4P9ML 3VFRB 3W9EA 4RH9A 1ZSDB 3NEEA 1OAJA 3MFGB 1I1RA 3FQXA 4G9FA 4LPXA 5MEQB 3D25B 4NM4L 2GC7C 1BZHA 3ZRFC 1BAFL 1H3UA 1U91B 2NUPB 3N1GC 1ECYA 1ZPUA 4HJPA 5F96L 3KCPA 4WI9A 5DD0H 3D9AH 4PS4L 4Z7OE 4C56A 5T1MB 2Z0UA 2AJVH 3F7YB 4IYKA 2A9MH 3T2QA 3PHSA 3SE8L 2QL1A 4FA6A 4MMYA 3U46B 1H8NA 1KCRL 3UAJC 3KLHD 5LXQB 4WU5B 1E4XL 1XSJA 2PSZA 4XMLH 2HRPL 2GTZA 2P24B 1ZHNB 2BMKA 4G6JL 3P9WB 4NO0B 5FGBA 4PRID 1BECA 4UUJA 3HE7B 2B4CL 3TTSA 1XSIA 2BVYA 1J11A 1VEOA 4LEOA 5DFWH 4M48L 5EIVA 4MA8L 3B7UX 3GLDA 3EOAB 2BC4B 5GRUH 5EC2B 1ITBB 4KK8D 4OB5L 4FS0A 4KQ3L 2WSKA 2OMBA 3TCTA 5D72L 5E0QA 5HYQA 1A4JB 4BKTC 3FQWB 1BCIA 2VLKA 4O2CB 4PSPA 2PR4L 5JQHC 3H4HA 3S34H 3EO1A 3GTTA 2FWUA 2ZUXA 3QORA 3WL9A 2CO4A 1AGCB 1J8RA 1J9SA 3ARBC 3QNFA 3RVTC 3TO4B 4PJEA 1JNNH 1NEZB 3UTOA 3KS0J 4NCC2 4YX2H 1N2RB 4YHOL 3RAJH 3WHXA 3ARFC 3TJPA 2FH7A 4G6ML 1AQDA 3OLIA 4ADJA 4W9IC 3QQDB 2HMID 2DD8H 1I4FA 2FX7L 4JDTL 4EIUA 2VTDA 5EU4B 3ATFA 3O4TA 4PJIE 1H6FA 2LGNA 1DLHB 1JMXA 4B96A 2VO8A 4Z9KB 2OJ1A 4PGCA 3QQ3A 4GRLA 3ARGC 4DHLA 2HN7A 4FQQA 4ETQB 1IM9B 2OP4H 2WMPA 4H1LA 2H3XC 2WYZA 3PDOA 4JPIA 3MJGX 4K9EH 2BZLA 2H4VA 5HYSB 4MS8D 1YNTF 1HHHB 4KMQA 4MMZA 1R4XA 8PAZA 1SJHA 3HIZA 1IZKA 4PJXF 1J9QA 3AWFA 4I5BB 1J05A 1HDMA 4Z23A 2NY4C 2AK1L 1OARL 5CKAA 3WIIH 5IFJB 4RWHA 4KROD 1RXDA 1T7WA 1QSVA 1D5IL 3GXNA 4HGMA 4PRPB 5DEFA 3Q43A 3EOBB 2O26U 4GPVA 3QCUH 2PO6C 4HOMA 1XV8A 2CIKA 3QHFL 5B3NA 1TYRA 2DQEL 4ZI8A 4GBXA 5AKRA 2VAJA 3LRSA 1FWXA 3RGQA 1OO2A 4RETB 1GGUA 4XVTL 3SY6A 1NINA 3IETB 4PGBA 4TTDD 5CUSL 5AVXB 1UQSA 4YSUA 3AC0A 2OPCA 2GJ6B 3WKYA 5I66B 2VWEC 3F3HA 5BPPA 2VE6A 5E00B 4P5KB 3REVA 5I5IA 5IB1A 5FECB 12E8H 4YEEA 2OSYA 1NDGB 2W9LA 2WLKA 2CSPA 3QC6X 4QXUH 3P73A 4Z95H 5H8DA 1SVCP 4HKJB 2WTZA 1DJZA 3RVVD 2C1PB 2WINB 3ARED 3QR2A 3MV9A 2ZWNA 3PWPD 2EIKB 4OF6A 5DUPH 2EUZA 5HHPA 1NCGA 1QFPA 5TPWH 4NQTA 3DV6B 2C9RA 1U25A 3CFUA 3Q8EA 3PWLA 4YE0A 1LD9B 2VR5A 4L8SA 2R29H 4LEXH 5DS8B 4NKMA 4AQAB 4XOBA 1RUAL 4JJ5A 1FAIH 4YHNA 3UYRH 1RFDL 4FQPA 3FU5A 4HXAL 4LVEA 4R4ND 4RAUB 5MHSE 3HB3C 5I76B 2F54B 4HKXB 5DHXB 2OMWA 4PH8A 3U9UB 1FRGH 3AS0A 2XA8L 2HPOA 2WBJA 3ALPA 3MLSH 4OSUH 4GUCA 3TYGH 1ZZWA 4R96B 3AG1B 1C08A 3NIGB 4NSKB 2ENYA 2JKSA 4DUVA 3QUYB 4BM7A 3C6LB 5DQ9A 5KS9A 1QFWI 3WO3B 3QDGD 4JFEB 4NYHA 2P8MA 2HT2D 2EDOA 4UIKH 4W6WB 3VXRD 3E6HA 3LPWA 3QWNA 1HC1A 1BQHA 3N0AA 1NL9A 5EU7C 2G4GA 3T08A 4MQXC 1KPUB 1NCJA 3TA3D 4MQTB 5FUOL 2LU7A 3EDDA 4OQTA 3GUFA 4IOFC 5CP7B 3MRHB 5F9WB 3BEWB 1DBJH 4MYWB 2NNFA 3BXNB 3ILPA 4P46D 2VLRE 7TAAA 2VOSA 1CD8A 2ENJA 3QXDA 4XN7A 4ZOEA 5CEYB 1A47A 1ACZA 3FONA 3NIDE 1AY1H 1PZSA 4NZUL 1KBBA 3NZUA 4OCXL 4YFEA 2YSSB 4P2QE 5BVJA 1P5VB 1FNEB 4MJIB 2XG5A 2JB6B 3GSXB 4ONHB 3W0WD 1AC0A 4GUQA 4OFYD 3DOSB 1OM3L 1KPRA 1TO4A 5F1NB 1IVTA 3VFVB 3UTQA 4A2FA 4ZMNA 1BZJA 5D7EA 4I0PB 3OJMB 1A5YA 2W8CA 1IAKB 1ROWA 1BQRA 3ZMQA 2NYZA 1HYRC 3S4SG 1QWUA 2XPZA 4HUCA 5DJZB 3JWNC 3ZDWA 3ZM6A 2Z0BA 4YSTA 1IBZA 5GGRA 3IDMA 3WN5B 2IH3A 1F11B 4PN6A 1IAOA 4MA7L 2C7SA 3V6OE 4H5SB 3MV11 2AQQA 2NZIA 4UQ2A 2F53E 4M8QA 3AXLB 3GMQA 3Q6FB 4C83A 5I17B 3OM3B 4ZO6A 4E41D 4OHLA 2IH1A 3RNKB 4DP7X 1NTDA 2EO7A 2CRYA 1KLFA 3QWRA 5B7FA 4HCRA 4YGVA 2Q8AH 4NWTH 1T3FA 1Y6NR 5A2FA 3DVGB 3QEUB 3DRQA 2XIBA 3ZRSA 3FQYA 3R0MA 2A74B 6FABH 4CVXB 2I3UA 1R5IA 1G7JB 2I75A 1TQSA 4HJTA 5AW2B 4BKLA 3D12B 3BLTA 4M8UA 4TQHA 2YJQA 3TBYB 4OLEA 4DGVL 3WE6B 4X6FA 2GW5A 1J18A 2FJUB 2AJZA 3AU1A 4NAMA 3MZGB 3SYOA 2IDSA 5ANME 1F4YH 5LDUA 1ZV5A 5CIPB 3GQFA 3SBWA 2GSGA 4K3EL 4YSSA 5FO7A 4BK4A 1VERA 2CRZA 2QADB 2CKBB 5IKCB 1INDH 2VZOA 5DWPA 4J27A 3F9BA 4MA1C 5KJRH 2F6YA 1J10A 4FQHB 5LBVA 4QRPB 3I50H 3ZKXC 1KNOA 4M29A 3T0EB 4CMMB 1IVLA 4FTDA 2HG0A 2JELH 1CD9B 1I9SA 3ETBF 3SJVB 4AL8C 1DJSA 2EIEA 1NUGA 3UTSE 2E5EA 1RSFA 1WAAA 2QGCA 4DO6A 5L9DL 5FEBA 1I82A 5GGTA 1U3YA 1MNNA 2TSBA 4QF1A 3BRHA 1OHZA 1E2WA 2DM7A 1E9OB 3NZ8A 1UACH 1QRNA 5IK3B 1ONQB 5B7EA 2G3MA 5GXBB 1SJXA 4M3HA 4F8NA 1B3IA 1FSKB 5F7WC 5IQ7L 1HOCB 2FO4A 3S96B 2QQKH 3VFPB 1A3RL 1FL5B 2HJFA 4FERA 1OPOA 4O51A 3ETBJ 4WJKB 5IW3A 4U33A 3EO0B 3ZE1B 4EI6B 5C97A 2DEWX 4GI9A 2ICWJ 1I7TB 4GE2A 2GC4C 4KQ0A 2AV1B 3NFNA 5A2JH 4M56A 4G2AA 4LCIH 3SDXB 3CWGA 4UWQB 1PF3A 1CFNB 4HAKA 4X4XB 5I2IA 3T3PB 1KELH 5FYKL 2FEDC 3LH8A 4L4TE 3BDXA 3WFCL 4KX8A 1AHWC 2PXYC 4JQXC 2VDPL 1HHJA 2K6ZA 2A6DB 2P47B 1S9YB 2WQUA 4HFWB 1GJIA 1Q94B 3DRTA 5J13C 1AO7B 1TITA 2QQNL 5DK0B 2F6AA 5F6IC 5BS0D 4PRDB 5FYJH 3GXMA 4F7PB 1KN2H 3S5YA 1A5FL 1B9KA 4AVHA 1G0DA 2WO2B 5C0AD 5I1GL 1RQ5A 2VUYA 3FZUD 4AYFB 1KCVL 2GSIA 2VDML 3LN5B 4L37A 3EAXA 1MFBH 2LLLA 1ZVSB 1RZGA 2BDNH 4UBDC 4HJSA 1BREA 2JQAA 2WQWA 4L8BB 5JXAH 4PJHA 3I3EA 2X70B 1P0SE 1GQQA 1N6UA 4WU7A 4QYOA 4ZX6A 2YA1A 1EFXD 1NA8A 4XVUC 4OV5B 2G2RB 1TSRA 5F7EH 4J3VA 2Y36L 1NEZG 3RJDA 4LBEB 4OLXL 1WSST 1PTZA 2FTAA 3HMWL 4NN5B 4LNVA 4LE8A 3QPKA 4UT6L 3T8MA 4AZ8A 4ZW7A 3BVVA 1PKOA 3CHQA 1YPZA 2ZX8A 1GAFH 2VAAB 3J2PA 2NR6A 4GLRH 2AQNA 3TN0B 4BSWB 1VF5C 3VWKA 2ZP0T 4AYID 3QK0A 3IPEA 1N64L 2R69H 3D85A 3ILQD 2VLJE 3K0YA 1EENA 3B7RL 4HUVA 3REWB 2ZOKB 3LPPA 1IIKA 3AG3B 4U3SB 7PAZA 3ET9F 2F7PA 1ZV9A 2B14A 4DAGH 2Y24A 4UNVA 4OBRA 3V7AE 4AJVA 2FK9A 4NHCH 4GG8B 2NNAA 5T1JA 1LQFA 4YDIL 1GGCL 2X89D 3C5ZB 4KXDA 3VQ2C 3VQMA 5I1DB 2ZOOA 2OJEA 1TO5A 2XIIA 4ORGA 3VXOB 3QQNA 2C8NA 3VACA 3VI3F 2NNXA 4AKQA 4DZBB 4AIOA 5I9QB 3IDIB 2VSKB 3CPLB 1ZJBA 4JRLA 4EQ2A 4Z76B 4XNQA 2BHZA 5JXEC 3WHE1 1OHCA 4PRIB 2M83A 2MNJB 4FYSA 1WZAA 2PWGA 3FL7A 4GP4B 3CZNA 1AS7A 4ATWA 5E8DL 1DQMH 4P2OC 4I2XE 3BZFA 1OP5K 1AQKH 4OJFL 3TZVB 3ZHLA 1X9LA 1R3LA 4W9CC 1DTUA 3CM3A 5BRZA 3KXFA 1HESA 1PA9A 3O6LL 3B5HA 5BXFB 3N41F 3QGVA 2VZTA 2J4WL 4M7JL 4R97C 5HI4D 4K71C 2XV0A 4L3AA 3GHBL 2NSQA 2HRLA 2VN5A 5C71A 4NJAL 3SKMA 5LXGH 1QACA 5GS2H 5ILTL 3N85H 5KYNA 2BOBA 1M2VA 2Y3NA 3MRBB 1G9HA 4YDMA 5AG8A 2XTLA 2F1BA 5CN1A 1RZKC 3AXIA 3B56A 1RUKL 5DK3A 2C7FA 1X7TA 2JQZA 3JWOC 5I6MA 4I8NA 3QZNA 1TU2B 5EHPA 4ZDHB 3L3KA 3UTPD 1T0MA 2YAQA 5IB3B 2FBOJ 4NP4L 3SPCA 4Y88A 4FKHA 5F89B 3GSVB 3TBTB 1K2DB 1EEZA 1WIPA 5T1LD 4N8UA 1BBDL 4A2MA 1JPGA 1IFRA 5BOJA 5ID0B 5K1JA 4M7LH 3JZ7A 3ABMB 5IJDC 4LCUB 3QUXD 2EEAA 3FQ1A 5E03A 1HYSD 3NRSA 3MRCA 5IQ9B 2D73A 1N59B 3FQTB 3T04D 1D6VL 1OEOX 5KJ4A 1Q9KB 1D5ZA 1JPTH 4P2RB 3VU2A 5FGBC 2I3RA 3MXWL 1UOVA 5C08A 1B90A 4ELKA 2C26A 1ZGLA 1X5YA 1G6RL 3O41B 3GS0A 3TBWB 2VDRL 2VDQL 1FZJB 3QCFA 1VEMA 3QNYA 5E1AB 4C4BA 4MXVE 2NT1A 2XVLA 5D6DA 1UATA 1XT5A 4OKVB 2EZ0D 5KG9B 4KPHH 5C3TA 3FMGL 2WSPA 4XP6L 1CFVH 2HH0L 3BAEH 1VFBB 5I18H 4YVNA 3QQ4A 2PP9A 4P04A 4AUJA 3DXAE 3H9HA 1L7TL 2EH7H 3UBXB 2I5YL 4JFYA 1DE4B 1XMWA 3BH4A 5IHZB 5FHAH 2EKJA 3MOAL 3C2AH 2CJZA 4WJG3 3NP3A 4J3OG 4BJOA 1F4WL 3RU8H 5IB2B 1ITCA 1URLA 3AREB 4Z78B 3K2UL 3PWPB 3O4LD 5TE4H 5TQ2H 3VB8A 4ZTOH 5HYJD 5CLWA 2Z91A 1Q0YL 5D5MA 2VQTA 4DCQB 2YMXL 2GHWB 3CSYB 4G80B 2BNUB 4ZFZA 3WKPA 1AMYA 1YECH 3EGXA 1CGTA 5DD3L 3DGCR 5CM1A 2ZCLH 4KJYA 4JM0A 1XGUA 3GBNL 5JOFB 4R90L 4WU2A 4GRLC 1JRHH 2OSWA 1NGYB 4MAYC 1WK0A 2OMXB 4PG2A 2QEJA 2TRHA 1S9XB 1J8HD 3L4UA 4XGZB 2JJDA 3DETD 4MMZC 2GJ6E 3HR5B 4Y2DA 4U6VL 2KS0A 2RAMA 2DJUA 1DUYB 5C0BD 2W0LA 3B8SA 5C07D 2F74A 4JFVA 4M5ZH 5IG7A 4NFCA 5EU6A 1CFBA 4TUKH 3GSQA 2Z92B 2PWFA 2DQ6A 4XBEH 1ZA3B 5BUAA 2XQBL 5TK4A 4B9IA 1PDKA 4ALAL 4GBXC 4HLZG 2IH9A 4UNTA 4WEEA 4PB0H 1BMZA 3BKMH 1D7BA 3N9GH 4GRWF 3U2SA 3C5JB 2XTJE 4XB7A 4AQ8C 4XCEA 4NENA 3ULVE 3TIEA 3G6DL 3U4BL 2XACC 4ACPA 2OJZL 2A3KA 3BH8B 3DUUB 1PQZA 3RX7A 4BELD 3FS9A 3MLYL 3TIDB 1S9WA 1YEDA 3RPIA 4WNQB 2PW2B 1PX8A 2FHBA 2R29A 3K6FA 3VYOA 2VR9A 3NIGE 2E4FA 2YD9A 4FQXA 4RMSA 1KOAA 2X40A 3ARGB 4HYTB 3CFDB 1UJ3B 3ZLQC 2RJMA 3NPZB 3ULUH 1MNUH 4O58H 4EF3A 2BZ7A 4NBZB 4C56D 4JFEE 5AAMA 1BFOB 3V0JA 2QSQA 1I9JH 4OHDA 4IJTA 3JV4A 4L8SC 2YUWA 5LGHH 4BUBA 1RK7A 1UA6L 2Z1KA 3UZEA 1YGUA 1E27B 3I6KA 3P69A 3MOWA 4N0YH 1KBVA 3SPIA 4PWHA 3NOIA 2UUDH 3STLB 5KVGL 1L6PA 3FB5A 1A6AA 3I9IA 3CMOL 3WLBA 3PHOA 2WBJC 4MD4A 4U7MA 1CB4A 1NC2B 2ZX6A 1W0WB 1AE6L 2GUOA 4IGBA 4R3SB 3FO9B 5DHYB 4K7PH 4E41B 3ZN6A 1JHKL 4BWUA 1XGQA 4KFZC 3Q2NA 1VADA 2BGDA 5KOVC 1OGAB 1M3GA 4HJUA 4ZPTA 2V3EA 3WKMH 4UOZA 4MJIE 3MJ9H 5J1AB 4O00A 5DVKA 3MJ7A 4IRJD 5G4NA 2EXWD 4ZS7H 3RPKA 1M9SA 5CGMA 4KKQA 1A7QH 4IW4C 5I1HL 5IHUL 3QORD 4IMLB 4QO1A 4R7DA 5ECJE 4HUXA 5AB9A 5L6YH 2A4EA 1T1ZB 3QIUD 4F8LA 5CHNA 3KR3H 4G8GA 4AM0Q 3UG5A 2OFQA 1K3IA 3DV4B 5GSVB 2ZUUA 3GYRA 3X2QB 3QIWA 4CVUA 3UZVB 2R8SH 1O7SA 2D7TH 3EJTA 1XH3B 1P5UB 1RZJL 4I3RH 4NO2B 4QKXB 3SDYL 2R0KL 4O02H 4TM9A 2AJYH 3HB3B 3BQVA 1YMMD 3GBMH 3GS7A 2CALA 1NCDL 1IQDB 4YSOA 1MI5D 1YDPA 4N26A 5AD0B 4YPJA 3ZO9A 1CICA 1YNLH 3AS1A 2D0HA 4MBOA 2FWOB 3M1CA 4R7XA 3VRIA 5LG1A 3LKQB 4IKLA 3DVNB 2VL4A 5JHBA 1UFGA 5M43A 1CLYL 1OT1A 2VDPB 3NEOA 2G5BA 1JZ7A 3K71B 1KENH 3NT0A 3D9CA 4EN2A 5DRZB 1U8JA 4LOUC 1XHHA 1NLBL 1HHIA 4QRTB 1YEIH 2LLGA 1JGEA 2LAAA 3VMOA 3QDMD 4FTVD 3PP4H 2X9ZA 4GH7B 3ECQA 4NQDB 1E6JH 4AGOA 1EX0A 4N8CL 4DN3L 3PJNA 4K8RD 4KI1A 3BD4A 1OE3A 1U21A 3I75A 4TNWK 4P2CG 2HKHL 5EA0H 3TEYA 1TJGL 1QSEA 1ZSHA 3E80A 3QWOB 2DYSB 1ZANL 4ZFOA 1QZNA 5JNYA 4DVBA 4PR5A 4WWNA 1AGFA 5F8RC 5JW5B 4WVRA 4XC3H 2FVNA 1WCHA 1E5BA 2BWQA 1ETB1 3LNEA 1J8KA 1EAPA 4QRPE 4XO8A 4B6ZA 4HV8A 1DCEA 2APSA 3T0EE 1EEYB 4YPGB 1JV2B 2FDBP 4UOW1 1G87A 5LLIC 3PL6A 2R2BB 4L1LA 2Y1YA 4WI7A 2Z31A 5BS0B 3MCLH 2FB4L 4PUBL 3MR9A 4YHZL 3IF1B 3QFDB 1HQ4A 3SBWC 3MLRL 3C08H 5EEVA 1RZFL 3HW7A 5EUKB 3BE1L 5C0AB 4N0FA 2Y1VA 1H5BA 3FCSB 1NGPL 3LHPL 3SDCA 3NIFF 4UDUB 4K8RL 3AADB 2JKTM 2H1PH 3HMXL 3RJQB 1JXKA 2P48B 3JWDC 4DFHA 1L3NA 1GYAA 3ZE1E 1SYVA 2WIMA 5HSFA 4OF0A 4QRUA 2ZCHL 2WLJA 4QY8A 4WUKL 2IFFL 2HLFC 3V6BR 5ACZA 1E7UA 3VRJB 3WGVB 1DN2A 5F0JB 1MFAH 3ETTA 1UGKA 4NM8H 4J3SA 3RKDC 4DKEH 1NGQH 2N7SA 5DC2A 2YEZA 3QEQE 3RWDA 2UWEF 4OGXH 2IPTH 3JXAA 1ZLSH 3UBFA 1A02N 4GO6B 2FJGA 1AO7E 2GFBA 3OKLB 2X4UA 5KJ7E 4X8JB 2NTFB 1XF3B 3L2NA 2QQQA 3B5TA 3GJFB 1EAQA 3DK2A 2CAKA 1VGEH 1IGCL