3V0QA

Crystal structure of the fucosylgalactoside alpha n-acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with udp and h-antigen acceptor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
297
structure length
297
Chain Sequence
AIGEFMVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYGGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histo-blood group ABO system transferase
publication title Base-modified Donor Analogues Reveal Novel Dynamic Features of a Glycosyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3v0qA00
3HL3A 2BO4A 2RIYA 2ZU8A 5CQNX 2QKXA 3RSBA 4L41C 2ZU7A 1ZJ1A 1HV9A 1H5SB 1ZI5A 1K4VA 4J18A 3I0EA 4Y7VA 2XMHA 4HO4A 4BQHA 1OMZA 1H7LA 5FTVA 3Q7UA 5CQMX 5C1GA 1ZDFA 3D98A 1FZWA 4HO2A 1H5RB 1O7QA 2FY7A 3U0YA 1VGUA 2JCKA 2VSIA 2P6WA 1V84A 2ICXA 3K8DA 3JUJA 4ARWA 4G3QA 5C1LA 2D7IA 4DE7A 1VM8A 1GX4A 1FOAA 1VZUA 2WAWA 1H7HA 1ON8A 2RJ4A 1JV3A 3U2TA 4Y63A 1FG5N 3BCVA 2YC5A 2VXMA 1JVGA 2RJ9A 3USQA 1V83A 1G97A 2XWMA 2W0VA 2O1FA 2YQJA 3I0CA 4JISA 4Y7TA 1H7EA 2WVLA 4FRLA 4HO0A 1NMMB 1OMXA 1MP4A 1GQCA 1H4CA 4ASYA 1R80A 3D5NA 1HJJA 1W57A 2UX8A 1XZ6A 2NXVA 5JQQA 1R81A 2Y4LA 3I0GA 4MNDA 5FU0A 1W55A 1FR9A 3TQDA 1FRWA 3ZGFA 2MZBA 1JVDA 2WEEA 3Q4SA 4YS8A 5EIYA 4KPXA 1H5TB 4G87A 3Q80A 1FWYA 1ZJPA 2D7RA 1HJLA 4AYJA 1NF5B 1O23B 3BRKX 1S4OA 1ZIZA 2Z86A 1WT1A 2YCMA 2P72A 5AJOA 4Y6UA 1EYRA 2Y6PA 3DJ4A 3FWWA 3PKPA 4MYBA 2Y4MA 4KXOA 4NAKA 4Y7UA 1G93A 4EE5A 4CJCA 1FXOA 4D0TA 1INIA 3SXDA 1ON6A 2FYDB 1IIMA 1H7FA 2BO7A 1TW5A 5C3BA 1MC3A 1HM8A 2Y4JA 3D8VA 3CKQA 1H5SA 1EZIA 2DPWA 3SXCA 3V0MA 1FO8A 2FFVA 3CKOA 4KT7A 4HCQA 5AJNA 3T7NA 1LZJA 1VH3A 2A8UA 2D0JA 1WSZA 4P02A 1ZCTA 4FRMA 4NAIA 4HO5A 5C1HA 1ZJ0A 3SXBA 4P00A 1XHBA 1ZCVA 2PGYA 3N9WA 3FOQA 4AC3A 3T7OA 5FU8A 1JYKA 4NALA 1H3MA 1H5RA 2O1HA 3V90A 4IRPA 1OQMB 1ZI4A 3USRA 1ZCUA 4Y64A 2JCJA 1MP5A 1TVYA 2OI5A 4KPZA 2PGVA 4LW6A 1FO9A 2OEFA 2A8WA 4Y9XA 3I0LA 1VZXA 4B2XA 2VS3A 3I0IX 4FRAA 2XMEA 4ECMA 4ZDQA 4HO6A 1HM9A 1H5SD 3OH4A 3SX8A 2X60A 1ZI1A 2V0HA 2I7BA 1G3LA 4EEOA 5C8RA 4GBPA 4Y7FA 1ZCYA 1E5KA 5C4EA 2PX7A 1HM0A 5C48A 3CKVA 3ZGGA 1WT0A 1G23A 3CGXA 3SX7A 3OH1A 1R7XA 2BO8A 1S4NA 5EJZA 4M2BA 4BMAA 1NWGB 1VGTA 2AM5A 1H5TA 1VH1A 4HOCA 4K6RA 1G95A 5DDTA 2OI7A 1INJA 4FRHA 2W0WA 1R7VA 1SS9A 2XWLA 1W77A 2ICYA 3O3PA 3DK5A 3RMVA 2P73A 1ZJ2A 5IDTA 5CQPA 5C49A 5CMJA 3OGZA 1IINA 4FCUA 2FFUA 4KRVA 4B4MA 1R7TA 4KC1A 1O7OA 4KQLA 1PZYB 2Q4JA 3OC9A 5C3AA 1H7QA 2OEGA 1WT2A 2RJ0A 1LL3A 4HO9A 3V8YA 3V0QA 4KNRA 4B5BA 3V91A 2RITA 5L6SA 2RJ5A 4CJ8A 1LL2A 3OH2A 3I0JA 1GX0A 3IOIA 3U0XA 1MP3A 5C4DA 3PKQA 2WVMA 5HS2A 2VD4A 1ZHJA 2Y4KA 3I0DA 2VS4A 1YP2A 3GUEA 4D48A 3OAMA 5L6VA 3K8EA 3RMWA 1R82A 4C2SA 3U2UA 1GWWA 4EEMA 4EE4A 2QH5A 1LL0A 5DDVA 4FRPA 1H7GA 1ZDGA 3ZLLA 2GGQA 1QWJA 4CVHA 1YROB 1QGQA 1H5SC 2V0LA 3ZF8A 4FQWA 2RIZA 2X65A 5CMGX 3V0PA 1FGGA 1JYLA 1V82A 1FR8A 2ZU9A 3OKRA 4NANA 1H4EA 2RJ7A 5EJ1A 1QG8A 1YP4A 2PA4A 3LW6A 2YQSA 4B2WA 3CKJA 4E1KA 3TZTA 1VICA 1G8OA 1GA8A 3SXGA 4B4BA 4AAWA 1ZJ3A 3SXAA 2AGDA 1R7UA 2Z87A 1H7TA 2V0KA 2YESA 5FYEA 4JD0A 3SX5A 1G2VA 5C3DA 2FYBA 4B3UA 3QVBA 3I0HA 2BO6A 2WVKA 5FUHA 1VGWA 4LW3A 1LZ7A 2AECA 3E25A 1JV1A 5CQLX 5CMIA 1GQ9A 1PZTA 3NGWA 2RJ6A 4XWIA 2E3DA 3V0LA 2VSHA 2X5SA 2O1GA 1NKHB 1Z90A 5I1FA 2AM3A 4EEGA 2AE7A 3V0NA 4DECA 2YQCA 2YC3A 2V0IA 2FYAA 4G3SA 2VXLA 4IRQA 4FRDA 1WVCA 5IFYA 1ZI3A 5CQOA 2CU2A 3SPTA 2OI6A 1R7YA 2V0JA 1TZFA 1LZ0A 4M4KA 3IOJA 2Y7AA 4FCEA 1FXJA 5AJPA 5C4BA 3U2WA 4R7PA 3I0KA 3ZLKA 1VZTA 4M28A 3JTJA 4FROA 3KIAA 4D0ZA 1VGZA 5CMHA 2RJ8A 3DUVA 3F1YA 3U2VA 3U2XA 2FYCB 4HO8A 1H4DA 1FGXA 2AESA 3R2WA 1YP3A 5BXCA 2WE9A 4KC2A 4Y6NA 2QGIA 4KC4A 5C47A 2E8BA 2YQHA 3IOHA 3I0FA 4M2AA 4FRQA 3CU0A 3E26A 4EEAA 3V8ZA 1S4PA 2I5EA 1VPAA 5FV9A 1NQIB 2AM4A 5J49A 1QGSA 3POLA 5CMFX 5IDSA 1ZJOA 4CJBA 2JCLA 2AH9A 2RIXA 3SX3A 2X5ZA 2GGOA 1GWVA 4ASJA 1TW1A 2VS5A 1G0RA 2RJ1A 1O0RA 3EE5A 1G9RA 4B42A 3V0OA 1LVWA 1WT3A 4FRBA 4DDZA 5FTSA 4FREA 2I5KA 2WGZA 2VFZA 3T7MA 4EE3A 4KNXA 4Y7GA 4EVWA 1G1LA 4Y62A 1KWSA 4D11A 4AYLA 5C36A 4HO3A 2XWNA 3OH3A 1NHEB 2JCOA 5C38A 3PNNA 4G3PA 1LZIA 3F1CA 4B4GA 1I52A 3ST8A 4D11C 4HG6A 3OH0A 5C4FA 3CKNA 3SXEA 4UEGA 5C4CA 3R3IA 3JUKA 2APCA
chains in the Genus database with same CATH superfamily
3HL3A 2BO4A 2RIYA 2ZU8A 5CQNX 2QKXA 3RSBA 4L41C 2ZU7A 1ZJ1A 1HV9A 1H5SB 1ZI5A 1K4VA 4J18A 3I0EA 4Y7VA 2XMHA 4HO4A 4BQHA 1OMZA 1H7LA 5FTVA 3Q7UA 5CQMX 5C1GA 1ZDFA 3D98A 1FZWA 4HO2A 1H5RB 1O7QA 2FY7A 3U0YA 1VGUA 2JCKA 2VSIA 2P6WA 1V84A 2ICXA 3K8DA 3JUJA 4ARWA 4G3QA 5C1LA 2D7IA 4DE7A 1VM8A 1GX4A 1FOAA 1VZUA 2WAWA 1H7HA 1ON8A 2RJ4A 1JV3A 3U2TA 4Y63A 1FG5N 3BCVA 2YC5A 2VXMA 1JVGA 2RJ9A 3USQA 1V83A 1G97A 2XWMA 2W0VA 4O6MA 2O1FA 2YQJA 3I0CA 4JISA 4Y7TA 1H7EA 2WVLA 4FRLA 4HO0A 1NMMB 1OMXA 1MP4A 2C0NA 1GQCA 1H4CA 4ASYA 1R80A 3D5NA 1HJJA 1W57A 2UX8A 1XZ6A 2NXVA 5JQQA 1R81A 2Y4LA 3I0GA 4MNDA 5FU0A 1W55A 1FR9A 3TQDA 1FRWA 3ZGFA 2MZBA 1JVDA 2WEEA 3Q4SA 4YS8A 5EIYA 4KPXA 1H5TB 4G87A 3Q80A 1FWYA 1ZJPA 2D7RA 1HJLA 4AYJA 1NF5B 1O23B 3BRKX 1S4OA 1ZIZA 2Z86A 1WT1A 2YCMA 2P72A 5AJOA 4Y6UA 1EYRA 2Y6PA 3DJ4A 3FWWA 3PKPA 4MYBA 2Y4MA 4KXOA 4NAKA 4Y7UA 1G93A 4EE5A 4CJCA 1FXOA 4D0TA 1INIA 3SXDA 1ON6A 2FYDB 1IIMA 1H7FA 2BO7A 1TW5A 5C3BA 1MC3A 1HM8A 2Y4JA 2J0BA 3D8VA 3CKQA 1H5SA 1EZIA 2DPWA 3SXCA 3V0MA 1FO8A 2FFVA 3CKOA 4KT7A 4HCQA 5AJNA 3T7NA 1LZJA 1VH3A 2A8UA 2D0JA 1WSZA 4P02A 1ZCTA 4FRMA 4NAIA 4HO5A 5C1HA 1ZJ0A 3SXBA 4P00A 1XHBA 1ZCVA 2PGYA 3N9WA 3FOQA 4AC3A 3T7OA 5FU8A 1JYKA 4NALA 1H3MA 1H5RA 2O1HA 3V90A 4IRPA 1OQMB 1ZI4A 3USRA 1ZCUA 4Y64A 2JCJA 1MP5A 1TVYA 2OI5A 4KPZA 2PGVA 4LW6A 1FO9A 2OEFA 2A8WA 4Y9XA 3I0LA 1VZXA 4B2XA 2VS3A 3I0IX 4FRAA 2XMEA 4ECMA 4ZDQA 4HO6A 1HM9A 1H5SD 3OH4A 3SX8A 2X60A 1ZI1A 2V0HA 2I7BA 1G3LA 4EEOA 5C8RA 4GBPA 4Y7FA 1ZCYA 1E5KA 5C4EA 2PX7A 1HM0A 5C48A 4Q7CA 3CKVA 3ZGGA 4MIXA 1WT0A 1G23A 3CGXA 3SX7A 3OH1A 1R7XA 2BO8A 1S4NA 5EJZA 4M2BA 4BMAA 1NWGB 1VGTA 2AM5A 1H5TA 1VH1A 4HOCA 4K6RA 1G95A 5DDTA 2OI7A 1INJA 4FRHA 2W0WA 1R7VA 1SS9A 2XWLA 1W77A 2ICYA 3O3PA 3DK5A 3RMVA 2P73A 1ZJ2A 5IDTA 5CQPA 5C49A 5CMJA 4FIXA 3OGZA 1IINA 4FCUA 2FFUA 4KRVA 4B4MA 1R7TA 4KC1A 1O7OA 5D92A 4KQLA 1PZYB 2Q4JA 3OC9A 5C3AA 1H7QA 2OEGA 1WT2A 2RJ0A 1LL3A 4HO9A 3V8YA 3V0QA 4KNRA 4B5BA 3V91A 2RITA 5L6SA 2RJ5A 4CJ8A 1LL2A 3OH2A 3I0JA 1GX0A 3IOIA 3U0XA 1MP3A 5C4DA 3PKQA 2WVMA 5HS2A 2VD4A 1ZHJA 2Y4KA 3I0DA 2VS4A 1YP2A 3GUEA 4D48A 3OAMA 5L6VA 3K8EA 3RMWA 1R82A 4C2SA 3U2UA 1GWWA 4EEMA 4EE4A 2QH5A 1LL0A 5DDVA 4FRPA 1H7GA 1ZDGA 3ZLLA 2GGQA 1QWJA 4CVHA 1YROB 1QGQA 1H5SC 2V0LA 3ZF8A 4FQWA 2RIZA 2X65A 5CMGX 3V0PA 1FGGA 1JYLA 1V82A 1FR8A 2ZU9A 3OKRA 4NANA 1H4EA 2RJ7A 5EJ1A 1QG8A 1YP4A 2PA4A 3LW6A 2YQSA 4B2WA 3CKJA 4E1KA 3TZTA 1VICA 1G8OA 1GA8A 3SXGA 4B4BA 4AAWA 1ZJ3A 3SXAA 2AGDA 1R7UA 2Z87A 1H7TA 2V0KA 2YESA 5FYEA 4JD0A 3SX5A 1G2VA 5C3DA 2FYBA 4B3UA 3QVBA 3I0HA 2BO6A 2WVKA 5FUHA 1VGWA 4LW3A 1LZ7A 2AECA 3E25A 1JV1A 5CQLX 5CMIA 1GQ9A 1PZTA 3NGWA 2RJ6A 4XWIA 2E3DA 3V0LA 2VSHA 2X5SA 2O1GA 1NKHB 1Z90A 5I1FA 2AM3A 4EEGA 2AE7A 3V0NA 4DECA 2YQCA 2YC3A 2V0IA 2FYAA 4G3SA 2VXLA 4IRQA 4FRDA 1WVCA 5IFYA 1ZI3A 5CQOA 2VK9A 2CU2A 3SPTA 2OI6A 1R7YA 2V0JA 1TZFA 1LZ0A 4M4KA 3IOJA 2Y7AA 4FCEA 1FXJA 4O6NA 5AJPA 5C4BA 3U2WA 4R7PA 3I0KA 3ZLKA 1VZTA 4M28A 3JTJA 4FROA 3KIAA 4D0ZA 1VGZA 5CMHA 2RJ8A 3DUVA 3F1YA 3U2VA 3U2XA 2FYCB 4HO8A 1H4DA 1FGXA 2AESA 3R2WA 4FIYA 1YP3A 5BXCA 2WE9A 4KC2A 4Y6NA 2QGIA 4KC4A 5C47A 2E8BA 2YQHA 3IOHA 3I0FA 4M2AA 4FRQA 3CU0A 3E26A 4EEAA 3V8ZA 1S4PA 2I5EA 1VPAA 5FV9A 1NQIB 2AM4A 5J49A 1QGSA 3POLA 5CMFX 5IDSA 1ZJOA 4CJBA 2JCLA 2AH9A 2RIXA 3SX3A 2X5ZA 2GGOA 1GWVA 4ASJA 1TW1A 2VS5A 1G0RA 2RJ1A 1O0RA 3EE5A 1G9RA 4B42A 3V0OA 1LVWA 1WT3A 4FRBA 4DDZA 5FTSA 4FREA 2I5KA 2WGZA 2VFZA 3T7MA 4EE3A 4KNXA 4Y7GA 4EVWA 1G1LA 4Y62A 1KWSA 4D11A 4AYLA 5C36A 4HO3A 2XWNA 3OH3A 1NHEB 2JCOA 5C38A 3PNNA 2J0AA 4G3PA 5D91A 1LZIA 3F1CA 4B4GA 1I52A 3ST8A 4D11C 4HG6A 3OH0A 5C4FA 3CKNA 3SXEA 4UEGA 5C4CA 3R3IA 3JUKA 2APCA
chains in the Genus database with same CATH topology
3HL3A 2BO4A 2RIYA 2ZU8A 5CQNX 2QKXA 3RSBA 4L41C 2ZU7A 1ZJ1A 1HV9A 1H5SB 1ZI5A 1K4VA 4J18A 3I0EA 4Y7VA 2XMHA 4HO4A 4BQHA 1OMZA 1H7LA 5FTVA 3Q7UA 5CQMX 5C1GA 1ZDFA 3D98A 1FZWA 4HO2A 1H5RB 1O7QA 2FY7A 3U0YA 1VGUA 2JCKA 2VSIA 2P6WA 1V84A 2ICXA 3K8DA 3JUJA 4ARWA 4G3QA 5C1LA 2D7IA 4DE7A 1VM8A 1GX4A 1FOAA 1VZUA 2WAWA 1H7HA 1ON8A 2RJ4A 1JV3A 3U2TA 4Y63A 1FG5N 3BCVA 2YC5A 2VXMA 1JVGA 2RJ9A 3USQA 1V83A 1G97A 2XWMA 2W0VA 4O6MA 2O1FA 2YQJA 3I0CA 4JISA 4Y7TA 1H7EA 2WVLA 4FRLA 4HO0A 1NMMB 1OMXA 1MP4A 2C0NA 1GQCA 1H4CA 4ASYA 1R80A 3D5NA 1HJJA 1W57A 2UX8A 1XZ6A 2NXVA 5JQQA 1R81A 2Y4LA 3I0GA 4MNDA 5FU0A 1W55A 1FR9A 3TQDA 1FRWA 3ZGFA 2MZBA 1JVDA 2WEEA 3Q4SA 4YS8A 5EIYA 4KPXA 1H5TB 4G87A 3Q80A 1FWYA 1ZJPA 2D7RA 1HJLA 4AYJA 1NF5B 1O23B 3BRKX 1S4OA 1ZIZA 2Z86A 1WT1A 2YCMA 2P72A 5AJOA 4Y6UA 1EYRA 2Y6PA 3DJ4A 3FWWA 3PKPA 4MYBA 2Y4MA 4KXOA 4NAKA 4Y7UA 1G93A 4EE5A 4CJCA 1FXOA 4D0TA 1INIA 3SXDA 1ON6A 2FYDB 1IIMA 1H7FA 2BO7A 1TW5A 5C3BA 1MC3A 1HM8A 2Y4JA 2J0BA 3D8VA 3CKQA 1H5SA 1EZIA 2DPWA 3SXCA 3V0MA 1FO8A 2FFVA 3CKOA 4KT7A 4HCQA 5AJNA 3T7NA 1LZJA 1VH3A 2A8UA 2D0JA 1WSZA 4P02A 1ZCTA 4FRMA 4NAIA 4HO5A 5C1HA 1ZJ0A 3SXBA 4P00A 1XHBA 1ZCVA 2PGYA 3N9WA 3FOQA 4AC3A 3T7OA 5FU8A 1JYKA 4NALA 1H3MA 1H5RA 2O1HA 3V90A 4IRPA 1OQMB 1ZI4A 3USRA 1ZCUA 4Y64A 2JCJA 1MP5A 1TVYA 2OI5A 4KPZA 2PGVA 4LW6A 1FO9A 2OEFA 2A8WA 4Y9XA 3I0LA 1VZXA 4B2XA 2VS3A 3I0IX 4FRAA 2XMEA 4ECMA 4ZDQA 4HO6A 1HM9A 1H5SD 3OH4A 3SX8A 2X60A 1ZI1A 2V0HA 2I7BA 1G3LA 4EEOA 5C8RA 4GBPA 4Y7FA 1ZCYA 1E5KA 5C4EA 2PX7A 1HM0A 5C48A 4Q7CA 3CKVA 3ZGGA 4MIXA 1WT0A 1G23A 3CGXA 3SX7A 3OH1A 1R7XA 2BO8A 1S4NA 5EJZA 4M2BA 4BMAA 1NWGB 1VGTA 2AM5A 1H5TA 1VH1A 4HOCA 4K6RA 1G95A 5DDTA 2OI7A 1INJA 4FRHA 2W0WA 1R7VA 1SS9A 2XWLA 1W77A 2ICYA 3O3PA 3DK5A 3RMVA 2P73A 1ZJ2A 5IDTA 5CQPA 5C49A 5CMJA 4FIXA 3OGZA 1IINA 4FCUA 2FFUA 4KRVA 4B4MA 1R7TA 4KC1A 1O7OA 5D92A 4KQLA 1PZYB 2Q4JA 3OC9A 5C3AA 1H7QA 2OEGA 1WT2A 2RJ0A 1LL3A 4HO9A 3V8YA 3V0QA 4KNRA 4B5BA 3V91A 2RITA 5L6SA 2RJ5A 4CJ8A 1LL2A 3OH2A 3I0JA 1GX0A 3IOIA 3U0XA 1MP3A 5C4DA 3PKQA 2WVMA 5HS2A 2VD4A 1ZHJA 2Y4KA 3I0DA 2VS4A 1YP2A 3GUEA 4D48A 3OAMA 5L6VA 3K8EA 3RMWA 1R82A 4C2SA 3U2UA 1GWWA 4EEMA 4EE4A 2QH5A 1LL0A 5DDVA 4FRPA 1H7GA 1ZDGA 3ZLLA 2GGQA 1QWJA 4CVHA 1YROB 1QGQA 1H5SC 2V0LA 3ZF8A 4FQWA 2RIZA 2X65A 5CMGX 3V0PA 1FGGA 1JYLA 1V82A 1FR8A 2ZU9A 3OKRA 4NANA 1H4EA 2RJ7A 5EJ1A 1QG8A 1YP4A 2PA4A 3LW6A 2YQSA 4B2WA 3CKJA 4E1KA 3TZTA 1VICA 1G8OA 1GA8A 3SXGA 4B4BA 4AAWA 1ZJ3A 3SXAA 2AGDA 1R7UA 2Z87A 1H7TA 2V0KA 2YESA 5FYEA 4JD0A 3SX5A 1G2VA 5C3DA 2FYBA 4B3UA 3QVBA 3I0HA 2BO6A 2WVKA 5FUHA 1VGWA 4LW3A 1LZ7A 2AECA 3E25A 1JV1A 5CQLX 5CMIA 1GQ9A 1PZTA 3NGWA 2RJ6A 4XWIA 2E3DA 3V0LA 2VSHA 2X5SA 2O1GA 1NKHB 1Z90A 5I1FA 2AM3A 4EEGA 2AE7A 3V0NA 4DECA 2YQCA 2YC3A 2V0IA 2FYAA 4G3SA 2VXLA 4IRQA 4FRDA 1WVCA 5IFYA 1ZI3A 5CQOA 2VK9A 2CU2A 3SPTA 2OI6A 1R7YA 2V0JA 1TZFA 1LZ0A 4M4KA 3IOJA 2Y7AA 4FCEA 1FXJA 4O6NA 5AJPA 5C4BA 3U2WA 4R7PA 3I0KA 3ZLKA 1VZTA 4M28A 3JTJA 4FROA 3KIAA 4D0ZA 1VGZA 5CMHA 2RJ8A 3DUVA 3F1YA 3U2VA 3U2XA 2FYCB 4HO8A 1H4DA 1FGXA 2AESA 3R2WA 4FIYA 1YP3A 5BXCA 2WE9A 4KC2A 4Y6NA 2QGIA 4KC4A 5C47A 2E8BA 2YQHA 3IOHA 3I0FA 4M2AA 4FRQA 3CU0A 3E26A 4EEAA 3V8ZA 1S4PA 2I5EA 1VPAA 5FV9A 1NQIB 2AM4A 5J49A 1QGSA 3POLA 5CMFX 5IDSA 1ZJOA 4CJBA 2JCLA 2AH9A 2RIXA 3SX3A 2X5ZA 2GGOA 1GWVA 4ASJA 1TW1A 2VS5A 1G0RA 2RJ1A 1O0RA 3EE5A 1G9RA 4B42A 3V0OA 1LVWA 1WT3A 4FRBA 4DDZA 5FTSA 4FREA 2I5KA 2WGZA 2VFZA 3T7MA 4EE3A 4KNXA 4Y7GA 4EVWA 1G1LA 4Y62A 1KWSA 4D11A 4AYLA 5C36A 4HO3A 2XWNA 3OH3A 1NHEB 2JCOA 5C38A 3PNNA 2J0AA 4G3PA 5D91A 1LZIA 3F1CA 4B4GA 1I52A 3ST8A 4D11C 4HG6A 3OH0A 5C4FA 3CKNA 3SXEA 4UEGA 5C4CA 3R3IA 3JUKA 2APCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HL3 A;  2BO4 A;  2RIY A;  2ZU8 A;  5CQN X;  2QKX A;  3RSB A;  4L41 C;  2ZU7 A;  1ZJ1 A;  1HV9 A;  1H5S B;  1ZI5 A;  1K4V A;  4J18 A;  3I0E A;  4Y7V A;  2XMH A;  4HO4 A;  4BQH A;  1OMZ A;  1H7L A;  5FTV A;  3Q7U A;  5CQM X;  5C1G A;  1ZDF A;  3D98 A;  1FZW A;  4HO2 A;  1H5R B;  1O7Q A;  2FY7 A;  3U0Y A;  1VGU A;  2JCK A;  2VSI A;  2P6W A;  1V84 A;  2ICX A;  3K8D A;  3JUJ A;  4ARW A;  4G3Q A;  5C1L A;  2D7I A;  4DE7 A;  1VM8 A;  1GX4 A;  1FOA A;  1VZU A;  2WAW A;  1H7H A;  1ON8 A;  2RJ4 A;  1JV3 A;  3U2T A;  4Y63 A;  1FG5 N;  3BCV A;  2YC5 A;  2VXM A;  1JVG A;  2RJ9 A;  3USQ A;  1V83 A;  1G97 A;  2XWM A;  2W0V A;  2O1F A;  2YQJ A;  3I0C A;  4JIS A;  4Y7T A;  1H7E A;  2WVL A;  4FRL A;  4HO0 A;  1NMM B;  1OMX A;  1MP4 A;  1GQC A;  1H4C A;  4ASY A;  1R80 A;  3D5N A;  1HJJ A;  1W57 A;  2UX8 A;  1XZ6 A;  2NXV A;  5JQQ A;  1R81 A;  2Y4L A;  3I0G A;  4MND A;  5FU0 A;  1W55 A;  1FR9 A;  3TQD A;  1FRW A;  3ZGF A;  2MZB A;  1JVD A;  2WEE A;  3Q4S A;  4YS8 A;  5EIY A;  4KPX A;  1H5T B;  4G87 A;  3Q80 A;  1FWY A;  1ZJP A;  2D7R A;  1HJL A;  4AYJ A;  1NF5 B;  1O23 B;  3BRK X;  1S4O A;  1ZIZ A;  2Z86 A;  1WT1 A;  2YCM A;  2P72 A;  5AJO A;  4Y6U A;  1EYR A;  2Y6P A;  3DJ4 A;  3FWW A;  3PKP A;  4MYB A;  2Y4M A;  4KXO A;  4NAK A;  4Y7U A;  1G93 A;  4EE5 A;  4CJC A;  1FXO A;  4D0T A;  1INI A;  3SXD A;  1ON6 A;  2FYD B;  1IIM A;  1H7F A;  2BO7 A;  1TW5 A;  5C3B A;  1MC3 A;  1HM8 A;  2Y4J A;  3D8V A;  3CKQ A;  1H5S A;  1EZI A;  2DPW A;  3SXC A;  3V0M A;  1FO8 A;  2FFV A;  3CKO A;  4KT7 A;  4HCQ A;  5AJN A;  3T7N A;  1LZJ A;  1VH3 A;  2A8U A;  2D0J A;  1WSZ A;  4P02 A;  1ZCT A;  4FRM A;  4NAI A;  4HO5 A;  5C1H A;  1ZJ0 A;  3SXB A;  4P00 A;  1XHB A;  1ZCV A;  2PGY A;  3N9W A;  3FOQ A;  4AC3 A;  3T7O A;  5FU8 A;  1JYK A;  4NAL A;  1H3M A;  1H5R A;  2O1H A;  3V90 A;  4IRP A;  1OQM B;  1ZI4 A;  3USR A;  1ZCU A;  4Y64 A;  2JCJ A;  1MP5 A;  1TVY A;  2OI5 A;  4KPZ A;  2PGV A;  4LW6 A;  1FO9 A;  2OEF A;  2A8W A;  4Y9X A;  3I0L A;  1VZX A;  4B2X A;  2VS3 A;  3I0I X;  4FRA A;  2XME A;  4ECM A;  4ZDQ A;  4HO6 A;  1HM9 A;  1H5S D;  3OH4 A;  3SX8 A;  2X60 A;  1ZI1 A;  2V0H A;  2I7B A;  1G3L A;  4EEO A;  5C8R A;  4GBP A;  4Y7F A;  1ZCY A;  1E5K A;  5C4E A;  2PX7 A;  1HM0 A;  5C48 A;  3CKV A;  3ZGG A;  1WT0 A;  1G23 A;  3CGX A;  3SX7 A;  3OH1 A;  1R7X A;  2BO8 A;  1S4N A;  5EJZ A;  4M2B A;  4BMA A;  1NWG B;  1VGT A;  2AM5 A;  1H5T A;  1VH1 A;  4HOC A;  4K6R A;  1G95 A;  5DDT A;  2OI7 A;  1INJ A;  4FRH A;  2W0W A;  1R7V A;  1SS9 A;  2XWL A;  1W77 A;  2ICY A;  3O3P A;  3DK5 A;  3RMV A;  2P73 A;  1ZJ2 A;  5IDT A;  5CQP A;  5C49 A;  5CMJ A;  3OGZ A;  1IIN A;  4FCU A;  2FFU A;  4KRV A;  4B4M A;  1R7T A;  4KC1 A;  1O7O A;  4KQL A;  1PZY B;  2Q4J A;  3OC9 A;  5C3A A;  1H7Q A;  2OEG A;  1WT2 A;  2RJ0 A;  1LL3 A;  4HO9 A;  3V8Y A;  3V0Q A;  4KNR A;  4B5B A;  3V91 A;  2RIT A;  5L6S A;  2RJ5 A;  4CJ8 A;  1LL2 A;  3OH2 A;  3I0J A;  1GX0 A;  3IOI A;  3U0X A;  1MP3 A;  5C4D A;  3PKQ A;  2WVM A;  5HS2 A;  2VD4 A;  1ZHJ A;  2Y4K A;  3I0D A;  2VS4 A;  1YP2 A;  3GUE A;  4D48 A;  3OAM A;  5L6V A;  3K8E A;  3RMW A;  1R82 A;  4C2S A;  3U2U A;  1GWW A;  4EEM A;  4EE4 A;  2QH5 A;  1LL0 A;  5DDV A;  4FRP A;  1H7G A;  1ZDG A;  3ZLL A;  2GGQ A;  1QWJ A;  4CVH A;  1YRO B;  1QGQ A;  1H5S C;  2V0L A;  3ZF8 A;  4FQW A;  2RIZ A;  2X65 A;  5CMG X;  3V0P A;  1FGG A;  1JYL A;  1V82 A;  1FR8 A;  2ZU9 A;  3OKR A;  4NAN A;  1H4E A;  2RJ7 A;  5EJ1 A;  1QG8 A;  1YP4 A;  2PA4 A;  3LW6 A;  2YQS A;  4B2W A;  3CKJ A;  4E1K A;  3TZT A;  1VIC A;  1G8O A;  1GA8 A;  3SXG A;  4B4B A;  4AAW A;  1ZJ3 A;  3SXA A;  2AGD A;  1R7U A;  2Z87 A;  1H7T A;  2V0K A;  2YES A;  5FYE A;  4JD0 A;  3SX5 A;  1G2V A;  5C3D A;  2FYB A;  4B3U A;  3QVB A;  3I0H A;  2BO6 A;  2WVK A;  5FUH A;  1VGW A;  4LW3 A;  1LZ7 A;  2AEC A;  3E25 A;  1JV1 A;  5CQL X;  5CMI A;  1GQ9 A;  1PZT A;  3NGW A;  2RJ6 A;  4XWI A;  2E3D A;  3V0L A;  2VSH A;  2X5S A;  2O1G A;  1NKH B;  1Z90 A;  5I1F A;  2AM3 A;  4EEG A;  2AE7 A;  3V0N A;  4DEC A;  2YQC A;  2YC3 A;  2V0I A;  2FYA A;  4G3S A;  2VXL A;  4IRQ A;  4FRD A;  1WVC A;  5IFY A;  1ZI3 A;  5CQO A;  2CU2 A;  3SPT A;  2OI6 A;  1R7Y A;  2V0J A;  1TZF A;  1LZ0 A;  4M4K A;  3IOJ A;  2Y7A A;  4FCE A;  1FXJ A;  5AJP A;  5C4B A;  3U2W A;  4R7P A;  3I0K A;  3ZLK A;  1VZT A;  4M28 A;  3JTJ A;  4FRO A;  3KIA A;  4D0Z A;  1VGZ A;  5CMH A;  2RJ8 A;  3DUV A;  3F1Y A;  3U2V A;  3U2X A;  2FYC B;  4HO8 A;  1H4D A;  1FGX A;  2AES A;  3R2W A;  1YP3 A;  5BXC A;  2WE9 A;  4KC2 A;  4Y6N A;  2QGI A;  4KC4 A;  5C47 A;  2E8B A;  2YQH A;  3IOH A;  3I0F A;  4M2A A;  4FRQ A;  3CU0 A;  3E26 A;  4EEA A;  3V8Z A;  1S4P A;  2I5E A;  1VPA A;  5FV9 A;  1NQI B;  2AM4 A;  5J49 A;  1QGS A;  3POL A;  5CMF X;  5IDS A;  1ZJO A;  4CJB A;  2JCL A;  2AH9 A;  2RIX A;  3SX3 A;  2X5Z A;  2GGO A;  1GWV A;  4ASJ A;  1TW1 A;  2VS5 A;  1G0R A;  2RJ1 A;  1O0R A;  3EE5 A;  1G9R A;  4B42 A;  3V0O A;  1LVW A;  1WT3 A;  4FRB A;  4DDZ A;  5FTS A;  4FRE A;  2I5K A;  2WGZ A;  2VFZ A;  3T7M A;  4EE3 A;  4KNX A;  4Y7G A;  4EVW A;  1G1L A;  4Y62 A;  1KWS A;  4D11 A;  4AYL A;  5C36 A;  4HO3 A;  2XWN A;  3OH3 A;  1NHE B;  2JCO A;  5C38 A;  3PNN A;  4G3P A;  1LZI A;  3F1C A;  4B4G A;  1I52 A;  3ST8 A;  4D11 C;  4HG6 A;  3OH0 A;  5C4F A;  3CKN A;  3SXE A;  4UEG A;  5C4C A;  3R3I A;  3JUK A;  2APC A; 
#chains in the Genus database with same CATH topology
 3HL3 A;  2BO4 A;  2RIY A;  2ZU8 A;  5CQN X;  2QKX A;  3RSB A;  4L41 C;  2ZU7 A;  1ZJ1 A;  1HV9 A;  1H5S B;  1ZI5 A;  1K4V A;  4J18 A;  3I0E A;  4Y7V A;  2XMH A;  4HO4 A;  4BQH A;  1OMZ A;  1H7L A;  5FTV A;  3Q7U A;  5CQM X;  5C1G A;  1ZDF A;  3D98 A;  1FZW A;  4HO2 A;  1H5R B;  1O7Q A;  2FY7 A;  3U0Y A;  1VGU A;  2JCK A;  2VSI A;  2P6W A;  1V84 A;  2ICX A;  3K8D A;  3JUJ A;  4ARW A;  4G3Q A;  5C1L A;  2D7I A;  4DE7 A;  1VM8 A;  1GX4 A;  1FOA A;  1VZU A;  2WAW A;  1H7H A;  1ON8 A;  2RJ4 A;  1JV3 A;  3U2T A;  4Y63 A;  1FG5 N;  3BCV A;  2YC5 A;  2VXM A;  1JVG A;  2RJ9 A;  3USQ A;  1V83 A;  1G97 A;  2XWM A;  2W0V A;  4O6M A;  2O1F A;  2YQJ A;  3I0C A;  4JIS A;  4Y7T A;  1H7E A;  2WVL A;  4FRL A;  4HO0 A;  1NMM B;  1OMX A;  1MP4 A;  2C0N A;  1GQC A;  1H4C A;  4ASY A;  1R80 A;  3D5N A;  1HJJ A;  1W57 A;  2UX8 A;  1XZ6 A;  2NXV A;  5JQQ A;  1R81 A;  2Y4L A;  3I0G A;  4MND A;  5FU0 A;  1W55 A;  1FR9 A;  3TQD A;  1FRW A;  3ZGF A;  2MZB A;  1JVD A;  2WEE A;  3Q4S A;  4YS8 A;  5EIY A;  4KPX A;  1H5T B;  4G87 A;  3Q80 A;  1FWY A;  1ZJP A;  2D7R A;  1HJL A;  4AYJ A;  1NF5 B;  1O23 B;  3BRK X;  1S4O A;  1ZIZ A;  2Z86 A;  1WT1 A;  2YCM A;  2P72 A;  5AJO A;  4Y6U A;  1EYR A;  2Y6P A;  3DJ4 A;  3FWW A;  3PKP A;  4MYB A;  2Y4M A;  4KXO A;  4NAK A;  4Y7U A;  1G93 A;  4EE5 A;  4CJC A;  1FXO A;  4D0T A;  1INI A;  3SXD A;  1ON6 A;  2FYD B;  1IIM A;  1H7F A;  2BO7 A;  1TW5 A;  5C3B A;  1MC3 A;  1HM8 A;  2Y4J A;  2J0B A;  3D8V A;  3CKQ A;  1H5S A;  1EZI A;  2DPW A;  3SXC A;  3V0M A;  1FO8 A;  2FFV A;  3CKO A;  4KT7 A;  4HCQ A;  5AJN A;  3T7N A;  1LZJ A;  1VH3 A;  2A8U A;  2D0J A;  1WSZ A;  4P02 A;  1ZCT A;  4FRM A;  4NAI A;  4HO5 A;  5C1H A;  1ZJ0 A;  3SXB A;  4P00 A;  1XHB A;  1ZCV A;  2PGY A;  3N9W A;  3FOQ A;  4AC3 A;  3T7O A;  5FU8 A;  1JYK A;  4NAL A;  1H3M A;  1H5R A;  2O1H A;  3V90 A;  4IRP A;  1OQM B;  1ZI4 A;  3USR A;  1ZCU A;  4Y64 A;  2JCJ A;  1MP5 A;  1TVY A;  2OI5 A;  4KPZ A;  2PGV A;  4LW6 A;  1FO9 A;  2OEF A;  2A8W A;  4Y9X A;  3I0L A;  1VZX A;  4B2X A;  2VS3 A;  3I0I X;  4FRA A;  2XME A;  4ECM A;  4ZDQ A;  4HO6 A;  1HM9 A;  1H5S D;  3OH4 A;  3SX8 A;  2X60 A;  1ZI1 A;  2V0H A;  2I7B A;  1G3L A;  4EEO A;  5C8R A;  4GBP A;  4Y7F A;  1ZCY A;  1E5K A;  5C4E A;  2PX7 A;  1HM0 A;  5C48 A;  4Q7C A;  3CKV A;  3ZGG A;  4MIX A;  1WT0 A;  1G23 A;  3CGX A;  3SX7 A;  3OH1 A;  1R7X A;  2BO8 A;  1S4N A;  5EJZ A;  4M2B A;  4BMA A;  1NWG B;  1VGT A;  2AM5 A;  1H5T A;  1VH1 A;  4HOC A;  4K6R A;  1G95 A;  5DDT A;  2OI7 A;  1INJ A;  4FRH A;  2W0W A;  1R7V A;  1SS9 A;  2XWL A;  1W77 A;  2ICY A;  3O3P A;  3DK5 A;  3RMV A;  2P73 A;  1ZJ2 A;  5IDT A;  5CQP A;  5C49 A;  5CMJ A;  4FIX A;  3OGZ A;  1IIN A;  4FCU A;  2FFU A;  4KRV A;  4B4M A;  1R7T A;  4KC1 A;  1O7O A;  5D92 A;  4KQL A;  1PZY B;  2Q4J A;  3OC9 A;  5C3A A;  1H7Q A;  2OEG A;  1WT2 A;  2RJ0 A;  1LL3 A;  4HO9 A;  3V8Y A;  3V0Q A;  4KNR A;  4B5B A;  3V91 A;  2RIT A;  5L6S A;  2RJ5 A;  4CJ8 A;  1LL2 A;  3OH2 A;  3I0J A;  1GX0 A;  3IOI A;  3U0X A;  1MP3 A;  5C4D A;  3PKQ A;  2WVM A;  5HS2 A;  2VD4 A;  1ZHJ A;  2Y4K A;  3I0D A;  2VS4 A;  1YP2 A;  3GUE A;  4D48 A;  3OAM A;  5L6V A;  3K8E A;  3RMW A;  1R82 A;  4C2S A;  3U2U A;  1GWW A;  4EEM A;  4EE4 A;  2QH5 A;  1LL0 A;  5DDV A;  4FRP A;  1H7G A;  1ZDG A;  3ZLL A;  2GGQ A;  1QWJ A;  4CVH A;  1YRO B;  1QGQ A;  1H5S C;  2V0L A;  3ZF8 A;  4FQW A;  2RIZ A;  2X65 A;  5CMG X;  3V0P A;  1FGG A;  1JYL A;  1V82 A;  1FR8 A;  2ZU9 A;  3OKR A;  4NAN A;  1H4E A;  2RJ7 A;  5EJ1 A;  1QG8 A;  1YP4 A;  2PA4 A;  3LW6 A;  2YQS A;  4B2W A;  3CKJ A;  4E1K A;  3TZT A;  1VIC A;  1G8O A;  1GA8 A;  3SXG A;  4B4B A;  4AAW A;  1ZJ3 A;  3SXA A;  2AGD A;  1R7U A;  2Z87 A;  1H7T A;  2V0K A;  2YES A;  5FYE A;  4JD0 A;  3SX5 A;  1G2V A;  5C3D A;  2FYB A;  4B3U A;  3QVB A;  3I0H A;  2BO6 A;  2WVK A;  5FUH A;  1VGW A;  4LW3 A;  1LZ7 A;  2AEC A;  3E25 A;  1JV1 A;  5CQL X;  5CMI A;  1GQ9 A;  1PZT A;  3NGW A;  2RJ6 A;  4XWI A;  2E3D A;  3V0L A;  2VSH A;  2X5S A;  2O1G A;  1NKH B;  1Z90 A;  5I1F A;  2AM3 A;  4EEG A;  2AE7 A;  3V0N A;  4DEC A;  2YQC A;  2YC3 A;  2V0I A;  2FYA A;  4G3S A;  2VXL A;  4IRQ A;  4FRD A;  1WVC A;  5IFY A;  1ZI3 A;  5CQO A;  2VK9 A;  2CU2 A;  3SPT A;  2OI6 A;  1R7Y A;  2V0J A;  1TZF A;  1LZ0 A;  4M4K A;  3IOJ A;  2Y7A A;  4FCE A;  1FXJ A;  4O6N A;  5AJP A;  5C4B A;  3U2W A;  4R7P A;  3I0K A;  3ZLK A;  1VZT A;  4M28 A;  3JTJ A;  4FRO A;  3KIA A;  4D0Z A;  1VGZ A;  5CMH A;  2RJ8 A;  3DUV A;  3F1Y A;  3U2V A;  3U2X A;  2FYC B;  4HO8 A;  1H4D A;  1FGX A;  2AES A;  3R2W A;  4FIY A;  1YP3 A;  5BXC A;  2WE9 A;  4KC2 A;  4Y6N A;  2QGI A;  4KC4 A;  5C47 A;  2E8B A;  2YQH A;  3IOH A;  3I0F A;  4M2A A;  4FRQ A;  3CU0 A;  3E26 A;  4EEA A;  3V8Z A;  1S4P A;  2I5E A;  1VPA A;  5FV9 A;  1NQI B;  2AM4 A;  5J49 A;  1QGS A;  3POL A;  5CMF X;  5IDS A;  1ZJO A;  4CJB A;  2JCL A;  2AH9 A;  2RIX A;  3SX3 A;  2X5Z A;  2GGO A;  1GWV A;  4ASJ A;  1TW1 A;  2VS5 A;  1G0R A;  2RJ1 A;  1O0R A;  3EE5 A;  1G9R A;  4B42 A;  3V0O A;  1LVW A;  1WT3 A;  4FRB A;  4DDZ A;  5FTS A;  4FRE A;  2I5K A;  2WGZ A;  2VFZ A;  3T7M A;  4EE3 A;  4KNX A;  4Y7G A;  4EVW A;  1G1L A;  4Y62 A;  1KWS A;  4D11 A;  4AYL A;  5C36 A;  4HO3 A;  2XWN A;  3OH3 A;  1NHE B;  2JCO A;  5C38 A;  3PNN A;  2J0A A;  4G3P A;  5D91 A;  1LZI A;  3F1C A;  4B4G A;  1I52 A;  3ST8 A;  4D11 C;  4HG6 A;  3OH0 A;  5C4F A;  3CKN A;  3SXE A;  4UEG A;  5C4C A;  3R3I A;  3JUK A;  2APC A; 
#chains in the Genus database with same CATH homology
 3HL3 A;  2BO4 A;  2RIY A;  2ZU8 A;  5CQN X;  2QKX A;  3RSB A;  4L41 C;  2ZU7 A;  1ZJ1 A;  1HV9 A;  1H5S B;  1ZI5 A;  1K4V A;  4J18 A;  3I0E A;  4Y7V A;  2XMH A;  4HO4 A;  4BQH A;  1OMZ A;  1H7L A;  5FTV A;  3Q7U A;  5CQM X;  5C1G A;  1ZDF A;  3D98 A;  1FZW A;  4HO2 A;  1H5R B;  1O7Q A;  2FY7 A;  3U0Y A;  1VGU A;  2JCK A;  2VSI A;  2P6W A;  1V84 A;  2ICX A;  3K8D A;  3JUJ A;  4ARW A;  4G3Q A;  5C1L A;  2D7I A;  4DE7 A;  1VM8 A;  1GX4 A;  1FOA A;  1VZU A;  2WAW A;  1H7H A;  1ON8 A;  2RJ4 A;  1JV3 A;  3U2T A;  4Y63 A;  1FG5 N;  3BCV A;  2YC5 A;  2VXM A;  1JVG A;  2RJ9 A;  3USQ A;  1V83 A;  1G97 A;  2XWM A;  2W0V A;  4O6M A;  2O1F A;  2YQJ A;  3I0C A;  4JIS A;  4Y7T A;  1H7E A;  2WVL A;  4FRL A;  4HO0 A;  1NMM B;  1OMX A;  1MP4 A;  2C0N A;  1GQC A;  1H4C A;  4ASY A;  1R80 A;  3D5N A;  1HJJ A;  1W57 A;  2UX8 A;  1XZ6 A;  2NXV A;  5JQQ A;  1R81 A;  2Y4L A;  3I0G A;  4MND A;  5FU0 A;  1W55 A;  1FR9 A;  3TQD A;  1FRW A;  3ZGF A;  2MZB A;  1JVD A;  2WEE A;  3Q4S A;  4YS8 A;  5EIY A;  4KPX A;  1H5T B;  4G87 A;  3Q80 A;  1FWY A;  1ZJP A;  2D7R A;  1HJL A;  4AYJ A;  1NF5 B;  1O23 B;  3BRK X;  1S4O A;  1ZIZ A;  2Z86 A;  1WT1 A;  2YCM A;  2P72 A;  5AJO A;  4Y6U A;  1EYR A;  2Y6P A;  3DJ4 A;  3FWW A;  3PKP A;  4MYB A;  2Y4M A;  4KXO A;  4NAK A;  4Y7U A;  1G93 A;  4EE5 A;  4CJC A;  1FXO A;  4D0T A;  1INI A;  3SXD A;  1ON6 A;  2FYD B;  1IIM A;  1H7F A;  2BO7 A;  1TW5 A;  5C3B A;  1MC3 A;  1HM8 A;  2Y4J A;  2J0B A;  3D8V A;  3CKQ A;  1H5S A;  1EZI A;  2DPW A;  3SXC A;  3V0M A;  1FO8 A;  2FFV A;  3CKO A;  4KT7 A;  4HCQ A;  5AJN A;  3T7N A;  1LZJ A;  1VH3 A;  2A8U A;  2D0J A;  1WSZ A;  4P02 A;  1ZCT A;  4FRM A;  4NAI A;  4HO5 A;  5C1H A;  1ZJ0 A;  3SXB A;  4P00 A;  1XHB A;  1ZCV A;  2PGY A;  3N9W A;  3FOQ A;  4AC3 A;  3T7O A;  5FU8 A;  1JYK A;  4NAL A;  1H3M A;  1H5R A;  2O1H A;  3V90 A;  4IRP A;  1OQM B;  1ZI4 A;  3USR A;  1ZCU A;  4Y64 A;  2JCJ A;  1MP5 A;  1TVY A;  2OI5 A;  4KPZ A;  2PGV A;  4LW6 A;  1FO9 A;  2OEF A;  2A8W A;  4Y9X A;  3I0L A;  1VZX A;  4B2X A;  2VS3 A;  3I0I X;  4FRA A;  2XME A;  4ECM A;  4ZDQ A;  4HO6 A;  1HM9 A;  1H5S D;  3OH4 A;  3SX8 A;  2X60 A;  1ZI1 A;  2V0H A;  2I7B A;  1G3L A;  4EEO A;  5C8R A;  4GBP A;  4Y7F A;  1ZCY A;  1E5K A;  5C4E A;  2PX7 A;  1HM0 A;  5C48 A;  4Q7C A;  3CKV A;  3ZGG A;  4MIX A;  1WT0 A;  1G23 A;  3CGX A;  3SX7 A;  3OH1 A;  1R7X A;  2BO8 A;  1S4N A;  5EJZ A;  4M2B A;  4BMA A;  1NWG B;  1VGT A;  2AM5 A;  1H5T A;  1VH1 A;  4HOC A;  4K6R A;  1G95 A;  5DDT A;  2OI7 A;  1INJ A;  4FRH A;  2W0W A;  1R7V A;  1SS9 A;  2XWL A;  1W77 A;  2ICY A;  3O3P A;  3DK5 A;  3RMV A;  2P73 A;  1ZJ2 A;  5IDT A;  5CQP A;  5C49 A;  5CMJ A;  4FIX A;  3OGZ A;  1IIN A;  4FCU A;  2FFU A;  4KRV A;  4B4M A;  1R7T A;  4KC1 A;  1O7O A;  5D92 A;  4KQL A;  1PZY B;  2Q4J A;  3OC9 A;  5C3A A;  1H7Q A;  2OEG A;  1WT2 A;  2RJ0 A;  1LL3 A;  4HO9 A;  3V8Y A;  3V0Q A;  4KNR A;  4B5B A;  3V91 A;  2RIT A;  5L6S A;  2RJ5 A;  4CJ8 A;  1LL2 A;  3OH2 A;  3I0J A;  1GX0 A;  3IOI A;  3U0X A;  1MP3 A;  5C4D A;  3PKQ A;  2WVM A;  5HS2 A;  2VD4 A;  1ZHJ A;  2Y4K A;  3I0D A;  2VS4 A;  1YP2 A;  3GUE A;  4D48 A;  3OAM A;  5L6V A;  3K8E A;  3RMW A;  1R82 A;  4C2S A;  3U2U A;  1GWW A;  4EEM A;  4EE4 A;  2QH5 A;  1LL0 A;  5DDV A;  4FRP A;  1H7G A;  1ZDG A;  3ZLL A;  2GGQ A;  1QWJ A;  4CVH A;  1YRO B;  1QGQ A;  1H5S C;  2V0L A;  3ZF8 A;  4FQW A;  2RIZ A;  2X65 A;  5CMG X;  3V0P A;  1FGG A;  1JYL A;  1V82 A;  1FR8 A;  2ZU9 A;  3OKR A;  4NAN A;  1H4E A;  2RJ7 A;  5EJ1 A;  1QG8 A;  1YP4 A;  2PA4 A;  3LW6 A;  2YQS A;  4B2W A;  3CKJ A;  4E1K A;  3TZT A;  1VIC A;  1G8O A;  1GA8 A;  3SXG A;  4B4B A;  4AAW A;  1ZJ3 A;  3SXA A;  2AGD A;  1R7U A;  2Z87 A;  1H7T A;  2V0K A;  2YES A;  5FYE A;  4JD0 A;  3SX5 A;  1G2V A;  5C3D A;  2FYB A;  4B3U A;  3QVB A;  3I0H A;  2BO6 A;  2WVK A;  5FUH A;  1VGW A;  4LW3 A;  1LZ7 A;  2AEC A;  3E25 A;  1JV1 A;  5CQL X;  5CMI A;  1GQ9 A;  1PZT A;  3NGW A;  2RJ6 A;  4XWI A;  2E3D A;  3V0L A;  2VSH A;  2X5S A;  2O1G A;  1NKH B;  1Z90 A;  5I1F A;  2AM3 A;  4EEG A;  2AE7 A;  3V0N A;  4DEC A;  2YQC A;  2YC3 A;  2V0I A;  2FYA A;  4G3S A;  2VXL A;  4IRQ A;  4FRD A;  1WVC A;  5IFY A;  1ZI3 A;  5CQO A;  2VK9 A;  2CU2 A;  3SPT A;  2OI6 A;  1R7Y A;  2V0J A;  1TZF A;  1LZ0 A;  4M4K A;  3IOJ A;  2Y7A A;  4FCE A;  1FXJ A;  4O6N A;  5AJP A;  5C4B A;  3U2W A;  4R7P A;  3I0K A;  3ZLK A;  1VZT A;  4M28 A;  3JTJ A;  4FRO A;  3KIA A;  4D0Z A;  1VGZ A;  5CMH A;  2RJ8 A;  3DUV A;  3F1Y A;  3U2V A;  3U2X A;  2FYC B;  4HO8 A;  1H4D A;  1FGX A;  2AES A;  3R2W A;  4FIY A;  1YP3 A;  5BXC A;  2WE9 A;  4KC2 A;  4Y6N A;  2QGI A;  4KC4 A;  5C47 A;  2E8B A;  2YQH A;  3IOH A;  3I0F A;  4M2A A;  4FRQ A;  3CU0 A;  3E26 A;  4EEA A;  3V8Z A;  1S4P A;  2I5E A;  1VPA A;  5FV9 A;  1NQI B;  2AM4 A;  5J49 A;  1QGS A;  3POL A;  5CMF X;  5IDS A;  1ZJO A;  4CJB A;  2JCL A;  2AH9 A;  2RIX A;  3SX3 A;  2X5Z A;  2GGO A;  1GWV A;  4ASJ A;  1TW1 A;  2VS5 A;  1G0R A;  2RJ1 A;  1O0R A;  3EE5 A;  1G9R A;  4B42 A;  3V0O A;  1LVW A;  1WT3 A;  4FRB A;  4DDZ A;  5FTS A;  4FRE A;  2I5K A;  2WGZ A;  2VFZ A;  3T7M A;  4EE3 A;  4KNX A;  4Y7G A;  4EVW A;  1G1L A;  4Y62 A;  1KWS A;  4D11 A;  4AYL A;  5C36 A;  4HO3 A;  2XWN A;  3OH3 A;  1NHE B;  2JCO A;  5C38 A;  3PNN A;  2J0A A;  4G3P A;  5D91 A;  1LZI A;  3F1C A;  4B4G A;  1I52 A;  3ST8 A;  4D11 C;  4HG6 A;  3OH0 A;  5C4F A;  3CKN A;  3SXE A;  4UEG A;  5C4C A;  3R3I A;  3JUK A;  2APC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...