3V0LA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with a novel udp-gal derived inhibitor (2gw)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
281
structure length
278
Chain Sequence
SLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified Donor Analogues Reveal Novel Dynamic Features of a Glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 278
sequence length 281
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0lA00
4KXOA 3USQA 5J49A 1FR9A 1TVYA 4D11A 4C2SA 1H4EA 4FRAA 1JV3A 4FROA 1OQMB 3K8EA 2Q4JA 3PKQA 1R7UA 2JCOA 4KNXA 4P02A 4CVHA 5DDVA 1GWWA 2FYAA 1H3MA 4CJBA 1ZI4A 2FYBA 3U0YA 3SXGA 5C4CA 2GGOA 4FRPA 5FYEA 1FGXA 3V91A 4FREA 3ZLLA 4EEGA 4IRPA 2WGZA 4HO3A 2Y4LA 2ICYA 1G2VA 2PX7A 1R7YA 5I1FA 1IINA 2AM5A 3CKVA 1R80A 4BQHA 5C38A 1H4DA 1VH3A 2ZU9A 3JUKA 1VGUA 1JV1A 3OKRA 4Y64A 5CQOA 1HM0A 2AESA 3DJ4A 4D0ZA 1ZJ1A 1HV9A 2PA4A 2X65A 3OH0A 4B5BA 2RIXA 1KWSA 2YQCA 2O1GA 5DDTA 1JYLA 1WT2A 2RJ0A 5CMFX 5AJOA 1FGGA 2PGYA 5FTSA 1H4CA 5C36A 1HM8A 1XHBA 2D7IA 3CKQA 4AC3A 4B4GA 3V0MA 2VXLA 3ZLKA 3ST8A 1H5SC 2AE7A 4D48A 1OMZA 3I0KA 4JISA 3U2XA 2AGDA 3I0LA 2I5EA 4AAWA 1YP4A 3T7OA 3I0CA 1NQIB 3U0XA 2FFVA 1LZ0A 1V82A 4XWIA 4E1KA 1NKHB 4KNRA 1MP5A 4FRMA 4M2AA 4LW3A 2YQSA 2X5ZA 1GX4A 2WE9A 4EE5A 2AECA 2APCA 1FO8A 1R7XA 2JCLA 5CMHA 3USRA 3DUVA 2P72A 1MP4A 2V0JA 1TZFA 4KPXA 2I7BA 2YESA 4AYLA 5IDTA 3U2TA 1NHEB 3T7MA 1YP3A 4M28A 1R81A 1ZHJA 1VH1A 2Y6PA 3CU0A 2VD4A 2QH5A 4YS8A 4Y6NA 2WVLA 4HO6A 4KPZA 2OI6A 3SXCA 1HJJA 2V0LA 3Q7UA 3U2UA 3SXEA 4B42A 2FFUA 1JVDA 1VGTA 1GA8A 2AM4A 3POLA 5JQQA 3SXDA 1ON8A 1NMMB 3SX7A 2BO4A 4LW6A 4NANA 3V8YA 1G23A 1H5SD 4NALA 1NWGB 2OI7A 3FWWA 4KC4A 2I5KA 2QGIA 1E5KA 2JCKA 3IOHA 1FR8A 3I0FA 4NAIA 4Y9XA 3QVBA 3I0HA 3R3IA 1GQCA 1R82A 4L41C 3PKPA 1VICA 3Q4SA 1VZTA 1H5SA 2RJ1A 5C4EA 4M2BA 2V0IA 3E26A 2ICXA 4HO5A 2XMHA 3IOIA 4HOCA 2VS5A 1INIA 2X60A 1H5RA 2ZU8A 3U2VA 3SXBA 3V90A 4MYBA 3SXAA 2QKXA 3CKNA 5AJPA 5C1HA 5C1GA 3TZTA 3E25A 5FUHA 1LZ7A 2GGQA 1VM8A 1OMXA 4G3QA 4Y62A 1VPAA 1ZIZA 1HJLA 2XWLA 5C3AA 5C47A 2D0JA 4M4KA 2WVKA 2RITA 1H5TB 1FWYA 3N9WA 3RSBA 5C4BA 4FRBA 5CMJA 1H5TA 4FCEA 1PZYB 1GQ9A 1XZ6A 4DE7A 1O7OA 4KRVA 4Y7FA 1ZCTA 1MP3A 2RJ6A 1LL2A 2A8WA 1ZI3A 1G97A 1H7LA 1WVCA 3I0DA 4GBPA 2VS4A 1ZJ3A 2WAWA 4HO9A 5C49A 4AYJA 4FRHA 4J18A 4FCUA 2RJ5A 1WT3A 1NF5B 3PNNA 2Y7AA 1G0RA 5FV9A 1FXJA 2WEEA 4ARWA 3I0EA 1QWJA 1QGQA 5CMGX 2YQJA 2RIYA 3IOJA 1H7FA 2AM3A 3OH3A 1W55A 2XMEA 3CKOA 3V0QA 2PGVA 3JTJA 4FQWA 2FYDB 4R7PA 5CQMX 2W0VA 4P00A 1QGSA 1JYKA 1K4VA 1ZDGA 1LZJA 3D8VA 3KIAA 4Y63A 1S4PA 3OH4A 4ASJA 4B2WA 3RMVA 2A8UA 4KT7A 5IDSA 3BRKX 2YQHA 5C4FA 4EEAA 4EE3A 4DECA 1EZIA 2MZBA 1FG5N 2OI5A 5C8RA 1LVWA 2O1HA 2NXVA 1YP2A 1EYRA 1V84A 4KC2A 1INJA 1LL0A 3OGZA 4EEMA 2Z87A 1H7QA 1G8OA 3FOQA 1JVGA 2E3DA 3V0LA 4FRLA 1G3LA 1G95A 2XWMA 3U2WA 5CQPA 1LL3A 2RJ9A 1G93A 5CQLX 5CQNX 3HL3A 1VGZA 2DPWA 3ZF8A 2VSHA 1H7EA 3SX3A 4HO8A 2CU2A 1GX0A 1R7TA 1H7GA 1V83A 3V0NA 3ZGGA 1QG8A 1WSZA 1O23B 4NAKA 3R2WA 1H5SB 1ZCUA 5EJ1A 1MC3A 4DDZA 4Y7VA 1ZDFA 1ZJ2A 1G1LA 4CJCA 1H7TA 4Y6UA 1ZJOA 4D0TA 2OEGA 2VSIA 1VZXA 1H5RB 1TW5A 2D7RA 3GUEA 3OC9A 4FRQA 1PZTA 3F1CA 4CJ8A 4UEGA 4HO2A 3I0IX 1VZUA 3SX5A 3F1YA 2E8BA 5C3BA 4ASYA 1ZI5A 4EVWA 5L6VA 2P6WA 2P73A 3O3PA 3SPTA 3CGXA 3NGWA 2UX8A 3V0OA 1Z90A 1TW1A 4EEOA 4B3UA 3K8DA 1W57A 1R7VA 5IFYA 1ON6A 5C3DA 5FU0A 2YCMA 2X5SA 4G87A 1FOAA 3LW6A 5C1LA 4K6RA 2BO7A 2ZU7A 1O7QA 1ZJ0A 4HCQA 1WT1A 3T7NA 4D11C 3V8ZA 1YROB 3D98A 2XWNA 2FY7A 1FXOA 1O0RA 4KQLA 2VFZA 1GWVA 3OH1A 5CMIA 4ZDQA 2VXMA 3I0GA 2VS3A 4KC1A 1ZCVA 4FRDA 1S4OA 5AJNA 4B4MA 4HO0A 1G9RA 2YC3A 1S4NA 3CKJA 1W77A 5C48A 4BMAA 3OAMA 3Q80A 3D5NA 1SS9A 1IIMA 2RJ4A 4HO4A 2YC5A 4MNDA 2Y4KA 1WT0A 2Y4JA 4ECMA 2BO6A 2W0WA 1FO9A 2V0HA 2WVMA 2Z86A 3OH2A 4Y7GA 4IRQA 4G3PA 3ZGFA 1FRWA 3JUJA 2FYCB 1FZWA 4JD0A 2O1FA 5C4DA 2RIZA 5FU8A 1ZCYA 1ZI1A 5HS2A 4G3SA 5FTVA 3BCVA 5BXCA 1VGWA 3RMWA 2Y4MA 3TQDA 4Y7UA 4B4BA 2JCJA 1LZIA 5EJZA 1I52A 4HG6A 1HM9A 2BO8A 4Y7TA 2OEFA 3EE5A 5L6SA 3V0PA 3DK5A 3SX8A 2V0KA 3I0JA 1H7HA 2RJ7A 4B2XA 2AH9A 1ZJPA 5EIYA 4EE4A 2RJ8A
chains in the Genus database with same CATH superfamily
4KXOA 3USQA 5J49A 1FR9A 1TVYA 4D11A 4C2SA 1H4EA 4FRAA 1JV3A 4FROA 1OQMB 3K8EA 2Q4JA 3PKQA 1R7UA 2JCOA 4KNXA 4P02A 4CVHA 5DDVA 1GWWA 2FYAA 1H3MA 4CJBA 1ZI4A 2FYBA 3U0YA 2VK9A 3SXGA 5C4CA 5D91A 2GGOA 4FRPA 5FYEA 1FGXA 3V91A 4FREA 3ZLLA 4EEGA 4IRPA 2WGZA 4HO3A 2Y4LA 2ICYA 1G2VA 2PX7A 1R7YA 5I1FA 1IINA 2AM5A 3CKVA 1R80A 4BQHA 5C38A 1H4DA 1VH3A 2ZU9A 3JUKA 1VGUA 1JV1A 3OKRA 4Y64A 5CQOA 1HM0A 2AESA 3DJ4A 4D0ZA 1ZJ1A 1HV9A 2PA4A 2X65A 3OH0A 4B5BA 2RIXA 1KWSA 2YQCA 2O1GA 5DDTA 1JYLA 1WT2A 2RJ0A 5CMFX 5AJOA 1FGGA 2PGYA 5FTSA 1H4CA 5C36A 1HM8A 1XHBA 2D7IA 3CKQA 4AC3A 4B4GA 4O6NA 3V0MA 2VXLA 3ZLKA 3ST8A 1H5SC 2AE7A 4D48A 1OMZA 3I0KA 4JISA 3U2XA 2AGDA 3I0LA 2I5EA 4AAWA 1YP4A 2J0BA 3T7OA 3I0CA 1NQIB 3U0XA 2FFVA 1LZ0A 1V82A 4XWIA 4E1KA 1NKHB 4KNRA 1MP5A 4FRMA 4M2AA 4LW3A 2YQSA 2X5ZA 1GX4A 2WE9A 4EE5A 2AECA 2APCA 1FO8A 1R7XA 2JCLA 5CMHA 3USRA 3DUVA 2P72A 1MP4A 2V0JA 1TZFA 4KPXA 2I7BA 2YESA 4AYLA 5IDTA 3U2TA 1NHEB 3T7MA 1YP3A 4M28A 1R81A 1ZHJA 1VH1A 2Y6PA 3CU0A 2VD4A 2QH5A 4YS8A 4Y6NA 2WVLA 4HO6A 4KPZA 2OI6A 3SXCA 1HJJA 2V0LA 3Q7UA 3U2UA 3SXEA 4B42A 2FFUA 1JVDA 1VGTA 1GA8A 2AM4A 3POLA 5JQQA 3SXDA 1ON8A 1NMMB 3SX7A 2BO4A 4LW6A 4NANA 3V8YA 1G23A 1H5SD 4NALA 1NWGB 2OI7A 3FWWA 4KC4A 2I5KA 2QGIA 1E5KA 2JCKA 3IOHA 1FR8A 3I0FA 4NAIA 4Y9XA 3QVBA 3I0HA 3R3IA 1GQCA 1R82A 4L41C 3PKPA 1VICA 4FIYA 3Q4SA 1VZTA 1H5SA 2RJ1A 5C4EA 4M2BA 2V0IA 3E26A 2ICXA 4HO5A 2XMHA 3IOIA 4HOCA 2VS5A 1INIA 2X60A 1H5RA 2ZU8A 3U2VA 3SXBA 3V90A 4MYBA 3SXAA 2QKXA 3CKNA 5AJPA 5C1HA 5C1GA 3TZTA 3E25A 5FUHA 1LZ7A 2GGQA 1VM8A 1OMXA 4G3QA 4Y62A 1VPAA 1ZIZA 1HJLA 2XWLA 5C3AA 5C47A 2D0JA 4M4KA 2WVKA 2RITA 1H5TB 1FWYA 3N9WA 3RSBA 5C4BA 4FRBA 5CMJA 1H5TA 4FCEA 1PZYB 1GQ9A 1XZ6A 4DE7A 1O7OA 4KRVA 4Y7FA 1ZCTA 1MP3A 2RJ6A 1LL2A 2A8WA 1ZI3A 1G97A 1H7LA 1WVCA 3I0DA 4GBPA 2VS4A 1ZJ3A 2WAWA 4HO9A 5C49A 4AYJA 4FRHA 2J0AA 4FCUA 4J18A 2RJ5A 1WT3A 1NF5B 5D92A 3PNNA 2Y7AA 1G0RA 5FV9A 1FXJA 2WEEA 4ARWA 3I0EA 1QWJA 1QGQA 5CMGX 2YQJA 2RIYA 3IOJA 1H7FA 2AM3A 3OH3A 1W55A 2XMEA 3CKOA 3V0QA 2PGVA 3JTJA 4Q7CA 4FQWA 2FYDB 4R7PA 5CQMX 2W0VA 4P00A 1QGSA 1JYKA 1K4VA 1ZDGA 1LZJA 3D8VA 3KIAA 4Y63A 1S4PA 3OH4A 4ASJA 4B2WA 3RMVA 2A8UA 4KT7A 5IDSA 3BRKX 4O6MA 2YQHA 5C4FA 4EEAA 4EE3A 4DECA 1EZIA 2MZBA 1FG5N 2OI5A 5C8RA 1LVWA 2O1HA 2NXVA 1YP2A 1EYRA 1V84A 4KC2A 1INJA 1LL0A 3OGZA 4EEMA 2Z87A 1H7QA 1G8OA 3FOQA 1JVGA 2E3DA 3V0LA 4FRLA 1G3LA 1G95A 2XWMA 3U2WA 5CQPA 1LL3A 2RJ9A 1G93A 5CQLX 5CQNX 3HL3A 1VGZA 2DPWA 3ZF8A 2VSHA 1H7EA 3SX3A 4HO8A 2CU2A 1GX0A 1R7TA 1H7GA 1V83A 3V0NA 3ZGGA 1QG8A 1WSZA 1O23B 4NAKA 3R2WA 1H5SB 1ZCUA 5EJ1A 1MC3A 4DDZA 4Y7VA 1ZDFA 1ZJ2A 1G1LA 4CJCA 1H7TA 4Y6UA 1ZJOA 4D0TA 2OEGA 2VSIA 1VZXA 1H5RB 1TW5A 2D7RA 3GUEA 3OC9A 4FRQA 1PZTA 3F1CA 4CJ8A 4UEGA 4HO2A 3I0IX 1VZUA 3SX5A 3F1YA 2E8BA 5C3BA 4ASYA 1ZI5A 2C0NA 4EVWA 5L6VA 4MIXA 2P6WA 2P73A 3O3PA 3SPTA 3CGXA 3NGWA 2UX8A 3V0OA 1Z90A 1TW1A 4EEOA 4B3UA 3K8DA 1W57A 1R7VA 5IFYA 1ON6A 5C3DA 5FU0A 2YCMA 2X5SA 4G87A 1FOAA 3LW6A 5C1LA 4K6RA 2BO7A 2ZU7A 1O7QA 1ZJ0A 4HCQA 1WT1A 3T7NA 4D11C 3V8ZA 4FIXA 1YROB 3D98A 2XWNA 2FY7A 1FXOA 1O0RA 4KQLA 2VFZA 1GWVA 3OH1A 5CMIA 4ZDQA 2VXMA 3I0GA 2VS3A 4KC1A 1ZCVA 4FRDA 1S4OA 5AJNA 4B4MA 4HO0A 1G9RA 2YC3A 1S4NA 3CKJA 1W77A 5C48A 4BMAA 3OAMA 3Q80A 3D5NA 1SS9A 1IIMA 2RJ4A 4HO4A 2YC5A 4MNDA 2Y4KA 1WT0A 2Y4JA 4ECMA 2BO6A 2W0WA 1FO9A 2V0HA 2WVMA 2Z86A 3OH2A 4Y7GA 4IRQA 4G3PA 3ZGFA 1FRWA 3JUJA 2FYCB 1FZWA 4JD0A 2O1FA 5C4DA 2RIZA 5FU8A 1ZCYA 1ZI1A 5HS2A 4G3SA 5FTVA 3BCVA 5BXCA 1VGWA 3RMWA 2Y4MA 3TQDA 4Y7UA 4B4BA 2JCJA 1LZIA 5EJZA 1I52A 4HG6A 1HM9A 2BO8A 4Y7TA 2OEFA 3EE5A 5L6SA 3V0PA 3DK5A 3SX8A 2V0KA 3I0JA 1H7HA 2RJ7A 4B2XA 2AH9A 1ZJPA 5EIYA 4EE4A 2RJ8A
chains in the Genus database with same CATH topology
4KXOA 3USQA 5J49A 1FR9A 1TVYA 4D11A 4C2SA 1H4EA 4FRAA 1JV3A 4FROA 1OQMB 3K8EA 2Q4JA 3PKQA 1R7UA 2JCOA 4KNXA 4P02A 4CVHA 5DDVA 1GWWA 2FYAA 1H3MA 4CJBA 1ZI4A 2FYBA 3U0YA 2VK9A 3SXGA 5C4CA 5D91A 2GGOA 4FRPA 5FYEA 1FGXA 3V91A 4FREA 3ZLLA 4EEGA 4IRPA 2WGZA 4HO3A 2Y4LA 2ICYA 1G2VA 2PX7A 1R7YA 5I1FA 1IINA 2AM5A 3CKVA 1R80A 4BQHA 5C38A 1H4DA 1VH3A 2ZU9A 3JUKA 1VGUA 1JV1A 3OKRA 4Y64A 5CQOA 1HM0A 2AESA 3DJ4A 4D0ZA 1ZJ1A 1HV9A 2PA4A 2X65A 3OH0A 4B5BA 2RIXA 1KWSA 2YQCA 2O1GA 5DDTA 1JYLA 1WT2A 2RJ0A 5CMFX 5AJOA 1FGGA 2PGYA 5FTSA 1H4CA 5C36A 1HM8A 1XHBA 2D7IA 3CKQA 4AC3A 4B4GA 4O6NA 3V0MA 2VXLA 3ZLKA 3ST8A 1H5SC 2AE7A 4D48A 1OMZA 3I0KA 4JISA 3U2XA 2AGDA 3I0LA 2I5EA 4AAWA 1YP4A 2J0BA 3T7OA 3I0CA 1NQIB 3U0XA 2FFVA 1LZ0A 1V82A 4XWIA 4E1KA 1NKHB 4KNRA 1MP5A 4FRMA 4M2AA 4LW3A 2YQSA 2X5ZA 1GX4A 2WE9A 4EE5A 2AECA 2APCA 1FO8A 1R7XA 2JCLA 5CMHA 3USRA 3DUVA 2P72A 1MP4A 2V0JA 1TZFA 4KPXA 2I7BA 2YESA 4AYLA 5IDTA 3U2TA 1NHEB 3T7MA 1YP3A 4M28A 1R81A 1ZHJA 1VH1A 2Y6PA 3CU0A 2VD4A 2QH5A 4YS8A 4Y6NA 2WVLA 4HO6A 4KPZA 2OI6A 3SXCA 1HJJA 2V0LA 3Q7UA 3U2UA 3SXEA 4B42A 2FFUA 1JVDA 1VGTA 1GA8A 2AM4A 3POLA 5JQQA 3SXDA 1ON8A 1NMMB 3SX7A 2BO4A 4LW6A 4NANA 3V8YA 1G23A 1H5SD 4NALA 1NWGB 2OI7A 3FWWA 4KC4A 2I5KA 2QGIA 1E5KA 2JCKA 3IOHA 1FR8A 3I0FA 4NAIA 4Y9XA 3QVBA 3I0HA 3R3IA 1GQCA 1R82A 4L41C 3PKPA 1VICA 4FIYA 3Q4SA 1VZTA 1H5SA 2RJ1A 5C4EA 4M2BA 2V0IA 3E26A 2ICXA 4HO5A 2XMHA 3IOIA 4HOCA 2VS5A 1INIA 2X60A 1H5RA 2ZU8A 3U2VA 3SXBA 3V90A 4MYBA 3SXAA 2QKXA 3CKNA 5AJPA 5C1HA 5C1GA 3TZTA 3E25A 5FUHA 1LZ7A 2GGQA 1VM8A 1OMXA 4G3QA 4Y62A 1VPAA 1ZIZA 1HJLA 2XWLA 5C3AA 5C47A 2D0JA 4M4KA 2WVKA 2RITA 1H5TB 1FWYA 3N9WA 3RSBA 5C4BA 4FRBA 5CMJA 1H5TA 4FCEA 1PZYB 1GQ9A 1XZ6A 4DE7A 1O7OA 4KRVA 4Y7FA 1ZCTA 1MP3A 2RJ6A 1LL2A 2A8WA 1ZI3A 1G97A 1H7LA 1WVCA 3I0DA 4GBPA 2VS4A 1ZJ3A 2WAWA 4HO9A 5C49A 4AYJA 4FRHA 2J0AA 4FCUA 4J18A 2RJ5A 1WT3A 1NF5B 5D92A 3PNNA 2Y7AA 1G0RA 5FV9A 1FXJA 2WEEA 4ARWA 3I0EA 1QWJA 1QGQA 5CMGX 2YQJA 2RIYA 3IOJA 1H7FA 2AM3A 3OH3A 1W55A 2XMEA 3CKOA 3V0QA 2PGVA 3JTJA 4Q7CA 4FQWA 2FYDB 4R7PA 5CQMX 2W0VA 4P00A 1QGSA 1JYKA 1K4VA 1ZDGA 1LZJA 3D8VA 3KIAA 4Y63A 1S4PA 3OH4A 4ASJA 4B2WA 3RMVA 2A8UA 4KT7A 5IDSA 3BRKX 4O6MA 2YQHA 5C4FA 4EEAA 4EE3A 4DECA 1EZIA 2MZBA 1FG5N 2OI5A 5C8RA 1LVWA 2O1HA 2NXVA 1YP2A 1EYRA 1V84A 4KC2A 1INJA 1LL0A 3OGZA 4EEMA 2Z87A 1H7QA 1G8OA 3FOQA 1JVGA 2E3DA 3V0LA 4FRLA 1G3LA 1G95A 2XWMA 3U2WA 5CQPA 1LL3A 2RJ9A 1G93A 5CQLX 5CQNX 3HL3A 1VGZA 2DPWA 3ZF8A 2VSHA 1H7EA 3SX3A 4HO8A 2CU2A 1GX0A 1R7TA 1H7GA 1V83A 3V0NA 3ZGGA 1QG8A 1WSZA 1O23B 4NAKA 3R2WA 1H5SB 1ZCUA 5EJ1A 1MC3A 4DDZA 4Y7VA 1ZDFA 1ZJ2A 1G1LA 4CJCA 1H7TA 4Y6UA 1ZJOA 4D0TA 2OEGA 2VSIA 1VZXA 1H5RB 1TW5A 2D7RA 3GUEA 3OC9A 4FRQA 1PZTA 3F1CA 4CJ8A 4UEGA 4HO2A 3I0IX 1VZUA 3SX5A 3F1YA 2E8BA 5C3BA 4ASYA 1ZI5A 2C0NA 4EVWA 5L6VA 4MIXA 2P6WA 2P73A 3O3PA 3SPTA 3CGXA 3NGWA 2UX8A 3V0OA 1Z90A 1TW1A 4EEOA 4B3UA 3K8DA 1W57A 1R7VA 5IFYA 1ON6A 5C3DA 5FU0A 2YCMA 2X5SA 4G87A 1FOAA 3LW6A 5C1LA 4K6RA 2BO7A 2ZU7A 1O7QA 1ZJ0A 4HCQA 1WT1A 3T7NA 4D11C 3V8ZA 4FIXA 1YROB 3D98A 2XWNA 2FY7A 1FXOA 1O0RA 4KQLA 2VFZA 1GWVA 3OH1A 5CMIA 4ZDQA 2VXMA 3I0GA 2VS3A 4KC1A 1ZCVA 4FRDA 1S4OA 5AJNA 4B4MA 4HO0A 1G9RA 2YC3A 1S4NA 3CKJA 1W77A 5C48A 4BMAA 3OAMA 3Q80A 3D5NA 1SS9A 1IIMA 2RJ4A 4HO4A 2YC5A 4MNDA 2Y4KA 1WT0A 2Y4JA 4ECMA 2BO6A 2W0WA 1FO9A 2V0HA 2WVMA 2Z86A 3OH2A 4Y7GA 4IRQA 4G3PA 3ZGFA 1FRWA 3JUJA 2FYCB 1FZWA 4JD0A 2O1FA 5C4DA 2RIZA 5FU8A 1ZCYA 1ZI1A 5HS2A 4G3SA 5FTVA 3BCVA 5BXCA 1VGWA 3RMWA 2Y4MA 3TQDA 4Y7UA 4B4BA 2JCJA 1LZIA 5EJZA 1I52A 4HG6A 1HM9A 2BO8A 4Y7TA 2OEFA 3EE5A 5L6SA 3V0PA 3DK5A 3SX8A 2V0KA 3I0JA 1H7HA 2RJ7A 4B2XA 2AH9A 1ZJPA 5EIYA 4EE4A 2RJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXO A;  3USQ A;  5J49 A;  1FR9 A;  1TVY A;  4D11 A;  4C2S A;  1H4E A;  4FRA A;  1JV3 A;  4FRO A;  1OQM B;  3K8E A;  2Q4J A;  3PKQ A;  1R7U A;  2JCO A;  4KNX A;  4P02 A;  4CVH A;  5DDV A;  1GWW A;  2FYA A;  1H3M A;  4CJB A;  1ZI4 A;  2FYB A;  3U0Y A;  3SXG A;  5C4C A;  2GGO A;  4FRP A;  5FYE A;  1FGX A;  3V91 A;  4FRE A;  3ZLL A;  4EEG A;  4IRP A;  2WGZ A;  4HO3 A;  2Y4L A;  2ICY A;  1G2V A;  2PX7 A;  1R7Y A;  5I1F A;  1IIN A;  2AM5 A;  3CKV A;  1R80 A;  4BQH A;  5C38 A;  1H4D A;  1VH3 A;  2ZU9 A;  3JUK A;  1VGU A;  1JV1 A;  3OKR A;  4Y64 A;  5CQO A;  1HM0 A;  2AES A;  3DJ4 A;  4D0Z A;  1ZJ1 A;  1HV9 A;  2PA4 A;  2X65 A;  3OH0 A;  4B5B A;  2RIX A;  1KWS A;  2YQC A;  2O1G A;  5DDT A;  1JYL A;  1WT2 A;  2RJ0 A;  5CMF X;  5AJO A;  1FGG A;  2PGY A;  5FTS A;  1H4C A;  5C36 A;  1HM8 A;  1XHB A;  2D7I A;  3CKQ A;  4AC3 A;  4B4G A;  3V0M A;  2VXL A;  3ZLK A;  3ST8 A;  1H5S C;  2AE7 A;  4D48 A;  1OMZ A;  3I0K A;  4JIS A;  3U2X A;  2AGD A;  3I0L A;  2I5E A;  4AAW A;  1YP4 A;  3T7O A;  3I0C A;  1NQI B;  3U0X A;  2FFV A;  1LZ0 A;  1V82 A;  4XWI A;  4E1K A;  1NKH B;  4KNR A;  1MP5 A;  4FRM A;  4M2A A;  4LW3 A;  2YQS A;  2X5Z A;  1GX4 A;  2WE9 A;  4EE5 A;  2AEC A;  2APC A;  1FO8 A;  1R7X A;  2JCL A;  5CMH A;  3USR A;  3DUV A;  2P72 A;  1MP4 A;  2V0J A;  1TZF A;  4KPX A;  2I7B A;  2YES A;  4AYL A;  5IDT A;  3U2T A;  1NHE B;  3T7M A;  1YP3 A;  4M28 A;  1R81 A;  1ZHJ A;  1VH1 A;  2Y6P A;  3CU0 A;  2VD4 A;  2QH5 A;  4YS8 A;  4Y6N A;  2WVL A;  4HO6 A;  4KPZ A;  2OI6 A;  3SXC A;  1HJJ A;  2V0L A;  3Q7U A;  3U2U A;  3SXE A;  4B42 A;  2FFU A;  1JVD A;  1VGT A;  1GA8 A;  2AM4 A;  3POL A;  5JQQ A;  3SXD A;  1ON8 A;  1NMM B;  3SX7 A;  2BO4 A;  4LW6 A;  4NAN A;  3V8Y A;  1G23 A;  1H5S D;  4NAL A;  1NWG B;  2OI7 A;  3FWW A;  4KC4 A;  2I5K A;  2QGI A;  1E5K A;  2JCK A;  3IOH A;  1FR8 A;  3I0F A;  4NAI A;  4Y9X A;  3QVB A;  3I0H A;  3R3I A;  1GQC A;  1R82 A;  4L41 C;  3PKP A;  1VIC A;  3Q4S A;  1VZT A;  1H5S A;  2RJ1 A;  5C4E A;  4M2B A;  2V0I A;  3E26 A;  2ICX A;  4HO5 A;  2XMH A;  3IOI A;  4HOC A;  2VS5 A;  1INI A;  2X60 A;  1H5R A;  2ZU8 A;  3U2V A;  3SXB A;  3V90 A;  4MYB A;  3SXA A;  2QKX A;  3CKN A;  5AJP A;  5C1H A;  5C1G A;  3TZT A;  3E25 A;  5FUH A;  1LZ7 A;  2GGQ A;  1VM8 A;  1OMX A;  4G3Q A;  4Y62 A;  1VPA A;  1ZIZ A;  1HJL A;  2XWL A;  5C3A A;  5C47 A;  2D0J A;  4M4K A;  2WVK A;  2RIT A;  1H5T B;  1FWY A;  3N9W A;  3RSB A;  5C4B A;  4FRB A;  5CMJ A;  1H5T A;  4FCE A;  1PZY B;  1GQ9 A;  1XZ6 A;  4DE7 A;  1O7O A;  4KRV A;  4Y7F A;  1ZCT A;  1MP3 A;  2RJ6 A;  1LL2 A;  2A8W A;  1ZI3 A;  1G97 A;  1H7L A;  1WVC A;  3I0D A;  4GBP A;  2VS4 A;  1ZJ3 A;  2WAW A;  4HO9 A;  5C49 A;  4AYJ A;  4FRH A;  4J18 A;  4FCU A;  2RJ5 A;  1WT3 A;  1NF5 B;  3PNN A;  2Y7A A;  1G0R A;  5FV9 A;  1FXJ A;  2WEE A;  4ARW A;  3I0E A;  1QWJ A;  1QGQ A;  5CMG X;  2YQJ A;  2RIY A;  3IOJ A;  1H7F A;  2AM3 A;  3OH3 A;  1W55 A;  2XME A;  3CKO A;  3V0Q A;  2PGV A;  3JTJ A;  4FQW A;  2FYD B;  4R7P A;  5CQM X;  2W0V A;  4P00 A;  1QGS A;  1JYK A;  1K4V A;  1ZDG A;  1LZJ A;  3D8V A;  3KIA A;  4Y63 A;  1S4P A;  3OH4 A;  4ASJ A;  4B2W A;  3RMV A;  2A8U A;  4KT7 A;  5IDS A;  3BRK X;  2YQH A;  5C4F A;  4EEA A;  4EE3 A;  4DEC A;  1EZI A;  2MZB A;  1FG5 N;  2OI5 A;  5C8R A;  1LVW A;  2O1H A;  2NXV A;  1YP2 A;  1EYR A;  1V84 A;  4KC2 A;  1INJ A;  1LL0 A;  3OGZ A;  4EEM A;  2Z87 A;  1H7Q A;  1G8O A;  3FOQ A;  1JVG A;  2E3D A;  3V0L A;  4FRL A;  1G3L A;  1G95 A;  2XWM A;  3U2W A;  5CQP A;  1LL3 A;  2RJ9 A;  1G93 A;  5CQL X;  5CQN X;  3HL3 A;  1VGZ A;  2DPW A;  3ZF8 A;  2VSH A;  1H7E A;  3SX3 A;  4HO8 A;  2CU2 A;  1GX0 A;  1R7T A;  1H7G A;  1V83 A;  3V0N A;  3ZGG A;  1QG8 A;  1WSZ A;  1O23 B;  4NAK A;  3R2W A;  1H5S B;  1ZCU A;  5EJ1 A;  1MC3 A;  4DDZ A;  4Y7V A;  1ZDF A;  1ZJ2 A;  1G1L A;  4CJC A;  1H7T A;  4Y6U A;  1ZJO A;  4D0T A;  2OEG A;  2VSI A;  1VZX A;  1H5R B;  1TW5 A;  2D7R A;  3GUE A;  3OC9 A;  4FRQ A;  1PZT A;  3F1C A;  4CJ8 A;  4UEG A;  4HO2 A;  3I0I X;  1VZU A;  3SX5 A;  3F1Y A;  2E8B A;  5C3B A;  4ASY A;  1ZI5 A;  4EVW A;  5L6V A;  2P6W A;  2P73 A;  3O3P A;  3SPT A;  3CGX A;  3NGW A;  2UX8 A;  3V0O A;  1Z90 A;  1TW1 A;  4EEO A;  4B3U A;  3K8D A;  1W57 A;  1R7V A;  5IFY A;  1ON6 A;  5C3D A;  5FU0 A;  2YCM A;  2X5S A;  4G87 A;  1FOA A;  3LW6 A;  5C1L A;  4K6R A;  2BO7 A;  2ZU7 A;  1O7Q A;  1ZJ0 A;  4HCQ A;  1WT1 A;  3T7N A;  4D11 C;  3V8Z A;  1YRO B;  3D98 A;  2XWN A;  2FY7 A;  1FXO A;  1O0R A;  4KQL A;  2VFZ A;  1GWV A;  3OH1 A;  5CMI A;  4ZDQ A;  2VXM A;  3I0G A;  2VS3 A;  4KC1 A;  1ZCV A;  4FRD A;  1S4O A;  5AJN A;  4B4M A;  4HO0 A;  1G9R A;  2YC3 A;  1S4N A;  3CKJ A;  1W77 A;  5C48 A;  4BMA A;  3OAM A;  3Q80 A;  3D5N A;  1SS9 A;  1IIM A;  2RJ4 A;  4HO4 A;  2YC5 A;  4MND A;  2Y4K A;  1WT0 A;  2Y4J A;  4ECM A;  2BO6 A;  2W0W A;  1FO9 A;  2V0H A;  2WVM A;  2Z86 A;  3OH2 A;  4Y7G A;  4IRQ A;  4G3P A;  3ZGF A;  1FRW A;  3JUJ A;  2FYC B;  1FZW A;  4JD0 A;  2O1F A;  5C4D A;  2RIZ A;  5FU8 A;  1ZCY A;  1ZI1 A;  5HS2 A;  4G3S A;  5FTV A;  3BCV A;  5BXC A;  1VGW A;  3RMW A;  2Y4M A;  3TQD A;  4Y7U A;  4B4B A;  2JCJ A;  1LZI A;  5EJZ A;  1I52 A;  4HG6 A;  1HM9 A;  2BO8 A;  4Y7T A;  2OEF A;  3EE5 A;  5L6S A;  3V0P A;  3DK5 A;  3SX8 A;  2V0K A;  3I0J A;  1H7H A;  2RJ7 A;  4B2X A;  2AH9 A;  1ZJP A;  5EIY A;  4EE4 A;  2RJ8 A; 
#chains in the Genus database with same CATH topology
 4KXO A;  3USQ A;  5J49 A;  1FR9 A;  1TVY A;  4D11 A;  4C2S A;  1H4E A;  4FRA A;  1JV3 A;  4FRO A;  1OQM B;  3K8E A;  2Q4J A;  3PKQ A;  1R7U A;  2JCO A;  4KNX A;  4P02 A;  4CVH A;  5DDV A;  1GWW A;  2FYA A;  1H3M A;  4CJB A;  1ZI4 A;  2FYB A;  3U0Y A;  2VK9 A;  3SXG A;  5C4C A;  5D91 A;  2GGO A;  4FRP A;  5FYE A;  1FGX A;  3V91 A;  4FRE A;  3ZLL A;  4EEG A;  4IRP A;  2WGZ A;  4HO3 A;  2Y4L A;  2ICY A;  1G2V A;  2PX7 A;  1R7Y A;  5I1F A;  1IIN A;  2AM5 A;  3CKV A;  1R80 A;  4BQH A;  5C38 A;  1H4D A;  1VH3 A;  2ZU9 A;  3JUK A;  1VGU A;  1JV1 A;  3OKR A;  4Y64 A;  5CQO A;  1HM0 A;  2AES A;  3DJ4 A;  4D0Z A;  1ZJ1 A;  1HV9 A;  2PA4 A;  2X65 A;  3OH0 A;  4B5B A;  2RIX A;  1KWS A;  2YQC A;  2O1G A;  5DDT A;  1JYL A;  1WT2 A;  2RJ0 A;  5CMF X;  5AJO A;  1FGG A;  2PGY A;  5FTS A;  1H4C A;  5C36 A;  1HM8 A;  1XHB A;  2D7I A;  3CKQ A;  4AC3 A;  4B4G A;  4O6N A;  3V0M A;  2VXL A;  3ZLK A;  3ST8 A;  1H5S C;  2AE7 A;  4D48 A;  1OMZ A;  3I0K A;  4JIS A;  3U2X A;  2AGD A;  3I0L A;  2I5E A;  4AAW A;  1YP4 A;  2J0B A;  3T7O A;  3I0C A;  1NQI B;  3U0X A;  2FFV A;  1LZ0 A;  1V82 A;  4XWI A;  4E1K A;  1NKH B;  4KNR A;  1MP5 A;  4FRM A;  4M2A A;  4LW3 A;  2YQS A;  2X5Z A;  1GX4 A;  2WE9 A;  4EE5 A;  2AEC A;  2APC A;  1FO8 A;  1R7X A;  2JCL A;  5CMH A;  3USR A;  3DUV A;  2P72 A;  1MP4 A;  2V0J A;  1TZF A;  4KPX A;  2I7B A;  2YES A;  4AYL A;  5IDT A;  3U2T A;  1NHE B;  3T7M A;  1YP3 A;  4M28 A;  1R81 A;  1ZHJ A;  1VH1 A;  2Y6P A;  3CU0 A;  2VD4 A;  2QH5 A;  4YS8 A;  4Y6N A;  2WVL A;  4HO6 A;  4KPZ A;  2OI6 A;  3SXC A;  1HJJ A;  2V0L A;  3Q7U A;  3U2U A;  3SXE A;  4B42 A;  2FFU A;  1JVD A;  1VGT A;  1GA8 A;  2AM4 A;  3POL A;  5JQQ A;  3SXD A;  1ON8 A;  1NMM B;  3SX7 A;  2BO4 A;  4LW6 A;  4NAN A;  3V8Y A;  1G23 A;  1H5S D;  4NAL A;  1NWG B;  2OI7 A;  3FWW A;  4KC4 A;  2I5K A;  2QGI A;  1E5K A;  2JCK A;  3IOH A;  1FR8 A;  3I0F A;  4NAI A;  4Y9X A;  3QVB A;  3I0H A;  3R3I A;  1GQC A;  1R82 A;  4L41 C;  3PKP A;  1VIC A;  4FIY A;  3Q4S A;  1VZT A;  1H5S A;  2RJ1 A;  5C4E A;  4M2B A;  2V0I A;  3E26 A;  2ICX A;  4HO5 A;  2XMH A;  3IOI A;  4HOC A;  2VS5 A;  1INI A;  2X60 A;  1H5R A;  2ZU8 A;  3U2V A;  3SXB A;  3V90 A;  4MYB A;  3SXA A;  2QKX A;  3CKN A;  5AJP A;  5C1H A;  5C1G A;  3TZT A;  3E25 A;  5FUH A;  1LZ7 A;  2GGQ A;  1VM8 A;  1OMX A;  4G3Q A;  4Y62 A;  1VPA A;  1ZIZ A;  1HJL A;  2XWL A;  5C3A A;  5C47 A;  2D0J A;  4M4K A;  2WVK A;  2RIT A;  1H5T B;  1FWY A;  3N9W A;  3RSB A;  5C4B A;  4FRB A;  5CMJ A;  1H5T A;  4FCE A;  1PZY B;  1GQ9 A;  1XZ6 A;  4DE7 A;  1O7O A;  4KRV A;  4Y7F A;  1ZCT A;  1MP3 A;  2RJ6 A;  1LL2 A;  2A8W A;  1ZI3 A;  1G97 A;  1H7L A;  1WVC A;  3I0D A;  4GBP A;  2VS4 A;  1ZJ3 A;  2WAW A;  4HO9 A;  5C49 A;  4AYJ A;  4FRH A;  2J0A A;  4FCU A;  4J18 A;  2RJ5 A;  1WT3 A;  1NF5 B;  5D92 A;  3PNN A;  2Y7A A;  1G0R A;  5FV9 A;  1FXJ A;  2WEE A;  4ARW A;  3I0E A;  1QWJ A;  1QGQ A;  5CMG X;  2YQJ A;  2RIY A;  3IOJ A;  1H7F A;  2AM3 A;  3OH3 A;  1W55 A;  2XME A;  3CKO A;  3V0Q A;  2PGV A;  3JTJ A;  4Q7C A;  4FQW A;  2FYD B;  4R7P A;  5CQM X;  2W0V A;  4P00 A;  1QGS A;  1JYK A;  1K4V A;  1ZDG A;  1LZJ A;  3D8V A;  3KIA A;  4Y63 A;  1S4P A;  3OH4 A;  4ASJ A;  4B2W A;  3RMV A;  2A8U A;  4KT7 A;  5IDS A;  3BRK X;  4O6M A;  2YQH A;  5C4F A;  4EEA A;  4EE3 A;  4DEC A;  1EZI A;  2MZB A;  1FG5 N;  2OI5 A;  5C8R A;  1LVW A;  2O1H A;  2NXV A;  1YP2 A;  1EYR A;  1V84 A;  4KC2 A;  1INJ A;  1LL0 A;  3OGZ A;  4EEM A;  2Z87 A;  1H7Q A;  1G8O A;  3FOQ A;  1JVG A;  2E3D A;  3V0L A;  4FRL A;  1G3L A;  1G95 A;  2XWM A;  3U2W A;  5CQP A;  1LL3 A;  2RJ9 A;  1G93 A;  5CQL X;  5CQN X;  3HL3 A;  1VGZ A;  2DPW A;  3ZF8 A;  2VSH A;  1H7E A;  3SX3 A;  4HO8 A;  2CU2 A;  1GX0 A;  1R7T A;  1H7G A;  1V83 A;  3V0N A;  3ZGG A;  1QG8 A;  1WSZ A;  1O23 B;  4NAK A;  3R2W A;  1H5S B;  1ZCU A;  5EJ1 A;  1MC3 A;  4DDZ A;  4Y7V A;  1ZDF A;  1ZJ2 A;  1G1L A;  4CJC A;  1H7T A;  4Y6U A;  1ZJO A;  4D0T A;  2OEG A;  2VSI A;  1VZX A;  1H5R B;  1TW5 A;  2D7R A;  3GUE A;  3OC9 A;  4FRQ A;  1PZT A;  3F1C A;  4CJ8 A;  4UEG A;  4HO2 A;  3I0I X;  1VZU A;  3SX5 A;  3F1Y A;  2E8B A;  5C3B A;  4ASY A;  1ZI5 A;  2C0N A;  4EVW A;  5L6V A;  4MIX A;  2P6W A;  2P73 A;  3O3P A;  3SPT A;  3CGX A;  3NGW A;  2UX8 A;  3V0O A;  1Z90 A;  1TW1 A;  4EEO A;  4B3U A;  3K8D A;  1W57 A;  1R7V A;  5IFY A;  1ON6 A;  5C3D A;  5FU0 A;  2YCM A;  2X5S A;  4G87 A;  1FOA A;  3LW6 A;  5C1L A;  4K6R A;  2BO7 A;  2ZU7 A;  1O7Q A;  1ZJ0 A;  4HCQ A;  1WT1 A;  3T7N A;  4D11 C;  3V8Z A;  4FIX A;  1YRO B;  3D98 A;  2XWN A;  2FY7 A;  1FXO A;  1O0R A;  4KQL A;  2VFZ A;  1GWV A;  3OH1 A;  5CMI A;  4ZDQ A;  2VXM A;  3I0G A;  2VS3 A;  4KC1 A;  1ZCV A;  4FRD A;  1S4O A;  5AJN A;  4B4M A;  4HO0 A;  1G9R A;  2YC3 A;  1S4N A;  3CKJ A;  1W77 A;  5C48 A;  4BMA A;  3OAM A;  3Q80 A;  3D5N A;  1SS9 A;  1IIM A;  2RJ4 A;  4HO4 A;  2YC5 A;  4MND A;  2Y4K A;  1WT0 A;  2Y4J A;  4ECM A;  2BO6 A;  2W0W A;  1FO9 A;  2V0H A;  2WVM A;  2Z86 A;  3OH2 A;  4Y7G A;  4IRQ A;  4G3P A;  3ZGF A;  1FRW A;  3JUJ A;  2FYC B;  1FZW A;  4JD0 A;  2O1F A;  5C4D A;  2RIZ A;  5FU8 A;  1ZCY A;  1ZI1 A;  5HS2 A;  4G3S A;  5FTV A;  3BCV A;  5BXC A;  1VGW A;  3RMW A;  2Y4M A;  3TQD A;  4Y7U A;  4B4B A;  2JCJ A;  1LZI A;  5EJZ A;  1I52 A;  4HG6 A;  1HM9 A;  2BO8 A;  4Y7T A;  2OEF A;  3EE5 A;  5L6S A;  3V0P A;  3DK5 A;  3SX8 A;  2V0K A;  3I0J A;  1H7H A;  2RJ7 A;  4B2X A;  2AH9 A;  1ZJP A;  5EIY A;  4EE4 A;  2RJ8 A; 
#chains in the Genus database with same CATH homology
 4KXO A;  3USQ A;  5J49 A;  1FR9 A;  1TVY A;  4D11 A;  4C2S A;  1H4E A;  4FRA A;  1JV3 A;  4FRO A;  1OQM B;  3K8E A;  2Q4J A;  3PKQ A;  1R7U A;  2JCO A;  4KNX A;  4P02 A;  4CVH A;  5DDV A;  1GWW A;  2FYA A;  1H3M A;  4CJB A;  1ZI4 A;  2FYB A;  3U0Y A;  2VK9 A;  3SXG A;  5C4C A;  5D91 A;  2GGO A;  4FRP A;  5FYE A;  1FGX A;  3V91 A;  4FRE A;  3ZLL A;  4EEG A;  4IRP A;  2WGZ A;  4HO3 A;  2Y4L A;  2ICY A;  1G2V A;  2PX7 A;  1R7Y A;  5I1F A;  1IIN A;  2AM5 A;  3CKV A;  1R80 A;  4BQH A;  5C38 A;  1H4D A;  1VH3 A;  2ZU9 A;  3JUK A;  1VGU A;  1JV1 A;  3OKR A;  4Y64 A;  5CQO A;  1HM0 A;  2AES A;  3DJ4 A;  4D0Z A;  1ZJ1 A;  1HV9 A;  2PA4 A;  2X65 A;  3OH0 A;  4B5B A;  2RIX A;  1KWS A;  2YQC A;  2O1G A;  5DDT A;  1JYL A;  1WT2 A;  2RJ0 A;  5CMF X;  5AJO A;  1FGG A;  2PGY A;  5FTS A;  1H4C A;  5C36 A;  1HM8 A;  1XHB A;  2D7I A;  3CKQ A;  4AC3 A;  4B4G A;  4O6N A;  3V0M A;  2VXL A;  3ZLK A;  3ST8 A;  1H5S C;  2AE7 A;  4D48 A;  1OMZ A;  3I0K A;  4JIS A;  3U2X A;  2AGD A;  3I0L A;  2I5E A;  4AAW A;  1YP4 A;  2J0B A;  3T7O A;  3I0C A;  1NQI B;  3U0X A;  2FFV A;  1LZ0 A;  1V82 A;  4XWI A;  4E1K A;  1NKH B;  4KNR A;  1MP5 A;  4FRM A;  4M2A A;  4LW3 A;  2YQS A;  2X5Z A;  1GX4 A;  2WE9 A;  4EE5 A;  2AEC A;  2APC A;  1FO8 A;  1R7X A;  2JCL A;  5CMH A;  3USR A;  3DUV A;  2P72 A;  1MP4 A;  2V0J A;  1TZF A;  4KPX A;  2I7B A;  2YES A;  4AYL A;  5IDT A;  3U2T A;  1NHE B;  3T7M A;  1YP3 A;  4M28 A;  1R81 A;  1ZHJ A;  1VH1 A;  2Y6P A;  3CU0 A;  2VD4 A;  2QH5 A;  4YS8 A;  4Y6N A;  2WVL A;  4HO6 A;  4KPZ A;  2OI6 A;  3SXC A;  1HJJ A;  2V0L A;  3Q7U A;  3U2U A;  3SXE A;  4B42 A;  2FFU A;  1JVD A;  1VGT A;  1GA8 A;  2AM4 A;  3POL A;  5JQQ A;  3SXD A;  1ON8 A;  1NMM B;  3SX7 A;  2BO4 A;  4LW6 A;  4NAN A;  3V8Y A;  1G23 A;  1H5S D;  4NAL A;  1NWG B;  2OI7 A;  3FWW A;  4KC4 A;  2I5K A;  2QGI A;  1E5K A;  2JCK A;  3IOH A;  1FR8 A;  3I0F A;  4NAI A;  4Y9X A;  3QVB A;  3I0H A;  3R3I A;  1GQC A;  1R82 A;  4L41 C;  3PKP A;  1VIC A;  4FIY A;  3Q4S A;  1VZT A;  1H5S A;  2RJ1 A;  5C4E A;  4M2B A;  2V0I A;  3E26 A;  2ICX A;  4HO5 A;  2XMH A;  3IOI A;  4HOC A;  2VS5 A;  1INI A;  2X60 A;  1H5R A;  2ZU8 A;  3U2V A;  3SXB A;  3V90 A;  4MYB A;  3SXA A;  2QKX A;  3CKN A;  5AJP A;  5C1H A;  5C1G A;  3TZT A;  3E25 A;  5FUH A;  1LZ7 A;  2GGQ A;  1VM8 A;  1OMX A;  4G3Q A;  4Y62 A;  1VPA A;  1ZIZ A;  1HJL A;  2XWL A;  5C3A A;  5C47 A;  2D0J A;  4M4K A;  2WVK A;  2RIT A;  1H5T B;  1FWY A;  3N9W A;  3RSB A;  5C4B A;  4FRB A;  5CMJ A;  1H5T A;  4FCE A;  1PZY B;  1GQ9 A;  1XZ6 A;  4DE7 A;  1O7O A;  4KRV A;  4Y7F A;  1ZCT A;  1MP3 A;  2RJ6 A;  1LL2 A;  2A8W A;  1ZI3 A;  1G97 A;  1H7L A;  1WVC A;  3I0D A;  4GBP A;  2VS4 A;  1ZJ3 A;  2WAW A;  4HO9 A;  5C49 A;  4AYJ A;  4FRH A;  2J0A A;  4FCU A;  4J18 A;  2RJ5 A;  1WT3 A;  1NF5 B;  5D92 A;  3PNN A;  2Y7A A;  1G0R A;  5FV9 A;  1FXJ A;  2WEE A;  4ARW A;  3I0E A;  1QWJ A;  1QGQ A;  5CMG X;  2YQJ A;  2RIY A;  3IOJ A;  1H7F A;  2AM3 A;  3OH3 A;  1W55 A;  2XME A;  3CKO A;  3V0Q A;  2PGV A;  3JTJ A;  4Q7C A;  4FQW A;  2FYD B;  4R7P A;  5CQM X;  2W0V A;  4P00 A;  1QGS A;  1JYK A;  1K4V A;  1ZDG A;  1LZJ A;  3D8V A;  3KIA A;  4Y63 A;  1S4P A;  3OH4 A;  4ASJ A;  4B2W A;  3RMV A;  2A8U A;  4KT7 A;  5IDS A;  3BRK X;  4O6M A;  2YQH A;  5C4F A;  4EEA A;  4EE3 A;  4DEC A;  1EZI A;  2MZB A;  1FG5 N;  2OI5 A;  5C8R A;  1LVW A;  2O1H A;  2NXV A;  1YP2 A;  1EYR A;  1V84 A;  4KC2 A;  1INJ A;  1LL0 A;  3OGZ A;  4EEM A;  2Z87 A;  1H7Q A;  1G8O A;  3FOQ A;  1JVG A;  2E3D A;  3V0L A;  4FRL A;  1G3L A;  1G95 A;  2XWM A;  3U2W A;  5CQP A;  1LL3 A;  2RJ9 A;  1G93 A;  5CQL X;  5CQN X;  3HL3 A;  1VGZ A;  2DPW A;  3ZF8 A;  2VSH A;  1H7E A;  3SX3 A;  4HO8 A;  2CU2 A;  1GX0 A;  1R7T A;  1H7G A;  1V83 A;  3V0N A;  3ZGG A;  1QG8 A;  1WSZ A;  1O23 B;  4NAK A;  3R2W A;  1H5S B;  1ZCU A;  5EJ1 A;  1MC3 A;  4DDZ A;  4Y7V A;  1ZDF A;  1ZJ2 A;  1G1L A;  4CJC A;  1H7T A;  4Y6U A;  1ZJO A;  4D0T A;  2OEG A;  2VSI A;  1VZX A;  1H5R B;  1TW5 A;  2D7R A;  3GUE A;  3OC9 A;  4FRQ A;  1PZT A;  3F1C A;  4CJ8 A;  4UEG A;  4HO2 A;  3I0I X;  1VZU A;  3SX5 A;  3F1Y A;  2E8B A;  5C3B A;  4ASY A;  1ZI5 A;  2C0N A;  4EVW A;  5L6V A;  4MIX A;  2P6W A;  2P73 A;  3O3P A;  3SPT A;  3CGX A;  3NGW A;  2UX8 A;  3V0O A;  1Z90 A;  1TW1 A;  4EEO A;  4B3U A;  3K8D A;  1W57 A;  1R7V A;  5IFY A;  1ON6 A;  5C3D A;  5FU0 A;  2YCM A;  2X5S A;  4G87 A;  1FOA A;  3LW6 A;  5C1L A;  4K6R A;  2BO7 A;  2ZU7 A;  1O7Q A;  1ZJ0 A;  4HCQ A;  1WT1 A;  3T7N A;  4D11 C;  3V8Z A;  4FIX A;  1YRO B;  3D98 A;  2XWN A;  2FY7 A;  1FXO A;  1O0R A;  4KQL A;  2VFZ A;  1GWV A;  3OH1 A;  5CMI A;  4ZDQ A;  2VXM A;  3I0G A;  2VS3 A;  4KC1 A;  1ZCV A;  4FRD A;  1S4O A;  5AJN A;  4B4M A;  4HO0 A;  1G9R A;  2YC3 A;  1S4N A;  3CKJ A;  1W77 A;  5C48 A;  4BMA A;  3OAM A;  3Q80 A;  3D5N A;  1SS9 A;  1IIM A;  2RJ4 A;  4HO4 A;  2YC5 A;  4MND A;  2Y4K A;  1WT0 A;  2Y4J A;  4ECM A;  2BO6 A;  2W0W A;  1FO9 A;  2V0H A;  2WVM A;  2Z86 A;  3OH2 A;  4Y7G A;  4IRQ A;  4G3P A;  3ZGF A;  1FRW A;  3JUJ A;  2FYC B;  1FZW A;  4JD0 A;  2O1F A;  5C4D A;  2RIZ A;  5FU8 A;  1ZCY A;  1ZI1 A;  5HS2 A;  4G3S A;  5FTV A;  3BCV A;  5BXC A;  1VGW A;  3RMW A;  2Y4M A;  3TQD A;  4Y7U A;  4B4B A;  2JCJ A;  1LZI A;  5EJZ A;  1I52 A;  4HG6 A;  1HM9 A;  2BO8 A;  4Y7T A;  2OEF A;  3EE5 A;  5L6S A;  3V0P A;  3DK5 A;  3SX8 A;  2V0K A;  3I0J A;  1H7H A;  2RJ7 A;  4B2X A;  2AH9 A;  1ZJP A;  5EIY A;  4EE4 A;  2RJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...