3V0FA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), form ii
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
337
structure length
331
Chain Sequence
b'GHMKASSNKRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
molecule tags Hydrolase
source organism Ciona intestinalis
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
total genus 112
structure length 331
sequence length 337
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0fA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0fA01
1G1GA 2ESBA 3V0FA 4HJQA 2VEXA 1MKPA 1PTVA 2CMAA 1C88A 1RPMA 2F71A 1OEUA 1Q6SA 4RI5A 2I75A 4TVVA 2BGDA 2QEPA 3ZMQA 1YN9A 3AWEA 1PYNA 4Y2EA 1Q6NA 2QCTA 1G4US 2GP0A 4YAAA 2FJMA 2A8BA 1G7FA 2F6TA 2Q05A 4QBWA 2F6VA 3D1HA 2I6MA 1I9SA 3F9BA 5KAAA 3H2XA 4ZI4A 1BZJA 2J43A 2QCJA 5M43A 2I1YA 2I6OA 2H02A 4PYHA 2QBQA 1OEMX 1SUGA 2H04A 1PH0A 2SHPA 3OLRA 3RGQA 2NZ6A 3EU0A 2QDCA 2HVLA 3M4UA 3ZM2A 2J73A 3O4TA 5KA3A 2B07A 5BUGA 5KADA 1C83A 3BLTA 2CM7A 4OHIA 4HRFA 2FH7A 2OZ5A 1LQFA 4JBCA 4NWFA 2AZRA 3V0EA 1R6HA 4D3PA 3F41A 1G1FA 2H4GA 2CNEA 5KA9A 2I6JA 2F6FA 4NNDA 2QBSA 1P15A 4RKKA 2C46A 3SR9A 4R30A 1VHRA 2Q47A 4D3QA 1QXKA 2PT0A 2BIJA 2F6ZA 3EB1A 4I8NA 3F99A 1LARA 2WGPA 3AWFA 1Q6PA 1OETA 2I3UA 4JMKA 2J16A 2YDUA 1KAVA 4IKCA 1NZ7A 2J16B 2I4GA 4JMJA 3GXHA 1D5RA 1LYVA 4Y14A 1GFYA 4GFUA 4BPCA 1ZCLA 1ECVA 5K23A 2I42A 1PA1A 3PS5A 1L8GA 5KA2A 1NL9A 3RGOA 2BGEA 4QUMA 1G1HA 4H1OA 4RH5A 2CFVA 1BZCA 3O5XA 1WAXA 1U24A 5I6VA 1YPTA 4HJPA 2R0BA 5MMZB 1C87A 1YTWA 5KABA 2FJNA 3V0GA 5AWXA 3RO1A 1YGUA 1J4XA 3D42A 1C85A 5KA8A 4OHLA 4ICZA 3V0HA 5KACA 2OUDA 4RI4A 4OHDA 4RHGA 3QCHA 2NTAA 1I57A 1ZZWA 3MOWA 1Q6MA 2OOQA 2FHFA 4JNBA 4KYQA 3CWEA 4GE5A 1XXPA 4GE6A 3QCLA 3QCCA 5BZXA 1G4WR 1OHCA 4RH9A 1Q6JA 2B4UA 3I36A 1L8KA 5BZZA 2A3KA 2J44A 2P4DA 2H03A 4QAPA 5KA0A 3RZ2A 1FQ1A 2IMGA 2OC3A 2YOCA 5J8RA 1ONYA 2J71A 5K24A 5K9WA 2BV5A 2CNHA 3CM3A 3ZMPA 4ZRTA 1BZHA 4AZ1A 1I9TA 2I5XA 2VEUA 3EAXA 1T49A 1GWZA 2J17A 2H4KA 4WU3A 3V0DA 1PTUA 3D9CA 1EEOA 4WTYA 1A5YA 4DGPA 4B04A 1M3GA 2GWOA 3I7ZA 3F81A 2CM3A 3A5KA 3QKPA 1OHEA 3QCNA 4NX8A 4GWFA 1YZ4A 1Q6TA 3BLUA 3S3FA 3GXGA 1OEVA 1XBOA 1YGRA 2CMCA 4YR8B 3V0IA 2CM2A 2DXPA 3EZZA 3MMJA 4QUNA 1XXVA 1AAXA 2BZLA 4D3RA 2CMBA 3LJ8A 5IBSA 2YA1A 2NT7A 1ONZA 2G6ZA 2HC2A 1U25A 3QCIA 1Q1MA 2FHBA 2B49A 1OESA 2FHCA 2ZN7A 4QBEA 1YTSA 4Z6BA 3S4EA 3N0AA 5EHRA 4NYHA 2PI7A 4PVGA 1OEOX 1YFOA 3QCBA 3BRHA 2HB1A 2NT2A 5KA7A 3QCMA 1JF7A 1NO6A 2PBNA 2NV5A 3QCGA 1EENA 1JLNA 1G7GA 2H4VA 2VEWA 2I4HA 2MBCA 2QBRA 4RDDA 4S0GA 1PA9A 1X24A 4GRZA 2HNQA 3ZM0A 2F70A 1QZ0A 1NWLA 2CNGA 2E0TA 3S3KA 2F46A 1WRMA 2G59A 1PXHA 2Y96A 4GFVA 2CJZA 3I80A 2VEYA 5IBMA 5KA4A 3O4UA 2C7SA 2QDPA 2I4EA 2HNPA 2F6YA 4GS0A 1T4JA 2B4PA 1NNYA 2QDMA 3BM8A 2HY3A 4ERCA 2HXPA 2RF6A 2GJTA 3D1QA 2PQ5A 2I6PA 1FPZA 3B7OA 1RXDA 4GE2A 2B4OA 5BX1A 2HCMA 3S3EA 1YTNA 1PTYA 3S4OA 2Y2FA 3OMHA 1C84A 2JJDA 4R0TA 2CNFA 4ZN5A 2AHSA 4DGXA 1C86A 2M3VA 3NMEA 3QCDA 2HC1A 3EMUA 3V0JA 1ZC0A 3D44A 4KI9A 2CNIA 3ZM3A 4NWGA 4WOHA 2ZMMA 5K25A 3O3LA 2PA5A 4GRYA 2B4SA 1NWEA 5K22A 3QCEA 3S3HA 5GTJA 3AWGA 3SMEA 3QCFA 1YWFA 4R0SA 3F9AA 5KA1A 1V3AA 2QBPA 2B3OA 5EHPA 1FPRA 3QCKA 4OHHA 4MBBA 2I6IA 4QAHA 2F6WA 2CM8A 1ZCKA 1U26A 5HDEA 1WCHA 4J51A 2PSZA 2NLKA 2J72A 4WU2A 2P6XA 3ZV2A 4OHEA 3QCJA 1XM2A 4BJOA 2VEVA 5LXQB 3U96A 4KYRA 1T48A 1KAKA 1PTTA 1XRIA 2I3RA 3A5JA 3ZM1A 1OHDA 4H34A 5K9VA 3D1OA 3MOZA 3QKQA 3O4SA
chains in the Genus database with same CATH superfamily
5A2KH 1G1GA 3JWNH 1UEYA 4YBLB 1GYCA 1XGRA 2X4QB 4QXVA 5FUOL 3L6FB 1EANA 5DK2A 1MKPA 1U95B 4WEUD 4HJEA 5E1HB 4F9LA 1I7TA 5F7KC 5CJXA 2GAZB 2E7LC 3RVXD 4LLDA 1KIUB 1UCTA 3AQDA 2H6PB 1JD9A 3M86A 4RMUA 1UCBH 4YIQB 3S0PA 1NH6A 1J10A 2MNJB 4P9HH 1HU8A 3NSJA 3MDJA 1Z3GL 4YSEA 2E7HA 5I6MA 2ROYA 3F04A 3D9AH 3LMJL 2A8BA 2FVNA 3EF4A 1PX8A 2A4ZA 4HIPA 5I30H 2NX5A 4BK5A 3FQWB 4Q74A 1D5IL 1PNCA 4M56A 4HGMA 5AWNH 1DSYA 2C9VA 4EI6A 3D1HA 1N5AA 3TEZA 3U2JA 1MH5A 2FX7L 2WJPA 1IEBA 1UVQA 1Y0LA 5TD4A 2Q2LA 2W92A 3AB0B 3C60C 4PD4K 2R8SH 5KN5B 5AB9A 4OM1H 3SD2A 3WIIL 1OP9A 3BGFC 1UADC 3EYFB 3FMGL 5DMKB 1AQHA 2D8KA 4FNRA 5EU3A 5HJDA 2GUYA 4RGMB 1I75A 3PAYA 4KXBA 5F7LB 3FONA 1XSKA 3ZM2A 2Y2WA 4GRWB 4NQEB 4PB9H 3PF2A 1SDAB 5HHOD 3C2SA 1G7MB 4KK5D 2HUEA 4KZCA 2WGNB 5BUAA 3OAZK 1UENA 3I74A 3DPDA 3LNHA 1TF4A 3Q43A 2AJZA 3KYMB 3P9LB 1JGEB 3PL6D 4KDVA 4RCAA 4RLDA 1DVTA 1WT5C 2NY6D 1GW6A 2CD0A 4D3PA 2XXCB 2FT7A 2V6HA 3IJ7A 4NKOB 2OZ4L 3IFPB 5EU6E 2NPLX 5CD3A 4ZFOB 2WWMC 1X5HA 3ZM6A 4PJCB 4JO1L 3KPMA 2A6KA 1VHRA 3K4DA 2DWEA 4GNKB 4CAGA 2LABA 2BOCA 1I85C 5IEHA 1TQVA 3ERXA 4RZCB 1XMWA 1A25A 1DSWA 1P0SE 2LR4A 2JE8A 5EULV 2OCJA 5HYJE 3QUKA 3RFZA 1D7DA 4LU5H 1RZPA 3WNJA 1QFWI 4CSPA 5AYUL 3H4FA 3OAZH 4B3EA 1P9MA 3AWFA 3CD4A 2QV2A 4Z7UF 4Y5VB 3O0RL 5K1NA 3GNML 4YHPB 4ZFZA 1G9NH 4ODXB 5F9OH 4L0ZA 2FD6L 4IOSD 4R4ND 5IFAH 1QFOA 1OT2A 4OFYA 1IBFA 4CVWA 3B2VH 1TETL 5I1GL 4OLWH 3BIBX 4YDLC 1JJUA 1UM4H 3KE0A 1LO2H 2Z4QB 3VD9A 4F7PB 1WG3A 5DZ9A 4MMZA 4NUPA 4B9IA 2I42A 1A65A 5IB5A 4LARL 2C34A 1IBBA 4BCYA 3PS5A 3T2OA 3LKSB 2NY5C 3WNIA 4XXWA 2FQEA 4XMTA 2VISB 3ARUA 1ORQA 4HLZG 3DV6A 1ZDSA 5F88A 1TZHB 1SJHA 2YRBA 3U48A 3HFMH 4MHHG 1ZOXA 3WLWC 1U8PA 1EERB 5AALA 4BDVB 4XMLH 1UXWA 1BWWA 2AVGA 4GRLA 5JW4M 2GJ6B 3E8UL 4KV5E 4UYQA 3DARA 4A63A 3VRJB 1NGPH 3DJSA 3P4NA 4KK6C 1YUHA 2EQDA 3LRLA 3NJXA 2IAND 4J3OH 4JQVA 4ODTL 3QR0A 2Y1ZA 2F19H 1ZANL 5K9OB 1EA9C 1Q4NX 1ZRUA 4ZAKB 2Y69B 3GGWA 5GIRA 1WZ1L 3MLUL 2F5BH 1A2YB 3MLRL 4ANVA 2VMEA 3BP4A 2H32A 4EI5A 3ZE0E 1WH0A 1Z6JT 1J87A 3SDCC 5ITBL 4AENB 5JXEC 1CICD 1IEAB 1S7SB 2JI2A 3BAJA 4M6MH 5DA0B 4ZUUA 3DA0A 3ILQD 4GG6B 4BKSC 3UTTA 3HZ3A 3NJMA 4MMXB 3L2LA 5EZLA 4NQSB 1NGZA 1CT8B 2PYEA 4AV5A 3T4YA 1U9KA 4C56B 1M05A 3BGMB 4FZ8H 2FJFA 1MQKL 4I85A 4I3SL 4U1KA 4ALAC 1G4RA 2ESVA 4H0GA 4XBGA 4S11A 2EE6A 1XXPA 4K7PH 3LEVL 1RIUL 2XUWA 4J23A 4TF4A 5DF0A 5DZJA 1G4WR 2VE6A 3F6LA 3I36A 1ZS8A 4HAGA 3N85L 3E9TA 3TH4T 5C0JB 3MODL 1CFTA 2DWTA 1IGFL 4FXGB 2P4DA 1IAKB 1P9MC 5E6YA 3PP4L 3TEWA 1KOAA 4ODUB 1VJSA 4Z76B 4ZFFA 1NJ9A 5AL8A 4J3VA 2QLVB 4PJFA 4IQHA 1HDMB 4ZDHA 4ORZC 3QQ9D 2D73A 4U6YB 3RWHB 1KIPB 1PZDA 3MC0A 1OAQL 3B9AA 1CGVA 1EEZA 1U8JA 3G5VA 3KYKH 2IFFL 5C08E 3P4NB 2DQIH 2R1YA 4CADB 5T1KB 2UUDH 3CFBB 1ZHLA 3CM3A 2YLHA 1BD2B 1MCOH 2ERJB 4GFTB 1AS6A 4YSRA 4BGLA 1MUJA 4EAEA 5HXMA 3QI9D 1F0LA 3M46A 1NQBA 4GG8A 3S36H 3UBXG 2XACC 5IB1B 1MRFH 5IVXE 1TLMA 2V0AA 3S3DB 5F0LB 5I5JA 2E4TA 1KYFA 2H32B 3HNVH 5C0IA 4D8PB 5KS9E 2TRYA 3D2UB 2OMVB 2WN3A 4LSQL 4ORGB 5JW5B 2D31B 4NZRH 4BM7A 2HTKC 5AAMA 3AY2A 2XZQH 1JBWA 2D3NA 3A5VA 4ZUTB 1K5WA 4QRSB 1R3JA 1IC1A 4TSAL 1QVOB 1SEQL 4ZQKB 3ATEA 3JUYA 1DQLH 1DDTA 1VSCA 1DFXA 5J6HA 1JPFB 1D9KA 4XN4A 1QZNA 4WW2A 1KWGA 2A7BA 2C7UB 2DTML 1KYOK 3AS0A 4LDLB 4N8VA 4PQXA 5KZCD 4HUCA 1TVBA 2OR7A 4O02A 2P9RA 1RK0A 1XBOA 2P45B 4OZFB 1AO7A 3AAZB 2GW5A 1A7BA 4MMXC 5E2WL 3KJ6H 4FJYA 3E80A 2DXPA 5CINH 2WINA 3ILDA 2HWZL 2WKGA 3BAYA 2CMBA 4N2CA 2FX9H 4HGWB 4MQ7A 1QSFD 1R5VB 5D5MA 5JQ6L 2NT7A 3QUZC 4G8GE 1ZTMA 5C8JB 4ZDHB 1BQLL 3WHE1 5E5UB 4CL7A 1ZPLA 1S5HB 4ZMWA 4NQVB 2N7BA 4G72B 5FUZH 4F37F 3KL0A 5EEUA 4AH2A 1BQKA 3B1UA 5DC9B 1E67A 3VD4A 3WXWL 5AVXB 3T9WA 4ELMB 2V17H 4FNSA 5EFIA 3S36X 2FWSA 3EHBD 2VTDA 3DYOA 5DRWA 4Y5YA 4KZDH 3NIGE 2P24A 1FO0H 1R5IB 5IJDC 1QASA 2EC9T 3ULVF 3CN0A 1DVFA 2E76C 1WA0X 3FQ4A 1D2PA 3QEHA 1HEZA 4LIQE 2MKLC 1ET5A 3MOBL 1ZK9A 2Y07H 4JG1H 1VDGA 4XNAA 4L3EA 3VXQA 1UT9A 1EENA 1G7GA 1F2XK 4LSSH 2C3VA 3PIQA 4YHOL 2MBCA 4HJ1A 5F1KC 5A5EA 1Y18A 4CDGC 4DZBB 4S0GA 3H7LA 5E99L 1IVTA 5DHYA 4OUUB 4HS6B 1VEOA 1CS6A 4FG0A 3ZM0A 2AJUL 1ZVSB 2QQLH 5L4JA 1T04A 3W1ZA 4UAGA 4MXQC 4XXDA 3ML9A 5GS2D 3LZNA 4PLOB 3LXCA 1KB3A 4PCSA 5KOVC 1K5NB 4QF1B 4KK5C 5CZVH 3R8BB 3WTSA 3IAPA 1DN2A 2DPKA 4X8JB 3N6YA 2ORBH 4L4VD 2AQTA 4HT1H 4OCRH 4XNYH 2A83A 4D3CH 4J12A 1FCCA 3N40F 4I2XB 5CNHA 5FHAL 2CJTA 4PGCA 1F13A 3E8VA 4UM8A 4ONFH 1ADQH 4XN5A 2UXFA 3ARGB 3F7LA 4F33A 3DYPA 5DXWA 3TASA 1K6QH 5D96B 2XVKA 3T2NH 3H54A 4Z7NF 4A6YH 2VABB 1CL7L 4FQXC 3X12A 2X0UA 1AP2B 3SE3A 4Y4HC 3TJEL 3CSYA 1RLBA 3US0A 1FYTD 3O6FB 4CDHA 1WFIA 2PQ5A 2HVJB 5EIVA 2XYBA 4MVBC 4XP9L 3OKNA 1GY2A 1JZHA 1JMZA 3C08L 3HB3B 2OMTB 4WV1C 1XL4A 5CR8A 3S3EA 4HALA 5DJXA 1KTCA 3KPQB 2ATPB 2PNDA 1UASA 3L9RA 3NP4A 2Y2FA 2VM9A 1XH3B 3V4VH 1ZTXH 5EPMA 2Q8AL 1NGWB 1KLUA 3FB7A 3GB7B 3N9GL 2DLFH 3DDFA 3Q6FA 2Y68A 2OMXA 4L9LC 1G7HB 5CLYA 4MJ6B 5D7IB 4M93B 4XO5A 3FO9B 3F83A 4PV8A 4ZRGA 1IC0A 1JPGB 2BSDA 1SYSA 2QPDB 1KBWA 4OJAA 5TF0A 1T83C 3X3GH 4WJKB 3PQYB 1ETB1 2I7OA 3MXWH 1OPGH 4ZXBB 3WMPA 5HBBA 1TMQA 1M56B 2BHYA 1KDJA 4GI6A 2A77H 2G5UA 4QNPF 4OBSA 1QG3A 1E2WA 3QZWA 3DDGA 3CFTA 3FO0L 1KJVA 3OXSB 4KQ3H 4WJ5A 1TYRA 5HJ3B 1NWEA 4L3ED 3LEVH 3MTRA 4Y7OC 2Y36H 4GJTB 2UZYA 3O3EA 1Q94B 5JZ7C 3PWJB 1BEYH 3MRPA 1RURH 5ANMB 4R0SA 2WXRA 2QBPA 2B3OA 4EMZA 2OMNA 5FOJA 4FQIL 3Q0HA 3NSFA 4ODVH 3MFFA 2XU9A 3MKGA 2AJSL 3ROOB 2CA3A 4BZYA 2I6IA 1WJ3A 1NBVL 5CIPA 5EU7C 4XPTH 4U6HA 5DQ9A 5IB3B 2Z35A 1FAIL 2GIMA 4PP1D 4JVUA 4KY1H 4PJEF 1JNHB 1WCHA 1JZ5A 3MJ6A 4FNPA 3OHXB 4WU2A 4N2KA 4YHKL 4G8IB 3WS6C 2R29H 4RIRA 3S37L 5BCAA 3K4AA 5IHLB 1HSBB 1Y6MR 2N1TE 3WEAA 5JW4N 3FKUS 4PJ6A 3QUXD 1OW0C 4U1SB 3V8OA 1ORSA 5DTFB 4A2MA 2VQ4A 1MJUL 4XH2A 3VE0B 1YEEH 4HFWB 2HX8A 4NFCA 3WJLA 4UWQB 4DK3A 2BVOA 2ZNXA 2HFFA 3PABA 4HK0A 1ZGLB 3VFRA 4DK6A 4OFDA 4R4BB 3ILPB 5EDXA 4Q9RH 4K9JA 1WIPA 1YHPA 2F8VA 1G4MA 3CVIL 3VX1A 3MOZA 3BGFB 5I1HH 2WMPB 4XNQB 2BNQD 3O4SA 3TZVA 3EYSH 2ICEC 4WI3A 3JVFC 4LCWD 1QOKA 3G6DL 2X41A 3KR3L 4LLVA 4Y9FA 4F2ME 4LCYB 1P2CB 3L4TA 1OOAA 3AB0C 3DETD 1P5VA 2R27A 5GRVL 4R3SB 2NY1C 4HZAA 4TVVA 1X5LA 2WXOA 5F7AA 1DQTA 5TE4H 1BFVL 5FO9B 4K23H 1LK3L 1EMTL 3UTSB 1J11A 5EEYA 3WFEL 3Q8BA 2A6DA 4HIEA 2H6OA 2JJSA 3W82A 3CLFH 1UH3A 4MS8C 4GRMB 3BESR 1F41A 2JELL 4WK4B 2EEXA 1T5WB 2FH6A 3IDGB 2XQYG 4DGIH 4LKCA 3QDAA 1KXTB 1TQTA 1XCXA 3GLAA 4PFEA 4BQ9A 2PETA 3L3OC 3OHXA 3QNXB 2GCYB 4YXHH 3SDDB 5FEBA 3MLYH 4NO5B 4NYLA 3QI9C 3BIAX 3RVUD 4YDJA 2VERN 2EDNA 2OMBA 3C6LB 3ZZLA 3IFOB 3RNKA 2KZBA 4QHUA 4XAWH 2YRLA 1BFOA 5EZOL 3VRLE 4QRRB 4B9KC 4NAMA 5F6IB 4CVLA 1XGTB 2GAZA 4XWOC 3U0WH 1S9WA 4LLDB 3RPBA 3ZDWA 1JI2A 2NY3C 2QMKA 1SUGA 1L0PA 4F8QA 4PW3A 1HQ4B 1SM3H 3OLRA 4POUB 1QBMH 1WS8A 3A4AA 4PN6A 5FYLE 3WY3A 4R7NA 2HVLA 4GS7C 4L0YA 1ZA3A 1H3GA 2D7MA 4JB9H 4DP9X 2DMKA 5KA3A 3O3UN 4ANUA 1BIIB 4NN7C 4QY8A 4JPIA 4NC1E 1P1VA 5B8CA 1U93A 1A0QH 4EZMA 4NXSA 1N3NB 1FSKC 2VRKA 3L4CA 4GY4A 3ZYZA 4NWFA 2YXVA 2IGFH 4GXVH 3QDJE 2J8HA 1QEWA 1LNUB 3IXTB 4YSOA 4PJHA 4MD4B 1IM3A 3UG4A 4ELME 2XRAH 1G1FA 5JOPE 4OSUH 4GRLB 3B56A 3OG4B 4HC1L 3ESNA 4LPTA 3T3PE 1CYGA 1DJYA 1XB6A 1KN2L 1G1KA 1CIDA 1QTSA 3VDAA 3SR9A 4R30A 4PRIB 4P49A 2DZEA 5JUEH 3BAEL 4ESKA 2OX5B 1KACB 1W72H 1G7IB 1U4FA 2MSPA 5ALBH 4CC4A 2V7NA 1I7ZB 4FQPA 1QXKA 4UF7C 1PSKH 3RX9A 1FN4A 2NNAB 3KW7A 1XXFC 1YNTB 5IMLA 3GZKA 4NO5A 4NYLB 1P4LB 4IU2B 3SPIA 4ADGA 1NEZB 1JCVA 3FFDB 4LESA 4K5NA 3BN9C 1B0GB 2ZOLB 1RHHA 4KTEH 4JO2H 5C0BE 4OTXL 2NQDA 1A1OA 2WO4A 4LSVL 2R0LL 3SKMA 1CT8A 1E5YA 2B39A 5CSGA 1D5RA 2EC8A 4GOSA 3T4AB 1G7LB 5EU4A 1OTSD 3X1NA 5K23A 3FO1A 5JA9A 4CBZA 2VDOB 2C1OB 3C5SB 3TIEA 4NGHH 3VFOA 1PAMA 2IVFC 3V4VL 1OT1A 2ODHA 3RGBA 3LH2L 4R84A 1YUKB 4WF7A 4YVNA 2F1BA 3RGOA 4B9GA 4RZCA 5I1LA 2CFVA 2IPUG 1IQDB 4YNYA 1KLFA 3R18A 1JF1B 1NCUA 4MSWA 3VXUE 2NLJB 1U24A 1J9TA 3BKJH 4TSCL 3RJQB 1J5OH 5FYKD 4HJPA 2LLLA 3EBHA 2E9WA 2F6AA 3B4NA 4I18A 5T3ZL 4GKSB 3S4SB 3FBQA 4Y1AE 1T22B 2WLIB 3P4MB 3MV11 1T6VN 3K81A 3UIZA 3UX9B 3UACA 1EAQA 1SDYA 5SWSA 3B2UD 4WKZB 5C7XH 1UTDA 3HB3D 4WO4A 1AXSB 1ND0A 3PV6B 1KTLB 5FOBB 5DUJA 1BWMA 4M7JH 3R7RA 5C1MB 4Z7QE 4ODSH 3KGSA 2VZ3A 2WZAA 4LLAA 4N24A 2CKBH 2HJKA 2XZQL 4RA3A 5TE7H 4AV4A 3HE6C 1E27B 3QUYA 4IBUA 4TQEL 4RFEB 3R7QA 3S8WA 3VMNA 2EADA 4EIGB 1HKFA 3A6OA 3H9ZA 2QDWA 3VXSA 3K1KC 3WE6A 4ZQKA 2X53A 1F42A 2RTTA 3VFSB 2J6WA 2A73A 4UQ2A 4MAZA 1OIOA 4W9GC 1UHVA 2NY4B 3L7FA 3GSQB 3ZUNC 2EDHA 4GE6A 3F6JA 5EUOF 5BZXA 5HHQB 3LH9A 3MV7B 4FQLL 4HEPA 4JN2B 1G9HA 4MJ4A 1O9ZA 3NFSH 3DBXA 5I1EH 1HZLA 2ZXDA 5MI0B 3TBYA 4NCC2 2K6WA 1AGEA 3OJDB 3G5XB 3NN8B 5B39A 1MFEL 3K6OA 5FCUL 3NEXA 3UAEA 2D3VA 2P5PA 2XFXB 4KJPD 3ZIYA 1EX0A 4ILDA 4Z77A 4L1DA 1X4XA 2G0KA 3RZ2A 5TQ0H 4BK8A 3EYSL 2QZ5A 2A6IB 2M2DA 4ZOEA 1QFHA 3MGOB 2ENYA 3B9KD 5K9JL 4XXDB 4R96A 4HIQA 1AXSA 1ND0B 3D2UD 4YAQB 4A2LA 4ZMLA 3QPQD 1LP9E 1FO0L 5D7SH 5IW6B 2OJEA 1RD6A 5LCVA 3VB8A 2CUMA 1KELL 2OS7A 4QCIA 2WWMD 1A22B 3AREC 4WFGD 4WUUB 3MRQB 1EDQA 1TEFA 4MJ5B 4GT7A 3D9CA 3M45A 2R1WA 3T1FB 1QAWA 1P6WA 4WU3A 2YN5A 1AMYA 4ATWA 1UWXK 4C56E 2XG4A 5FKPA 4Z8FL 1DTUA 3UPRA 3NSYA 3KCPA 4PJEA 2JELH 3K0YA 1ZLWK 3X14A 1IFHH 4UOQA 4DWHA 5C3IA 3HN5A 4L2LA 4NJ9L 4RGOL 2ZKXA 5ITFB 4GWFA 1TJHL 2DBLL 2A1WH 3FQXA 4NZUL 4TQPA 4NHCL 2DN7A 5TQ2L 1SN0A 4OBRA 1QABA 2Q76B 2IQAB 1S8DA 1OWWA 2WUCH 5SV4A 1C8PA 2EICA 1DCEA 4HV8A 4P2CG 5EZOH 1KLGB 3TIDA 3WGVB 1SMOA 4WW2C 5IESH 4M48H 2B20A 1NM9A 2BSED 2CMCA 3O4LA 3QZBA 4JDTH 3U82B 3VDCA 1VFBB 5LLIC 1F8TH 4LVHB 2WWOA 4WWNA 2G4EA 2YUZA 3FRUA 3L08A 3UC0L 3CMOH 4MXVE 1W0VA 3MCYA 4S1SL 4LSUH 1ONZA 2O61A 4JHBA 2G6ZA 4X7EC 1R5VA 3FO9A 2X2JA 4GQRA 1IGIL 3SE6A 5A2FA 1MFCL 3C5ZA 1A0QL 4QDIA 2I24N 4KKPA 1EQWA 1Q9LA 4PRNA 3ET9F 5FKAB 1PQZB 3AS2A 4K3EH 5KANI 2PMZA 3V52L 5FAAA 3RFRA 5I1AB 4KHXL 3ZLQC 1YMME 1KPUB 5DS1A 5EUOA 5K93A 2OP4L 5EHRA 2O6FA 3KLAB 3D51A 2VW4A 4UOW1 2MTAA 1HINH 5A43C 5DRWB 4Q6IC 3G5YA 3QCMA 5F2FA 2PPDA 1JF7A 2PTTA 4P23C 4Y4HD 1RJZA 1L0YA 4HZLB 2K4WA 1JNNH 4J3OG 3G6AB 2BOLA 2ID5A 3MBWA 3NZ8B 3QCGA 3O3AB 3Q05A 5KYXA 2I9LB 3CDGB 2ZSWB 4GSRA 3QYCA 2NDGA 3QDMA 1YEIL 4XX5A 3AACA 4NQVA 2VQ1A 2QPUA 3PIQB 1X24A 3U0TB 1I85A 1P6FA 4NM4H 4OCLC 4OTXH 4KX7A 4GW4B 3NSXA 3MJ9A 1KFGA 3PQYA 3U30B 4XI5C 3GINA 5FLUA 4F8LA 4HEME 1XD1A 3PWLA 4YSSA 1BA9A 1AXTH 5D1ZD 2VT0A 3HHRB 3T77B 2TRHA 3LY6A 3SDYH 4APQD 4QRFA 1TFHA 4Y5YB 2VDRH 3ZDYE 4OLYH 2PTUA 2VEYA 3QFJE 2X10A 2WXQA 1EGJA 3HC3H 3TURA 3FPXA 1Q94A 4K3GA 4OT1L 4FYTA 2RH0A 4MAYB 5K39B 5AOKA 3WHXA 4G1EA 4WY7L 3WEXA 3ECBA 2DQUL 3T5WA 1AQMA 4K07A 3BZEA 3CJJA 1G0YR 4K7PX 1PZAA 3EH2A 3A6BL 3LQZA 1BOGA 1SQ2N 4Y5XA 4E36A 5ECGA 4L5FL 5KVDH 4U1MB 1ZLUH 1C5DA 2WLYA 4IOIA 2VYRE 2HTLC 4YFEA 5GGTL 3MRCB 3TPKA 2PWHA 3MRRB 4DPAX 4CVUA 3SQOH 3MCG1 5D5ME 4Z7UB 1U3YA 4M7JL 4ZUVB 4A2FA 4ODSL 4MAYD 2XWDA 3VD2A 5E00A 1CLZH 4Q9RL 1Z66A 3KPQA 3NBNA 4AYFA 2GEEA 4F8OA 2XV2A 1E8ZA 3MRIA 4TNVF 3QDMB 2GSIB 4XC1L 3T8XB 3U46A 2O26U 3OKOA 3BQUD 3S7GA 4LU5L 3JZYA 4D0CB 3CZUB 1NCOA 1TLKA 1FC2D 2OLDA 5HVFB 3MACH 1FF5A 3MRKA 2K3HA 3KCWA 3GSUB 4GXUN 1HHGB 5EO9B 4MX7A 2CO4A 3GNMH 3QZOA 4YN3A 1N19A 3GRWH 4PLKD 4GRYA 1QHQA 3I6KB 4CUCA 2IDQA 1KPVA 4HKZA 4N90E 5TE4L 1BFVH 5TDPB 3QQ4A 5D2NA 2NY2C 3WTYA 5LCVL 4Y2NA 2VAAB 4CNIA 4Y19E 3QCFA 3F9AA 5CFAA 2BP5M 3VWJC 2QQKL 4S2SA 5JDJA 2GEQA 1HX0A 3DIVA 1KB5L 3D18B 2GUOB 4OHHA 3QO1A 2GJRA 3O9WC 1GPOL 5CSBA 4WV1A 3ETSA 1I3GL 2FYVA 1DQQB 2Q8BL 1BP3B 1MVUA 3SE9L 4J3OD 4EBQH 3V6ZA 2P6XA 1TTFA 1SYVB 3ARWA 2DJSA 4YDKH 4OI8A 1QFUL 5HGDA 5PAZA 2E9GA 5DJDA 5I1DA 4Z7UA 3ILEA 4ZUVA 4EN2A 3ZL1A 1MCQA 2GSMB 2DQMA 3HE7B 3F6IA 2GSIA 5DLMH 4FRWA 4JDEB 5J8OA 1I7UB 1AHWC 4ZD3L 3LRGA 3GM8A 1TJGL 3K5SA 5DZNA 4IU3A 5T1LB 4NWTH 4BFBD 4GXVL 3CLEL 3N44B 4QAWA 4HWBH 3QCTL 2VDKH 4FA8A 2R2BB 3I9GH 2AJ3B 1MCCA 3AXIA 4RX4A 3D4YA 3NJFA 4DHLA 5JIHA 1UH2A 4KPHH 2HMIC 1ASOA 5KSUB 2ERJC 1N5YL 2F71A 1UCBL 4GKZB 5AW4B 3VYOA 3EFDL 4MMZB 1QFWM 5JUEL 2AZUA 3BAEH 1L6PA 1EEHA 4JPQA 5MEQB 3ATDA 1RPQA 3D25B 1UB6A 2WC7A 2XTJB 3EGXA 3D18A 2B59B 2ZUWA 5JW3L 2NX5B 3AT9A 4N5UA 4AGOA 5KJRL 5LGKA 2D2CC 3EUUA 4MJIA 4X5WB 3UTSE 5C09B 3UGUA 1OM9A 4DKTA 2CLVA 3KYAA 2BSBA 1MFCH 4KTEL 1E9QA 5DJZA 4YJZL 1YNTF 3U79A 3ARSA 4BWUA 2ZPKH 5T1DH 1MNUL 5J1AA 2N1KA 2VLKB 1I7RB 1AD0A 2QHRH 5J89A 4YDJB 4UT9H 1XIWD 3FQNB 4N90D 3PV6A 2IANE 2H1PH 2H02A 5CZKA 2W07A 1OKEA 5IHHA 2CA4A 2RCSL 2P8PA 4XP4L 1E4XL 2C9XA 2D7TL 4JE4B 4ZS7H 5LGHL 4ZO8A 2JV6A 2NZ6A 4LP8A 3QZNA 3BLKA 2WXPA 2AVFA 3MV9B 1L3NA 1C16A 1A6ZB 1CJYA 1OT4A 4NC0B 2AW2A 2CCLA 2ZNWA 2WANA 2BHFA 3MV7D 5L0QB 3E1F1 1C83A 5K9KB 2JKIS 1HHJB 4N3TA 5JPNA 2E3VA 3IPEA 1ZT1A 1AJ7H 3GMMB 5KVFH 1DJZA 2V33A 1WF5A 5FYKH 1GW0A 2YKLH 4HPOL 1T4KB 4P57B 4S1QH 1XMEB 1FZJA 3DO7B 4P3WA 1CI5A 3WEBA 2K1MA 2QTVA 1MH5B 1RL1A 5HGHA 3I75B 1KY7A 1D5ZA 1SXZA 5JR1H 2Z4QA 2I6JA 3OWRA 1S7QB 2A6KB 4ABWA 2H2PD 4TPRH 4CRPA 5KN5A 4ZFOA 2GTQA 1A7PL 3MROB 5D4JA 5DEJA 3VQ1C 2D0FA 3GO1L 5GGSA 3B9KC 2FX9L 2BRQA 2XV6B 4O5LL 5BV7L 4GIAA 5AKSA 4W6YB 4H1LB 1HOCB 4LMQE 4N2MA 5CJ8A 5KBMA 4YFDB 4UOZA 3SO3B 3AABA 4HULB 1E4KA 2RFXA 4PJGE 4FA7B 4FADA 4D2NA 2GJ6A 1MVYA 2XA3A 4WTZG 1H9DA 2ITDA 1URIA 3B2VL 4AIZB 2IGTA 1LMIA 2GFBB 3EOBB 4LNRB 4MB4A 1G9NL 4PWIA 1S9YB 2J1ZA 3OZ9L 3IU4H 4TRPH 4MJ5A 2EEAA 1BX2A 1E43A 2B15A 3B5TA 2H6PA 5D7HA 2BINA 3LDBB 3VWKD 2VISA 4AUYA 1DZ0A 1L8GA 1J8HE 1GQYA 5FB8A 1JAEA 3EDDA 4K7FB 4P5RA 4A66A 3KAAA 1D5MA 3HE7D 1A6TB 4UIMB 3QWRA 4MZ2A 4P3DB 1YNKL 3IDXL 1OP5K 1G1HA 3TL5A 4W4OA 2EEBA 5FYLL 3QJHA 4O2FB 5DGQA 5KVGE 3NRFA 1MHPL 4XBEH 2OCFD 2IALA 2UAGA 3T4YB 4IHOB 1JUFA 1C8QA 4C4KO 3ZE1F 1U8OB 1BVKA 5TK4A 1PZUB 25C8L 5EORL 1D5ZB 1QFPA 3BSZL 1IBDA 2GSGA 3GRWL 4ODTH 4QDGA 4H8VA 5IMKA 4ZYKA 5LG6A 3J8F7 4AV0A 4OM0H 1SF5A 3E8UH 1FVEA 2LTQB 3HNSL 2NY3B 3D42A 1F1GA 2HA1A 2A4CA 1T1XA 1FLRH 3OGCA 5KA8A 4Y4FB 1W72A 2JB5L 2VLRA 3N41B 4P2QE 3T4AA 3UTTE 4AEFA 1CDCA 1W0VB 1NCHA 3WI9A 3GGWB 4OI9A 3BUTA 4JDVB 7CGTA 4M8UA 2YBRA 1I1CA 2E9BA 5AZ2H 1CG9B 4ZW3A 5IHZB 3A3YB 1RIHH 4FG2A 1MSPA 3WSQL 2X4PB 4FLRA 4LT7A 2WUCL 4MSWB 3ULUE 4UQ9A 1GGCH 1M6UA 1ZWIA 1A7NL 5IJCC 1ZVYA 2KZKA 1NCBL 3V0AC 2ZX9A 1T2QH 1OOWA 4BUHA 2IXQB 1G1CA 3ALXA 3BWUF 5IESL 4M48L 5CZXD 4PJ7E 3WE6B 3QUXA 4X4XA 3BGMA 4XNXH 4JPWL 4WI6A 4MQXD 1LD9B 1OHCA 2IBGA 1AC0A 4BRJA 2HMID 4BHUI 2PO6B 1U8HA 1LO4H 2VLJB 1H0DA 4F3FB 4U1JA 4BFJA 1U2CA 5DLML 2EE0A 2NY0B 2IDSA 2EDTA 1K2DB 1NEZG 4XOEA 4CSSA 4TNEA 4YBQD 2KL6A 1XQ4A 3TBYB 3VH8G 4AZUA 3ULUF 3HCVA 1EAPB 4MCNA 4EI5B 3IETB 3RGVB 1KYUA 4F58H 3P9WB 2IEPA 4PS8A 5D72H 1MCJA 3MRHA 3QIBB 4MXQD 3BD3A 3JUZA 2J71A 3OR7A 1M7DB 1B3JA 5F89B 3Q9PA 2NXYC 2FO4A 4JKLA 3SDDD 4O2CB 1MJ7H 4E0RB 4Y4HA 4ONHA 1HKLH 5JHDD 3ZE0F 1GWZA 3WAJA 3QIBC 2YD9A 3IJEA 2R7EA 2Q7YB 5E4OA 4W4NA 3CVDA 1L6XA 4LQFH 2FBJH 4AYMC 2VXVL 4JFFB 3RA7H 2QPFA 4B04A 1HE8A 5BQ7B 4DEUA 3F05A 3S35L 4JQIH 2XX0A 2AXWA 2Y1OA 3P77B 5FO8B 5IHBA 4G6MH 5HI4C 3G04A 3BE1L 3VD7A 3COOA 3FHEA 1IM9D 1NAMA 3MGAA 4PJFF 2X70B 4HLJA 3VI3F 2BIMA 2H0EA 4OF0A 3MJ8A 4YDNA 2WHVA 2ZUUA 3NJKA 3BLUA 5J3HD 1W78A 4LBEA 4F2FA 4WO0A 4N2AA 3O4OC 4MNQE 2BH0A 2AITA 1B9ZA 2BOBA 1MCWM 2WXLA 2VDRL 4GQ9H 2OSLB 1G0XA 1H9VA 1JK8B 3LEXB 1A1MA 1JDCA 4HIJB 3SDAC 2J1XA 4IOSA 4QUNA 3US9A 3KXFA 5DK0B 3KJ6L 2BZLA 4XMPL 4AXWA 4OKVA 2C9PA 2G3NA 4ZXBC 4KROC 3TC9A 1WP6A 4ZX3A 4H88H 5D7KD 5EF2A 5I1HL 5C09E 1AKJB 4HJJL 4RGNC 1RUPH 2FHBA 3WXWH 2OKMA 2XWRA 1AJ7L 2AJYL 1ZVSA 3V0WH 1GQQA 2DL9A 1CE6A 3V4PA 2PW2A 2YXMA 4H2AA 3TH2T 5L2KD 3EKCA 2C26A 1T89A 2YAOA 4OGQC 1CFSB 4Y4HB 3RI5F 3SBWA 4UTAH 4Z6BA 1F4WL 2K0RA 3HHMA 5GGTH 1WUNT 4IK6A 3KWWB 3PWNA 4NYHA 4DVRL 3RY6C 1LO2L 4JO3H 2NY3D 3GLZA 3SPHA 1AHMA 1UURA 4HLEA 1R24A 4M8QA 3VGEA 3GRBA 5EIIA 3QUMB 5T3XE 4M03A 5BV7H 2XDHA 4FLQA 4Y0GA 4U31A 4PREB 1PGRB 2I7SA 2HXAA 4JFHE 1JZ7A 5SWQA 5L6YL 2I4HA 5KBKA 2PWFA 4XHJC 4L3EB 3NCJH 2CM6A 4GRZA 5F93C 1S4IA 4EIZC 5A16A 3MNWA 2J2ZB 4KNSA 3AG1B 2BOBB 2MCAA 1CYWA 1MHHA 1AR1D 3PWPB 3FUIA 4IRJC 5KTEH 5EO9A 3OKNB 3QXAA 4XVJL 1ZT4A 1WGOA 4TULH 3V9FA 1FZKA 1MRCH 4L8CA 4GAFB 1AQKL 1PBYA 3I80A 4RAHA 1Z9NA 2GK0B 3DUSA 1I1YA 1BAFL 5ACZB 4G6JL 5TDOA 2NSMA 3OTTA 4E41B 1FNFA 1DSFL 3MLWL 3CIAA 4LOVA 3ARGA 3FBKA 4URTB 1DQJB 2WJ5A 5ITBH 1KZYA 4IU3B 5T1LA 4I2XA 4O58H 2DYPD 4FULA 3WY4A 3R1GH 3UJTH 3WIFB 2PPFA 3BM8A 4MA8L 1XF4A 1VFAA 3DVIA 3ZE2B 4XHQA 2VZ1A 5EWIH 1KN4H 3Q13A 1R3KB 2NCMA 4Y5XC 4A7VA 4OD1H 5CCJA 1ZHBA 4ZW6A 1UQSA 1QLEL 2RA1A 1JNLH 4FL4B 4EJ1C 4Z7VE 4CC1A 1BZ8A 1S7TA 4Z18A 3ETTA 1ZTXL 3IDJB 3D52A 3OMHA 1F4XL 2ITCB 2ZKHL 2I5YL 3P4OA 1JFQH 1EZVX 5D1QC 4LDOB 2AZAA 1TYEB 2EC9U 3FQTB 4RMBA 2D0GA 3MNMA 2WLLB 3SE8H 4IBYA 2HG5B 2NDFA 3QCDA 5CZXC 1T7VA 1ZC0A 4AG4L 3T8XA 3U46B 2QSCL 3BZ5A 4Q97A 5IHUH 2UUPA 2VLKA 4H8WL 4JFZH 5EBGA 2M83A 3W81A 5FA3A 5K25A 1BQRA 5C07E 3MXWL 3LKRB 3C8DA 1QI3A 1MF2L 2EDDA 5I6XC 3Q8AA 1LYQA 3PWJA 1MAJA 5ANMA 4HKZB 4IOIB 3LEYL 1CFQA 5F7FA 4ZQTA 1ZLVK 5HJ3A 2OMTA 2A9NH 4IRJD 3HI1B 3DUHA 3EG9B 3KPLA 1AO7D 3ILPA 3LH2H 2IPKB 3VFMA 1UUNA 3NPSC 1Z2KA 4N0CC 3SGJC 5J56B 1CWVA 2AJXH 4PJDA 2C8NA 4RWYL 2ZAHA 3NTCH 4YGVA 3WOVA 3OKOB 3QUML 5I71B 4JO4H 3EJTA 3H0TA 4IJ3C 3II1A 3RBSA 5MEOB 5DMYA 1YY8B 1UQSB 9PCYA 2R69A 5LXQB 4YK4C 1H6FA 2APTA 4MVBD 3ARGD 3FSWA 1E4XH 1KCVL 4FZEL 1Q1PA 1YEEL 1JYVA 2HKHH 3MNVA 3P69A 5GZNC 1XVSA 3KDPB 5IW1B 4R4BA 2BCKA 3M1CA 3ZHNA 4EQ3A 4PVNA 2CKBL 5C6PB 5K9QG 2WQVA 5KVGL 4HFWA 1CGYA 1FE8H 2HG5A 1DVFD 2QVMA 2PW1A 4JFDE 3DOSA 1C16B 3CWGA 3LN5A 3V10A 5CM1A 2FWUA 2G60L 2ZXQA 5E2VL 3KR3H 4F33B 4P4RB 1BBJB 1TTCA 3MVNA 2VEXA 1PD1A 1T5KA 2V17L 2QKIB 5CUSH 5I8EA 2J88L 5INCB 3ESPA 4MBRA 3ZRCC 1DLFL 3IGAA 3LS4H 1FZJB 1JDAA 2OAAA 3LKPB 4F7TA 1OHQA 5I75B 5L88H 5E4EB 1XR9B 1WCBA 3HI1A 2LHAA 4Y4KC 4AQAA 5F7UA 5KG9A 1MCEA 5I19H 1EZSA 3MZTA 1IIIA 1JGDA 1LO5A 1R3LB 3O6MH 3BN3B 4H26A 2H1XA 3V9CA 5I1JL 2X1XR 2E59A 3FU7A 1HYRC 5I8KL 2WK2A 2F5AH 1T4WA 5D71L 1TQBC 2F6TA 4LSSL 4YHLL 5FUCC 3FTSA 3FS9A 2YJQA 4HC1A 5FF6B 1HXYA 2E9IA 3D85D 3F58L 3S98A 4S1DC 1R3HB 1YLBB 5E2TH 2JKRM 5I15L 4PI0A 1JS4A 2MOGA 4BFKA 4Q58C 3HLAA 1KCSL 2PR4L 5BZWA 2P8MA 3F5WA 2I1YA 2IWGA 3SKUD 1RMFH 3DX8B 5LWYH 2Y0SA 2DM3A 5CJBA 4RESB 1FHNA 2XPZA 4JO3L 3MUGA 4PJCF 1DBML 1EXHA 5CGBA 2HTKD 1NCWL 5HPMA 2BOCB 1OTUC 3HNTL 1ZV2A 4FXKB 1TQCB 3QDJA 1QBAA 2J55A 3OZLA 4WI7A 4UTAA 3O6KL 1CN4A 4L29B 1DVXA 2HFEB 1EBPA 3NPZB 1P84K 4R2GC 3RFZB 2CDGA 3GTTA 4LEXH 3UYRH 1SLUA 5CEXA 4OHIA 1I1RA 1LQFA 4JBCA 4A6YL 5BS0E 2PR9A 5ACLA 4XB8A 3V0EA 2PCPA 4KRPD 5DWPA 2A73B 4UQ2B 2B1AH 2CO2A 2CK2A 2QELA 1G5AA 3ABLB 4PJ8A 4YH6A 1OGPA 4AJ0A 1TZGH 4JHVA 2H4GA 3ARFC 1KENH 3KPMB 1A7QH 2BPBA 5F7NC 2HZHA 4Q56A 4EN3B 2ZZUT 1TQUA 3HUJF 3CQPA 5EDSA 3VA2C 4NO0D 4I48A 2EDQA 2PCYA 5ESVB 2BS9A 2CUAA 4ABUA 4OZFH 2NNAA 5C0BA 4XI5D 4ZO9A 5ADOH 5F88B 3HFFA 1J1OH 4EUPH 2HAZA 2X87A 4ZAKC 5FYJE 4AGQA 2ED6A 3UEQA 5GZOC 5KYWB 3FT4B 1N12A 5A3IC 1KJ3H 4I8NA 4PBVC 5HY9B 5AW2B 3OGOE 2P7TA 5IM7B 1MG2C 3X3GL 2XQYA 4RQQA 4OGYL 1NPNA 1GGYA 4MJHA 4KXCA 2XG5A 4NS0A 1FO0B 4R0LC 3ULVD 1BLNB 3WDJA 2YDUA 1SXBA 5D6DA 1LXMA 4E0RA 3DSNA 4MD4A 1IBGL 4LCCC 3QORB 3BEWA 4WUUA 1N7MH 1RFDH 3GIZL 3P2DA 3D3VB 1EXUB 3P0GB 1ZDQA 5I66B 4MDIB 4YR6A 1ZLSH 1U8MB 3NCXA 2XWZA 5IGXH 5KA2A 3KM2A 2P3YA 4PW9A 4UILL 2B5IC 3BMVA 1UZGA 1JGLL 5GHWH 2VDKB 4ZMAT 4P46D 2KQMA 3E1ZA 4HXBH 2BK8A 3TP4A 3BAKA 2EECA 4V1DB 3WJJA 4XPTL 3WL9B 4BDVA 2FDBP 5EZLB 3OLDA 3RVTD 5E5MA 3C5ZD 3HPLB 3RZWA 5C0DA 1WWWX 1YEJH 5EEWA 2R9HC 4NX0A 4WCYH 5LBSL 1HJBC 3S96B 3ZTCC 3V5HB 3FCBA 1PZBA 4PJCA 1EVUA 2VITA 1TZAA 1QO3B 5FOBA 5DMIL 2VE6B 3QNFA 1IT9H 5GIRB 2WZPD 5A40E 5F7MC 4N0UB 1HAWA 3TCLA 1IC5L 1UATA 5LBVA 3WFDL 4AGNA 5CEZL 4WWKB 5D93C 5KYUB 1A7RH 1P7KA 4UT7L 4F92B 3BE1H 4Z77B 5TE7L 5BQ7A 3P73B 3DTXB 4MMXA 4KKLC 1IQDA 1KF9B 2NY5H 5TK2A 2NTAA 1TEYA 2MPAH 3CUPA 1B4TA 4Y89A 1A6VH 2NXYB 3FTUA 2F18A 4U1KB 2DKSA 3U30C 2TAAA 2MJWA 2KYIA 2OMYA 1CBVL 3V4UL 3OKEA 2Y1VA 1CGSH 1R6VA 3PHAA 1GHFL 4A6YB 4CMHC 2G2NA 1BVNT 1R5WA 4WKZA 1S7RB 3G5YB 4RH9A 5IKCB 1FRGH 3ME0A 4AGMA 1VENA 1HYSC 3G5XA 3NABH 1A1MB 3NN8A 1GKEA 5FKPB 4NBXB 1WA2X 3HC4H 4RGMC 2D7OA 1NAMH 4PBDA 2G5BA 4G70B 3ALWA 4X6CF 5BRZA 3SKOB 4XC3L 1DBAH 3KL5A 1E9PB 1ONQB 4G7SB 4UNUA 3D8MA 1LP9A 3P2BA 1KTKE 1JWMA 2R0ZH 2IMGA 4BELD 1S8DB 2YD4A 2PF6A 2XZCL 3NFNB 3RGHA 4CN4A 2AK4E 2DDQH 2WJ7A 5CUSL 5I8CA 3PWLB 1PY0A 2FEEI 4FOMA 1JHTB 4H25B 1EO8L 5MEND 3KWUA 5I1CH 5AB2A 4PRBB 4KDTA 2XXGA 4P59L 2XG4B 3X3FL 1QBML 2DLIA 1UM5H 1B2YA 1P7KB 4JN2A 4YEFA 3F85A 3X13B 1MLCA 2DV6A 4RMWA 3W0WD 2YPVH 4XMKH 1DQDH 3NCWA 2JK5B 3APMA 1HQRB 4HUWB 3H9YA 5DUPL 1BF8A 1GZHA 3VCLA 2AJVL 4XHJD 4YHLH 2ATKA 4OZ4B 5CF3A 4CVKA 1IFHL 3ARZA 3C60D 2IADB 4LE8A 5HDOA 2F53B 1TMCB 2EXWC 5K1VA 3G04B 1QRNE 4NNXB 4CC0A 1DBBL 1JGUL 1EH9A 3NIFF 4PHZA 4U1LB 1GTNA 1YQ2A 4K94C 3L48A 4XBPB 5A16B 3OAWA 1E3ZA 5J06A 2XWJB 4R5TA 1QFUH 4JDTL 2WVSA 3KPOB 1PKQA 1FFOA 3BJ91 1AGFB 2HPTA 1U8CA 4F57H 1BAFH 2G9HA 1I8LC 2ZCHH 3JV4B 1XX9C 2OBGA 1CFNB 3DI3B 4GRWE 3HNTH 3LMJH 3D48R 3O3AA 3JVGC 3DUSB 3OAYH 1IAIH 2GKIA 4AXWB 3MV7E 4G6AD 1RZKC 5I73C 1NSNH 3ZJAA 4X9YA 3TBVB 1ZTXE 3QCIA 1JHKH 1IC4L 3RVXC 3QK0A 4U6VH 4KROD 1N6QL 1X9UA 5AG9A 5MERB 1NOFA 2WBJD 2X9WA 4HISA 1BQUA 4PY7A 3H42L 3WS6A 3OKLB 3KD4A 4X9FA 4HHAA 5DFTA 1V3KA 2JVUA 4HK3J 1F4AA 3HC2A 3IGFA 4JAMA 2YAMA 4HS8H 1C08B 1T83A 3FTGA 3VVVA 1D6EB 2YAQA 2AQ2A 4N20A 1MW1A 1WT5A 5CWSB 4BA0A 2HB1A 1OP3K 4XP5L 2Y06L 4UBDD 3B9KB 1NO6A 4F9PA 4NQQA 4XXWC 3C6SB 4PGCB 1EZLA 2LV4A 2Q7NA 1KULA 4QHKJ 3MGTB 5JW4Q 1KBGL 1THCA 4IM8A 5IROC 5MHSE 4OLZH 1DZBA 2UZXA 4QYOA 5DC4B 5DRNB 4WNQB 1G9NC 1Q0XH 1YRKA 2I27N 1MFAL 1UFGA 3TTYA 2VJXA 1AFVH 1HZHH 4MRBA 3D69A 2P42B 2ZWKA 2V2TA 2AXFB 4OW6A 1E9OA 4OGXL 3CZJA 1IBGH 1NFDA 5GRJH 1S9VB 1FDLL 3DX7B 5EZJB 3LEYH 4AWJC 1FNGA 3FL7A 3QXAB 2R23A 1AG0A 1KJ2A 1NFKA 4JM2B 1FG9C 2AV7B 2FSDA 3KBFA 4J4PC 1KV7A 4OLYL 1DP0A 1IBHA 3Q6FB 1ET8A 1GSMA 2ZOOA 5AVUB 5GHWL 3SEPA 3IMWA 1NANH 3ZRFC 1TTAA 1F4YH 1PJWA 4X98B 4MJID 5IB4B 5HYQB 3P4LA 2DH3A 3ZL4H 4KK6D 4HUMB 5E4AA 5KJ4A 5EO1A 2BNUA 3L1FA 1QVOA 3G5ZB 3S5LB 3HUJA 3BW9B 3TVMC 4XXCA 3HE7C 5DC0A 5T1KD 2P49B 2Q2EB 3V6BR 2FD6H 2F7IA 3MPCA 4RRPG 1K4CB 5C9JA 5FPIA 3RB7A 4DVBB 1RXDA 4AC2A 1NDMB 2FE0A 2WQUA 1ANUA 1Q90A 3O45B 3WNLA 4UZSA 4AYFB 3JWDL 4G80A 4NQDB 2R56H 2J12B 4DP7X 4Z95L 1USZA 5C09A 2BSSB 1CGTA 3PJNA 5B1JA 2HFTA 4KZEL 1SYSB 2J5LC 3POHA 4U6HB 1XV8A 1B88A 5DQ9B 5IB3A 1NGYA 1LE5B 3K2IA 2X89A 3M1OA 3VGDA 1I8KB 3ZTJH 3C5XA 4TQ8A 2XKSA 4YO0A 4WOHA 2J8UB 5GRZA 1FNEA 1YYML 4G7VL 1HL8A 4HWBA 2XTJC 4Y19A 1NFDB 1ZK5A 1J8HD 5AOLA 5IVNA 5J4MA 3QQ4B 3I6SA 1FH2A 1U95A 3M8OH 3QNZB 2B3RA 3ZTDC 4B9CA 2UXGA 3IU3B 5HHNB 5L8JB 1C5DB 2NY2B 4OF8A 1TR7A 3S3PA 4OIAA 1QLFA 3O6ML 3W5NA 1G5GA 4R90L 4XN9A 4KO6A 3EOTH 2BVOB 3ZE2E 4BUBA 2F58L 1FGVL 3HC4L 3I2CL 4X4YB 4ZZFA 1QKZH 2EIBA 2O1AA 3R4DA 1H19A 4IBWA 3LHPL 3K6DA 4G8EA 2EH8H 1QPPA 2UUOA 3ZKMD 2GUOA 3FU8A 2JCCF 2O93L 5T5FL 4NZUH 4JKKA 5TQ2H 5J1SC 4B97A 1LL1A 1P2CA 3MRNB 4KUZL 1F58H 4UDUB 2KC0A 3QRBA 3QCJA 1AD9A 1KGYE 4WSGA 1ZVNA 1RQ5A 4HXAL 2CIIA 4M4PA 4Y2DA 5DZLA 3WFHA 5DJXB 4AYSA 1BLIA 6FABH 1T48A 2VR9A 3FCSA 4KK9D 1WSST 2O6PA 3AVEA 3EJUA 1CLYH 3HG5A 5MEQA 3IJ8A 3VYNA 5JDSA 1F8TL 4UAHA 3M7OA 2B1HH 3IE9A 5GS1C 3BUQA 3VFGH 2YBGA 5E9DD 3MODH 3FU0A 5JXEA 4FEMA 1U3HC 4XN1A 1ZA6B 1FJ1B 4P23A 1I8KA 2VR4A 2Q8AH 4MAYA 5K39A 4LLQB 5H94A 1GH7A 5SWZD 2HFEA 2R2BA 4YHMH 1SJMA 3DOSB 1MWAB 4LCYA 3V0FA 4JL2A 4R4FL 2Q5BA 4ERSL 5CILL 4OFKA 4HUVB 4WGWB 2CMAA 1KENL 2C5DC 3FU6A 1FFRA 5E03A 1E42A 4A7TA 2OXHB 3DVNB 4TNVK 4FJZA 1Q6SA 5I18L 3C2AL 3KXFD 3FZUC 2LU3A 3H2PA 2YD5A 4WUKH 2JFCA 3BPLB 3JV5A 3FT0A 3DJZA 3LKPA 3MYJA 5J12C 2QCTA 4X4YA 4FFWC 2GP0A 2VXSH 5ERWB 3HI5H 5C0AE 5L4MA 3WJMB 1BYOA 2WZ5A 2R69L 1H8NA 4HA1A 3FB8A 2ZYIA 3LRSB 1F00I 1DBKL 4JGNA 5T3XH 3WBDA 3ARVA 1G87A 1VGKB 5ESAB 4F58L 3UJIH 2VH5L 4AIXA 4AE1A 3APNA 2CLVB 5H8DA 4XVOA 4M6NL 3W56A 2JFGA 2XKUA 5D2NC 2WP3O 3RIAF 4RQQB 2CK0L 1QO3A 3ZT7A 4AVHA 1YYLL 2B0SL 3ECQA 5ANME 2Y67A 5GS0C 1INQB 3QEUB 3Q2LA 4U1IB 1WIOA 2WXNA 2D7TH 5LGHH 4PCKA 1KGCD 1NGQL 4JHAH 4H0IA 1TIUA 1I8MB 2EDBA 4UILH 3VXNB 1PIGA 2J57A 4WK0B 3HW7A 1R3LA 3Q5TA 2G2PA 3EH4B 1HH9A 1KG0A 2KUTA 4NPYB 4OD2B 3T0AA 3OR6A 1OTUD 4LCUB 6CGTA 1RK7A 1WO2A 4UTBA 3FFDA 3AFLA 2FH7A 4IOFC 3MOAL 1XCWA 1UAGA 4WV1B 1Q0XL 1T20B 3DURB 1U42A 1MFBH 4DGWC 2AZRA 2B5IB 3IGUA 3HZVB 4Z23A 1FIEA 2ED7A 4FF9A 2OXHA 3DVNA 2O4EA 1AD0B 3OKEB 5JR1L 4WU5A 4AZ8A 2X4RA 1QR4A 3E3QC 3WEMA 3V5HA 4M43H 4NNYA 1A4JA 1CFBA 2OL3L 4JFSA 4RAVB 5C0RH 3HG1A 2C46A 4RISL 4WSJA 1SEBB 2AMGA 3ZHLA 2AANA 2RBLA 4LLYA 1XGQB 3RQ3A 5DI8A 3GBEA 1HCZA 1WEJH 3S9DB 2B2XH 4LKCB 3STBA 2R29A 2VTFA 1MN4A 4HK0B 4HKXA 2WXMA 3IS0X 1MDAA 3ZYJA 2GC4C 4H1LA 1WBXB 1QBLH 3VMPA 5IQNA 1QR1A 3BP5A 3EYQD 4ZPVA 3PHQB 4K2UL 4DFIA 2J16A 4YXHL 1CFVH 4JLRB 3GSRA 3V0VB 3ARED 4PG2A 3QC5X 2Y5EA 2OK0H 3L5IA 4HX1B 3S3JA 1DL7H 3VI3A 2GBUA 3TJHD 4Y14A 1CGUA 3UP6A 4IOFD 4XBGB 1U0QA 5G5DB 3QWOB 3GUTA 5DD0L 2APSA 4K9EH 3CLWA 3H56A 4LCWE 5ISZD 3KYOB 2PP7A 1N26A 2DM7A 5D1QD 4LF3A 3ARBC 3LKQA 1JV5A 2PYFA 1JHLH 5JZ7D 4MXWH 1INEH 1M7IB 3RGVD 4OZ4A 1EDYA 4WNSA 3AREA 3OAYK 3WKYA 1AI1H 1CBJA 3QZMA 3N2AA 4Z76A 3QUZA 5FYLH 2W0FB 5ICUA 3O3BB 3R06B 4OB5H 5IZ7A 1CF8H 1S7VB 1QLRA 2N7AA 3D0LB 4P5MB 5ACMA 3GSOA 5TGBB 2VDRB 1NKGA 2VLRE 2V9UA 3NEOA 3WMSA 4BXSV 5MMZB 1UXSA 4QRBA 4ZTPL 1EO8H 5HYSA 2ZTBA 4X6EB 4M7LL 5L2KA 5KTEL 3V0GA 3LNFA 1Q9WA 1FLRL 1X5MA 2ARJQ 2R83A 4UZGA 3SDXE 2UZIL 3CHOA 1OCOB 5LB1A 2YGPA 3FF8A 4P04A 4QIRA 4OAWB 3JYBA 3RKDD 3T3ME 3QE5A 1R75A 3MFGB 5HYJD 5F1OB 2OUDA 1SXAA 4BZ1H 4XP6L 3BIKB 1YPZB 3BEVA 4ZOBA 5ALBL 2NOYA 3T6VA 4EN3C 3S35X 1NEUA 5F0JB 5DO8A 2ETWA 1DVSA 4AMKH 5GGRA 4V1DA 2NY6B 1I57A 1SY6H 1XB3A 3U9UA 3V0VA 3CHQA 4FTVA 1CXFA 2LLNA 3QG7L 4JR9L 3L7FB 4HU2A 1U8KB 3H7BA 1UZ6F 1J1PL 4KUCF 2MPVA 4KXZI 3B3IA 3T0VA 1P69B 1NDTA 4MCZA 1ZEAL 5JTWA 1DUYA 3HI6H 1IGTA 4PJ9B 1BXXA 2VDLH 1UH4A 3LZFL 4FQ2L 4OD3L 3JWNE 2A3KA 1D5BB 5AOZA 2WINB 5JW3H 5KJRH 3E38A 2H0JA 3WUWG 4XPBL 4F3FA 3VXRB 4M5YH 1C12A 4UUJB 3TBCA 3FT9A 1RZGB 4XNDA 2A6IA 1MCFA 2DYPA 3QHFH 2CO7A 2OJZL 3U7WH 3QWRD 3NYKA 2QJDA 5MI0C 3OMZA 3HR5A 4CJ0A 2H26A 4WO4B 5T3ZH 3L1OH 4B7LA 4JZJA 4L5FE 2HRGA 3IJEB 3LEXA 3Q2WA 5ISZB 4P3CL 2FBJL 4AEIL 4O2CA 2ITFA 1SOSA 4BBWA 4MASA 1PTUA 1BDYA 4MA3A 4ZUWA 3MLTA 4WTYA 4U3CA 4DNLA 2O61B 3S35H 3EJQA 1GS8A 5CXPA 1J8KA 2WQAA 5E8NA 1DBKH 2PN5A 1NAMB 1QEXA 3A5KA 3FQXB 4RWYH 2WWKO 2HFGL 1XF4B 4I0PB 4C56A 2BY0A 4QR7A 1JE6A 5BV7C 2QKIC 1YZ4A 4S1QL 3ZDZB 3ZO9A 4DK5A 2XWXA 1YYLH 3NJHA 3P4MA 3CDCA 1Z9PA 2MHAB 1JHTA 1PTZA 1VFBA 5KW9H 35C8L 4KHTL 4TLKA 3D30A 3IDJA 2Q1EA 5C0JA 1DFBH 3Q44A 1FNGB 4MRCA 3BWUC 2EVHA 2MQGA 1EEYB 2WLMA 2P5EA 3B1TA 5D1QB 1WDAA 2AEPH 1Y7VA 2WO2B 4PB9L 2P80A 2HC2A 2JKTM 4NUJB 3PL6A 4KDTC 4TTGA 2PYEE 1FORL 1JPTH 3SGJA 5ICYB 1MDTA 4TNFA 3NGBC 2BFVH 2ROXA 4KXAA 1GJIA 2GC6A 3DPBA 3VNYA 2PWDA 2OV0A 1EHLL 2YD6A 3N5AA 3N04A 5HPOA 4YSQA 4J5VA 3R8QA 2YN3A 5BXFB 1LHZA 1QFWH 1CMOA 1SJEB 2NZ9D 4WWOA 4P5KA 4DVRH 2Y1YA 1RH8A 5D9SA 2NT2A 2EINB 2G9HB 4IKNA 1N67A 1JK9A 2Z7WA 1RPUA 3GXMA 2F0CA 1PVHA 1WEJL 4FXGC 2NV5A 2RQ8A 3C6LC 4ELMF 3OJDA 1YNKH 5F1SA 4L4TA 1AVAA 3UYOD 1MIMH 2K8QA 4NZ8A 3NCJL 3WJLC 4E42B 3A24A 4R9HA 2DS4A 1KCRH 2XICA 5C0CD 1GCFA 2XLLA 2FECL 3MNWB 1I8LA 5L6YH 2XVLA 1I31A 2WBJB 3N1GC 2UZXB 2AKRB 2YO3A 4LVOB 4QYOB 3EDFA 4X6FA 2JKXA 4HV8B 2YEVB 2A1WL 3TIDB 3GBLA 3DECA 1NWLA 4V33A 1IM9A 1KCSH 1EHNA 2PR4H 2VN3A 1I1AA 2Z31D 3FOMA 4GQZA 4OM0L 5DHEA 4UQIM 5C07D 5E8OA 2KT6A 5KUMA 5IVXA 1IC7H 1E8CA 2X88A 1F3JB 1KN2H 3NZSA 4ZOCA 1FVCB 1JL8A 4FQCL 3QDHA 4JFXB 5B38B 3OG6B 5HDBE 1KXQE 3MLWH 1I3RB 1Q0EA 3F84A 4M61B 4QNPE 1DQJA 1NINA 3MRPB 3QBTB 2Q87A 3EXLA 4KTGA 3IDMA 3U0PB 4Q4EA 5AZ2L 1WFMA 5I26A 4NP9A 4PGEA 4OLUH 1U8IB 1RXLA 4OF6A 3QS2A 4WW2F 2ADGA 3KH4A 5JORB 2ZSVA 2Z91B 4YWGL 4NOFA 4BIKA 4H8HA 4P2RE 3OHMB 1WUZA 2Q76A 2XIBA 1OF2B 4KKNA 3UYPA 4ES8A 3U1PA 3MRDB 4BSWA 4GE2A 3Q2VA 4RIRB 3STZB 5C3LD 5D5MF 5JHDB 3VNZA 2YJLA 4G83A 1X6NA 5CMAB 3BKYH 4KNUA 5DR5H 2F5BL 3RAJL 5B8CC 1XO8A 4WI5A 4PJDF 5IQ7H 2JJVA 3K1DA 4WI0A 5LAPA 1VPOH 1B4JL 2XN9A 1NCCL 3OD3A 4ZTOL 4AVIA 1YEFL 4N2LA 3VFRB 1O7SA 4M6ML 2OTWB 3QXUA 1Q9OB 1H15B 5FUOH 3D44A 3HJEA 4XAKD 4KZ0A 1MY7A 5AW8B 4CVZB 1SMAA 2WVTA 4OY9A 5HHOB 3VSVA 5I6OA 2N01B 4WDIA 1AHKA 2R1XA 1S9XB 4JANB 3S5LA 4B9JA 2NYYD 1X5YA 4OKDA 4Q6YA 3DMMB 2VUKA 4DGYH 4PRAB 3RNQB 5KAQG 1O9WA 1QI5A 4NRYA 2FRGP 4YC2B 3LAFA 4P2OC 2JCWA 1YN7A 5F1NB 1O6SB 2EEDA 4RWHA 1BMZA 2X2HA 3NOIA 4GI9A 4JDEA 5EHPA 4AM0B 3QWQB 3FF7A 1MFVA 3UAAA 1R24B 4YSPA 2VH5H 4P48A 4KJYA 4AYDC 4HVBA 2BVPA 4G6ML 1IL1B 5JYMA 1E5UI 2XX1A 4CC4C 2GBTA 3ZL2A 1U26A 3KYMA 5DHMC 5EBLB 2F15A 1I8AA 3DHMA 1HCYA 3BSZA 3E2HB 3QUMH 3WV0A 2A99A 1BSIA 1WAAE 1ACZA 3ZV2A 2DQFA 2EIKB 4FP8L 3VFPB 5JOFA 3OB8A 4RGNB 3FMGH 5LQBH 3UEZA 3KWTA 4K73A 4DN4L 3TWCL 3JV6A 4NHUB 3VG0L 4OQTA 1M2VA 3RVUC 2E27L 4XO8A 4Z7QF 3O6FC 5MEPA 3T04D 3UTSD 5JMRA 4NZRL 4UIKL 1IGYB 3O9WD 4QJ3B 3SE4C 5HHVH 3QPKA 4DZ8B 2BSEA 4XC1H 3DMMC 4PRPD 1U93B 5AKVA 1BQHG 4L05A 3QFJD 3CH8A 3V0WL 3HZMA 3VWJD 2K6ZA 2KDYA 3MV9E 1TCRA 2DTMH 4JVPA 3TA3A 1OSZA 2W81C 3HS0C 1RPMA 1ACCA 1GHFH 1KTJA 4FKKA 2YLKA 4U4BA 5SWZB 1TKWB 3IJSA 1MFUA 1KELH 1UWGL 4YR6B 1W8EA 5DVLA 2FSEB 1OAZH 2CLRA 3PWUA 1UA6H 2AGJL 4HWEL 2XPCA 4DW2H 3FSVA 2DEXX 4HJIA 1FIGH 1T7YA 3LZOA 3HB3C 3F58H 4JRYD 5E5MB 1J1XH 1J6UA 1MRDH 2V5YA 4NI6A 4OUOA 3BPOB 5KSBB 4NC2B 2V9QA 1E30A 4MGXA 4XPAH 4HIIA 1FV1B 2AAVA 5E9AA 2EKSA 2XVGA 4HH8A 3VWKC 3GM0A 4DP5X 4LCCB 5DYFA 1I7TB 1YMHB 1Z9OA 3JV0A 3TJHC 2Y2TA 2F7PA 4DP4X 1P4BH 4KJWD 5AW9B 4PS4H 2NY0C 2WBXA 3UC0H 3CMOL 4WWKA 2F54D 4XRCA 4TUOB 1INEL 4GUCA 4P06A 4XMKL 2ZG2A 3TNMB 4Z3FA 5E7BA 1Z3RA 5BW7A 2YWYA 4Q0XL 1RKRA 3GHBH 1PEZA 4IRSC 3IJYB 5EC1A 2MCG1 1EO7A 1C7SA 1T4KA 4P57A 5SWSD 4F9PC 2YPKA 4NWTL 4Y19D 1BYPA 3CMGA 3S5LG 4R3SA 4ZK8A 3NRQA 1LEKA 3GMRA 2DQEL 4QHLA 1EK3A 1KCBA 3FTYA 1DJHA 3GMQA 2BC4B 3L17A 2YFNA 3VXSE 3M6DA 3MA7A 4R5VA 2F6FA 1CXIA 1OTTC 3P3RA 4LFHG 1EGJH 5I66A 3VSUA 1EJOL 3C8KA 5GGSB 5DHVB 4NUMA 2GK2A 3H2QA 2NY4D 3MJGX 4UT6A 5KVEE 4LFHD 4FFTA 4B9YA 4GRMA 1MI5D 3FYIB 4XTRD 4XCFH 2VXTL 3MU3A 5EBMB 2FIKB 2VC2H 3W38A 4LSTL 2F6ZA 3WY1A 1OAKL 1V54B 2YUWA 2F53D 1JRHH 1I7RA 3Q06A 5DZVA 3EHBB 5FC9A 2I3UA 4YEEA 1W8OA 1EWHA 3S96A 4JMKA 1KWKA 1XAUA 2R4SL 3AADB 4JHWL 3PGCB 1D9KC 3E7JA 4TL4A 4XE5B 5DRZA 1VLXA 3QH3A 2WKLA 4JM4H 1ZEAH 1PIFA 2IWFA 5SX5H 3VVWA 3ZOAA 5KBPA 2I9TA 2QVTA 4H44C 3UH8A 1ZCLA 3F65A 4TVUA 3VXOB 4TLUA 4GRWF 2MQ0A 5G5DA 3GUTB 1QSFB 2VSMB 2HT3C 2BGEA 4J39A 3C9NB 4ZUTA 5ICXB 4RH5A 5DJ0B 1XIWA 4BKTC 4OLZL 1HILB 4K94L 3MJ9H 4QOKB 1YEJL 4C57C 3T2PA 4NRZA 5FF6A 3ARQA 4ZYKB 2W0FA 3PHQA 3N42F 2X2YA 2AEQH 1TEGA 2V5MA 3FN3A 3C6EA 5C0DB 1BLNA 4JGUA 3GZPA 3REVA 1D6VH 3L3GB 5DCCA 3KLHC 1RUQH 2EXWD 4GSDH 1R5WB 3BH9A 3R19A 4RH4A 3REWB 4PJ9C 3GMLB 3LYRA 1W72B 3UDWA 4U4IA 3L3HA 3EUDA 4M4RA 4U6TA 1K4DB 4JFDD 4K3JL 1P4IH 3M1BB 3VXUB 1SJVA 5HD8C 3ZKQD 3LNEA 3FU9A 1IT9L 3QWOA 3O4LE 1MZYA 4NSKA 4X6CA 4OAWA 2WCPA 4NM8H 1JGVL 4N0UA 3H3PL 5FO7B 5DURD 1YG9A 4FXKA 4UT9A 4NDMB 2YGNA 1IKFH 1A6ZA 2IC2A 3BJLA 4ODWB 3JTTB 2RALA 2CGYA 1P5UC 5CD5C 2QFPA 5ESQA 3QC6X 4MMZC 3A0OA 5DVOA 3EOBA 1CBVH 1F6AB 2CXGA 2XZAH 2G2RB 3MR9B 4ZMOA 4JFFE 4ONGL 1FVDA 5C92A 5ECJE 3S37H 3EOYG 2EDKA 3O81A 2YWZA 4X8XA 3CWEA 1YUHB 5GS2H 4POZC 1P84J 1WTGT 3AITA 4RFOL 5D7LD 1BVLB 5IVOA 3UBFA 3VFTB 1CO1A 2EYRA 1OV8A 1J05B 5TF1H 3VGAB 1AO7B 3AAZA 3EHBC 1MCIA 2C9SA 2A38A 3UPAA 3ETBJ 3CVCA 4R0LA 1EHKB 1ONQA 2A9MH 4U3XA 3VQ2C 3BFOA 3V4PH 2R0ZL 5HHVL 1DHKA 1XWVA 2BFVL 3PXJA 4XC3H 1WAEA 3QNYB 3ZKXC 1FQ1A 4TLSA 2HCZX 5LG1A 4JFUA 3OC5A 1MHPH 4LP4A 3FSAA 1GOGA 2XG5B 4U6YA 4W9DC 3S6CA 2CR0A 2IV8A 2CRMA 2EDYA 3SJVB 1TJMA 5F9JB 4P59H 5KVDE 4JFOB 4MD0A 2VEUA 3EAXA 3QEQE 1JTOA 4FG6D 2J17A 2H9GA 3C87A 3ULUH 2E74C 1NCWH 4X5PA 4GG8B 4DF9A 4Y2LA 3ZHKA 1OAJA 2BCMA 1N6VA 5FYJL 4AQ8A 5G4NA 3SZKC 4PWKA 1QRNA 5ICZB 5A2BA 1SY6A 2JQZA 4R7DB 5FO8A 1AMXA 3LHPH 5T1MA 4TUJA 2FLMA 2OQJB 3T0DA 4NOBA 2VRQA 3JWNG 1LE9A 5IBLC 2BNRA 4J7RA 1RZGA 2V2XB 5C71A 1YC7A 1ESOA 1FVDB 2JSFA 3F64A 3MO1B 2X5OA 3T0BA 2VXQA 3LQAC 5H37G 2A9BA 4QRAA 3CFUA 1PYWB 2J8UF 4ADIA 4WHDA 4LLUA 1WQVT 2VITB 3W9EB 2VMDA 4QHKI 3ARFA 1IIKA 3BSHA 3FCTA 5ISZA 3CBKB 4JPWH 1TTBA 1V10A 2LW3A 1QI4A 3ARBB 3NA4A 3LJ8A 1PLAA 2YA1A 2ZJSL 4PS7A 3WJJC 5IOPA 5HDBB 1BZ7A 3ZMRA 5B39G 1F02I 1HL5A 2XNAB 3AMKA 1QSED 2WPGA 3BZFA 4YDLB 2Y66A 3ULSA 1JZFA 3V6FA 3MLPA 4WFFE 1B90A 2E4FA 2P47B 2UY7B 3GPSA 1FZMA 2JJTC 4I87A 4NKMB 4XGZB 1M9SA 1HAUA 3K71A 4CVMA 5D4HA 3O6LL 4QCIB 4W6XB 5LKNA 3I3EA 3LB6C 3H42H 1DDHA 1N7ML 1RFDL 3A47A 3GIZH 3NA9L 3QJRB 3U7YH 4WUKL 4XP5H 3TO4D 2HVKB 1PLCA 5KA7A 5IQ7L 1CI3M 5DC2A 3N9GH 3ZDZE 2PBNA 3ULAB 1TZOA 2R69H 5C0GA 1FNLA 4JCLA 1CE1H 1GGBL 3BDYL 4WNQA 5HYQA 4YPGB 5C0NC 4PRHD 3SDCD 3MSPA 3MUHL 3OPZH 2QBRA 3ZE1E 1MFAH 1VCAA 3GJFB 5JNYA 4AW4A 4QRTB 2Q86B 3W0WA 5CCKL 5KVFL 2DLEA 4TVPL 4OLVL 2LU5A 2A77L 5LGJB 2TSAA 1FDLH 4DT2A 3T08A 1CICC 2Y36L 3T8MA 5DJCB 5I24A 4KDWA 1E9OB 4OM1L 3GZOA 3SQRA 4ZX4A 2Z64C 2PCFB 4IBVA 1SDDA 3ZMEA 5T5NF 4FQIH 2OYLA 3FQTA 2UXTA 3ARBD 4O02H 3CNKA 4BH8A 2D3JA 5IFHH 5LXGL 2QDPA 3DWTA 4D94A 1FJ1A 4P23B 1E7UA 3RWJB 4DO5A 3IMTA 1TVHB 4MCYA 4N1CA 4O2EB 4PCYA 1NM4A 4C55A 2UX6A 5GRUL 4GS0A 3VXQB 3WLWD 4XMXA 3DI2B 3BW9A 2J8UA 4LPVA 4N0RA 3NAAL 4O4YL 1NLDH 1IL1A 1MCBA 1A6VL 1MFBL 1R3KA 2CU9A 4PTTA 5DD1H 3P0VH 4LO9A 2NR6D 4NLAA 2BM3A 2Y9RT 4TV3A 2RF6A 3RTQB 1WFOA 1IV8A 1HK6A 2VDLB 2I6PA 3GSWA 2YQ3A 3MXVL 1A1NB 4CVXB 3EO1A 3O4OB 3IU4L 4LPWA 2E27H 4XOAA 5EU5A 1CVSC 2D03H 3QYMA 4Z95H 4BWWA 1MREL 2YS4A 1JGVH 5KYXB 4OCXL 4P5TC 3W11C 1YEGL 2ZSWA 5F3FA 2R56L 4A2DA 4ZMYA 4HPYL 2QGDA 4GBXA 3QT2A 1SXNA 1S46A 1OP4A 5EB9A 2EYSB 5CEZE 1UT1A 4MS8D 3ZGIA 3ZM3A 3WFBL 3P3UA 2DF3A 1TJIH 4HLZH 4KRPB 2BNUB 3F7PC 5LJYH 3I02B 5E1AA 25C8H 3IDNA 2NZIA 2CIIB 3B6SB 2PW2B 4ZMZA 3J07A 4G7RB 4KMTL 4UOJA 1TQSA 5IJVB 1IAMA 3HG2A 4JFDB 1ZGLP 4DSYA 3KL3A 3EYFA 2AGJH 2IANA 1M6OA 2MCPL 4HWEH 4ZX6A 5GTJA 3GEWB 3ESMA 5DD0H 3LKNB 3RZCA 2IPTL 1FQ9C 1XDTT 3O45A 4XRCB 1BZ9B 1S3RA 1L9PA 5E6RB 2VLJD 3FUDA 3LV3A 4MBOA 1GYAA 4FFVD 4QJ4B 2DKMA 3MN8A 3QCKA 2XJKA 4PWEA 2BSSA 1RIVL 3PL6C 1N3NA 5TH2B 4GBXC 3QXVA 1SVBA 2VRAA 3O2VL 1JZ2A 1X5FA 4GW5B 3L6FA 1SUHA 3E6FB 3ROLB 3HMXL 2PO6C 1W80A 2J72A 4FQ1H 3TVMD 3LXUX 3ZW3A 3GSXB 3WIHH 1WAPA 4F15C 2MQ3A 1MW3A 4S10A 1JWSA 2VEVA 3U96A 3VRIB 3RVWC 1KAKA 3GXNA 4YHIA 1HHIA 3N43B 1KJ2B 2VZUA 2GK0A 1J86A 1ZA6A 1TFPA 4Z8FH 1O6SA 3JV6B 1OHDA 1X5KA 2WLLA 1F4XH 1ZSDA 2ZKHH 1FUNA 5CLZA 4LB8A 4OFQA 2QHLA 3R4RA 5CSZB 5IBTL 4DP0X 1BM3L 3ARRA 3TNMA 1JHKL 1XGRB 2X4QA 4NO0A 4QY8B 4EI6B 1QW9A 4LLQA 5EO1B 4XNUH 4JRYB 2PCXA 1EEUA 1T7XA 4JMXA 3DRTB 4HSAC 1N8ZB 4ZW8A 3ILQC 3KGUA 4UDUA 5C0AA 4QOKD 1MI5A 4OV6F 3ARTA 3MYJB 3RY6A 4GBXD 1OSZB 4X6BA 1BZ9A 5F9WC 4UCFA 2C1OA 3C5SA 3QB7C 4LQFL 3MV01 2E9JA 2E7CA 3UTPD 2KPWA 4D8OA 1FH5H 3HKFA 4Q4IA 4QRRE 2FJMA 4PRIA 1CDGA 2BVQB 2V3DA 3DRQB 5T3XL 4Z3HA 3ESOA 5BZDA 4OV5A 2VGLM 4TM9A 2WUBH 2W65A 5EBMA 2DJ4A 3CK0L 5JIDA 3BHBB 3U25A 2VR6A 4E5XA 1HJCA 3IDGA 3KPSD 2CHZA 5H94B 3FC8A 2I6MA 5I76B 4TNGA 4NKOA 5KAAA 3OJVC 1KB9J 2NX5E 5I1DB 5CZRA 3O6LH 2OMZA 4L8BA 3RKDC 5D1XB 2X6MA 4ZO7A 1T0PB 4MAUL 1E3XA 5I0XA 1AIZA 1GZHC 1NANI 5DD6B 5HHNA 2NW2A 5KAQF 4EOWH 1MLBB 5DJ6B 1XIWC 1CFQB 2C1PB 2XPYA 4PG9A 3TVMB 1E5AA 4NQEA 4X0NA 1KIQA 2K6YA 2A6DB 2J73A 3AY4C 3BIKA 3ECUA 1AANA 3PLYA 4BHUA 1LGVA 1OB0A 2GC5A 1SNRA 2VMJA 2Y5QA 3BLTA 3QUYC 1EAOA 2KZ1B 5H4YA 1GZQA 1FWXA 5EC2B 3HG1E 4DO4A 3BVNA 3L2NA 3PDGA 3SDDA 3BPCA 1MI5B 3Q8FA 2QLYA 4PGDA 4ANXA 3ISWA 3JWOH 1KEMH 2VLRD 3SDAA 2WB1A 4UT6L 3SGKC 2BDNL 2Q6WA 1VACA 3NSCA 1P15A 1NDGB 1WRFA 3NGBB 3G9AB 2OFQA 3JWDH 3RP1A 2CJ3A 1HHKA 3DVGA 3PP3K 1PW3A 4I18C 2FBRA 3LZLA 4Y16C 1CCZA 5AD0A 3SE4A 2YSTA 2OSWA 5DS8B 2HJKB 1WZMA 2PT0A 2Z92B 5I82A 3IFNH 2K7QA 4UQ3A 1I1FB 2BJMH 4NN5B 3VI3E 2QR0B 4OIFA 5F9OL 4JFPB 3VYPA 1VB9A 5IFAL 5DK2B 4K2UH 4IIQB 4K3DH 3MUGB 3GSRB 1K8IB 4FNQA 5DD6A 2H2SD 2Z9TA 3ZQ9A 1G9MC 1OGAE 3PDOA 2OK0L 2IAMD 2SEBA 4G6FB 4FCAA 1FBIH 3ZTNL 4RBPK 3MRLA 2AABH 4FMVA 4L8SA 5JLZB 1QWNA 4MKTA 3KNBA 4W9JC 1G43A 3DJRA 3PP3H 2OMUA 1V7NH 2WIMA 5I0WA 2ALWA 3RURA 5DJ8A 1FGNL 5KSAA 1SN5A 4WNJA 1JZIA 4JG1L 1GSKA 2V7NB 3Q9QA 2UY6A 5ITFA 2IH1A 4PEEA 1I4FB 4MWFB 1BZCA 2BNQB 4MQXC 4F7MB 4IGBD 4NEHB 2J25A 3U6XA 2HT3D 1B6DA 5HGHB 3FQYA 2E47A 3VWJB 3FB6B 1CF8L 2ICWB 5D7SL 5KABA 2W9DH 1E8YA 2DIAA 2B1AL 1NDGA 1OE1A 3ZE2F 3BLBA 4RAUB 4BUQA 3QJVB 3VI4E 3DX8A 4UINH 1MCRA 2YPVA 5I9QB 4ZMNA 4P2AA 4HUUB 4QXUH 4NWUH 3QORD 4KMQA 4WHYH 1I9RL 3KLHD 2Z65C 5HVGB 5FFLA 2QQKH 1H5BB 7FABH 4FERA 3GSVB 2WBKA 1WZ1H 3P73A 3SKOA 1CD1A 2EO7A 4IDJH 3GBNH 5IREA 4J3UA 1JBVA 2V7HA 5AVTB 4XO3A 3E6HA 4XPGL 4J3TA 1FZMB 4NKMA 2VSKB 4TMPA 3GBMH 5HHXH 3HMXH 3SGKA 3BVXA 1INDH 2H26B 3SE9H 1A66A 2COQA 4NQXA 4EZKA 4Y1AD 2C9RA 4FTVB 5DQJB 3KPPA 3S34H 2FGZA 1RIUH 3QG7H 4JR9H 3QQXA 1R5IA 4AC4A 4GE5A 3NQIA 1KB5A 4F15B 4KNTA 5CJXC 4FQ2H 2X9XA 2E7LA 3W39B 3QJOA 4XB7A 3BRFA 3H9HB 5FB8B 1VEPA 1TXKA 2A9NL 3KGTA 5LO7A 3D12B 4S1RH 4HIJA 3HI6L 4I48B 1DE4A 2G5BB 1YSOA 2JXMB 3RAJH 4ZW5A 2BW5A 3M88A 4J8QA 3ZR5A 3QQDA 3F62A 4OVVA 4G8FB 2BMKB 1D5IH 3MCKB 1UUSA 3RHWK 2YAFA 3BT2L 3DROA 3MRJB 2DQIL 2J56A 1UB5B 4N8VG