3V0TA

Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
336
structure length
287
Chain Sequence
MPRVKLGTQGLEVSKLGFGCMGLSPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREKIQVGTKFGIHEIGFSGVKAKGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELKKLVEEGKIKYVGLSEASPDTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRGLFWGKAIKEYYRIEALSQKHGCTPVQLALAWVLHQGEDVVPIPGTTKIKNLHNNVGALKVKLTKEDLKEISDAVPWKFANTPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of perakine reductase, founding member of a novel aldo-keto reductase (AKR) subfamily that undergoes unique conformational changes during NADPH binding.
pubmed doi rcsb
source organism Rauvolfia serpentina
molecule tags Oxidoreductase
molecule keywords Perakine Reductase
total genus 103
structure length 287
sequence length 336
ec nomenclature ec 1.1.1.317: Perakine reductase.
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3v0tA00
1A80A 3ERPA 2PDYA 2ACQA 2PDXA 3MB9A 4QX4A 3CAQA 4XVEA 3B3DA 1EKOA 2PDMA 4JQAA 1FRBA 3CAVA 3LEPA 4PUUA 4JTAA 3FJNA 4GIEA 2PDUA 2BP1A 3O3RA 4YS1A 4AUBA 3BCJA 5KETA 4XO6A 2IPFA 2HVOA 3P2VA 1IEIA 2WZMA 3LQGA 3RX2A 1R38A 2PFHA 4IGSA 3MC5A 4JQ4A 3G1RA 1ZSXA 4LB3A 3GHSA 1ZGDA 2PDWA 3CV6A 2PDBA 3LBOA 1ZUAX 4JQ2A 2DUZA 3O0KA 3R58A 4IJRA 1T40A 3R6IA 2BGSA 1M9HA 4XK2A 4QXIA 5HA7A 2DUXA 1EXBA 3ONBA 2HDJA 1Z3NA 1ZQ5A 1Z8AA 4OTKA 1Q5MA 1S1PA 4ASTA 1QRQA 2ACSA 3BV7A 4LBRA 3M64A 2I16A 2INEA 1X97A 3LNMA 4F40A 2PZNA 2QXWA 3GUGA 4DBSA 3UP8A 3CMFA 1PYFA 1AH0A 5AZ1A 4PRRA 3LZ5A 3M0IA 3UGRA 1PZ1A 1RY8A 2FVLA 1C9WA 2IPGA 1S2AA 4JIHA 3VXGA 3V35A 2PDFA 1S1RA 3V36A 3LN3A 5LIKX 3UG8A 2F2KA 4JIIX 1S2CA 3F7JA 4JQ1A 4GCAA 4DBWA 4JIRA 3T42A 1PWLA 3LENA 2IKGA 3R94A 4JQ3A 2IQDA 2IKHA 3LQLA 4IJCA 4LAUA 4FA3A 3QKZA 3NTYA 2PDPA 2HEJA 2F38A 4HBKA 1JEZA 4H7CA 3LUTA 2HV5A 3RX3A 4XZNX 3GHUA 1ADSA 2INZA 2CLPA 2R9RA 5AZ0A 1PZ0A 2FGBA 1XJBA 3EB4A 3BUVA 2HE5A 3EAUA 4FZIA 2ACUA 1RY0A 1VBJA 2FZ8A 1PWMA 2AGTA 2FZBA 4XZIA 3N2TA 1MI3A 4DBUA 1X96A 4XZHA 4YU1A 1AZ1A 4JTRA 4YVVA 2HE8A 3UZXA 1Z89A 4PR4A 3CV7A 2PDGA 1AZ2A 2PEVA 4XZLX 4L1WA 4GACA 2IKIA 1US0A 1AFSA 3UFYA 2IPJA 3M4HA 2PDHA 4ICCX 2PDIA 2R24A 3LZ3A 3UYIA 3D3FA 1LQAA 4G5DA 2J8TA 1YE6A 2HVNA 5LIYX 3R8HA 2IPWA 4XO7A 2IKJA 1MZRA 2ISFA 4Q7BA 3UZWA 2I17A 1QWKA 2NVCA 4DZ5A 3R8GA 4XAPA 2VDGA 1AH3A 4QR6A 4RPQA 3V0SA 1K8CA 2PDNA 3UWEA 2FZ9A 1MRQA 2PDQA 5M2FX 2PD9A 4LB4A 4YVXA 1YNQA 3KRBA 1EL3A 1XGDA 4L1XA 4R9OA 4MHBA 3FX4A 3UZZA 3GHTA 1J96A 3BURA 4LAZA 3GHRA 4JTQA 4XVDA 4EXAA 4YVPA 1IHIA 2IS7A 1RALA 4JTDA 2A79A 1SM9A 4WEVX 3V0UA 3EB3A 4HMNA 3S3GA 4FAMA 4PUWA 1YNPA 4GQ0A 5LIWX 1X98A 4NKCA 1XF0A 3H7RA 3C3UA 3WCZA 2PD5A 3Q67A 1Z9AA 4WRHA 1Q13A 4WDUA 4GQGA 4QBXA 4PMJA 3COTA 1GVEA 3R43A 5LIUX 3WBWA 3V0TA 5C7HA 3ONCA 4WGHA 3R7MA 4WDWA 3Q65A 1VP5A 4I5XA 1HQTA 4JTCA 2NVDA 4ZFCA 5DANA 4GA8A 2IQ0A 1YE4A 2ACRA 1HW6A 3RX4A 1EF3A 3U2CA 3H4GA 3H7UA 4EXBA 4H8NA 1OG6A 2C91A 4LBSA 1UR3M 4FALA 3WBXA 1T41A 4WDXA 5JH2A 2FZDA 2BGQA 2DV0A 3WBYA 1AH4A 2PDJA 4WDTA 2PDCA 1LWIA 3DN5A 2PDKA 5HNUA 2P5NA 5HNTA 3DOPA 3LD5A 4GABA 3UZYA 5JH1A 5LIXX 4XZMX 4Q3MA 2PF8A 2WZTA 2ALRA 3CASA 3G5EA 2PDLA 3WG6A 4PRTA 3N6QA
chains in the Genus database with same CATH superfamily
1Q7ZA 3LU2A 3UXKA 5AECA 3TIMA 5C0QA 3KFTA 3MB9A 4FF5A 4IMCA 3WIJA 1JCMP 4GUHA 4R7OA 2IUZA 3M0VA 1P6WA 5AYBA 1R2TA 3PPCA 5CG7A 1YPFA 3MZ2A 3E5PA 5IHSA 2OSXA 2FVKA 4KFNA 1PDYA 3PZNA 5FEXA 4AZ7A 3HPFA 2O92A 2OEKA 3FEQA 2V6AA 4FSAA 1EF2A 4RE2A 1W3IA 2VD8A 1OK4A 1OGSA 3N14A 3G1RA 3POHA 4REQB 1P7TB 5IBXC 2Y61A 3T44A 2OOFA 3E9AA 3OHMB 5GJMA 3QH2A 4PCPA 4ATDA 3THCA 1TIWA 3WUBA 1HKIA 2JEPA 3WLQA 4WSHA 4CQAA 4TTUA 4XTDA 4B92A 2DUXA 1J11A 1F4AA 2HMCA 1ZALA 4L64A 1B4KA 3U4AA 4BR1A 4G7FA 3TOPA 4JR5A 4P8VA 4JGDA 3N29A 1WDWA 2PWFA 1IXNA 4ASTA 3BV7A 1UKQA 4RW3A 1XLLA 3P84A 4P7QA 1JZ4A 1BD0A 1KM5A 3TU9A 5EBAA 1GQIA 5I3KA 2QXWA 3G1FA 2J24A 1DIKA 3OHIA 4DPPA 3BANA 3KBWA 3KDNA 1PYFA 2HRWA 1K1DA 2FGLA 1V3IA 1WOAA 1GVIA 4X63A 4PFHA 3G1VA 3IJLA 4LOCA 1HVQA 1W5MA 1XFCA 1R47A 4LUTA 1I0BA 1J2WA 1E6XM 4YWSA 1K8XA 1J4EA 2VEGA 1YLVA 3DDMA 1THFD 3W29A 3FS2A 1WZMA 4L56A 2RDUA 1DWGM 2IKHA 2ICSA 3PBMA 1W5OA 4QDMA 2DP3A 3FJLA 3CXOA 2FVMA 2NQZA 2BVYA 4XBSA 5FEPA 2AL1A 3PSWA 3TFXA 4DELA 1OYAA 3TWBA 3KS5A 3NQEA 1QHZA 4GLEA 2VL4A 4HNUA 2PSNA 3KTCA 4HU8A 1IWBA 2BDQA 2P76A 3DHUA 2W79A 2Q71A 4HSNA 3EX6A 3W2KA 3W71A 4QJ4B 4ALDA 4NAFB 1KRCC 1JF5A 2BVTA 1TRIA 4KEVA 3A24A 2E7FA 1HF6A 3PWGA 1XYBA 4K7VA 1AZ1A 3MVTA 1W1A1 1OWQA 4FOKA 1VEOA 1J0HA 1EJRC 3N4EA 1BF6A 2RUSA 5AYZA 3V3WA 2VO5A 3MYOA 4P7RA 2X7VA 1KW1A 3BQ6A 5HUPA 3E0FA 4NZCA 4L1WA 2IKIA 5BXSA 3WZ0E 1M53A 1K6WA 1DJGA 3LM3A 3AO0A 1GNXA 5F2MA 5CSRA 1OM0A 4HKPA 2FDSA 5LZLA 5J8LA 3TA9A 3Q37A 1U5HA 3AYTA 3AS3A 3RMJA 4J28A 2D0FA 3WEOA 1B90A 4AIBA 3PAJA 3L4VA 3EKZA 1G7VA 3UZWA 1UR0A 1XLFA 2V3EA 3ISIX 5RUBA 2DVUA 1TTJA 1TZZA 1IE7C 1N7KA 1AH3A 4QR6A 3PTMA 2DORA 5DRIA 2CIPA 3TSBA 3UWZA 1ODZA 3KOYA 4O0QA 1NOFA 1RD6A 3W83A 3N2XA 3PK7A 2PRHA 1K77A 1TR1A 2BHZA 2QCNA 3HQOA 3BURA 1W8SA 1MEWA 5KINA 1VBUA 1XIBA 3TQKA 4DWSB 4JTQA 3PUOA 1FH9A 4S3GA 3H2NA 2Y5SA 4JTJA 1KTCA 5FJRA 1OCQA 3HV9A 1C8QA 4WEVX 4ZENA 1TPB1 1Z7AA 3EA3A 1QR7A 4NNAA 2CBJA 4RZ4A 4HMNA 4LUJA 2CWXA 1LT7A 5K9XA 4RV8A 5IM51 1VBHA 4OIFA 3WCZA 1KTNA 4FP1A 3DAQA 3RM9A 4F0LA 3L5AA 3QY6A 1R46A 4Y8FA 4PMJA 3GFXA 3FHAA 2CLIA 3H53A 1DJIA 3L2LA 2R1MA 3SI9A 2Z6IA 4JPGA 4BI6A 4CD4A 3EYPA 4TXEA 1SO5A 3CQJA 3CHDA 3BOXA 4WGHA 4C6IA 3SQLA 1T7LA 4QM1A 1JPIA 2DU2A 4D71A 3AJ7A 5XIMA 1ZJBA 4DEFA 3AUOA 3PTKA 4O18A 1EX5A 3TNOA 1CZ1A 2BS9A 4A22A 2VKZG 4RNFA 3CHEA 4AXKA 3FY1A 1XUUA 3HOJA 3W7GA 2GJXB 2AKMA 4RDWA 4CNSA 1OFQA 4ML9A 1A5SA 1C92A 4GXMA 1XDMA 1E51A 2YXXA 1UR3M 1A5OC 2VELA 5C8BB 4C6BA 4D8AA 2W63A 5HBFA 3W6MA 3G1HA 3RPDA 1DE6A 5LSMA 3C5QA 3HMCA 1D9EA 5BXPA 4INFA 3LHTA 3LRMA 1R8LA 1LM1A 4GISA 1A3XA 5HNTA 4LVBA 3FYOA 5AHIA 1DXIA 1WP6A 3H26A 1CW2A 4QISA 1Q6DA 5A69A 1ZJAA 1M68A 8RUCA 4D8ZA 3QM3A 1PIGA 1TWWA 2GYIA 1P6CA 3REQA 4LYKA 1B3XA 1XBVA 2O9TA 1UKPA 1ECEA 5F2IA 4RCXA 1OFAA 1YTDA 4IXHA 5D38A 4RNHA 2FB2A 3ZJ7A 3B05A 1Q6QA 4JTAA 5MHBA 3FJNA 4GIEA 1VFSA 4UBPC 3IVSA 1UMYA 3T07A 3O3RA 2VYOA 4AEFA 1JCLA 3QC0A 1OF6A 4EE9A 1XC6A 2TSYA 1E6QM 3LTSA 2R14A 3EDFA 3NEVA 1H7OA 4GJJA 2CW6A 1ZCCA 3AU2A 4QJ3B 3AYSA 1WO2A 3VD4A 4OV9A 2VR5A 6REQA 4LGXA 2NX3A 1OT1A 3MC5A 3KDOA 2E6FA 1HFBA 2X2GA 1DQXA 2J7CA 1NFGA 2V9DA 1JZ7A 1UB3A 2EG6A 3AAMA 3SJ3A 1TB3A 3C0QA 3PANA 3CUHA 5BU9A 2Y5JA 1WYIA 2J7BA 3P93A 3LV6A 3VFCA 3V1HA 1WZKA 1TMLA 3SGUA 2OYMA 3VNJA 1NELA 1HTIA 2WSPA 2QJIA 1S1PA 3OQ8A 2P0IA 4NZ4A 1O7AA 5IXEA 3VGHA 1U5VA 4QLJA 1AJ0A 5BRBA 1XSIA 1VRXA 2A6LA 1L2UA 4IQDA 1FCVA 5D8ZA 4GY1A 4FNSA 4KRZA 1EJ7L 3B06A 1ONEA 3UG5A 2QCGA 4FNUA 3LPGA 4LQ1A 1R86A 2WJZA 1GOIA 1A5LC 1VPYA 5CPSA 2VX4A 1UQZA 4Z2JA 3GR8A 1HNYA 1MNSA 3PFRA 3OZPA 4U5KA 2OB3A 1RA5A 3GKFA 4IJCA 4KT2A 1G4EA 1FWAC 2BOGX 1JCXA 4XD3A 1HIZA 1W17A 4FR6A 5D33A 4AY1A 5EFDA 3EKLA 3GS6A 1EHAA 1L6YA 1YTEA 1KV5A 5AZ0A 4GQQA 5J04A 5BNKA 1RY0A 1E0WA 1DXEA 3IV8A 3W7IA 1WDQA 5LKYA 5FESA 2AGTA 2CITA 2PWDA 5FAGA 4DJFA 1VBGA 2PPGA 4NJKA 3T40A 4US6A 2GJXA 1X96A 2WCAA 3UZJA 1I2PA 3SAZA 4NVTA 3UF9A 4MNLA 3TSMA 1KFJA 2PDGA 2OQHA 1CGUA 1QXLA 4GACA 1NDWA 3MUAA 4ZTXA 3SJNA 3KBJA 5HQMA 4U4MA 3DHFA 1F61A 4G1NA 2ZUSA 4O0KA 4JKLA 3HPSA 4MJMA 3UYIA 2RJGA 3FYYA 2J8TA 2XGBA 3KOFA 2HVNA 2PP1A 1DV7A 1IT7A 3WLOA 1C7TA 1XHGA 3MA8A 5AN7A 1XXXA 3TNBA 1WZAA 1AUSL 2R8WA 2Z29A 4WK9A 2ISDA 3NJ3A 2XPKA 2ALDA 5AHNA 3TW7A 1RQEA 1BYCA 4F8XA 3EOEA 2VT0A 3RMEA 3WMSA 4HHLA 5E09A 4BS0A 3V0SA 4I8YA 2PDNA 3RLUA 1PV8A 3IVUA 3FAWA 3CK5A 3A4JA 2ANUA 5LXEA 3A4XA 3NPXA 4JFUA 2VQUA 1E6RA 1GK8A 1A50A 3DH7A 3P67A 3WYZA 4K6AA 3SURA 1XBYA 1LL4A 2DZAA 2J9ZA 1FDZA 3FGCA 3ZLFA 2ODOA 1J6OA 2Y8KA 3K4WA 1LBMA 3S4TA 3G3DA 1UBPC 3KXQA 3ZOAA 3AI0A 3L0KA 3I4EA 1XCXA 2OQLA 1EWDA 5REQA 3RITA 1YNPA 5A8NA 1XF0A 2F9RA 5AYIA 4HT3A 4WRHA 1I8JA 4GO8A 2WMJA 3MBDA 2ZTKA 2AQWA 4UFMA 1YXYA 5DEZA 1WCGA 1T96A 1AL7A 4XUYA 1FUYA 5A6BD 4NZJA 3ABOA 3R7MA 1HKVA 4GKLA 4D72A 5F1UA 2XFWA 3WFZA 4NZ1A 5KITA 1G67A 3EBVA 3HG2A 4WY0B 1V7AA 3GAYA 4F0KA 3R2GA 3VILA 5D37A 3WDRA 3QXBA 1PAMA 2PRMA 3DFSA 3ZJKA 1EDGA 1FKXA 4IJBA 4O1DA 5A8PA 2FZDA 2VJXA 4GYJA 3BH4A 3CU2A 3SR7A 2WZEA 3NXLA 2ZRYA 1TPFA 2XG9A 1QW9A 3CWHA 5E5CA 4KWUA 2XUCA 4PN2A 1HKKA 4DF0A 5CZSA 2VDHA 4QP0A 2J66A 1A5NC 3LD5A 4V2XA 4J3UA 4AEEA 3WK2A 1HJUA 4LXFA 4YLWA 5FKYA 1K7EA 1AL8A 5E9XA 3RCNA 1DWIM 4EPKA 3C2OA 4LSBA 4C1NB 2AGKA 3URQA 1KCZA 1EA9C 1OIFA 1HZYA 1LOSA 3GNOA 5A2BA 1H7RA 3VIMA 2JEQA 3W1AA 3LRLA 1ZENA 1Q8JA 1J10A 1IZCA 4MTVA 4MSSA 1W1B1 1DWAM 5C9XA 1T8QA 4DF2A 5HK4A 4DF1A 2VZTA 1W1VA 1JCJA 3TK7A 3H2CA 4JYEA 4CEUC 4M1BA 3BLFA 2Z2AA 4IUOA 3GNRA 2NUXA 4US5D 3OPSA 4A3RA 3M44A 4MWAE 4TR9A 4UIOA 1ZSXA 4FK9A 2FTYA 1JDCA 2G37A 5A6AA 3CV6A 4UTJA 1ZAHA 3CL8A 1TUFA 4Y9OA 3V4BA 4J5NA 3KBMA 1T40A 3DC0A 1LRNA 4KWVA 4NSBA 1V0NA 2E5DA 3RLVA 3MUCA 4AY8A 4LTSA 2HISA 3K1DA 1DEDA 2CZEA 4HHMA 4S2BA 3G2GA 5HAOA 3JUGA 2ZDRA 1LQ2A 3B9DA 2A5HA 1CXHA 1FWFC 3C8FA 3GXDA 4FR1A 4IICA 2O7SA 3NQ6A 2CBUA 3WY1A 3EGJA 2YA2A 3UJSA 1MWOA 3THDA 1HN1A 4MB4A 2GGJA 4YTQA 1IR1A 1UD8A 4I7UA 1S1RA 4AHQA 3HU7A 4KCUA 3ITOA 2CU0A 1KBIA 1TMHA 4P5UA 5D32A 2WHMA 3GD6A 1PUDA 1MDLA 2V63A 3KE0A 4XAFA 2XZ7A 4JIRA 4IX2A 3HG5A 1WDPA 3E0VA 2X7WA 4TMCA 1L6WA 1TJPA 2VZOA 2IQDA 2A7RA 1TTQA 5TAOA 4PEEA 4BFAA 2V2CA 3NTYA 3KOZA 2GDVA 2HEJA 5IDIA 1XWYA 2C7FA 1FHDA 2B0MA 2WSKA 3VKDA 4Q8WA 2WOQA 4JNYA 1QBBA 3NDOA 3T0AA 1JQVA 1U1JA 4GI9A 4QE1A 3UR8A 1EJTC 1V0KA 4U2ZA 4ILSA 4Q7IA 2OT1A 3TCSA 3ARYA 5E93A 3VAVA 1TWSA 1FY6A 3B9EA 1WBJA 4ZOCA 2PTYA 1ZS2A 3MTWA 3GU1A 4UOQA 3PUEA 3W22A 2QDDA 5I3FA 4CQ9A 1QOPA 2NXGA 1S38A 3NGFA 4KIEA 1Z89A 1ECQA 3PC0A 3MKKA 1IEXA 1XIEA 3LV5A 1DJHA 3MCOA 4QDPA 5CC3A 3A47A 3OO2A 2VEPA 2DZTA 3KCLA 2QV5A 4ZXOA 4GJIA 2FMNA 3GM8A 4BWLC 3VGFA 2XGIA 1MEIA 4NHVA 1JPDX 3W1RA 4BKNA 4M56A 4ICCX 1UASA 2B4GA 5BW6A 1MZHA 1M65A 3FXYA 4UFJA 4HD5A 3T0DA 1QJWA 1R9YA 5DBTA 4IIBA 4HHPA 4Q22A 3EA1A 4DM1A 5FIPA 3RYSA 1DWJM 4FOUA 4C5YA 4UTTC 4B9ZA 7TAAA 4PB4A 3IS4A 4XZ9A 2WBGA 3GUWA 4Q4KA 5FEWA 1QTWA 1J8VA 3BAKA 3CAWA 4JHOA 2ZFAA 3H70A 4OOZA 2FZ9A 1IIHA 4DAFA 2QZRA 2O4QA 2Y24A 1NWTA 1BYBA 1EIXA 3O2LA 3RAOA 3EDJA 2QCDA 1J96A 4GYKA 3WF2A 1GG0A 1S39A 2NVAA 5GQBA 1OD0A 4JIPA 4L80A 4IGMA 4HNOA 2QPXA 4IPLA 3G6LA 1YDOA 2G96A 3CMGA 3CUXA 3R4IA 3H24A 2Y62A 3TTOA 4K39A 4NF7A 1EJWC 3B8TA 2IXVA 2YCLB 4R85A 4X9YA 4N9CA 2P50A 5K3VA 3STPA 4IFRA 2Z6JA 4OJYA 1A5CA 4H6EA 1VLIA 1Q6CA 2F2HA 1EO5A 1H3GA 1CLXA 1JUEA 5I24A 4ZO6A 1GVEA 3T2PA 4L6OA 2TMDA 5CKSA 4D1JA 4GVFA 4BQ3A 4N9EA 3ITXA 3FKKA 3OYXA 1P4CA 2OX4A 5D8WA 2R1NA 9RUBA 4Z2GA 5CJ5A 4L9YA 3CTTA 1XLCA 1SZRA 3AIVA 4MDPA 3UW6A 4QG8A 3SQMA 1H41A 4UFHA 3WLHA 1K02A 3RX4A 5G2HA 4DUOA 3WF1A 1J0ZA 1XG4A 3F4CA 4MVAA 4H8NA 2B31A 3A6OA 1TQXA 3QFEA 1VBRA 2ZZ6A 4JXCA 1W9XA 4GRSA 2A7PA 4KQNA 2XZ9A 3ZWSA 1MQRA 3MUXA 4S3EA 3ZMRA 3C8NA 2YBTA 4C6PA 1XS2A 1SW0A 3AHXA 3N6HA 5A94A 4DQWA 1SFTA 2P5NA 3KW3A 3N04A 2HQAA 4YTTA 1R3TA 1JNEA 1VRDA 2WC4A 2J62A 3R5EA 4Q3MA 5XINA 1OZQA 4Q8PA 1KLZA 4UFKA 1VZWA 1WAUA 1Y5XA 2UBPC 2J4GA 4AZGA 1GZJA 1CB2A 2DSWA 2Z1XA 4PRTA 2P88A 3ZSSA 3QTPA 1KXHA 4ORIA 1UKOA 3SCUA 1QPKA 2ZBTA 2PDYA 3RDKA 3OG2A 5G4HC 3RO6A 1A5AA 1QNSA 3POCA 1SO6A 3VTRA 1K8ZA 3CAVA 4HGXA 1HJSA 4QROA 2V3DA 3GU9A 2J74A 1JRBA 1BXCA 3LXAA 3HO8A 4S39A 5B7ZA 2PI6A 2ZXDA 2VDIA 4H9UA 3RJYA 4D6IA 3L12A 4UNKA 2C0AA 4X0VA 1ITUA 1W0MA 2OWCA 1BXNA 7CGTA 2QDEA 2IPFA 1O60A 4Q8VA 3C2RA 2WZMA 1Z44A 2OWXA 5CZJA 3E0IA 3XINA 4Y9AA 4JTLA 2YBVA 2DVTA 2G97A 1HO4A 2YOCA 3E1F1 3WUFA 4D6DA 1E9ZB 2HNEA 3GHSA 2XH2A 1AD4A 5A3HA 5BWFA 3QPYA 1H0GA 1DJXA 1TA3B 1JFHA 3GIPA 1H4PA 1DIOA 1S3TC 1KWKA 1VIZA 2QV4A 3S1WA 1EC7A 1BFNA 1S5WA 1CECA 4PTMA 4Z1AA 1GVFA 4JTUA 1IEQA 3G18A 1XH2A 3WMCA 1OX5A 5PTDA 1ZQ5A 4ZQMA 2X09A 1QRQA 5LYRA 1W3LA 4R27A 3A22A 1NAL1 3RR4A 4XD4A 5BOFA 3M0KA 3ES7A 2G4FA 4F40A 1AK5A 3TTEA 4E4PA 4WQ6A 1YMYA 1FWCC 5ABEA 5DN1A 3CEPA 4FIQA 3EWWA 5I78A 4HYRA 4AZCA 4U3CA 2V2DA 2CLEA 1GPWA 5GPRA 3BOFA 5FF0A 1J0YA 4U28A 3LSCA 1KQYA 3WELA 1JI2A 1ALDA 2J6VA 4H8VA 1B30A 3IRDA 5A5WA 2DW6A 3HG4A 4CNUA 1EEXA 1SFSA 3HGJA 4OWGA 3DUGA 2DQXA 2DZWA 2VCCA 4LAUA 3W7MA 3NYDA 4NAEB 2HV5A 3HM7A 3FHQA 1G0CA 1ADOA 4KFPA 2QULA 4PULA 4FNPA 1XGEA 2GOKA 4L9XA 3PVFA 5CPNA 3EPMA 4M8UA 2BBFA 4IG2A 4NJJA 4HNCA 4MFDA 1Q6EA 4GZIA 3E2SA 1E6PA 1TZ9A 5I3JA 1LZOA 3ZT5A 4B5UA 4MWAA 5H8PA 3NQVA 3DI1A 4RDZA 3FIGA 3CUIA 4PTNA 4JS3A 1F3XA 5DMYA 3VPLA 2P10A 1DJNA 1XPYA 3CV7A 3ALGA 2WNWA 1TYGA 2DSUA 1M1BA 1MXDA 3MVIA 1W1PA 3PBYA 4PRWA 1HKWA 1VIWA 5EBUA 3VO0A 5FJTA 1XLIA 4S3BA 2PGWA 3E38A 4JCMA 4AAJA 5H1WA 2XIBA 3GG0A 2BY1A 4GH1A 1E15A 4RLIA 2A3LA 1FWDC 3UA4A 3WLSA 3IJIA 2PTZA 2CZFA 2DT2A 4JY9A 4PE8A 3HIJA 2H9AB 2BHUA 4XAPA 1VEPA 3II1A 1VF8A 3K13A 1Z41A 1DWFM 3UWEA 1C7SA 5CLTA 4CQ8A 4LB4A 2PLJA 4ECLA 1UWUA 3T0BA 4DAIA 1DQUA 4PB3A 3Q94A 3CO8A 4PYSA 1H49A 1KRAC 4ZB5A 1GOWA 3RGTA 2W61A 5D03A 2PUZA 1JGMA 2ATSA 4GY7A 3O1NA 3SGZA 1SMDA 3WDIA 4IIHA 1O95A 3BAXA 3GB6A 3DGBA 3C4UA 4HOXA 3BLPX 3PTDA 1O5QA 1E3XA 4PC8A 3IIOA 4A8RA 2DIEA 2JK2A 1CXFA 1EBGA 3RCMA 3FN9A 1QI2A 1BAGA 1SVDA 3MKCA 1JCNA 3G24A 2C3ZA 1X98A 2HTMA 3C3UA 3WQGA 1SO4A 3BLKA 4Q6XA 3LPPA 2BODX 5C9WA 5AHEA 2XFYA 4KWOA 1BKHA 2VX7A 2WO5A 3BJSA 1I4NA 2FIQA 3GZAA 3WD1A 1UZHA 4UB9A 4Y90A 1T8XA 1KBKA 3RM4A 5DT5A 4J2PA 4IIGA 1X6NA 1DJQA 1ICSA 5GNZA 3WQ4A 4QQUA 2V5DA 5K9CA 5E0KA 2NVDA 1RZMA 3GFZA 4H3DA 8CGTA 5A6TC 4JYDA 4JEJA 1OCJA 3OZOA 2P1FA 4C6MA 1YX1A 4O1CA 4M5PA 2D0GA 4BZYA 3LYEA 1TCMA 1ML1A 1H11A 2QJGA 4FLOA 3THAA 4E4UA 3CMJA 1DTNA 3H4GA 3S5YA 2ZRZA 2VOTA 2QNEA 3OQEA 5IFTA 5TD4A 3WBXA 3VM7A 1ONWA 2BGNE 3MUIA 3WQ8A 4JL2A 3TKFA 1FFRA 3UQNA 4CQBA 4P8WA 5HNNA 4L4PA 2CLOA 1H7XA 2FJKA 2WNNA 3BTNA 3WNKA 4GFSA 4ERGA 1VFLA 3REQB 4GABA 3HPXA 3WKZA 4ZVJA 4GI8A 1OK6A 2GGHA 4C7GA 1B3WA 4M6UA 1MXGA 5HDRA 2AMGA 3W23A 2PF8A 1KBJA 4IQEA 2GVEA 2G3FA 3VIFA 4E8GA 1LTDA 4Q6JA 3MI2A 1V4YA 1HGYA 4U33A 2E6YA 2BVDA 1QW7A 2E09A 3W76A 2HSAA 4PZVA 4XVEA 1EKOA 1T5AA 2G3JA 4I9TA 2XM2A 4LUTB 3L0GA 4Z2KA 4CCDA 1W8GA 3DFPA 3VX0A 1JL8A 1GVYA 3T7VA 1V3JA 1N8IA 3GVVA 3DG3A 1VYSX 4NNBA 1ZAIA 1M01A 4TVDA 2BOEX 4L6HA 4UTTA 1SGJA 4KF1A 4A35A 2DFAA 4Z08A 2AMXA 3NQ2A 2ZZ5A 4OOUA 3EWYA 2WB5A 3AS0A 3CWOX 4PMZA 3O15A 3H21A 1WKYA 4J3TA 1PHQA 2Y0FA 4ATWA 2X30A 3T05A 5AHFA 5HMFA 1KA9F 3CL7A 4D2JA 4P61A 1Z6KA 5FJOA 3VD5A 3M6YA 3AHZA 5DRCA 2Y70A 2WSYA 3C3NA 4O12A 1KFLA 2OPJA 1R85A 4ZB2A 2Z1VA 1BVNP 1BYDA 3W4RA 3GC2A 2D2HA 3A9IA 1QNQA 1NEYA 2Z1SA 4H19A 4OVXA 3W1TA 1IWAA 2VEMA 1TVNA 1Q6LA 4S3FA 4TTGA 1AG1O 3PZIA 1PKLA 4HMDA 1MUCA 2VC9A 4O16A 1W1YA 4UFLA 3N12A 1OEPA 2DT3A 2I16A 4IM4A 4M29A 2HNHA 1X97A 2AQOA 3LLXA 4IP7A 2PZNA 1FDJA 4DBSA 5BOOA 1JULA 1H1YA 1BG9A 3WH7A 5LNWA 1EBHA 4EX4A 3ZVIA 1OG0A 2ZZ4A 4C1KA 4J3VA 4UQDA 5KZEA 2H6RA 2WC7A 3V36A 1Y5WA 2WSQA 4U3AA 2WJDA 3NL6A 1IXQA 4X2RA 3LENA 5EMYA 1EZWA 4XBKA 1EO7A 2GPTA 3PHAA 1YPXA 4PMRA 3QZEA 4HBKA 2GL5A 1XICA 4XD6A 1FP9A 3V75A 2VHLA 3RK8A 3VGEA 3L21A 1VFMA 2BY3A 2OVLA 4KEUA 1GW9A 1CDGA 1XIGA 1YDYA 3OVPA 5FJUA 2DJLA 3S1UA 2GVLA 1KQZA 4MG4A 4UZUA 4AZ5A 1D3HA 3SUTA 2ZUVA 2XIMA 3UD6A 1US2A 4KFOA 2ZE0A 4DWSA 5CG0A 1CPUA 3CC1A 4QJ5B 1SUXA 2CHNA 3CHCA 4O28A 3HZ3A 1CT5A 3M7SA 4J40A 3MKVA 1HKJA 5B80A 3TC7A 2HCVA 3UZXA 1TKKA 3HMJG 1K7FA 3N19B 4YCPA 1BF2A 1O66A 1GZGA 2YDSA 3CQHA 3NQAA 1IGWA 1YBQB 4XWUA 3DXIA 5A6JA 3Q2DA 2EHHA 1GOQA 3QQ1A 4FLQA 2Z1BA 1RJPA 1GQJA 2IKJA 4B2DD 1B2YA 2PGRA 3QPZA 3W88A 1GQNA 4E6MA 1GZ1A 4BF9A 3N25A 1GOKA 2P8CA 2HJPA 3SSZA 2BOFX 4AZIA 4JTHA 3LBMA 3RF9A 4Q8TA 3RO8A 3GR7A 4GZ7A 4IZGA 1J12A 3OVGA 3OGVA 2OKOA 2H8ZA 2KZHA 2CC0A 2W66A 1OX6A 1OX4A 4KH2A 2A4AA 2G4JA 3KVKA 3W02A 3IGHX 2OO6A 2I9UA 5FJPA 4L4OA 3W24A 1I6NA 3ITGA 3SUSA 1MFVA 3WX7A 3LCWA 3PG8A 1HL8A 1R3VA 1AD1A 3JS3A 1MEHA 4ACZB 1XD0A 4BF5A 2XIJA 1A5MC 1R87A 1XIDA 2OO0A 3AWOA 2GGEA 4O11A 3W0KA 2GK1B 4L6DA 2E5BA 1S46A 4Q8OA 2QQ6A 2XJ7A 3MDUA 4LVGA 1EJUC 3KBSA 2BXVA 1PKMA 2I56A 1F8IA 4JD4A 3W87A 1TZ7A 2CBIA 3N18A 5JQ9A 4I5XA 4DYEA 4AHOA 1E0UA 2MUCA 1ZY9A 3PZUA 4JIEA 3RUBL 1XRVA 4FPSA 3AALA 1HQTA 4JTCA 4NP7A 2P0OA 5DANA 3GXNA 1OSEA 1SFJA 3AMLA 1JI1A 2ZC1A 3NQ7A 3W6YA 4AVOA 3CPUA 2D3LA 3AMKA 3U2CA 3PP7A 2UZ9A 2VGFA 4ICMA 4N02A 2FQIA 3UYCA 4DJED 4Z42C 3UR5A 2WZHA 3W7KA 3ME3A 1UOZA 2J88A 2PTWA 1EGVA 4IGNA 4D6HA 2G3IA 4DO6A 4WF7A 3ARXA 4W5ZA 3OJGA 1RP8A 4HA1A 1L2QA 2PDKA 5JBDA 4ZGYA 3H2EA 1VFFA 4RNJA 4W8BA 1TJ2A 1XD1A 3W9ZA 1FWJC 4PA8A 4Q7NA 1F73A 2W3ZA 3LRKA 5D05A 2F6UA 5I0DA 5HMDA 4LS0A 1GJWA 1QPNA 4IOTA 4YMZA 3W82A 3CJPA 4HK7A 4O57A 5I3IA 4QSHA 4JX6A 3SCQA 3BAWA 1I1XA 1FDYA 1V5XA 1REQB 3BAYA 1H51A 3TXZA 2ACQA 3AUJA 4J3ZA 4PUKA 1NF0A 5CPTA 2VZUA 2EPNA 4AMCA 4O0ZA 4F0SA 2VWTA 3WQVA 5JBEA 1HX0A 4C6JA 2Z4GA 3LXBA 3LEPA 2J27A 1WDRA 2GJPA 2PWVA 3L66A 5IOBA 3CIXA 3VOHA 4MZ1A 2X05A 2A21A 5LNVA 3VNMA 3LCLA 4N0RA 4XO6A 1JVNA 5F4XA 1RP9A 3MYPA 4GX9A 1UBSA 3RXZA 4IFKA 2D0HA 3P14A 2DJXA 3ZYZA 4UTUA 3W2JA 2FHBA 1IZKA 4GOAA 1XBXA 3HQNA 4XKYA 1UUMA 4Y8EA 4MYAA 3EX3A 1AMKA 2ZVIA 4UMCA 1EJVC 1IWPA 2HK0A 4IJRA 3K4DA 2V5CA 5A2CA 4UTLA 3FDKA 4WR3A 4ZMGA 2WHLA 4C6KA 4HYWA 4DZIA 3QV6A 2J8FA 1W5NA 2PGEA 1ZLPA 3O7UA 1Z3NA 1HG3A 3CQKA 2OYLA 3GTHA 1XSKA 2WKLA 1JDDA 4I5RA 4N42A 4KGJA 2BXYA 3PBVA 2KAUC 3UWYA 1YXDA 1XLGA 1UD2A 5D04C 3DFTA 5FF7A 6ALDA 3OLGA 1PX8A 1AQ0A 1SYTA 3M0IA 3LS9A 5GJNA 4ROPA 2QIWA 5JXQA 1Y0EA 1R3YA 3V35A 3BW2A 7REQA 3Q58A 4X22A 1FWIC 3UG8A 1TJRA 2GJRA 3PNUA 1GG1A 5FJJA 4R33A 1HT6A 4DRSA 1LROA 2L5HA 1SSGA 2RDXA 4GNKB 3QEZA 3CB3A 4CLMA 5M5DA 3QZAA 4EP8C 5D9MA 4R3UA 1TREA 3LBCA 3NVTA 4JTGA 1WZLA 1MSSA 4S1FA 1Q6RA 3DBPA 3HBLA 1S2VA 2DZPA 2I1OA 4Q8MA 5HMEA 3SY8A 3XISA 2YLAA 1LUCB 1PZ0A 5BYWA 1GEQA 2MNRA 3SIMA 3A23A 3QGAC 4I6VA 3EAUA 5CBJA 3W81A 4ZODA 1C9DA 3THUA 3GE7A 3IWPA 3PUGA 3IJDA 5AYXA 3I3EA 1UD3A 2E4TA 3OLEA 3AS2A 3RPTA 4IX0A 5FJIA 3MZNA 3CT2A 4DHGA 3AOFA 3WJXA 3NSNA 4LAOA 2F61A 3NL5A 2VEFA 6CGTA 4FB7A 3EOUA 5K4XA 2O9RA 4L5ZA 3TMLA 1KXVA 1QUMA 4M1RA 4JFSA 1TPWA 1DJYA 1SSDA 3VYLA 2I7GA 2WMFA 1NH6A 3B9NA 1FH8A 2PLMA 3WLNA 7XIMA 2GZXA 4W5UA 1EQCA 1MZRA 4OBSA 2RHGA 4MB1A 1WB0A 4AD1A 4IL2A 1O68A 2OELA 4WCJA 4RPQA 4BEUA 2NSXA 3PJXA 3LTPA 4GI4A 2BV9A 5M2FX 3G0XA 1NWUA 2EBNA 2P3EA 2GDUA 4KEZA 3URNA 3GVRA 3GO2A 3S47A 4AD5A 1EUAA 4R9OA 4ZQNA 3TFCA 5FF4A 1MW2A 1CBGA 2YB4A 2G5WA 4AD2A 3STCA 3W1PA 1GTHA 1WUEA 4IPIA 1VFUA 1ITQA 3IAQA 3M46A 1VJSA 3EOSA 4GIRA 1SM9A 2NLYA 2J9YA 1H60A 4QLLA 3VIJA 3KL0A 3P8JA 1VC4A 3TYAA 2OCZA 2O4MA 3S3GA 4XX6A 3VE9A 5HJYA 3MY9A 3L68A 3VDGA 1AQMA 2QEZA 4IMDA 1NARA 2WMIA 4H9MA 3ITVA 2BWGA 1ISWA 5LGXA 3GVWA 4OE7A 4GC4A 3T09A 4PMXA 3ARWA 4O8RA 4WSKA 4R7WA 5M3WA 5KZ6A 4K3ZA 1MRAA 3PBWA 1SU5A 4LUSA 4GQRA 1O5XA 3N2CA 4AEOA 3WMBA 4PH6A 1HW6A 4DYKA 1QT1A 3LCGA 2XH4A 4C1NA 3QRHA 1Y7VA 4DJEA 4ZOBA 1Q85A 1SW7A 3WQFA 2WKGA 3EXTA 3CEUA 3USBA 3S1GA 4DBDA 3NZGA 4PUEA 3CZGA 1I2QA 1TWDA 2FHCA 1PVNA 4GUJA 4XSMA 3H7VA 4M0XA 3ANUA 3E74A 5D09A 4WDXA 3E3HA 3ABZA 3GSMA 1BWLA 3QY7A 2QW5A 1W6TA 1FWEC 2QCDB 2DUAA 3L4YA 1M03A 5KEZA 2WNZA 1M7OA 1OD8A 2Q6ZA 2AKZA 1XP3A 2WAGA 4MJ4A 5I77A 1VJZA 4ZL1A 1TPEA 6XIMA 3DG6A 1XX1A 1EX1A 4QNWA 1A3WA 3LCFA 3H12A 1PJ9A 2VC7A 3H2OA 2BG5A 1J5TA 3KWSA 3N6QA 5AC6A 3SCSA 1B3YA 3WJYA 3S9IA 3MU7A 1CGYA 1DVJA 4X61A 2G0WA 3R8RA 1XIMA 3VU2A 2DIKA 3O6YX 4CD7A 3T81A 4K36A 2X1UA 4B3LA 3KUMA 3SUVA 4RDYA 4GK8A 4YS1A 4AUBA 3SCOA 3ZM8A 3MSYA 3SFWA 4NY2A 1X6LA 2JKPA 3MI6A 1NQKA 5KETA 5AC7A 1FA2A 4GWEA 2ZTJA 3NM3A 1JAKA 3O07A 5BROA 4J1OA 3QW4B 4R7JA 3DESA 3SCTA 3HFTA 1XYFA 3HTWA 1V3MA 1P0BA 3MWAA 3UCDA 3BCFA 4QJ1A 4LB3A 3WFAA 4MPQA 2PZ0A 1U1HA 4S3DA 4KIRA 1EB3A 1YPIA 1ZUAX 3LBOA 4LUIA 3YPIA 3VM5A 1JXJA 3R58A 4LBUA 3AYRA 3WQDA 3IK2A 3PB2A 5C9ZA 3WNNA 2X1IA 5KTLA 2GUYA 1P5BA 1KRBC 3W7DA 3CBWA 3ES8A 2FB3A 1YIXA 4MAVA 3TYEA 3I7SA 1OFRA 2YX0A 1HL2A 4DN1A 4IIDA 1EPXA 3RLHA 4QHRA 4H01A 1XKJA 3BQ5A 2GK1A 3QHMA 3K30A 1G4PA 2E67A 3NGJA 3VX1A 2ZICA 4H8HA 1WDDA 3DKLA 4JIHA 1FWGC 4AW7A 2A3EA 2DSZA 3LGEA 4NRRA 4MIMA 2D2GA 4LW7A 4QEEA 3IGUA 3GNDA 3WQ6A 3BG5A 4JQ1A 5FOOA 4BY3A 3MSRA 4L65A 1TMQA 4M6VA 4HVXA 6REQB 2PRLA 3R0KA 1AQFA 4A29A 3O05A 3ZWTA 2E9LA 3OODA 5A95A 4NUWA 1V6UA 1MQPA 3FLUA 2PDPA 3I6RA 2F38A 3M0HA 4H7CA 1W37A 5EMUA 4IWWA 3B0PA 1YRRA 5CH9A 4YWIA 1UR1A 3KS6A 1I2OA 2X8RA 9CGTA 4AFYA 3S6TA 3NSXA 4LUSB 3BMXA 2FGBA 1EH9A 3RU8X 1WA3A 2VRQA 3UCCA 4Q32A 3NQ8A 3O06A 3H55A 2FZBA 1EOKA 3RCYA 1FWTA 4K8GA 1RPKA 2OG9A 1UH4A 2WYSA 2YB1A 3FOKA 4JTRA 3ITYA 2HE8A 3MHGA 3VZZA 1V0MA 4HZ6A 1QNVA 4O52A 3WDPP 2XH7A 4CN6A 3GXTA 1G1YA 1RSCA 3HGRA 1JYXA 3S46A 1PHWA 3OB8A 3I3DA 3QR3A 1VKFA 1XKYA 5HINA 1C91A 2R24A 4OBTA 3JZUA 4UTHA 2YGYA 3OLDA 3TYBA 3UXIA 1FWSA 4S2CA 3PAOA 4I90A 4RZBA 3PPHA 3WJSA 4TMBA 2ISFA 2PC8A 1EEPA 5H6HA 2A3AA 4UUIA 4GO9A 2D73A 4KETA 1Q2SA 3NDYA 4DZ5A 1EHNA 1HJQA 3LI1A 3VE7A 1OIMA 4AF0A 2F8QA 1SJBA 1L9WA 2V8ZA 2V38A 5D9NA 1G5AA 1RQBA 1TTPA 3BLDA 2ZCGA 2ZXQA 5EKYA 4KCWA 3GHRA 1QCWA 2GVYA 1KB3A 1Q3NA 1UD4A 3WK0A 2QUUA 3PZGA 3T1GA 5JVLA 4CEXC 1I45A 2QUNA 2I5IA 2XVKA 5H2ZA 3D6NA 3NO3A 3P82A 4BQ4A 1R7OA 2H9AA 3MV01 3TQVA 3M0ZA 3CV1A 3NIYA 1E4LA 4MWAD 3AISA 3RR1A 4ERIA 4CNNA 4XAZA 4OKDA 3VDHA 3LXCA 4ATLA 4GZEA 1G94A 3EWBX 1BHGA 3SSJA 4HZMA 3TAKA 4BK9A 5EB8A 3VKCA 3OIXA 1PO9A 3TLLA 3KTXA 4TX6A 5C7VA 5DXYA 3S6OA 3Q65A 1A0CA 1H5YA 2PA6A 3FAXA 2GGIA 3CZEA 3E49A 1I75A 3NZPA 1R2SA 2Y2WA 2VC5A 4HCDA 1ZBVA 3SUUA 4PSRA 4IPNB 3SFKA 1UYQA 3OTRA 1IT8A 4KKXA 1PTAA 4IMAA 4FF7A 5HJLA 1U83A 1ZRQA 4YHGA 3EMZA 3C0LA 1LOLA 1G9HA 2SFPA 3PFMA 1JUKA 3QMSA 2PE4A 3BDKA 2CESA 5I00A 2NQHA 4DI9A 2XTKA 2OZ8A 4R9XA 1R6WA 4W89A 3N15A 2OZ0A 1EGZA 3V5OA 2Y7EA 4CUCA 4LV9A 1XYMA 2JGYA 1POJA 5D2YA 3W01A 1UR9A 3VOGA 3T8LA 1BXBA 4LNYA 2JGQA 3PBGA 3T0TA 2XN1A 5M1TA 3BV4A 2WZTA 1G01A 1ME8A 4DBEA 2A6NA 3U3HA 3FJ6A 4B9YA 1C3FA 1BGAA 4Z17A 4AWTA 1F76A 1XRTA 4PFMA 2H3BA 3WFLA 1V6YA 3ABSA 4EPEC 3B3DA 1GT8A 3QGVA 2PDMA 1T99A 3CH9A 4JQAA 3HQ1A 1GEHA 3QOMA 1W9PA 3SN1A 2X1SA 4PUUA 1W3JA 3EDDA 1NOUA 4IIEA 3O6CA 4HCHA 4JNMA 1KM4A 1HKMA 1I9CB 5DCBA 1P0EA 3LG3A 1Q4WA 1P43A 3SRFA 2ISWA 3E2RA 1MFUA 3WK1A 5LA1A 4KMQA 3UT0A 4BHYA 1MYRA 4W4QA 4JN6A 2OKTA 4JAWA 1EYWA 3G1YA 1GOMA 2DZUA 5G1YA 3W2UA 2V2HA 3I7QA 1PB0A 3FDGA 5G2WA 3UXLA 5DCEA 3O0KA 4HYVA 4GXWA 1S3HA 1R2RA 2BGSA 2Z2UA 3O0FA 4QXIA 1CWYA 3LHVA 4DJFD 1H7WA 3TC6A 1S5NA 3GTIA 1QNPA 4LEQA 3BICA 1O94A 1ICPA 3WSUA 5CBBA 5LNRA 4HU4A 5DMNA 3UR2A 4Z2IA 2WM0A 4PMUA 5BMWA 2O0TA 1QPQA 3ATYA 4KWWA 5CZKA 2YXGA 3UP8A 4UOJA 1BRLB 3ARSA 1WKDA 4HB7A 5I23A 3MMWA 2WVUA 4DUVA 1E1FA 4MM1A 1UW9A 2EG7A 4K8HA 1SR0A 4LX4A 3W86A 5CPOA 2LLEA 2ZRUA 3VGDA 5AC8A 1WNOA 4WKAA 1S2CA 4UTMA 3MI3A 3WD0A 3MCMA 2ZZ1A 4PTDA 4B16A 5FACA 3S5ZA 4DBWA 4JL1A 2QCCA 3W7EA 4CU7A 4F2BA 5AC5A 4EAMA 1V6XA 1JEZA 5ENLA 4NNCA 2UY4A 2YCLA 3IIXA 3AS1A 3LGDA 3L4WA 3BE7A 2RGMA 3UWUA 3TDFA 3F1QA 3QFWA 3B40A 4CKQA 4B90A 3IJ8A 4WGXA 2BY0A 5D2XA 1BYAA 3LTYA 3UG3A 1ZB5A 1GONA 3BSMA 5JUVA 3RJXA 1H1ZA 2BLEA 2V68A 1I0DA 4I8DA 4IFOA 4L7ZA 4RJEA 1MI3A 3GG1A 3WQWA 4FO4A 4KWSA 3EDEA 3N2MA 2HK1A 3GK0A 2NXHA 4GY0A 3V7PA 3FCPA 4Y9NA 3PNZA 4E0CA 2JF6A 3W3OA 1FHUA 5E0CA 4AX7A 4BA0A 1BWKA 2V82A 1OC6A 2CHRA 1E55A 2E5CA 3GTXA 2B7QA 4W7WA 4D6GA 4IUGA 3UZ5A 2PDHA 3DC8A 3C56A 2VZSA 1UHVA 2DIJA 2QS8A 4A05A 3M16A 3FA5A 4G5DA 1WAWA 4WZHA 5G2IA 2VTFA 1A5KC 2HROA 2WC3A 1JIBA 1PX4A 3C86A 5HWJA 4PCSA 5K7JA 1X39A 4ADTA 1XDJA 3DCPA 3H8AA 5SWUA 4X0NA 2QT3A 2VDGA 4LAKA 2ASHA 1PE1A 3QW3A 1WE5A 4PTVA 1DORA 2EEXA 4ZCWA 3F5LA 2P8BA 1IXPA 4AVNA 4NIRA 1I1WA 3URAA 4WD0A 1AA1B 2AL2A 1EL3A 3G1SA 1FWBC 1POKA 4MHBA 3FX4A 1KXTA 2Z28A 1FWHC 4FEZA 1Z32X 3UJ2A 4W9TA 4OUEA 3VNLA 3S9ZA 1EQPA 3MUZ1 4IMGA 1IHIA 3WLLA 5A6LA 3VCNA 4PGLA 3TTSA 4C6OA 1ZZMA 4B5SA 1ISVA 1FOBA 3W75A 2WVVB 1WBHA 2FHFA 2VUYA 3VOFA 3ITLA 1UH2A 4MJZA 1YHTA 4Z2LA 1KBLA 4KGLA 3TC3A 3JVAA 3M0YA 5LIWX 4I3GA 3W1QA 4DWSD 4QQ3A 3DFYA 4DUWA 4JHZA 3WENA 4IMFA 1XISA 3NO5A 2WVVA 4RE4A 1TWIA 3W7JA 4NJHA 4GXPA 1G4SA 3NO1A 5LIUX 1KTBA 1MDRA 2POZA 1CXKA 3NWRA 4UC5A 5D9OA 1VP5A 1PZ3A 2Q3OA 3N2OA 1WDSA 3B8VA 4X2PA 3ZO9A 3EA2A 3EX2A 1BQCA 1ITCA 4GA8A 1VD6A 2IQ0A 1O1ZA 2V3FA 1PTGA 2EO7A 3NOEA 4EKJA 4ZQCA 1UP3A 1A0EA 3ZR4A 4U5IA 4PUMA 3C52A 3URBA 1N8FA 3TROA 4RK8A 3IGSA 4EK7A 2D20A 3CGTA 4E5TA 3GWQA 2F7FA 2VRJA 5I5RA 1XM3A 3ARRA 1BGGA 1DHKA 2W62A 5JH2A 4XTIA 2DV0A 1DBTA 1RBLA 1OFOA 1J93A 1FHLA 1W9BM 4AC1X 1OCBA 1FCUA 3ARQA 3C0SA 1XYZA 2OGYA 4P7OA 4LUYA 1OX4B 2POTA 1W9VA 2GDQA 3LX9A 5I02A 1JPMA 5LIXX 4A2RA 3QHOA 5IFPA 1OQFA 4CU8A 1N2VA 1MO0A 1ESWA 5FSEC 1I2RA 1CGXA 1KGXA 1NM9A 2OR2A 3SGGA 3M7WA 4J35A 3QF0A 4PCTA 2EPHA 4TV6A 3CAQA 4HQVA 5AFDA 5KMYA 1ODUA 1IEVA 1WQ5A 2BY2A 4KCVA 1JAEA 3DIPA 3Q4DA 2VGBA 4F2TA 4D1IA 1V3LA 4QG9A 4RE3A 3QBUA 3F4NA 3H4WA 3ZSTA 4EVZA 1I60A 5AB3A 1XGZA 3NL3A 4PB5A 2PDUA 1SJDA 2W6RA 3LHWA 4L4MA 1G69A 2VFHA 3IJ9A 3WJZA 2ZX8A 1LQ0A 2QVHA 5G1TA 5EU9A 1DXFA 5ECVA 5EFFA 1LBFA 4NU7A 5FF2A 3VMPA 1E9YB 2OFJA 2CLHA 4CCCA 4HTYA 5D02A 2IQTA 4TUFA 4ZFMA 4A8NA 4XIMA 1OGGA 2CPUA 3OLIA 2J6XA 3OP2A 3ZZ1A 4O13A 4HOZA 1UC4A 3VCCA 3ITCA 3CUFA 4LVFA 5T8GA 4PUNA 5HA7A 1VJIA 3NURA 1UKTA 4M80A 4ZBCA 2YIHA 4JFWA 3B0UX 2ABAA 3ZR6A 3W6LA 3I4KA 3H54A 2Z26A 5ABHA 4IFKB 3HURA 1F05A 3GDMA 2ZZ2A 3AWNA 1L6SA 4O1AA 1IZJA 3ZLGA 1AH0A 3L4UA 3UXDA 3UG4A 2EPOA 3GBEA 2FVLA 4UMBA 3CUJA 2ZWZA 1PIFA 2VURA 3P62A 3LK6A 2WV8A 4LANA 3NNTA 5T9CE 2OQYA 4QDWA 4LC6A 1UR8A 2VXNA 1DHPA 1NIUA 4GIYA 2XISA 4LVDA 5A6KA 3W27A 1TJ1A 4EF9A 4EWND 4PMVA 5K4ZA 1IGSA 2TRSA 3M6DA 3W7NA 5ABTA 3E0WA 2IKGA 2DSKA 1GUVA 3IIVA 4O19A 4JQ3A 2VI0A 3CUZA 2PU1A 2E8YA 1NJJA 4FA3A 4E2VA 1VFOA 3KLLA 1FKWA 4S3AA 3ZJ6A 5CGQA 5JMUA 1DWHM 5FA5A 2C14A 1QI5A 5FSDC 2WMHA 3OVRA 2E77A 1M7JA 3CO4A 1GKPA 2VFIA 1QNRA 3R11A 8XIAA 2VP8A 3O9NA 2C1GA 4MZYA 1V6VA 2OJPA 4WVXA 1D3CA 1S5MA 1ITXA 4V27A 1GYLA 1UZ1A 3OW1A 3KAOA 1QVBA 4EANA 3F4DA 3T2OA 3D5HA 3EMQA 4NT0A 3QN3A 3S5NA 3BK0A 2YL8A 5BCAA 4JX4A 2C71A 2GQ8A 2I5QA 2DPEA 2DEPA 1NSJA 5EMJA 4YU1A 5BXRA 1NFBA 4DLFA 3FXGA 4YVVA 2YSWA 1UPMB 4BI5A 1RVKA 5C70A 4NYUA 4FNQA 4XV0A 1DOSA 1W3NA 3GLCA 5HR6A 3P80A 3T4WA 3LOTA 4XZLX 2QAPA 1LWJA 2PWGA 4MADA 3S1VA 3M4HA 4PBFA 3VNIA 4AHPA 3P8IA 1TPDA 2BX7A 3DBNA 3GNXA 4OHQA 3WLJA 1HL9A 1QMLA 3VZXA 2XWDA 1KM0A 2HPIA 2OLAA 2OOGA 3TCEA 1UKSA 1JPHA 1NOWA 4REQA 5CCZA 3D47A 1R9ZA 1W3KA 3B8DA 2J7GA 3RU6A 2Y6ZA 3P61A 4DUXA 3VOJA 4X9SA 5K9DA 3DERA 3FGCB 2ZUUA 2WXDM 4LAZA 4S3JA 4ACYA 5F1VA 4YVPA 3M5YA 1E5JA 1QK2A 4LYRA 3SZ8A 4CCEA 1UWAA 2WHKA 1E56A 2VOMA 3V16A 1SMAA 3HJEA 4FX8A 1J79A 3L65A 4UMAA 1UA7A 4YL2A 2G41A 1OB0A 3AIEA 4YYCA 2J7DA 1NWRA 4LY8A 3OOQA 2ADAA 1DE5A 1Q13A 1OVDA 4HA3A 5DY2A 3U48A 4QBXA 4BWLA 3WF3A 2R1KA 1P0KA 3KP1A 5C9RA 1ISYA 1YQ2A 1UWIA 3DHDA 4WDWA 1RCQA 3TV8A 3WH6A 2WMGA 3K2GA 4DJEC 3FW6A 2VMFA 3IV3A 1XLAA 2EKCA 4ZA0A 4FI4A 4MAZA 2VC6A 2EAWA 2CZ5A 3SCVA 2G95A 1YEYA 1XRFA 2GVGA 4DO5A 4ICNA 5GNXA 3VC5A 5KSWA 1D8CA 3OU8A 5U7SA 3R0UA 3D3AA 3PBUA 2W5FA 1KGUA 3QTGA 1GWJA 1US3A 3KCJA 2Z00A 4ZTYA 2BGQA 1BQGA 1RA0A 4DVOA 1LDCA 2PDJA 4IISA 4WDTA 2PDCA 4UQAA 4LVAA 5BOEA 4J3WA 3TQ0A 2YA0A 4N7QA 3LMZA 5BWAA 2RGLA 3F2CA 1B31A 2JF7A 4LYPA 3BSHA 1F6KA 4XZMX 1VFTA 3HB9A 8TIMA 3WLTA 4ENLA 1JPKA 2YCIX 4N9DA 3U7VA 4E4FA 4Z0SA 1CEOA 3P81A 1PKYA 1N55A 1E9LA 5K2ZA 3KCOA 4GYFA 5CC5A 1F74A 3LPFA 3I3BA 3QYSA 2NT0A 1CIUA 3CM4A 3GIYA 4UTFA 4DWSC 2BP1A 4H83A 1K9DA 1GQLA 1UUQA 2V5KA 3FJ4A 3U6WA 3ZVHB 1TPVA 3CQIA 1XI3A 3SRHA 3VGBA 3ARVA 2E9MA 4HIBA 4N4PA 5LHEA 1NU5A 1P48A 3VUSA 3BOLA 3U4FA 2HS8A 3BLEA 4JTFA 4IP5A 1F7BA 1R38A 4LY4A 1A0DA 4JICA 2OU4A 5EL1A 4WXZA 5HPOA 2FJUB 4A6GA 2ZDSA 4P7LA 3DZ1A 3B0YA 4M24A 2YYTA 3EWUA 4PL1A 5EMMA 3AFBA 3PUDA 4HNNA 3DU0A 3CS2A 1OFEA 1SFLA 4DO7A 4RZ6A 3P5YA 2DZBA 3HA1A 3G77A 2HDJA 4JX5A 1F8MA 3INPA 4IT1A 1WXZA 1UUOA 4OTKA 3RILA 2INEA 1U5JA 2B7NA 3MCNA 2VNCA 2X41A 4DM2A 1UIPA 4OBRA 3PN8A 1DKWA 3CIWA 2WVTA 1Q4NX 2Y88A 3E0LA 4V15A 4C91A 1RY8A 1RQHA 4YTRA 2G3MA 4JNZA 1KKRA 1R30A 2IPGA 3QR1A 3CNYA 2TYSA 4ES4A 1RXOB 3PY2A 3WUEA 3VABA 2WWDA 3U5UA 2FFCA 2AQVA 5F7UA 2PWUA 3UVIA 2GFTA 4MY9A 4J2MA 6XIAA 4PODA 4JYFA 1HP4A 2OGJA 4GUIA 4YTUA 4JKKA 5I79A 3F4WA 2X42A 1XLMA 1J18A 2HBXA 3CHFA 3LUTA 3APYA 2FMOA 1L6FA 3L4XA 1QPOA 4O54A 3PZMA 3WN6A 3RPMA 3GC4A 4NRSA 1F4HA 3SO7A 4B5WA 3ENLA 4ZB0A 2PS2A 3FVDA 5CAKA 1OGBA 3QV9A 4FZIA 1SZFA 1XUZA 5G4EA 1NVMA 3WDQA 1PWMA 4Y7EA 2ZWYA 4MMWA 1D2KA 4CNTA 4IIFA 1KNWA 1JZ3A 3VI2A 5E6YA 2VFEA 5U4NA 2QCMA 2VGGA 3A9BA 2OSWA 1WKFA 4TOQA 3M43A 5HNRA 5LNSA 2C8NA 4PL2A 3M5VA 1W54A 4RZ5A 2XVGA 4UWMA 1JG9A 3W1XA 5HANA 4K1WA 1AODA 1K6AA 4AZBA 3GDLA 2PU0A 3APGA 3NEHA 3MANA 4L61A 5MKGB 4UQCA 3NPVA 3D3FA 1TWZA 2V5BA 3FV9A 1CGVA 3W74A 3LLFA 3L7RA 1JDEA 3CLWA 3NQFA 5T91A 4J3XA 4E2OA 1BSLA 1RUSA 1XQLA 3NCOA 2QCHA 2HS6A 2ZX5A 2CBVA 4N9BA 1XV8A 3WBAA 2OX1A 4K8EA 1TV7A 3MSDA 3H2AA 1RPXA 1YNYA 4QTGA 4YIWA 7ODCA 1DJZA 6ENLA 1CYGA 2QJHA 4GHRA 1QW8A 4TX8A 9XIMA 4ZXLA 1O4UA 5HR7A 3NQDA 2R94A 1UQYA 4L1XA 2CFFA 3GHTA 1TTIA 2EGZA 3GY1A 4GVGA 5I09A 4G8TA 4A3QA 3LCHA 3WF4A 3M0JA 2WQDA 4CQCA 4NXKA 1L8NA 3W72A 3EB3A 3O63A 1EDTA 4O14A 4NX5A 4MY8A 2A3BA 5DLCA 1D8WA 3DFOA 4QIUA 5BMXA 3H7RA 5E6ZA 5LA0A 4PUJA 3R89A 3L0NA 2GQAA 5E9AA 4CD5A 1O5RA 4HPXA 3BGGA 1C29A 1RV8A 1XYCA 1AMYA 1C8YA 1S5VA 2Z1WA 3NG3A 2G50A 4UR8A 4E3VA 3WEMA 1HP5A 1J9YA 1KBBA 1UZDA 1NQ6A 1PTDA 3WNPA 2X1TA 1B9ZA 4YYFA 3QY8A 1R9XA 4ZFCA 4CVUA 2CEQA 3LLDA 3UY7A 3MUY1 1ZTVA 4QE4A 1BEUA 1LL7A 5C6MA 4F9DA 3RNDA 2FTPA 1EUNA 1J0IA 1SW3A 2E68A 2GWGA 3KEHA 2F6XA 1OG6A 3NUKA 3GU2A 2DY3A 3EMCA 3EWXA 2WJFA 3PPFA 4UNLA 4EACA 3U8GA 4GYPA 4QFUA 3KZPA 3HV8A 1WPCA 3OGRA 1CX9A 1O1HA 1RJRA 1OYCA 4XQ6A 1H1NA 2J8GA 3G0UA 4UZSA 4D8LA 3B8WA 3U2EA 1TV5A 1C8VA 1ZPTA 1B54A 5CC6A 4HPHA 2VRKA 1SQ7A 2ZXAA 3IIPA 1RH9A 4D6EA 3ECQA 1W1ZA 3ZT6A 3TLQA 1GORA 4Z1DA 4AH7A 2ZKMX 3TXVA 4TQTA 1D7KA 1TUXA 1QBAA 3N6JA 3IJ6A 4O8AA 4K37A 3ZJ8A 5DELA 3W37A 2PDXA 3DKJA 4ROQA 3P60A 1QPRA 2CLLA 2C16A 2Z1KA 2VD9A 4V1YA 1OINA 3DGRA 2I57A 1WUFA 1MW1A 4H8UA 4O1EA 3B8UA 4G56A 3WLPA 5I3GA 3T2QA 4Y9PA 4AXNA 4YPJA 3PM6A 2Q01A 4NG3A 4MOZA 3NXFA 1NFPA 4UTWA 2GVJA 1TJ0A 2WNQA 1E4IA 5DMMA 5CPQA 1IEIA 4DY1A 8A3HA 4YCOA 2NQJA 2CLKA 3IUIA 1B9BA 1PS9A 4WIWA 2FZMA 3LNPA 1OABA 3BLOA 1F9CA 2E0PA 1IV8A 2O55A 2PDWA 4W8AA 4LCQA 1ME9A 3UWVA 4HU0A 1XQKA 1QATA 1VQTA 1E40A 4HNVA 5C71A 3R6IA 3ZLHA 1M9HA 4LRSA 4W7VA 2Q3RA 4YXGA 1EXBA 1ISZA 3DENA 5DMLA 1TPC1 2F84A 2Z27A 4IPPA 4LU0A 1BRLA 1ICQA 1RBAA 4Q8UA 1R0MA 1VFHA 4AMAA 4URIA 2NW0A 4HA0A 4AWUA 4M6QA 5HPCA 2QKFA 3D46A 3FA3A 3GW0A 1TV2A 3I68A 3E5BA 3VKJA 4AG0A 1V0LA 4KRUA 3LZ5A 3LCXA 2PLCA 1X7IA 2QGYA 2CWNA 1JCYA 1NWSA 4P8XA 3A21A 1QNOA 4NI8A 3V5FA 1JCTA 3PJTA 5HUOA 1UC5A 5TQLA 1WXYA 2F2KA 4JTEA 3C2YA 4B2DA 3N9RA 3W1NA 3U0HA 2QCLA 4H41A 3R94A 3IJQA 3AHTA 2GUBA 1MXSA 3M41A 2NV2A 4NJGA 2ZZ7A 3UESA 3M5ZA 2Q8XA 1JZ5A 3B9OA 4HNLA 2QDHA 1X8CA 3RX3A 3PJUA 3GHUA 1ADSA 1V7YA 1QWGA 4QLKA 4Q8NA 4GI6A 1BSIA 2INFA 3QSTA 5A8GA 4LAMA 4A8IA 2FZNA 3MSGA 4ERAA 3WLIA 3S9YA 2WPBA 1KM6A 2E40A 2I9EA 1CXLA 4OZOA 1LP6A 2VGIA 3AU6A 3EXSA 4XKYB 1JJKA 4Y6GA 1GYNA 4NX0A 4UR7A 4PEKA 3ORWA 4WY0F 4K7YA 1J2BA 1QI3A 3HG3A 3MMTA 3FA4A 1AZ2A 1OC7A 3HGOA 4MNKA 2GQ9A 3VIKA 3VMOA 7REQB 1ZP4A 1IR2A 3KRUA 5D2VA 3LZ3A 1EJXC 4JN8A 3RRXA 3TWAA 1LL6A 1FWNA 1MUWA 3SRDA 1GHSA 5LIYX 3U7BA 1TV4A 3VDBA 4LF1A 4R34A 3WNLA 5JBFA 4Q7BA 4CNPA 4RR4A 4MB3A 3TQPA 1FWWA 3N34A 4XD5A 3PZQA 2A85A 4LCRA 3PZOA 2RAGA 4R5EA 4ZE5A 2Z0IA 3R79A 2WWCA 3GFYA 5DCDA 5C2XA 2VZVA 2PDQA 1JUBA 4D6CA 3TN6A 1JZ2A 1WXJA 3KRBA 2V3GA 5AYYA 3GXMA 2VR2A 3OA3A 2QMJA 3RFAA 1GVQA 3DECA 2R82A 2FLIA 3EEGA 4XVDA 1R3WA 2VUNA 3MHFA 2XIQA 4Q4MA 1W9DM 4JTDA 1AW1A 1L6GA 1LYXA 4HZ8A 3NVDA 2O56A 4PMNA 1V77A 1ZL1A 2R91A 4Y2WA 3VDCA 3W84A 4GJ1A 3NDZA 3UA3A 1J5SA 2GSEA 1V79A 3KZSA 4N6FA 3EB2A 4ACZA 5EA9A 1DYSA 1Z9AA 4CQDA 2DT0A 1B4EA 1QU4A 4IGHA 4H04A 1P1XA 3CWNA 2QPSA 1XYAA 5CSUA 3B4YA 2UY2A 2E28A 3CB8A 4P7NA 1E43A 1PX3A 4F0MA 1E73M 4TO8A 3WBWA 5FD0A 4UQ9A 1MNZA 3ONCA 2ABBA 2VX6A 4WKHA 3P6LA 3A13A 2EJ1A 2BMBA 3RRAA 3BZJA 4NQ1A 4AZCB 1QDSA 3P7YA 3PPGA 4HPNA 3AROA 1XLHA 4GGHA 4JTIA 3LI0A 1RK5A 3F2DA 4IG2B 3K8LA 1C90A 4B91A 1U30A 4HCLA 4XAYA 5C2GA 4C5ZA 3EPOA 4YN5A 4B4HA 3KP0A 1XPGA 2QCFA 4EIVA 2REQA 2WW5A 1HVXA 3TW6A 5IDZA 4UR9A 3HQPA 2GSJA 1FHVA 2CNCA 2IW0A 1A47A 4JFTA 4O15A 1XH1A 2OWWA 2YKKA 5T9BG 4Z0JA 1UPPA 3K8KA 2XYLA 2DT1A 2Y7FA 3SCWA 1EGMA 3VMNA 1V6TA 1WOBA 2NZLA 1LLZA 5CSYA 1VPXA 3WG6A 3W7LA 2XIIA 1SR9A 2YPIA 5I3HA 2BZNA 5H8MA 4PSPA 4BCEA 1GVOA 3KOXA 1ONXA 4H9ZA 1SZGA 3C2FA 3U5YA 3CAKA 3W1UA 1UD5A 4PUDA 5DT7A 3AXIA 2BVWA 4OGZA 3CT7A 4Z1YA 3VD7A 4FX7A 4QCFA 5FEZA 4EAYA 3UU0A 3H2MA 1IF2A 2XVLA 1K03A 3B8IA 1ZJIA 3UNTA 2BASA 2XSAA 1TCDA 1VCGA 2J7EA 3UETA 5HWMA 1SO3A 2VVSA 3QZ6A 4LALA 3LQGA 5DX7A 1LJYA 3I65A 2EQDA 4HMEA 3F03K 1QO5A 4XAGA 4ZSUA 3BXWA 4UTIA 3QQ0A 2BHYA 3GIQA 4YJ5A 3CPGA 7A3HA 1UIOA 1JR1A 2PDBA 2C0HA 1EXPA 2X0HA 3MQTA 1Z42A 5BZAA 5C5YA 4WXYA 1XFBA 1QOQA 3WL0A 1UR2A 1JZ6A 3ZXWA 1JDAA 2PAJA 4PMDA 4QAIA 5MKGA 3ONBA 1NF7A 1E4NA 3W7HA 5HATA 4EF8A 1DP0A 4IXXA 4BQ5A 5ECUA 2ACSA 1YKWA 1M41A 4HU3A 1CENA 5H91A 2PF0A 3S6DA 4AQLA 3WQ5A 1XIJA 4L9ZA 4KESA 1S2TA 3BJTA 3SADA 3FNDA 4X3ZA 3DX5A 5AVHA 3CH0A 1F6YA 5HULA 2YBUA 3BLLA 3LGGA 3P0WA 4MNJA 4YTSA 3QJAA 2PDFA 3C0JA 3IPWA 1EJSC 1E1EA 3LN3A 3AJXA 1EPVA 2A2IA 3PG9A 3OBAA 4O50A 3TSDA 3F7JA 3TYCA 3P3BA 2GWNA 3WJWA 4QRNA 3BVJA 5HOSA 1VCVA 4WJXA 3SRKA 1ZAJA 5TIMA 1FX6A 1IT0A 1OJXA 1QFEA 5D30A 4W7UA 1E70M 1CLVA 3JRKA 3CYVA 3LQLA 3MT1A 4AYSA 2W9MA 2EPMX 3P74A 5XIAA 3A3HA 1R7AA 1FCQA 2GSHA 4XZNX 4ADUA 1K3UA 3G0SA 2D3NA 4GG9A 2R9RA 2ZE3A 1E72M 1Q63A 2VEIA 1LORA 3ZS4A 3EB4A 3TYZA 2HE5A 1RR2A 2ACUA 4HP5A 4KS0A 3IUDA 3PZ9A 2YYUA 2WKJA 1GJUA 4HSOA 1G4TA 3CZLA 4NASA 3KBNA 5CGTA 5I6SA 4GINA 4W84A 2NX9A 3IACA 5IHRA 2DH2A 4IQLA 3A3WA 2PEVA 4U10A 3TR2A 1K4GA 4Q8QA 1H2JA 1A5BA 3K4AA 5FAJA 4OFCA 3SM0A 3VGGA 1GHRA 3VNYA 4I7VA 1VYRA 1YE6A 3WO8A 1WKEA 3A12A 2IPWA 4S3CA 4W93A 5CQ1A 1QHOA 3F5JA 3G6MA 4GD0A 2WCSA 1KCXA 1RBOB 3STGA 2E1WA 4WHBA 1QWKA 2QJNA 3JR2A 3S5SA 3AZRA 1S5TA 1LRTA 2TAAA 4MPKA 4JBRA 1FTXA 4O10A 4BJHA 4ZSTA 3STFA 2XN2A 1JXKA 1K8CA 3QKEA 1MRQA 5IRPA 1GPFA 1AW2A 1LG1A 1M5WA 2QJMA 2ON3A 4HN4A 2ZUWA 1IIGA 1QASA 4QEHA 3A5VA 1Q6GA 3W7PA 3LB0A 3I6TA 3DFNA 1EZ2A 2IS7A 2FH6A 1A4MA 5AHLA 1GVSA 2BB0A 3H4XA 1LUCA 3IUHA 5F4SA 4GC3A 5G1MA 3M1ZA 2Z7KA 2OLSA 1GGOA 3IVTA 3N3TA 4J4KA 5AY7A 2XSBA 1TV8A 4NYYA 4GQ0A 1NTHA 4NKCA 4XIAA 4HA4A 1XC4A 3VFLA 1OADA 4NI3A 2VFFA 3QR0A 3AXXA 1F5ZA 3HPAA 1OC5A 4H6KA 2JKAA 3W7RA 1R3SA 1BPLB 3R43A 4LJ3A 3UEQA 2YA1A 4LH8A 4A3HA 5C9UA 1OYBA 3FYPA 5A6MA 5GVJA 5LNUA 3M47A 1Q45A 3GZ3A 3SIZA 2EPKX 2DZXA 2Y89A 1LCOA 1TR9A 3F2BA 2ONEA 3C2VA 3TJ4A 3TTYA 2QMKA 1EP2A 4GZJA 4H2HA 1KC7A 3MJYA 3H22A 3M0LA 4FXJA 3GNPA 3W7CA 2ZA2A 1V3HA 4QNEA 4R53A 4DO4A 3AIRA 4H2CA 1ZU8A 3HJZA 1FQ0A 4H9XA 3PWAA 1H0IA 4FALA 4HJWA 1PCWA 2O9OA 3HFYA 2RDTA 4B3ZA 2NV1A 1R3QA 1U2YA 4F0RA 3NA8A 2F6KA 3KHDA 2HZGA 1XH0A 3TZNA 3DOPA 3G1AA 3EWDA 3UCQA 3NL2A 3UJEA 1FFQA 1VS1A 3A4WA 3VD9A 1KCLA 2ZADA 3L23A 3AMGA 4GNJA 4D9PA 3UR7A 3G5EA 1LWHA 4HNTA 5F2GA 2XIOA 3BG9A 3BW3A 2Y8UA 1XLJA 2WANA 4KRTA 2QAFA 3ANVA 1UD6A 3ERPA 3WD4A 3W2MA 3NPWA 4ZOAA 4AF0B 4WUIA 2A1YA 3S2CA 2FPYA 3TVAA 1MQQA 4RV3A 4JZ5A 4AB4A 5CPMA 2PMQA 4AC7C 3N9KA 3O8AA 4KPLA 1E6SM 1LRQA 3BAJA 3W26A 3GDTA 4FS9A 4F4RA 4AIUA 3BCJA 3UY8A 1TELA 1D3GA 4AU0A 2FDMA 3VNZA 5AOUA 3J7HA 1TX2A 3OBEA 4CN1A 2P53A 6A3HA 1NY1A 1E6ZA 3W7OA 2PFHA 1FXPA 3N17A 3TH6A 4CD6A 4IGSA 4A2SA 4HPJA 1UA3A 1XRSA 5M17A 4I9JA 5REQB 2RKXA 5DBUA 3IJ7A 1W5QA 4O4VA 3EKGA 4DB7A 1E4MM 1ZGDA 3L5MA 3W73A 1V51A 2DZVA 1VENA 4JN7A 2CETA 2VR4A 4H9VA 4MJ2A 5DXXA 3E12A 1F6PA 1JDFA 2DUZA 3L4TA 3M07A 3B97A 1O12A 3S2JA 3CV2A 5TBOA 2NT1A 4P8UA 1M7PA 3WNMA 3UJRA 1BKSA 1C8XA 1Q7MA 1FCBA 3M0MA 4FIRA 3JZEA 3NFUA 4JIQA 4GNVA 3R12A 3UWQA 4RNIA 2MANA 2YW4A 1VH7A 4B5XA 2O7QA 3QV8A 5AC4A 3UGRA 1X8FA 1OHLA 3SY5A 4ML4A 1TFVA 2PWHA 3AIQA 4W86A 3ZR5A 2Y63A 7ENLA 1CNVA 3MP3A 2DZSA 3GNNA 6TAAA 2V30A 4H9YA 3T8QA 4AY7A 2VWSA 5LIKX 2JIEA 2V5JA 5FL1A 4C6CA 2A3CA 4MKNA 1KCKA 3B04A 3KTSA 5KZDA 5A8MA 1KV8A 1PWLA 2AL2B 2FH8A 4W8LA 1XDLA 1JZ8A 3GDRA 3PB0A 3CUGA 1QI0A 5A6SA 1UROA 3AMCA 4C6EA 4DJFC 3B4UA 3NYZA 3U2ZA 4JHMA 3B03A 4NZ3A 4TX9A 1QAPA 4WSJA 3XIMA 4RUBA 3HGSA 2INZA 3L67A 2GUUA 4EPBC 3RHGA 3SDOA 1YDNA 1VAHA 4ZZ9A 4FX6M 4JDYA 4F3HA 4OV4A 1HUVA 1YBQA 3F5KA 3EPNA 1KR1A 2CERA 3W38A 4HTBA 4PMYA 2X0YA 1FVPA 2DDXA 1UCWA 3NQBA 2BFGA 3GVGA 4L4LA 1XLBA 4OECA 4RXGA 3VKAA 4DBUA 3NZ1A 5HWNA 4IF2A 4W85A 1W32A 1UH3A 3WQPA 4PR4A 4B15A 3LSBA 2FTWA 4JDBA 4HHHA 1AFSA 3M5XA 5I07A 2IPJA 2C18A 3N73A 2PDIA 3WNOA 2Y8VA 2GLKA 4LCSA 3K8MA 4KEMA 4UFIA 4L1GA 4B5VA 4MZ8A 4K1GA 2PURA 2DH3A 3H6OA 4XO7A 1W2PA 2W91A 4QITA 3HF3A 2V67A 4A8LA 4UTKA 3GTNA 1W5PA 3NQGA 4CN4A 4Q4PA 4UTWC 5TF0A 3QMRA 2CCRA 2OYKA 7TIMA 4UNIA 3VOCA 3OEXA 3WDHA 3UXAA 1V08A 4FXSA 1Q65A 2EF9A 4A21A 4JOMA 4M7SA 1H63A 1BVWA 4AWEA 4MKVA 5MF5A 1OFPA 1YNQA 3FK4A 4ONVA 2GJLA 1H62A 4KERA 1UR4A 3EXRA 4MNMA 3QLDA 4CU6A 1A3HA 4V33A 4EWJA 1HO1A 2ATMA 4ZE4A 4M19A 1ADDA 5HXMA 1B3VA 1LG2A 4H4IA 3ATZA 4FXRA 1E5NA 3E2VA 2BSLA 3LDVA 4BQ2A 3KM8A 2PGFA 2V69A 4PMOA 2CZVA 4GBUA 1Q6FA 5AVNA 3T55A 3C61A 2HXUA 4QSFA 4WX2A 3BMVA 2PD5A 3TYDA 5CBIA 1ENUA 3WLKX 1UMLA 2PBOA 3T78A 1KM3A 4WDUA 1OCNA 2CLMA 4HJFA 4LFYA 3L2MA 1IYXA 1RJQA 4NILA 2QUTA 3MP5A 1OBAA 4KBXA 5C7HA 3UBPC 1R3RA 3G22A 1BTCA 3CPRA 1H5VA 4DWDA 1XL9A 3FSUA 1E71M 1GKRA 1E0TA 3WL1A 4MWAC 2JALA 3U2OA 2PP0A 1OZMA 2NSOA 1U33A 2ZUNA 1DIEA 2V5LA 1VHNA 3T6CA 1Q2RA 1RCXB 1LOQA 1EYEA 4AVFA 1BLIA 3CTLA 1Q6OA 3TJLA 4E8CA 1UOKA 3LCIA 3VC6A 2E3ZA 2Y4SA 3D0CA 1QHPA 1GKQA 2X40A 4C65A 1B57A 4LS2A 4AD0A 1AH4A 4NXSA 4Q33A 4YHEA 2RJHA 1RAKA 4O4WA 3S42A 1KRMA 3NR0A 3UGVA 3W53A 3S8HA 4ZQRA 4GIAA 3AICA 3WDJA 2E8ZA 4IL0A 1YADA 3G8EA 3I6EA 3S1XA 1B1YA 3W07A 4IH3A 4PCFA 1Y8BA 3VNKA 4XBJA 1OF8A 2HXTA 1KKOA 1GYMA 1CLKA 1VEMA 2XINA 3EX4A 3ID7A 4N4QA 2W67A 5LXXA 4XISA 5D9PA 4IP4A 3NQMA 4ZO9A 2YR1A 2WHJA 3KWXA 3WK3A 3RN6A 1JNDA 3S2MA 4BF7A 4DJDC 3SCNA 1K9FA 1R5YA 2WM1A 4CVWA 3W85A 3O6AA 1Y5VA 2DGAA 2J25A 1XCWA 3BGJA 4I7WA 4QS6A 1VB9A 3PULA 4P2VA 3ALFA 2REQB 3DG7A 3N13A 4NZFA 5CJNA 1REQA 3TTQA 3TE9A 2IXUA 3MS8A 1NDYA 2VX5A 1A5UA 1E3ZA 3RX2A 3P5ZA 3AXHA 3MO7A 4LYQA 2VM8A 2QUMA 3CYJA 5HMSA 2BTMA 3E6EA 4FMVA 5E70A 3TMQA 1KWGA 2V81A 2PCEA 4GUFA 3TA6A 1MW3A 1E6NA 4MYXA 3MJMA 1B3OA 2YDQA 4GCXA 2JFEX 1VCFA 2PP3A 1XBZA 1WX0A 4Q4SA 3KVLA 1H50A 1PDZA 3ARTA 3BC9A 1V02A 4XK2A 3R0DA 5LA2A 2ZXBA 1RHCA 4XZBA 2Z2BA 1JYVA 4G9PA 3N1AA 2ZQ0A 1DQWA 3SN0A 1K9TA 4FLSA 4DXVA 1P1MA 1Q5MA 3V18A 3VCRA 5A6BA 2DSVA 3WEZA 1Z69A 3BSGA 4LBRA 4OU1A 3M64A 5C55A 2GQ3A 1HJWA 3B0VC 2NXIA 4I9MA 2ZA1A 5DF0A 4S38A 1ZJHA 4WJ8A 3NAVA 2NQ5A 1OT2A 2D22A 4PRRA 2XHYA 1KD0A 2PODA 3RIKA 2ISVA 2OZ3A 4AIEA 3AZTA 2C19A 4U31A 4HN8A 4MB5A 1MMFA 4QE5A 1EP1A 3T08A 2ZYFA 3BMWA 1S2AA 4LF2A 5E0FA 4G2DA 3GTFA 3QMTA 3QC3A 4GVIA 1JGIA 1T0OA 1TQJA 2VCBA 1KFEA 3TYUA 3LA4A 1KM2A 3TN3A 3OA5A 3H23A 3SW6A 1BVZA 1W1IE 2OEJA 2E6DA 2WMKA 1XIFA 2E9BA 5A1AA 3QSRA 3QKZA 1CI1A 1U1UA 3GG8A 1W9UA 4O53A 2CZDA 3S0CA 2QPUA 4FLRA 1PCKA 2XSXA 4C7FA 4RL3A 3OZMA 2YFNA 4PCNA 3GXFA 3WLRA 1FBAA 3NQCA 4A4AA 1PKNA 3WQCA 4XG1A 1TE6A 4QCEA 2FZ8A 2FGZA 4POCA 1PZ2A 3EX1A 3KVMA 2RH9A 1ZBCA 4XZIA 3N2TA 4DJDA 4RKAA 3LM7A 3SQSA 1GOXA 4UXDA 2YCKX 1A49A 5EYWA 1K7XA 4J7RA 4GMEA 1XLDA 3GAKA 2NV9A 5GJPA 1BG4A 4W88A 4OT7A 1KFWA 3WLMA 2WJEA 1VPQA 4DZAA 3ZFHA 4IHCA 2H3DA 3DYPA 4A3YA 1XIHA 4I5UA 4JTTA 3BAIA 1TPH1 1EC8A 1AJ2A 4A3UA 2R1PA 3AXMA 3WUGA 1EIBA 2OZTA 4HOWA 1ZFJA 4LT9A 1UJPA 4F79A 4NJIA 4C1LA 3QYQA 3P0XA 2E1DA 4EXQA 4MY1A 3FEMA 2NVCA 3BL3A 3R8GA 4X60A 5C2CA 1RVGA 4BEQA 3EOOA 4YVXA 1AQHA 9XIAA 2VEKA 2BNJA 2OLHA 4J9JA 3UZZA 1M04A 1JYWA 3SEPA 5D2WA 4WKFA 3AQUA 5EGRA 2E6AA 3ZIZA 3PTQA 2DVXA 4AIOA 3W2LA 4Q4QA 5FCZA 3V1PA 2ZRXA 3V0UA 3AMDA 4F2UA 3BG3A 4UCFA 3TJIA 2QVNA 2UY5A 4HMCA 4TVUA 5L9FA 3CLMA 5FI8A 4LC8A 2ZUMA 3PR2A 3GH5A 3PJWA 3KX6A 3G3MA 3IIZA 3HN3A 1P7TA 1EFZA 3LHZA 2QR6A 3SN4A 3K46A 2PTDA 4UOZA 2YXOA 1PL9A 1W3HA 3TX9A 2O9PA 2YW3A 3V0TA 1M7XA 4KW2A 1UWRA 2XM1A 4GUGA 4AZ6A 4C6NA 5I03A 1KM1A 1TA3A 1F3TA 4M81A 3USZA 4AX6A 2PB1A 4IPJA 3DI0A 2W27A 3NSMA 2GOUA 3VOIA 3VIHA 2HWGA 3ICJA 5KZMA 4ORMA 2CKRA 3S5OA 5A2AA 3GYEA 1GVRA 3LPOA 1EC9A 2B7PA 2BXZA 3PS7A 2OT0A 4EXBA 2NUWA 5HJXA 2C1IA 3G8RA 4W87A 3WF0A 1KFBA 3ANYA 1D7FA 1LWIA 5J5DA 4LS1A 2XVPA 2XGZA 3SCRA 2CXGA 3BARA 1PPIA 1KR0A 3KBVA 2Y1HA 1F3WA 2CXEA 3ELFA 2QDGA 4XUGA 1TX0A 3QLLA 4B5TA 2QF8A 2ALRA 3NOYA 4NAEA 3V5CA 3GH7A 2ZC8A 4JTKA 5HQLA 3NM1A 4C6FA 1E0XA 3OIHA 1A80A 3RM8A 3ITTA 5CZTA 4ZO8A 2UV8G 1W56A 4PMQA 1OY0A 2OMAA 4H7ZA 1V93A 2WSRA 2EKGA 1FRBA 1J6PA 4N2YA 1JYNA 1MVYA 1EDQA 3A64A 3MMUA 1G6CA 4MWAB 2PCQA 4G7EB 4QS5A 2A7NA 1ZBKA 1XCFA 2ZX9A 4DPQA 3CQ0A 3SUWA 2VCAA 4RW5A 2Y7DA 1GOOA 4F9JA 1LT8A 3CZJA 2HVOA 3P2VA 1X1OA 3BPWA 3VINA 3DHPA 1CGWA 3CHVA 1V03A 3TJXA 2J77A 2WBKA 3FVMA 2EXOA 3OZYA 2WZIA 1KXQA 4UQEA 1CXEA 3W70A 4JQ4A 2J13A 1E1CB 1N82A 3KOWA 4MUZA 3TEVA 3ARZA 3FKRA 1MW0A 3L4ZA 2R6OA 3VA8A 5DO8A 5AKQA 1FXQA 1EP3A 2CLFA 3GW3A 1XLKA 2YL5A 2FYMA 3AZSA 4JQ2A 3BW4A 1Q66A 1RLCL 4M7TA