3V0WH

Crystal structure of fab wn1 222-5 in complex with lps
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
219
structure length
214
Chain Sequence
b'EVKLVESGGGLVQPGGSLSLSCAASGFTFSDYYMTWVRQAPGKAPEWLALIRNKRNGDTAEYSASVKGRFTISRDYSRSILHLQMNALRTEDSATYYCVRQGRGYTLDYWGQGTSVTVSSAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSGLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WN1 222-5 Fab (IgG2a) light chain
publication title Antibody WN1 222-5 mimics Toll-like receptor 4 binding in the recognition of LPS.
pubmed doi rcsb
molecule tags Immune system
total genus 41
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v0wH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v0wH02
5E95B 1G7JA 3VFOB 1KACB 2FIKA 2R9HD 3P4MA 3ARUA 2IH1A 4NCDA 1G9MC 2APXA 4NQCD 5BZWB 5I1CH 4K23H 3BN9D 4EKXA 4LOUD 1WBXA 3D39A 4JO2H 1HXYA 4XVTH 1PZUB 4OCSL 1S5HA 3P4LA 3RWCB 1N7MH 3UTZA 4DGVL 1MFEL 2KZWA 1B90A 3X3FL 3SE8L 1RIUH 1ZHBB 3HRPA 2F19L 3OGCA 3T3PF 1N6UA 5GRWA 4NQTA 4U1IB 1DJSA 1S7VA 3DBXA 2YXFA 1AC6A 3SDCD 2XQYK 4P2QD 1T5XB 4I3GA 3FT4A 4P23A 1A8JH 4K7FB 1INDH 5JW4M 1FCGA 2AJXL 1NGQH 3V7AE 4ELKB 5E9DB 4WNQB 4RX4A 2J5LC 3GM0A 1XH3B 3S3JA 2X05A 4OZFH 3WE6A 3VXUA 1A1OB 1AR1D 3PHSA 3T09A 2O5YL 4M6AA 1AJ7L 1T2QL 5FHBL 3G04A 2Z35B 4OZHB 3MOQA 5C0AB 1JMXA 3BP5B 1CT8B 1FAKT 5EU7C 3WUWG 3MMEA 5B38G 1EGJL 5AAMA 4KK5D 3MBEC 1YEDA 3QDMD 5CINL 2D9CA 3RVWD 3D85B 4FQ1L 4BUGA 1R5WB 1SJXA 1MHHA 2ZUVA 1UA6H 2YZ8A 4I0PA 4HJGA 5GGQH 5IBTH 3FOMB 1FZOA 3QHTC 2Y5TA 5J1AA 1XIWC 1U3YA 4XMPH 2CO6B 2BY3A 4LLDA 1U8OB 3G5XA 3ZZ1A 5E6YA 4XPGH 4FA8A 4M8QB 1F00I 4Y0GA 3KPSA 4JFYB 4QHNB 2X4PB 4PLKC 4P4KD 5DI8A 1K9TA 2BFVL 3FO2B 1MI5D 4NSKA 3ROOB 5FM4A 1MRCL 5DFWH 2XIDA 5BXFA 4LSRH 1K2DA 3ULSB 1NBZA 1WWBX 3AU1A 3ZYZA 1QBML 1J8HD 1XGQB 4XNXH 5FYJH 2ICEB 3MLXH 3OJDA 4WV1B 5EO1B 1R5VB 4WO4C 1V3MA 4P46B 5BQ7B 1HWGB 3LV3B 3PWNB 3EFDL 4HS8H 1W0VB 1SM3L 4D94A 3NZ8A 1G7HA 3RTQC 3PL6A 1IGFL 3NCEB 4W6YB 3O11A 5HGAB 1YC7A 3WN5B 1KF9B 4L8BB 5C0IA 5E8PA 3E3QE 3HI5H 5FA4B 1BBDL 3BGFC 5KJRH 1FIGH 1JNLL 3V95A 4LF3A 1EVUA 1W72H 3TPKA 3X11B 3MRLA 5CJ8A 1FG2A 2X4OB 4IMLB 4ELMA 1INEL 1BFTA 2HA1A 3PABA 3VG0H 4HJJH 2H32B 2YRLA 1CTNA 1R3JA 5EUOB 1YEEH 4DOHE 3UTTA 3U0WL 3GHBH 4E41E 1AGBB 2OQJB 2OR8A 3H7BA 3KS0J 1I3UA 1YDPB 2F5AL 1BX2B 1CXHA 2XQBH 1MRFL 2MCPH 2YK1H 1H3UA 1P9MC 4P9HL 5LQBL 4LCWD 5AZEL 5ADOL 5DRZB 1QFOA 2R69L 1LD9A 2V9RA 5ITFB 1BD2A 2F53E 3I9GH 5TF0A 3BVNA 1C5CH 1OSZB 3LQAH 5LAXA 1HINL 1ORQA 2ORBL 2C7UB 3DVNA 4PIRF 2H2SC 4G8GE 4NOBA 2X4UB 4RFEB 3WFZA 5C7XL 5EULV 5MEQB 3BKMH 3B5GA 5GSVB 2R0LL 5CGYD 1RSFA 4PJ7F 4L5FL 4AQ1B 3SDAA 5CEXA 1LK3H 2VXVH 3ILPB 3VA2C 2AI0L 3O8XD 4C4KT 1JZ3A 4U1JA 1V8HA 2VC2L 5D5MF 5EG6C 3MRIA 5J7CC 2HKHL 4ZUSA 1TCMA 3GDBA 3V4VL 3JWDH 2CUHA 5DJCA 1UFUA 1X6NA 5DHVA 5IOPA 5C0GA 3NGBB 2W0FB 4OF6A 1YMHB 4L4TA 3WKNA 3EOTL 2E9WA 4JR9L 3CMOL 2NMSA 5HVFB 4BFIB 1TZHA 4F7PB 4HX1B 3KJ6H 1KSRA 3C5ZD 5EZJB 4RGMB 4WW1B 1WLHA 1X5XA 3HUJE 5FCSH 1GGIL 3HNSL 1V7NL 4QY8B 4P4RA 3AREC 1AXIB 3TWCH 5DQJB 3WUWB 3S97C 1KC5H 4U7KA 5B38B 2AV7B 4I8DA 1Z9OA 4X7TA 3EUUA 2JJSC 1DL7H 4XB8A 2QKIA 5L0QC 5ABDE 1MF2L 2B1HH 4YBLC 4KRPD 4AH2B 4X4ME 3DUSB 1WZLA 8FABB 1P4IH 4N8CH 2DKSA 2DTML 1CZ8H 2ZG2A 3DMMB 4R97C 4R4FH 2R4SH 5D2NB 4Y4HA 4F9PC 4NN7C 4OQTL 5HYJD 2AK4A 4YBHA 4TPRH 2JIXA 1F6FB 1IEBB 3GRWL 3RVVD 1JWUA 3BWAA 3EO1B 3OWEA 3DRTB 1DN0A 1JPSH 2EH7H 3FMGH 3VWJB 4KDVA 4WHYH 2W0KA 2BERA 2Z91A 4OV5B 2DDQL 3LIZH 1J1XH 1U2HA 4XWOD 5C92A 4J23A 1D5MA 4JRXA 4TSAL 1PX3A 1ONQA 2GSIB 3QIBC 4FG6D 2FBOJ 1FFOB 3KR3L 2V7NA 4KKLC 4ESKA 4XNQA 2VDOL 3RUGA 4MD4B 4MHHI 3IS1X 5EZIL 3NTCL 1QSFA 3UX9B 5DD6A 1PFCA 4KGLA 5JMOC 2I9TA 2HFGL 1K3IA 1DFBH 4WUUE 5TQ0H 4P3WA 1XF5B 4KDTC 2BVQB 4XPTH 5EORL 1H9VA 2APFA 4OZGF 5C0EB 4RQQB 3DSFH 5D7IA 5EA0L 4N9GA 3MYJB 4XHJC 1DVFB 3T0EA 1YN6A 2YPLA 3P9WB 4G5ZH 3QHZH 3K74B 4ZTOH 3OSKA 3MLZL 1E6JL 3HZYA 1ULVA 3CZFA 1HHKA 3L1OL 3RZCD 4XGZA 2HH0L 3HZKA 4M6OL 2BVPA 2E7CA 2QADD 5T3ZL 2NY3D 3O6FC 4X6CB 3PHQB 3W82A 5E08L 3IDNA 5TE6H 5GS1A 3ZTJH 4R0LB 1OB1A 4CADA 3TYFB 2APTA 3EJZD 3Q6GH 4ERSL 4A6YL 1NC4D 3MACL 4OCWH 1MCDA 4PRAB 3S34H 1Z5LB 4PS4H 4C55A 5ELIA 4FFZL 3STLA 2DQGH 1WT5A 1C5BH 1B4JH 2V2XB 2BX5A 3EZJB 2P24B 5D8JL 3MRKA 4JQVC 5DYOA 4IRSC 2OK0L 4L8SC 5ACMA 2ADIB 1OVZA 2H2PD 3U4EA 4PTUA 4F3FA 4G9DA 5I73C 1PD6A 4UILH 2HFFB 1S8DB 4C56B 2L4OA 3VXRB 2EIZA 4FZEH 5DEGA 3EYOA 4DKFH 3AGVA 5JZ7C 1KPRB 2PCPB 3RDTC 1X4YA 2EC9U 2P8MB 4X6EA 4MJIB 4Z76A 2CLVB 4OCXL 5F6IB 2DWEA 3OR6A 1IGMH 3VXSD 2V5MA 1CLOL 4NQCA 4XBEH 3UTPE 1MCLA 3UBXG 3FN9A 2AXGB 1IAKB 4PJCE 5LBSH 4DGIL 4J8RB 4WW2C 1TIUA 1JNHB 4DVRL 3MCKB 1BEYL 1FBIL 4JLRB 4QRQB 3U36B 2K1MA 2NR6C 3VH8G 2IMNA 4JHBA 1YQVH 4QRRB 3B9KC 2Y72A 3MRQA 5IIEB 4WU5B 5C0JA 4UT6H 1J88A 2V17H 4WWKD 3W81A 2KKQA 4Q6IC 3Q0HA 1B88A 1TXKA 1KV3A 4K3DL 4XWGH 5A16A 3SDCA 4P2QA 3G08A 2VDML 4CVXA 1WBYB 4Z0BL 3LB6D 1KG0B 4OCLC 1GGTA 3KLHC 4P2RE 3UZQA 4L4JA 1DQLL 3K46A 3JTTA 2XRAH 1BZ9B 4NYLB 4WHDA 3N0PB 4P5TB 4QHUB 1HOCB 2NYYC 4UINL 2IWGA 1DQTA 2AJSL 3MXWH 1O7VA 3EYSH 3GSVB 3M45A 4MB5A 4S0SD 1IZKA 4BH7A 4LDEB 4Y5VA 4J6RL 1E4KC 1UB6B 4NNXB 4I5BA 4X80H 3OAUH 3MJ7A 3RWDB 4LEOA 4Z77B 2XZQL 1FGVL 2EDJA 3DV6B 4IRJC 4Q97A 5INCA 4M1DL 4LU5L 5I30L 4OLXL 4PJXA 4ORGB 3V0VB 1HI6B 1RIVH 3ESUF 4D9RE 4BKLA 2PYFA 1F4XH 1X5JA 3E6FB 3LEXA 3CFBA 1PEWA 5BZDB 5JDSB 3MSPA 1AKJB 2NY2C 1F90L 4KGJA 2AJZA 5FOBB 4XAKD 4ZDHB 5CEYB 3DRQA 3ULVF 4OLWL 1JPGA 4PP2A 1CF8L 5E2JA 3T0DA 3CLFL 2ZNXA 4P4KA 1MI5A 4XPFL 3IJYB 5IW1B 5IBLD 3C9NA 3MNVB 2HRPH 5ACZA 5CHNA 1J8HA 3AS2A 4LMQE 4Z7WE 4YXKL 5HYSB 3VDCA 5T3ZD 2ID5A 2BNQB 1T1WA 4X5WB 1NFDA 1CXFA 3GJEA 1CFNA 5FM5M 1JHKH 5E6ID 4RSVA 2ESVB 5EFIA 1TPXC 5J12C 5DC9B 5J1TC 4R7NB 3C6LD 4L3EE 1RAMA 3QEQA 4M43L 4NPYB 4X7SH 3QI9C 4WHTB 4BSVA 1IC1A 4P9ML 1UQSA 32C2B 3L3KA 4MX7A 5HY9A 5GRJL 4CL7A 3B9EA 3ZTNL 1CCZA 3TBYA 3FQNB 4YC2B 4LVOC 5JPNB 4K7PH 3DX9A 4KWUA 4RMVA 3PWUA 4X6DE 3CH1A 4MXVE 4RBPK 2VLKD 3RWHA 3O3BA 4EDWL 4YHMH 4C83B 3IFOA 3W11C 3A6CH 4RMQA 1HQRA 4M6NL 4PJIB 3QXDB 2FJFA 1TVDA 4U1KA 5IHZA 4IHOA 4LCWA 4U6YB 4F37F 3FRUB 3RHWK 3UJJL 5KZCB 5AYQA 1GHFH 4PJFB 1DQQB 3UBXB 1FJ1A 4F7CA 1DDHB 3EJYD 4NUGH 3FB7B 5MP6H 3GIVA 1NCDH 4JVUA 1AHWC 1BAFL 3JWOC 1J5OL 3KPNB 4LLVB 5CMAA 4KJPC 1RUKH 1MWAL 2ZKHL 4ZD3H 2NY1B 3VH8B 4NHCL 4TUOA 3D3VA 5T33H 3BIKA 3Q2CA 1HHHB 4FFYH 4UOW0 2NY4B 2QSQA 4FRWA 3O8XA 1ZT1B 1MQKH 2FD6H 3L95A 4PJBA 4PJ5B 4NRXB 3V52L 1KCVL 1FL5A 4BFBD 5FAAA 3BMWA 4WUKH 3VD5A 5EWIL 4WRLA 3WHE0 2CR3A 5CUSH 5KAQG 1TNNA 4CMHB 4E0RA 2XG4A 3DETC 1EBAA 4ONOA 3C5ZA 1B2WH 3BE1L 3QEHB 1PBYA 5BRZD 4S11A 2ICES 3SY0B 2IANB 5IF0B 1EGJA 3VRJB 2EECA 3NABH 3PDOB 4E5XA 5ESQB 3OKKB 3WSQH 4IRZL 3FB8A 1I9JH 1X4ZA 4LP4A 2R0WL 3BDXA 1DSFH 1BFVL 3RWEB 2WINB 2Q8BH 4OZFG 4OCMC 4HQQH 3SO5A 4XVUD 1NGXB 5H2BA 3VGFA 5EUOF 3BPNC 4X0KA 5GHWH 4G43A 2NXZD 3HPLA 3QEGL 2R4RL 4P49A 3FFCD 4DN4H 2NX5E 3LEYL 1Z0NA 1T03H 3TCLB 5JIPA 4UI2A 2B0SL 5JW3L 5D7LE 3H9HA 5EOCH 2ITCB 4F33A 1DBBL 5HYJA 4QLRA 4X6BA 2DQCL 2WP3O 3W0WE 3MXVL 3CU7A 4LCIH 5C6PB 3OR7A 1B0RB 1VERA 1Z9SA 1QRNB 5CD3B 5EC2B 1T2XA 1KELL 4PG2C 3HUJF 3SJVE 5T3XL 1HDMB 5DDHB 4Z6AT 4Q9RH 5IQ9B 2WK2A 3F6LA 1ACYH 3BAEL 3EZ8A 4K9EL 5HGDA 4EQ3A 5IM7A 1DP0A 1VENA 5ISZD 3VGGA 1GAFH 4L4VB 5CGMA 1JGLL 3KPMA 1INQB 2DQDH 3CVHB 1OPGH 1EHLH 3QQ9C 3ARBC 1C12B 2F8OA 3SKMB 5DK2A 3MRCA 4XZUB 5I16B 3JVGA 1FV1B 3LSOA 1II4E 3TPUA 1E4WL 1KULA 4OM1L 2RAMA 2ICWI 5HI5C 2HLAA 2DLFH 1PVHA 2VDKH 4LSVL 2NW2B 5C2BH 5L8LB 3T4YA 1NFKA 4XC1H 5A2IH 5TJWK 5IHUL 1D5XB 3JTSA 4KQ4H 4YH6A 5E8OA 2WP3T 4IMKC 5A2JH 3FCTA 4I18A 2EIDA 1EV2E 4RFOL 5F89B 4HIXL 1YEIH 4MCZA 4POUB 4TNVK 1QP1A 1G9NL 4L29B 1LEKA 4HUMB 4X9FA 3QWOB 5BS0E 3TNMB 1GCFA 4N1CA 3RZCA 2OTUA 1KXQE 2AK1H 3V2AR 3X3FH 2FLBT 4FABL 5TQ2L 3MLRH 5C71A 3LMJH 4X99A 1MIML 3GMOA 4J3VA 5D96B 2HJFB 3B8YA 1LEIA 1CR9L 4U4BA 1CE1H 1X7QB 3D18A 3LKNA 4JVPA 1I85C 1NC4A 3VI3E 3BZDA 4UTBL 1IGJB 1JGDB 3LEVL 3VXTA 1NDGA 2ATKA 3WXVL 1J05A 4S1QL 5A40E 3WS3B 1DCLA 4U1SA 1OW0A 4I2XA 3UAJD 2F74A 1RIHH 4ZFZB 3PGDB 4YPGB 2NY5H 2O5YH 3OZ9L 1T2QH 5LKNA 3RX8A 5FF6A 3L7FA 4MGXA 1FDLL 4PJ8D 1KTDB 2CUMA 1QFUH 4G6JL 2CIIA 2ZSWB 5C07E 1V7MH 5AD0A 4YDVB 1QFWM 1RY7B 1PAMA 2IMMA 2ZOLB 4JQIL 1MFAL 4U6XB 4Z7UE 3SO3C 4NQVA 3VXSA 3M07A 3C6SB 2CO7B 4HSQA 1IFHL 5HHOE 2JTDA 1HSBA 3MLPA 2WBJD 3TT3L 4M7ZC 3ARDD 1FNLA 4HS6A 1G0YR 1JWSA 1RD6A 3RPKA 1ZANH 1MJUH 2R23B 1UM5L 5DF0A 5F7HA 2YUXA 1I8LC 4N0CC 2NW3B 3ZE0E 3VFTA 5I19H 4HFWB 2ICCA 2ZG1A 3MPCA 3RIFF 1XF3B 5ALCL 4KQ3L 3KPRB 3V6OA 4EXKA 4WWKA 2YOCA 5HHNB 2IH3A 5CAYB 5DJ8B 2WV3A 2IALB 5DEFB 3H8NA 4P3DB 3MFGB 1AD0A 4L9LC 1AO7D 3H42L 1ODAA 3ARFB 3QUKB 3QUMA 2NY7H 1R3IH 1FVDB 3CFDB 4ZS7L 3QUXC 1PG7W 3WNPA 2YA1A 1TZGH 1K8DA 1WC7B 1Q9OA 1U93B 3GRWA 3KYOB 2BVYA 3HTLX 4ETQA 5T3XD 5ID0A 2ICWA 4JFOB 3IFLL 4PJEA 4PJCF 1XCTA 3Q3GB 3BQUC 4K71B 2OYPA 2I07B 3WHXA 3WXWL 4YEEA 2ZUUA 4XCFL 1ZTXL 5KSAD 2Q6WB 1CIDA 2FL5A 3INUH 5L6YL 4UT7H 2VQ1B 3VXMB 4HZAA 4R2GD 1A3LH 4GAFB 4ZO9A 5F1IA 3VWKB 4G7VL 1YJDC 4F15C 1AXSB 5ID1A 2RB8A 3FFDA 2ARJA 1DEEB 5HGBA 1IJ9A 3RWFA 5I0ZA 3GSRB 3PV7A 4O2CA 1U8NA 2JJUA 3OXRA 4OLVL 5AUMB 3K2MC 5I1LB 4WHYG 5B3NA 4AM0A 1NLDL 3WMSA 2DLGA 4D0DA 1KB9K 4KMTH 5DD1L 1LWRA 3DNKA 3MRJB 5HVHC 1MRFH 1A0QL 5DUBA 1ZA6A 4P9HH 5DVNA 3ZL4L 5IG7A 3CFJA 3DHJA 2I27N 4AEIH 2KZ1B 3TV3L 1XFPA 4D0BB 1D5BB 1A4KA 3QJHB 5EIIA 4NJAL 5GGVL 2Z0BA 1KEGL 3GJFK 2G75B 3KLSA 4MXQD 1YY8B 4WFGE 3RX7A 1HYRC 1W72B 2DKUA 4FS0A 5E6IA 5EZOH 3BX7C 3GSNL 4A6YA 1G9EA 2PETA 5C08D 1HXMB 2AI0H 1DEDA 2FO4B 4RGNB 1E28B 3TFKD 1G7JB 4ZYKA 3C6LA 1U3HB 2A83A 3MGTB 2R2BB 1KXTB 3V4VH 4POZC 2WIIA 4KVNL 4EUPH 4NZUL 4QT5B 2VIRA 5CSZA 1BJMA 4Y16D 2VDRH 1HXYB 5DT1L 2GT9A 3S36H 4LCYB 3P77B 5I18L 4LSUH 4JPKH 2AKRA 1FNEA 1UYWH 3ZTJG 2CK0L 1RURL 3OGCB 3VGBA 5FV1L 4PGDB 2VLKA 4OZIE 4OUUA 5ANME 3DBXB 1BQHB 5IMMB 3VFWA 4BFGA 3UROR 3WIIH 5GGSY 4JCLA 4DVBA 3AM8C 2Y6SD 4IS6B 3KLAB 1T0MA 4X5LA 5HHXH 1WBZA 2QQKL 3RQ3A 2UYLB 3JUZA 3WE6B 4HKBA 4L8DA 4M48L 2MKWA 3I3BA 4XXCA 1S9YA 2E8YA 4GW4B 3IFPA 4H88L 2FIRT 5CJ5A 5IFHL 5GS0H 3G04B 3QUMH 5CP7A 3B83A 3SKNA 1CLYL 4D9QD 3TA3D 2Z92B 4DTGL 3U1SL 3VXNA 3L3HA 3ET9F 1UVQB 3KWWA 3GRWH 3QPXH 4KTEH 4Y4KD 1Y6MR 2VJXA 3TYGL 1V3LA 4XBPA 3BRGC 1KTKE 3MRRB 5TGBA 3I02A 1MVUA 4LVNC 4WEUD 1YYLH 2D31A 2QR0A 4OCYL 1KB5A 4ZFFB 4OIIL 2HJLA 3GMRB 2P8LA 2GJ6D 1MHHB 1YC8A 2RBLA 1JWMA 4GKZA 1CGTA 1S9XA 5DO2C 1QO3A 1A21A 2XV6B 2ZCLH 3KR3H 1TITA 3GKZA 4QTIH 5D72L 2EH8H 3HN3A 4TSCH 3VXUE 5BRZA 3QZWB 4G8IA 5EZIH 4BSJA 2DQTH 1CBVH 3QNXA 3KPSB 3EW3B 5GJSH 5TE7L 3PP3H 2PR4L 3RPIA 1EJ6A 1GGUA 1QNZH 1FE8H 5MERA 2PTTA 5ILTH 5I17A 2ZUQC 4JM2D 2BK8A 3T08A 1O5DT 5DRWA 1K2DB 2E27L 3I6KB 1NBZB 5DMYA 4EI5D 2XKUA 1I8KA 3EDKA 5EA0H 3NH7H 1P6FA 1QQDA 3NZ8B 3FFCA 3FQWA 5TFSH 3WDJA 4H8WL 1KENL 5AAWA 1I7ZA 1HNGA 1UJ3C 2VLJD 3MLZH 2D7TL 3CH8A 3OKDB 4PJIF 1WTGT 1HH9B 2CK2A 3IS0X 3L1OH 3HLAA 3F58L 4M6OH 5DQDL 1P2CB 5I1HH 2R29L 5E2WL 3EKCA 1DLFL 5JW4R 1NCWL 1OCWL 3KPLB 1SVCP 2WBWB 2BVUA 5CJXC 5D71L 1FG2B 2BHYA 3MACH 5I8KL 4CGTA 4MNGA 1BVLB 4DAGL 4TNWK 4M5ZH 4WJ5A 2NY0B 5EBMB 3SKOB 4PTTB 5ISZA 4LAQL 5F7EL 4J2XA 1I3GH 1G7MB 3GNML 5CLWA 3LN4B 2GFBA 5I1AB 2QLVB 5FB8A 4HXBL 4ODSH 2OK0H 2P43B 4DKAA 4LRNH 5C9JB 3HMXA 4ODXA 3H7BB 4ZMAT 2JJWA 3O45B 4BA8A 4FQXD 5BJTA 5CD5C 3IF1A 4M7LL 1XR9B 5HI3D 1DANU 4NO5A 4HZLB 1MRDL 1LP9B 1LD9B 2D4FA 3FTGA 5MEPA 1RZGA 3K8LA 4WFEE 3CGTA 5IV2A 3R0MA 2YR3A 4OCXH 1CU4H 4Y1AE 4YR6B 2DS4A 3I3EA 3DGGA 2N7AA 4U1GB 5ESVA 1FFNB 4RWYL 4K7PX 3L5WA 1FC2D 2QSCL 4FTVB 3SDAB 3B9VA 2P7TA 1GZQA 4MXWL 3SEPA 5E2TH 3RBGA 1T3FA 4DVRH 3I75A 4FNLH 4NM4H 3U46A 2DM2A 3VFVA 1KNOA 2I60H 3ULVL 5DS8A 3UTTE 5D6CA 5DK0B 4D0CB 4S1SL 6FABL 2IADA 5EBWB 1OAQH 1RUAL 3S6CA 5JA8B 1A2YA 4U6VH 3ZHKA 2P5EE 5D7JD 2F5BH 4LSPL 3V79C 1YECL 1K4CB 3LAFA 3K1KC 3RU8L 3CFCL 1KCRL 3HRZA 3VDAA 1K3ZA 4QHLA 2VDMH 4CDGC 4Z0BH 1BD2E 2YUZA 3WNMA 1MWAA 2Y36L 1A1MB 2M26A 3MRGB 3N1FC 4FQLL 1TQBC 5H94A 5KANI 1NSNL 1OAZH 4N1HB 5ICZB 4EI6B 1KB5H 2QSVA 1G7IB 1ZVSA 1S7XA 4U1HA 1FZKA 1QLFA 3VGHA 2Y06H 5T1LB 2F53B 4YXHH 5HBBA 3KYMA 2AJSH 5E8DL 1I8MB 3BYTA 4KFZC 5SWQA 2QKIB 4PJ8A 4YHZL 2EO9A 3QXWA 4JG0H 2HMID 4M62H 3C08H 5MI0C 4IJ3B 4G8GB 3ESVF 4JN1L 4UAOB 3PQYD 2XZQH 2KBGA 3VRIA 1MCHA 1LO0H 4HIHA 4IIQA 3BUYA 4GH7B 3BEWA 1IEAB 1UG9A 1C16B 3FHAA 5I30H 2AK4B 3VI3F 1RJYB 2FGZA 4MHHG 1BVKA 2WBJA 4Z7VE 1JWUB 3ARDA 2ZOKB 4RCAA 3S35L 3TBTA 4KTYA 1Q9LA 1OAUH 4Y7MA 1T21B 4Y19E 2Z91B 3UXFA 3BP6A 3P9LA 3JV6B 4N0FA 2XTJB 2BXZA 4HUVA 2GSGB 5E24E 5FO7A 5J56B 5TPWL 1Y18B 3ARGC 1TFHA 4JFQA 4NCC2 5CBAA 3QIWD 2VDLL 1EAJA 4JRXB 1AO7A 2X9YA 3IAQA 1SEQL 3NPZB 3CSYB 1C1EL 4GRWB 4R96A 4PJGE 3DX6A 1S7SB 1IM9B 3QXAA 2Y7QA 3RUGB 4ONGL 3H3KA 4GAJL 3JUYA 4NO2A 4N5ED 2FX7L 3LQZA 4Z7UF 1VB9A 4YHPA 5FYKE 2I9TB 1FO0L 3I6LE 5C0BA 4P5KA 4TUKH 3MRMA 1BREA 4XP1L 1HEZA 3G5YA 4DK6A 1TMCB 3MCLL 2WANA 5JLZA 1QUNA 3HE6B 3HMXH 1BLNA 3OTTA 4CKVX 3AB0B 3WDHA 4HFUH 4ZXBC 5FYJU 2Z8WC 3GK8L 4CBPA 3P30L 2APWA 1RFDH 1FL3A 4KI5E 4PBXA 5KSAA 3ZE0F 3HC0B 1JJUA 1KIPA 3BW9A 3S7GA 2P42B 5GRJH 3V6ZA 3S37H 5MEOB 4NJ9L 2EDKA 2O61B 5IFAL 2BOBA 4OQ1A 4XPBH 1BOGA 2Z31C 2BVPB 3TZVC 2A38A 4YXLL 3UJTL 2W9EL 4YFLF 1UENA 3GMMB 3C60C 2HT4D 5GS1B 3HFMH 2EDYA 4XP6L 1T1XB 3ULVC 1OB1B 1QSFE 3CX5J 1CGSH 1F8TL 2PUQT 5KAQF 3EGSB 1H3WM 1CK0H 4MJ2A 3OPZL 4YZFF 4OKDA 1P7HL 4QYOA 5KVGL 3L3IB 1HHGA 3STLB 4AENA 5HYQA 1OP3H 4JHWH 4YWGH 2NXYD 3CLEL 5D7IE 1MH5B 3PWLB 1W2KT 4YHKH 1CYGA 4PTUB 4N5UA 2PYED 3HB3D 2C4FT 2IQ9H 2YPLE 1ZS8A 4GBXC 4TN9A 4G9DB 1RZJH 2A0LD 5DZLA 4EEEA 4OLUH 4MNQE 5FGSA 4AK1A 1MWAH 1LDPL 1OD9A 4JAMA 3BKCH 4R9HA 3VGDA 2VTFA 3UPCA 1KTLA 1W8NA 1YN7A 4PJDB 5C0DB 4DN3H 5FYLL 1Q8MA 4NHCH 1T4KB 4DKDC 5C08A 4NGHL 3U82B 2YC1A 2Q8AL 5IB4A 3KJ4B 4ZAKB 4Y8DC 1QG3A 1M7IB 1SMAA 1UACL 3RY6A 2VLRD 4RMSA 3OR6B 3V52H 2OTWA 1MLCA 2OM5A 4GG8A 4M8VA 5I0DA 4MWFA 4RFNB 1S7QB 4LIQE 4Y16A 4NQSB 2O5ZH 1YA5A 4BQ6A 2FWOB 1TJHL 2X89D 2EKSA 2GTZA 2M2DA 1D9KC 4GKOA 1LO4L 2X41A 4IM8A 5LVEA 3BE1H 4KRLB 1IQWL 4ZO7A 1UWXK 3THMH 5KVFH 1D7FA 4HUXB 3MX0A 1ETZA 5A16B 3SDCB 3O4OB 1CVSC 3IDIA 4XI5D 2FB4L 4V2BA 1GOFA 3NZHL 1FNSH 4PJHA 1IKNA 1T80A 2R0WH 5C0AD 1JFQH 1UWEL 1BFVH 5JW4Q 2FGWL 1I1FB 4NQXA 3E3QC 1CFBA 1ZVYA 1OTSD 4LGPB 3V0WL 4JM4L 1ZWIB 1RJLB 1PDKA 1GGYA 3FRPA 4NQCE 4I48A 2R56L 3FN3A 3LEYH 4KJYA 4Y5XB 2BDNH 2X1QA 3D85D 3MBXL 4R4BA 5JW3H 4FQ2L 5E2UL 1GOHA 4OKVB 4D9LH 2BJML 4FQIL 3TA3A 4U3HA 3FO1B 4AL8H 4QRPE 4Y5VB 4M3JA 4Z18A 4G80B 5I2IA 3WFHB 5AZ2L 3GSOB 1CL7L 2FYYB 3QIUC 2KQNA 4Y4KA 3ELAT 3MJ7B 5C6WH 4TTDC 3DVIA 4PYHA 4OZIF 2NLJA 5INCB 4P2QE 2EDHA 1IT9H 2V5TA 1H5BA 2VDNH 2VYRE 3MV9E 1TENA 4BKLB 1YNTA 2PYFB 4OAWB 1TETH 3EYFA 3QO1A 3CFBB 3V5DB 1UADC 1WUNT 2J8UE 2VXSH 4JDZA 2V7HA 3ALPA 3BOVA 5I6XB 2W65B 4HXAL 4P46D 4PP2B 4RAVA 1E4WH 2PF6A 4QXTB 4W68A 4X9BA 1R3KB 2QEJA 4WFFD 3W5NA 1XCQA 4LSVH 5HDBF 3LKSA 4JM2A 3EYUH 3IDXH 1HSAA 4F57H 4BZ2H 3W39A 1KGCE 3MYZA 5FK9A 5ACZB 4EI5A 2YRZA 1RUPL 5IHUH 2GUOA 3C5JB 3QDME 1MFCL 5IB5B 4R8WH 1NFDB 4H26A 4XAWL 3P4OB 2DYPD 4RA3A 2VN4A 2YRPA 1MNUH 3O2VH 4PJXE 2VLJA 4KKAC 1G9NH 2BRRH 3U0TB 5EFIB 3NIDE 3DUUA 1OF2A 3LN5B 5EU7E 3T2QA 1OARH 2A77L 3EYQD 2Q87A 4OGXL 4LEXL 4FABH 5TQ2H 4LPYA 2EYRB 3QEQB 4BSVB 5DJXA 1UQSB 4HWZA 4UDTA 1F3RB 5HY9B 4YK4C 3OJVC 1CR9H 3MV7D 1A6TA 2QTEA 2EYTB 1MCKA 4U2YA 5HHMB 5IWLC 4MJ4A 1C5DB 4P59L 1MI5E 5IGXL 1YY9C 1LQSR 5E5RB 1NANI 2VN7A 4Y5YA 1YPZA 1N0LA 2RR3A 3IB4A 3ULUL 1RUMH 1J8HE 4XXDA 3WIFB 3WXVH 5FYLD 1F11A 4WEBL 3GSNA 4YO0A 3O3BB 3WJJA 3BXNA 4TOYL 3LRSA 4FQXA 2EE6A 4M61B 3K81A 3IJSB 2AABL 2D2OA 4KK6D 5AEAA 4Z7WB 4U1NB 3HI1A 4LLUB 4JFHE 2LQRA 3B5TA 4KY1L 5D1ZC 5SWSE 4G6JH 3LHPL 4WY7H 1MCCA 1MCOH 4F7CB 1JZ4A 5E1HB 3UO1L 5JXEC 4YDKL 3RIFK 3DJ9A 3E2HC 4P48A 4QO1A 3S36X 1HKFA 4F9LA 5HVWA 1NMCC 1WEJL 2ADGB 1J7VR 4L3EB 1IC5L 3QFDB 4TUOB 3D3VB 5EU3A 4M93B 1AD9A 1ZGLB 3REVA 2LTQB 4XVSL 5CZVH 4CJ1A 2EIBA 1YNKL 3QJFB 3N85H 2V2TA 2DMKA 5K9JL 1J0HA 5D7JA 3I3DA 4X83A 2R1YB 3HAEB 5D2NC 3U7YL 1UEMA 2VKXA 4GO6B 2GHWB 4S2SB 4U49A 3STZA 4NUJA 3EO0A 1I7RA 3O6LL 4MQXD 4PGEB 4GG6B 12E8L 43CAB 1IARB 5CEZH 1I1AD 3SE9L 3VWJC 4HWUA 5KSBB 2IG2L 3GM8A 4HCRL 3DMMD 2LE9A 3IKCB 5BV7H 3GKWL 1BGXL 3U4BL 4PJ9B 4ELMF 5JQ6H 1UEYA 2GITA 3GSQA 4KK8D 4WDIB 2OZ4A 4FQHA 2C3GA 4QXUL 2DD8H 1YNLL 1UXSA 4NC1E 1PYWA 4PJBE 1NUNB 1F4AA 4NRYA 1KBGH 4MB4A 1FYTB 2P5WE 3O2WL 1JK8A 3PQYA 5F3BA 4JY5L 4NKMA 3Q5YA 4NM8L 5MHSD 4EN3B 1OL0A 1F58H 2P47B 1HWHB 4CNIB 5ITBL 4F33B 3VFUA 2HVJA 1IAOB 5HYJB 5DRNA 1HZHL 3L3DB 5FA3B 5DC4B 4H0GA 3QULB 3HZVB 3D2UA 4OLVH 4OCRH 4MA1B 1CD8A 1MCQA 4KV5E 4Y4FB 3VU2A 3T4AB 3U2SA 4CMMA 4HKXA 1YYMH 1SYSB 5JW5A 1M6OA 2D0GA 3IXTA 1EVTC 1G9MH 3FOLB 5IM7B 3ZL4H 3HS0B 2DQJL 3QIWA 3QPQC 4OGYH 2YPKA 3KPMB 4FQCL 4R6UA 4PV8A 2X4SA 1ZT7B 3PGFH 3HNTL 2UWEA 1VPOL 1KEGH 1Q94A 1NAMA 1KPVA 4R0LC 2IC2A 1NGPH 1DVFD 1YZZA 1NL0L 5LGJB 3TPUB 5ICYA 2XTLA 4BH8A 3WJLC 2YBRA 2DL2A 3HE7B 4NKOA 4EVNA 2HFTA 2CIKB 5I8EA 2YD4A 1S78D 3VFSA 3QRGL 3MRFB 3PG2A 2HJKA 2HT3C 3TVMB 3ULUD 1T20A 2X4RB 2B1AL 1SVZA 4WCYL 4DGYH 1L7TL 1VFUA 3V4PL 1JP5A 4J3TA 1P69B 4MLSA 5DVLA 1A4JA 5DT1H 4LLMB 1XGUA 3U83A 1LEKB 5BW7A 4UNVA 2VOTA 4NNPL 3MUGA 3SJVB 2XPGA 5DA0B 3CFKA 4ENEC 1T66D 4X5XA 15C8L 1NCCH 1F4YH 2H26B 2PKDA 4JFFB 4NP4L 5FUOL 4XPAH 5DTFA 2VR4A 4X99B 1GC1L 4NKDB 5F6IC 1TJGL 4XNZB 1EERB 1GPOH 4M5YH 5B8CA 3VFGL 3D18B 2VNCA 4C56D 2HTLD 4S1DD 3VXRD 3OB0K 2B4CH 5E6ZA 1H0DB 2AEPL 1KIQB 1M4KA 4G8FB 4K2UL 5KW9L 5F8QC 3VXOA 3SDXA 2AJUL 4IOIA 4XP4H 2QQKH 2A74B 4S0TD 2BSED 3AMLA 4MJID 2HN7A 1UB5B 5EOTB 2PYEA 3VFOA 3SE3C 3WFDH 2F74B 3LS5H 4C58B 2AW2A 1RULL 3RVTC 1ZLSH 1FN4B 4H88H 2EDBA 4RWHA 2YD7A 5BZWA 1A1NB 4JB9L 3NCJL 4ZFGL 4EUPB 5EBGA 5F1SA 2IQAA 4D3CL 3A6BL 3OQ3B 1EO5A 2CIIB 4I0CC 3RWCA 1TTGA 1N5YL 5GXBB 2YD6A 1ZHBA 4NO0B 3RUGF 1G0XA 2VLRA 5EU5B 5BS0B 1YEGH 4QRRD 2COQA 3BPLC 2OZ4H 1IL1A 4UV7L 4OCYH 3FN0L 4OIIH 1K85A 1HSBB 2X89A 4YUEH 5J0BA 1S9VB 2OLDA 4K7FA 1JV5A 3QQ3B 4R3SB 1QFWL 4NBYB 4KROB 5J3HC 4ELKA 4XP5L 1KIRB 4WNQA 3L3OB 2XZCH 4I2XE 5D7IF 1XH3A 3EDDA 2A1WH 1CD1B 2MPAL 2VDQH 3KYKL 1A1OA 1T1ZA 4KKBD 1QBBA 4JO1H 5HDQL 4P5TD 1S7TB 3HR5A 2WLYA 5TE7H 1ZLWK 5ENWB 2IFGA 3KG5A 5BO1L 5A2LH 1NBVL 4YDJB 2Z35A 4MAYD 3RKDD 1QSED 2X1XR 3QUMB 1DLHA 4OZHA 5C0AA 2FX9H 5D2LB 1JTTA 3TIEB 3BP5A 5DJZB 3ZT7A 2VWEC 1MIEL 4OJFL 4F58L 1K8DB 4PB0L 1JZ7A 1Q9OB 3V5KB 5D1QB 1RZ7L 3VXSE 3UDWA 1VFMA 4ZNEA 2E5EA 3C2SA 4H8WH 5TDOB 1U8JB 1KJ3L 1NANH 1J0JA 3D85A 5JO5B 5ID0B 2C1PB 4NQEA 1BJ1H 1R5WA 4PJEB 3TLRA 2BY0A 2D7MA 1XCTB 3F58H 4YBQC 1IEHA 1NAMH 5DQDH 4Q0XH 4JGJA 4QOKB 2R29H 4NN5B 5E2WH 3RNKA 1LO5B 4WI6A 2BVOB 5E1AB 1HH6B 1AKJD 1NCWH 3S3PA 1U8OA 3RL1B 4M9PA 2JLLA 3BDYL 1VFOA 3HNVL 4M8QA 4Z8FH 5I8KH 5ID1B 3GMQA 4GRLC 4QHNA 4JFYA 2X4PA 5HGBB 1MJ8H 4R7DB 1CGWA 5KSVB 5I1EH 1SMOA 3FO2A 3ROOA 1Q0YH 1A7BA 5HI4D 4LAQH 2RIKA 4NN6C 2APVA 1U8NB 3OXRB 4MS8D 1WIUA 3GNMH 3ULSA 2DM7A 4AM0B 4DW2H 1XGQA 4D0DB 5CIPB 2ICEA 2IPUG 2O5XL 1UC6A 4JY6B 4WV1A 1I9RL 5EO1A 4JHZA 2C9AA 4P46A 3WFBL 2BNQD 3ZDYE 5BQ7A 5C0CD 2CRYA 3LV3A 3PWNA 1KTRL 1W0VA 1EIBA 3NPSC 1ZA6B 2VB5A 4YC2C 3VG9C 3P0VL 2KQMA 3H3PL 3CVHL 4FFVC 4BM7A 5HGAA 2ESVD 3WN5A 4G6KH 4L8BA 4KK9D 3L5HA 4RMUA 5FA4A 3CU1A 4OSUL 1CDBA 5KVEH 3S37X 3ARZA 2AEQL 4HK3J 4G7YH 4P3CL 1FFQA 1PSKL 2DYPA 1T83C 2X4OA 1OWWA 4JQXC 4IMLA 3M17B 1RMFL 4GRMB 2H32A 3CUPB 4ZYKB 4QHMA 3IYLW 4JDVA 4XAKE 1RUAH 4R90L 2VITB 2WIIB 1AGBA 1QPXA 4NQDB 2OQJA 2VIRB 4LSPH 3P4NB 1RVFL 1U41A 3MV7A 5EU4B 4J12A 1YDPA 1JN6B 5IB2A 5IHLB 1BX2A 2PN5A 2E9JA 2ADFL 2DQUL 2FEEI 2DI8A 2AKRB 4KU1A 5DRZA 4K55A 5KZCD 5ITFA 3TO4B 4FQLH 4ZSOE 1WK0A 2VLKB 1J0ZA 3HG1B 5T3ZE 4OUUB 5F70A 1OSZA 3RKPA 2EXYC 2CSPA 2R0KL 1AE6L 3IXAB 2C7UA 3VFWB 5KOMC 5I75C 4RFEA 5GRZA 2NY1D 3G6DL 2FCBA 5MEQA 5GSVA 4PJXF 1DQDH 1WQVT 4ZO8A 3MV11 4RGOH 3RGVC 5EO9B 3NIDF 3F7YA 1T0MB 2JK5B 1WBZB 2NY4D 1WTLA 3DOSA 1A7PH 1QFHA 1VGEL 4HKBB 1NUFA 2JE8A 4PJ5D 2L0DA 5SWZD 3TBSB 4L1HA 2AXHA 2Z93B 1YEFH 5I71C 3CSPA 1IGTA 4PRNB 4JO2L 3E6HB 2W0FA 1YMHA 4XVTL 3VD3A 3VXNB 3TN0D 1DUZA 2QL1A 3L3HB 1OSPH 3KWWB 4BFIA 1YEKH 4HX1A 5EZJA 4WW1A 4PJAE 4I0KA 4NNYA 2GY7B 1CDYA 1QYGL 2IAND 1CD0A 4QY8A 1JCKA 2D31B 1KB5B 5EC1B 4PUBH 2P8LB 5DQJA 5B38A 2AV7A 2VDLH 1INDL 1U9KA 4APQC 3SDDC 3LDBB 5C1MB 4UU9A 1U8PA 1HIML 2H45A 3HA0A 4QWWC 1QRKA 3DUSA 8FABA 4KRNA 1I1AA 2MQCA 2PO6C 1S9WB 1PQZA 3DMMA 3RPIB 1OTUD 3LQMA 4LHUB 4BZ1H 3BGMB 5MERB 2PTTB 3JXAA 5I17B 3IDJA 5K9KB 4GW1A 5D9SB 4PGBB 3VGAC 2P49B 3EO1A 5FIEA 1QRND 5I8CB 1QQDB 2DAVA 1I7ZB 3AROA 3QCUH 4OV5A 4QGTA 4MJ5B 4Z7OE 4M1CC 1IGCH 3HLAB 4XTRD 5B22A 1EXUB 4MDJB 1UA6L 3BT2H 4YXLH 4QRSB 5EIVA 4L4VD 5GGQL 3EIFA 5IBTL 2GSIA 4LP5A 4XMPL 4J1UB 4LQ1A 3KPTA 4MD4A 2HT2D 4XPGL 1F8TH 3O4LB 4YHOH 1UZ6F 1AGFB 4JDTH 5I1IL 4WJ5B 3FZUD 5E8NB 2L7UA 5GRUL 1MELA 4JZJB 1XF5A 2EDRA 2YD1A 2BVQA 4GXUM 3UP1A 4LSRL 3VFMA 4JKKA 3UTQB 4TVPH 3LPWA 4PJBF 4XNXL 3OKMB 5I1GH 5FYJL 5C0EA 3MLXL 4RQQA 4XT1C 1XT5A 3FFCE 4O2EB 1DVFA 5JHLL 4HS8L 1JTOA 3CD4A 1G6VK 3DECA 5MEPB 4D2NA 2FNBA 4JHAH 5FYLH 1A9EA 2JCCE 4NGHH 4GS7C 3PIQA 2Q8AH 5DJ2B 4X6CA 3MA7B 3T77B 1FIGL 4KV5F 3DGGB 1RPQA 1W72L 1NCTA 3KXFB 5ESVB 3TYFA 5FV2A 5KANG 4MNGE 4TULH 1OQOA 4K94L 4PRAA 1ZEAH 3X12A 3ILQC 1Z5LA 2L7JA 3VG0L 3IDMB 4HJJL 4ODHH 3U46B 4GKNB 2BXYA 3VXQA 4PLJC 2V2XA 2GCYB 1YEEL 1IQWH 3WO4B 1CLZH 2P24A 4DUVA 2ADIA 4W4OC 4PY8I 4WI2A 4E42B 2AJYL 2MCPL 5DO2D 2HFFA 1S8DA 4P2OC 2YK1L 4C56A 4FHBD 4QHLB 3VXRA 2Q86A 2FB4H 3H0TB 4HDIB 1B4RA 3TO2B 1CXIA 4HPOH 3ARWA 1GIGH 5H94B 2EXWC 2B2XH 4POYA 1KPRA 4PRIE 1GYAA 2PCPA 3I9GL 3ARYA 5AYUH 2P8MA 1C5CL 4MJIA 2CDEB 3LQAL 2HKFH 2CLVA 1FZKB 1QLFB 1GH7A 3U0PB 1DE4B 1WIOA 1QKZH 4JY4B 3SBWA 1YMMD 3AUVA 4HUUB 3MZTA 4FQ2H 1QZ1A 5SWQB 5LWYL 5IKCB 1IAKA 5F1OB 4J8RA 1LK3L 2VXVL 1JNHA 1WFOA 1MHPH 3MCKA 3DX8B 3QNZB 2WSKA 4JLRA 3U36A 2YMXL 1U92A 4RRPG 3MNZB 4IIQB 1AR2A 4QRRA 3BUTA 5LGHH 5IIEA 1VCAA 4WU5A 1SBBA 3KPRD 5EU6E 4KKCD 3RRQA 2VQTA 4HCRA 3FRPG 1BVKB 3TBWB 1U36A 1WBYA 3RWJB 4WTXA 3ARFD 1KG0A 2P5EB 3LOWA 3W2DL 3TBTB 2H8PB 2WWMD 5J11B 3UBXI 1MCWW 1G7QB 3BRDA 1MQ8A 4HJ0D 3BP6B 1BZ9A 1U3JA 4LLYB 1S3KH 4P5TA 4GXVL 4QHUA 1A7OH 1HOCA 1TJIL 3QUZC 4MAYA 1QSEA 4OF0A 1DL7L 1ZHLB 3ZKMD 4HWEH 5I76A 2B1HL 1H3XA 1PX4A 4DQOL 1UB6A 1RUPH 4NNXA 3TIDA 1P4IL 4DEPB 4N8CL 1UZ8B 1CZ8L 4NO2B 3RWDA 4Z77A 4JFDB 2JB6B 3DV6A 1O7SA 3VXMD 2GTWB 3PWPA 3LZFH 4ZUWB 3VWKD 2R4SL 4HGKC 5C0BB 4I4WB 4P5KB 3FO0H 3MRMB 4IEFB 1HEZB 3EYVB 2BC4A 3G5YB 2VL5A 3B3IB 2V6HA 4ORGA 1HI6A 4TPRL 1L6XA 1YQ2A 2LU7A 2IPKB 4LEXH 4A2LA 3E6FA 2EH7L 2MKLC 1FL3B 3TJEH 5JDSA 4HK0B 4LVHC 5BZDA 4JJ5B 1AKJA 5KSAB 1T0PB 5EOQH 5FOBA 4ZDHA 5CEYA 4Z7VB 1CQYA 5FYJD 3LIZL 3EOBB 5C09B 3QXTA 3ARQA 3LKOB 4Y2DB 1NCBL 4Y19B 3F7VB 3SHSA 3UPRA 3NCFB 1VSCA 3WLWC 4X7DC 3BHBB 1TVBA 5IW1A 3ULUH 4RGNC 3MNVA 5DJ6B 4NOFA 5DFTA 1CDHA 4IDJH 1EEYB 5HYSA 2HTKD 4WI7A 3VCLB 5SV3A 5C0CA 2UZXB 2BNQA 1J86A 4X5WA 1JGUL 4WI4A 5T3XE 4QYOB 1DFBL 5TQ0L 3W9EB 2J8HA 1JPTH 2ESVA 3BO8B 4OBSA 3QDGB 4XPTL 3UTSB 5E00A 3SKJL 3DSFL 1HYSC 3DYPA 1U3HD 3UCRA 4NPYA 3G6JB 3QSKB 2D03H 4RISH 2F8XC 3LQAC 4G5ZL 4LCCA 2HVKB 2Z4QA 1V3KA 3QHZL 5FM5O 1KTLB 4P23C 1IC5H 1ZLUK 3FQNA 3F7QA 3MREB 1W0WA 2YC1B 2OSLB 2SEBA 4F8TA 1KLUB 3RVXD 1KJ2H 3VD9A 1ZE3C 1KCUL 1B9ZA 4UDUB 4UQ2B 2J1KA 4HUKB 2OTWB 4PY8J 4FN0A 4MWFB 5K9JH 5MENE 4C83A 3Q6GL 4RBPH 2B5IB 5E2VH 3JWDC 3QXDA 3TEUA 4PS4L 5M95B 3HR6A 1I8LA 4U6YA 4PJEF 2JF1A 4HGMA 2DQGL 1C5BL 1B4JL 3IDYB 1R6VA 4OGAD 1DQQA 4PJFA 3UBXA 1TZIB 3SE9H 1DDHA 1AY1H 3FB7A 3WDIA 3CNKA 4LPWA 4UILL 3KPNA 1QSVA 3IDIB 3QUXA 3O3EB 5C08E 4I0PC 3QUYB 4FZEL 1QR4A 4DKFL 2V9TA 1NMBH 4NQXB 1HHHA 4PP1D 1ACZA 1ZT1A 3MQIA 3O2WH 4N8PA 2AQ2A 4NRXA 5SWZA 5KG9B 1IGML 3WFCH 2Y07H 3CVIH 3K8KA 4ONFH 4XBEL 4R4BB 4G9FB 4ZPTB 5LBSL 1BF8A 3G9AB 3TN0A 5I2IB 4MMXC 1LO2H 2CKBA 3R4DA 2FHCA 5IB1B 3SY0A 4UT6L 5DD5H 3VRJA 3MUHL 3PDOA 3PL6C 4XWGL 1CWVA 2XQYG 5ESQA 3OKKA 1KEMH 2DQJH 4OFYD 3RAJH 5KSUB 2J88H 3D25A 5BV7B 4HUWB 3QO1B 4FQCH 1ZHNB 2WINA 3HNTH 2VZSA 2E6QA 1WZKA 2W0LA 2YD2A 1DQML 3BYYA 2W59A 3VMOA 3MXWL 3TCLA 2JJVA 1MFNA 5IMKB 2ITCA 3W39B 2Y5EA 4P2YA 3BKJH 3QRGH 1TVHB 4X80L 1B0RA 2LV4A 2NNAB 1QRNA 3MFFB 5CD3A 5EC2A 1GGBH 4V1DB 1L7TH 4AEEA 1HDMA 3PP4H 1UH2A 2ZUTA 3P0GB 1IM3B 2GJ6E 5DHXB 4PJ7E 4K8RC 2GY5A 2BOCB 3RP1A 2OCFD 4UZGA 1OF2B 2NY0D 1RIVL 3QCTH 2I5YL 1I4FB 5T5FH 1F4XL 3OKOB 4L4VA 5D5ME 4H1LH 5FUOH 3CVHA 1O0VA 1P6AB 1C12A 4UDTB 4C57C 4ISVB 4ZOCA 3MRBB 4XZUA 2O26U 5I16A 5I15H 1FV1A 3SDAC 5GZNC 4KJQD 1NJ9A 3S4SG 4JPVH 3K8MA 1OGTB 1RZIB 2HRPL 1F11B 2H6PA 2NW2A 3B2UD 5A3IC 5LXGH 2A6JB 1BZQK 4M02A 3UYOD 4YNYA 3FQRB 4K3HA 2VLJE 2J5LB 5F89A 3NCJH 2R2HB 3MGAA 4FTVD 1JHKL 2EIEA 1IAMA 3HI1B 4JFXB 1LHZA 4L29A 3GSWB 3ZDXE 4D3CH 3QWOA 2BY1A 1QPPA 4TSBH 3UJIL 2DLTA 1RHFA 1XF2B 2B8OT 4X7SL 2G9HB 3OG6B 2HJFA 3O3AB 4FXGB 2Q7NA 3KHQA 5CZXD 3GSUB 3FN0H 1X7QA 3T04D 3WIHL 5I1JH 2CGRH 5EU3B 3MBEB 4K7PL 1OLLA 4UBDC 1L6ZA 2KUTA 4IJ3C 4Q2ZB 1IGJA 2EDNA 4UAOC 4R4NC 3NA9H 4W70A 1TNMA 1FSKB 1M71B 4YHML 2Q3AA 3SQOH 3SCMC 3QISA 4QNPF 4ZFZA 3A6CL 2DOCA 3QXVA 4Y4HC 4YPGA 5T1LD 2ERJC 2F53D 4EXPX 1LO3H 2NQCA 1XIWB 1NBVH 4LAJH 5EUKB 1JZ8A 2CKBH 4NUJB 1YJDH 3GI9L 3SGJA 1GHFL 2E7LA 2JCCF 2MNUA 4OJFH 4G8GD 1F2XK 4NUGL 4PB0H 4O4YH 5KS9B 1RK0A 4L9DA 4Z9KB 1LGVA 1NCDL 2ZOLA 3WD5H 4U6XA 1FC1A 3ZKNC 4AT6B 3QDJE 2XTJC 5SWSB 3C6SA 1RUKL 1RZKC 2EO1A 1YMMA 3ABZA 4X9GA 4ZD3L 3OF6D 2NCMA 2GITB 2CRIA 2DQIH 5JDJA 4FQHB 4WO4B 3MLUH 4FFYL 1JYXA 3HMWH 1E6OH 4OZGE 5FGRA 1MQKL 4G6FD 5IP4A 2FD6L 2R23A 4RA0C 3UZVB 1U58A 3RVUD 1GXEA 1Q1JH 1KYOJ 3WCYA 2NW3A 4HFWA 3HNVH 1MPAL 1XF3A 3B2VL 3KPRA 4XCCH 2FJGB 2DIAA 1A6VL 3VFUB 5DJ8A 4HH9B 3BGFB 3MLWH 4I13B 4P3DA 5JTWA 1SYVA 3D2UB 3ARFA 3JSSA 4YX2H 1IM9D 1FVDA 4XCNB 1B2WL 3MCG1 4U1LB 3Q6FA 3T0EC 5DJDB 2YD8A 2O5XH 1U93A 2XY2A 3KYOA 4HMDA 3IXTB 2K3TA 3NABL 3MODH 1WJ3A 2GK0A 1EUTA 4QKXB 1I9JL 3CVHH 3BP4B 4JFOA 1DSFL 4N0UE 4G6AD 2Q8BL 3HE6D 3I50H 3Q3GA 4JG1H 2ZUWA 4HQQL 5GS1C 1JYVA 1OTTC 3FQTB 2I07A 3LVEA 1IE5A 1NAMB 5GHWL 1ZSDB 2R1XB 2Q6WA 4ODWA 5L2KE 4DN4L 2VQ1A 3VXMA 1JF1A 3VWKA 1T03L 1AXSA 5IQ7H 2P5WB 3VFRB 5E7FA 3MJGX 1DEEA 1U2CA 1WT5C 1RMFH 5F9AC 3VFSB 5F7DA 5K9OA 3GSRA 2DIJA 4LCIL 3U6RA 5TF1H 1ERNA 2CUIA 3W5MA 2XXCB 5I1LA 1T20B 2P48B 4LLAA 4QXGH 3S4SB 4WI5A 1EA9C 3MRJA 3FHQA 5IJVA 2VAAB 2DQUH 1ACYL 2H3NB 3TJHC 4TRPH 4LBEA 4M7JH 4ZS6D 2UWEE 1GAFL 2V5YA 3FO9A 2DQDL 1NCNA 1OPGL 4D0BA 1EHLL 1D5BA 1WWCA 3QJHA 5JORB 2R9HC 4PYGA 4HK3N 4WUUD 3RL2B 2G75A 4NO3B 2FX8H 3AY4A 4U05A 3GJFH 1YY8A 3BN9C 2VXQL 4LOUC 3MOBH 2VZOA 2A9MH 3U79A 1S7WA 3SDXB 3BPOC 4JO4H 1EZVX 3AREB 1HXMA 5C2BL 1EAPB 1FNAA 3ES6B 4XC1L 5DMGD 5L8JB 4BELD 2FO4A 4ZAKD 2HN7B 1E28A 5IVNA 1VGEH 2PYEB 5H35A 5CP3H 4KQ4L 1U3HA 4X7FC 3MGTA 4AEFA 4ZFOB 2R2BA 5L0QB 4PRPB 4QT5A 3SDCC 3K3QA 1YEIL 2IQAB 4LCYA 4X9HA 2FLRT 2LAGB 3P77A 4CU7A 2PTUA 5B4MD 2WWKT 3PUCA 1CICD 2AK1L 4KUCD 4R97B 3SOBH 4XNMB 3MLRL 1F6AA 3LMJL 4NN7B 2VLRB 3IVKA 4PGDA 1P1ZB 4JRYB 1AR1C 1QYGH 1BQHA 5CWSB 1IL1B 3DROB 1CE1L 5IMMA 2VH5H 3N1QC 1JV5B 1SJVA 5C3LD 4Y5VC 4IS6A 1HIMH 3KLAA 5INDB 5FUZH 4KK5C 3QAZC 2UYLA 3ULVE 1T1ZB 3HI6L 1ZHKA 1RIHL 5EZLB 3HR5B 3RVWC 2NY5L 3QIBB 4GW4A 3MR9B 2V5SA 1YEJL 1DLHB 1VADA 3T0BA 3OB8A 2Z92A 4YLQT 1QFUL 2EE9A 2VABB 1U8KA 2EC8A 3KVQA 3WFEH 1UVQA 1OGAE 4Q74A 1V7ML 3MJ6A 3C8KB 1CFSB 1CDGA 3MRRA 1DZBA 3E8UL 4X8JA 3GI8H 1N8ZA 2X4TA 4MA7H 4NQEB 4P4KC 4ZFFA 1VACB 3GMRA 4ZXBA 2OMNA 3CC5B 4RMRA 3ARTA 2NY6D 3LN9A 3N9GH 4JPWH 4XP9L 4Z78B 1U8MB 3X14B 5E9DE 4G8EB 1ZANL 3RNKB 4NZDA 1CE6B 1MJUL 1LE9B 4KHTH 3DV4B 3M8OH 5I19L 3QZWA 3OKEA 3MV8B 1A22B 3GMQB 3O6FB 3P11H 3N50A 5GGUA 5I1IH 1CGUA 4OZHE 2OJZH 5GRUH 4OFYA 2NY7L 3I6KA 1R3IL 1MCWM 4J4PD 4XH2A 1MJJA 2X70B 4NZTH 4P99A 2DIBA 2F15A 3MUJA 4BUHA 1CFTA 1TZGL 2VLME 3GMNB 3SGDH 2BHUA 4PPTA 5JHLH 2UUDK 1WWWX 4IRSB 4L8SB 4ZUTB 3OKDA 2Z8RA 1HH9A 4GBXA 5I73B 4H0IA 1P2CA 1N2RB 1QTYT 4HD9A 1JHTA 1OAXH 5HTSA 2BCKB 3QEQD 2X1PA 3GGWB 2MHAB 4D8PB 2AV1B 3V9FA 3KPLA 5LJYH 3O9WD 3INUL 4UT7L 1FG9C 2DYPB 1A3LL 5HHMD 4K94H 1M1SA 2WUBL 1BVLA 4PJHF 3SKUD 4IOFD 5EBMA 1BQSA 1FPTH 3SKOA 4PTTA 3BSZH 1T89A 4BFEA 4QHMB 5DFVD 1G7MA 1WV7T 4JDVB 3LN4A 3IDUA 4JFEB 5I1AA 1AP2B 5C9JA 1XGRA 4WW2B 2ZUSA 3MV7B 4KMTL 2AJYH 5IB2B 3O45A 1OHQA 1D9KA 1XR9A 5CGYC 1I1RA 2IBZX 4HZLA 2EEBA 3IKKA 1RU9H 1LP9A 1KN2H 3B9KB 4AEIL 3O8XC 2XFXB 4NC1C 2YN5A 4Q6IB 3JV0A 5CSBA 3I2CL 3CX2A 5IVXB 1MAMH 1N3NA 3T0WA 2FDBP 2FECI 4YR6A 1XR8B 1FFNA 1MCRA 5IJKA 1RK1B 3V0AC 4FTVA 5LWYH 4L3ED 5EZOL 3D3VD 4HIIB 1TCRB 3F7YB 4NKIH 2VUYA 3C5ZC 3RFZC 4J3XA 5EUOE 4LDLB 3ZSTA 5DK0A 4D0CA 2YMXH 5EBWA 5LGKA 1D6VH 1JZ6A 2DWDB 3JV5A 3ZKXC 4OLEA 1IGTB 5BVPH 1K4CA 2VDRL 3S36L 2DMCA 1DUZB 4LSUL 4JPKL 1F3JB 5FKPB 4IRJB 4JM2F 4L3CA 4E41A 1UYWL 4KRPC 3W2DH 5IESH 4HPYH 5FYLE 1A1MA 3MRGA 1G1CA 4DCQA 1F5WA 4AQOA 4NNYB 5DVKA 5I8OH 5ICZA 4EI6A 5BMFH 1P4LB 5GZOD 5DRXB 1G7IA 5IT2H 1OM3H 4GXVH 5T1LA 2F53A 1Q9KB 1TJIH 2CJUL 3BJ91 4N0YH 2CQVA 3REWA 3WIIL 3W9DA 1I8MA 2NY2B 4PJ9D 3TC9A 4UU9B 1U8PB 3DHMA 3RVVC 3ZDXF 1I7TB 5KVMC 3NCYP 1F13A 5HHXL 4DQOH 1QR1B 4G8GA 5EB9A 1I1AB 1FYTD 3DVFA 3R1GH 5D7KD 2N7BA 1PQZB 3L3GB 1VA9A 4EN3D 1JZ5A 5GS0L 3QUML 1UH4A 3H9SB 4FFWD 1IEAA 3IDJB 4KAQH 4XWOC 2KPNA 3OF6A 3GZKA 5DMKA 1WF5A 4O58L 1C16A 3VA6A 1FLRL 4GW1B 5M94B 1RJYA 1YPZF 4ZG1A 1OQXA 4FG6C 2YEZA 4KTEL 3QPXL 1U95B 3VFNB 2ZOKA 5HXMA 4YHIB 3IU4L 1PKQB 3KYAA 4Y4FD 1MCIA 1T21A 4I3SH 1YYLL 3JVGC 3PDGA 4O51B 1TPXB 3FAXA 1QHOA 5J12B 3JV6A 2OBGA 2GSGA 5CJBA 1Y18A 2E7BA 5D6DA 1NCBH 4NRZA 4PJAB 3QI9B 2RGSA 4LNVA 2GAZB 3CSYA 3WKMH 1S7SA 2ZCLL 5E70A 1IM9A 4QTIL 4WEMB 4E9LA 1F02I 2EH8L 4TSCL 2XKSA 4LLQB 1T6VN 3BZFB 3TH2T 4LVOB 3NMEA 3QG6A 4I18C 2DQTL 3CDGB 1CBVL 4PD4K 5FO8B 4XX1G 2KL6A 5D2NE 3VMNA 5GJSL 1JGUH 4K3EL 1QNZL 1A6PA 1FE8L 5ILTL 3FT2A 3RZCC 3HE7D 3V8CA 4X9IA 4X7CC 2QADC 4P9HC 3VFMB 2NY3C 5CILL 4GAYA 3HE6A 1BM3H 2ZCKH 3SKJH 3NH7L 2DLIA 4QHKI 3TVMD 5MHSE 2X7LB 3EJZC 5TFSL 3HC0A 3DYMA 3NIGE 1NKRA 1QLEH 5MEOA 5HYSG 2O61A 1A9EB 2QHRH 1A6ZB 2NZIA 1KPUB 3SJVD 3PIQB 1AHWB 5I1HL 3MO1B 4X98B 3CSGA 5J06A 4JFFD 2ZWLT 3GMMA 4Y2OA 2H2PC 4OIBA 1KCUH 1OW0C 5L2JB 3JZ7A 4OLYL 1T1XA 1BBJB 4FP8H 4TUJB 2UY7A 1H3VA 1MFDH 3EGSA 4KJWD 3X12B 2RQ8A 3L3IA 4M5ZL 2QHLA 3OXSA 4H1LG 5IK3B 3IAPA 1ZXQA 5DGQA 5GGTL 2FSEB 3VXQB 3IAGC 1I3GL 3G5VB 4ODSL 1MH5A 3PWLA 1IKFH 4LRNL 2Y4SA 4LPTA 4WUUA 4MNHB 4Z0XB 2LU4A 1RV6X 2Q86B 1PZ5A 4A2MA 3RNQB 2OP4H 3O2DH 4MYWB 4PJDA 5E99H 5C0DA 3LPGA 4PRDB 1T4KA 3WIHA 2BNRB 1EFXB 4ZAKA 4GQ9H 3ULUE 1EBPA 3WLBB 1M7IA 4NO0D 1CU4L 1KJ2B 5BS0D 3OV6A 4WWKC 2CR6A 3CXHJ 5JPMB 4JZNB 1S7QA 1U91B 2C3WA 1V3JA 4NQSA 3LB6C 3BPNB 3BZEB 2FWOA 3B5HA 5E2TL 5C6TH 2R1WA 3DYOA 4FNLL 4NM4L 5C3TA 1CICA 3ECBB 1TQCC 2I60L 5CCKH 4KROD 1IC7H 5GGVY 2UWEF 1OAQL 3GO1L 3NCBB 1U92B 5DLMH 1VEMA 3BISA 4U6VL 1ADQL 2F5BL 5K59F 4HUXA 1UWXH 3VXRE 2XYCA 4XRCB 4U1MB 5GGSA 4LMQI 2ZJSH 5GS0D 1I8IB 4G3YH 4KTDH 1H8OA 4JVWA 4NN5C 1LK2B 2YD3A 4MA3B 1I1FA 1OAZL 4LARL 2RCSH 2HFEA 2I9LB 1BFOA 1J12A 1KB5L 2FEDD 4EBQH 5D1QD 1ZWIA 1RJLA 1IVLA 1CFQB 4QTHB 4I77H 2OTPA 2Y06L 1DQMH 5CLTA 4YXHL 4GRWH 4Y5XA 4MAYB 2A6KB 3KPPB 3ARBB 1QSEB 5DURB 1K6QH 3OMZA 4CVZB 3T8XB 4OKVA 3J7HA 3EOAA 5EPMA 5E56A 5I76B 3C09C 3MUY1 4JG0L 3FO1A 1XZ0A 5LCVH 1ROWA 4M62L 2QQNL 4QOKD 4G80A 3C08L 2IAMD 3WFHA 3BESR 3GSOA 3TIDB 2FYYA 4CU6A 4Y88A 1BQLH 3WJLA 3QFJE 3DX7A 3EJJX 1LO0L 3OL2A 1NEZB 3PWPB 1VFAB 3HKFA 3DIFB 4MA8H 2LAAA 2BC4B 2VL5B 4LGSB 1E27B 3QHFL 3KYNB 2I5YH 5IBLC 4MQ7B 4OAWA 5DVMA 3UTOA 5EU6B 3V5DA 4KC3B 1OAUL 2VSCA 4NWUH 4PLOB 2W65A 3EBAA 5E8EB 3ME0A 4GSDH 4KHXH 5E6IC 2IEPA 4QXTA 1D5IH 3UPRB 1R3KA 2WNGA 1TVBB 1A9BB 4JKPH 1P7KB 1VKXB 4MVBD 4J4PA 3C6LC 2AS5M 4LHJB 1NCAL 4QHKJ 2G5BB 3N06B 3PDDA 5C0CB 3C5JA 5IB5A 1J18A 1I7UB 3P4OA 4MZ2A 1ZVHA 4EQ2A 1BVZA 4TUKL 1UCBH 3U0TA 3FAWA 4YHNB 3UJIH 3HMXL 3MROA 5E00B 2FZ3B 4U6TA 3LN5A 4B41A 3BD5A 1W8OA 2NZ9D 2VWEE 4HFUL 5JHDE 2EYRA 2H41A 1RFDL 4H1LB 3VXPA 4NQDD 1F3DJ 4LCCB 1L7IL 2Z4QB 3O9WA 5CZKA 4OI8A 2EYTA 2BRQA 3S37L 1C5DA 1PKOA 3WIHH 4F8QA 3B6SB 5HJ3B 2ARWA 3RX5A 4XPBL 1W0WB 4WI9A 1LVEA 2EDXA 2D7OA 4OZHF 2SEBB 5EOCJ 3AC0A 5CJQL 4U6HB 3RJQB 3PV6B 3TO4D 2EZ0D 3EJYC 3HFML 3WIFA 5GRYA 3C5SA 5D93C 1P84J 4XXCC 3HG1D 2BNQE 1CIUA 4BQCA 4M7ZB 1CGSL 2ZPKH 2ZCHH 1DQJB 1CK0L 2EEDA 2LVCA 3CCHB 1KJVB 4M61A 2W07A 1WZMA 2OI9C 3IJSA 4PR5B 5GRVK 2ESVE 4Z7WA 4M7KH 3GI9H 4UB0H 4U1NA 4LLUA 4JHWL 4YWGL 1QVOB 4WFGD 3BKYH 3U9UA 5SX4I 5J6HB 1FRGH 3K1DA 4YHKL 4B50A 2IQ9L 4XC3L 1Z2KA 4L9LB 4YHLL 5GRXG 1RZJL 4HEPG 4OLUL 5GJTH 3GHEH 4RDQG 2I24N 5DSCB 3EOYG 3QUXB 3UYPA 3BKCL 5FO9B 3RIAK 4WGWB 1FNGB 1ZAGA 2ADGA 2J12B 5F9WC 4L3EA 4DN3L 3QFDA 3EDJA 5DMJB 1A6UH 4NWTH 1ZGLA 5F7LB 3GMLB 2DQEH 2NTFB 1H3TA 4KRMB 1CG9B 3S96A 4YHYC 2PNDA 5IBUB 5SWZB 4PLNC 4JEGB 1AQKL 2DTSA 1K8IB 3QJFA 1SBSH 3BWUC 4AG4L 1GZPB 1MPAH 1P5UA 3D0VB 4PJIE 3B2VH 3L3JB 3KDMB 1A6VH 2R1YA 3HAEA 4PGZA 2O5ZL 5H8DA 4X6DA 3TN0B 1UWGH 5DWUH 5HD8D 7CGTA 2PXYD 4S2SA 3ZDZF 3D0LB 4XVUC 1KN4L 5JIKA 2CKBB 4PGEA 4GG6A 1MCNA 4F15B 4JKMA 43CAA 1ZLVK 1EEZB 2NXZC 3THML 5KVFL 5KSBA 1B6DA 1RZFL 3IKCA 5DHYB 4HWBA 1GL4B 4LHUD 3SDYH 2JELH 4PRHE 1FNSL 3IFNH 4PJ9A 3D25B 4EOWL 5E4IA 1JFQL 2CKNA 1BZ7A 4WDIA 3FT3A 1X9QA 5DJ0B 3R8BB 5HVHB 1OWRM 2UY6A 3V4UH 1SY6H 4PJ5E 4HH8A 1F3DH 1FYTA 1IGIL 1EO7A 2VRAA 2XT1B 3DXAB 2AJ3B 2WUCH 4EN3A 5BCAA 2BDNL 2OL3H 3SGKA 5C0ND 3U7AA 4CNIA 4D9LL 2IFFH 1IAOA 3QDAA 4AL8L 3L3DA 5FA3A 2VDPH 3QULA 3HZVA 3HCVA 4JN2B 4Y4FA 2IANE 4HULB 3T4AA 4UUJB 5HPOA 2E7MA 3RA7L 1V05A 5I74C 1SYSA 2IPTL 3O4LD 1UKQA 2UV3A 1F6LL 4WI3A 2DBLL 1T04B 1IT9L 3D9AL 2VDNL 3FOLA 7FABH 2ITDA 1MEXH 1T2JA 2ARJQ 3GUTA 3HS0A 4HBCL 2DJUA 5ALBH 1TETL 4P5MB 5GGRY 1NC2B 1JHLH 1ZT7A 3IT8D 1DR9A 2VXSL 5GIRA 1CDIA 4JZOA 2WIMA 5F6HI 4JANA 2VXQH 1J0YA 4LPVA 2HAZA 5ECJE 1SJEB 5LGJA 1IMHC 3EHBD 1NJ9B 5E4EB 3HE7A 5A2FA 3EYUL 3IDXL 1OP5K 4F57L 4BZ2L 1MCSA 2CIKA 2H6PB 5DR5H 1QRNE 3S3SA 1J1PH 3MRFA 5ADPL 3GFUA 4OI9A 1T7VA 5L9DH 4YNYB 3TVMA 2X4RA 1WFNA 3CX5K 4R8WL 3KXFD 3W0WA 1RZJC 4ETYA 2P8PB 1MNUL 3O2VL 4LLMA 2J6EA 2BRRL 3V8OA 1HQ4B 4MD5B 2WAHA 5FYKL 1UGNA 4L4VE 3SJVA 4LASH 2E9BA 1OARL 1FP5A 4Q6YA 2C4FU 2H26A 4JFFA 4PJ7B 4F7EA 3UAJC 4NKDA 1I1YB 2F54E 2AEIT 3NCCB 4MQSB 4JFPB 4QCIA 4HKZA 2G5RA 5D5MB 3GJFB 4PJ8C 1H0DA 1KIQA 1KCKA 4G8FA 2Q20A 4LVNB 3OB0H 1ZK9A 4O02H 1AGEB 3QO0B 1RUML 4PRBB 3WS6A 1CI5A 1HN1A 2A74A 2WZPD 1UB5A 2D4DA 5EOTA 3HAEH 3UC0L 3HI6H 4IIQC 1HILB 4NZRH 1FN4A 3NFNB 1A1NA 3NIGF 3PGCB 1YEJH 2WBJC 4EUPA 3Q48A 5E03A 3ARDC 1TLKA 1BQHG 2CD0A 1Y0LB 1EHNA 4WY7L 4NBZB 1MCOL 1X6LA 1RK0B 4AZ8A 4OD3H 3RJDA 5I9QC 2ZUQB 4HWBH 4NO0A 5D1XD 3E8UH 5EU5A 5BS0A 1YMMB 5F93C 4HUNB 3QT2A 5J9PA 3TH4T 1NEUA 2HP4A 3NIFE 4XP9H 1S9VA 5GSRA 3CDCA 2P5ED 3QQ3A 2O93L 4YE4H 5JR1H 1CDCA 1Q72L 4R3SA 4CW1B 1G6RH 1U58B 2XWJB 5TH2B 1UJ3B 2CLRB 1KIRA 5DGRA 3I6GA 5CZVL 3L3OA 3N85L 1NBYB 1CD1A 5TDPB 1BIIB 4NKQB 3QCVH 4PGCA 1S7TA 2XN9E 1ND0B 5ENWA 3LH2L 3AAZA 5F21B 4YDJA 2W60B 1ZLWH 1SYVB 3K80A 4K9EC 1IBGH 1CFVH 5D2LA 3TIEA 1QA9A 4WHCA 3L7EB 5DJZA 4X6CF 5CEZL 3Q6FB 1ZA3B 3WNNA 4I9WE 5KSAC 3V5KA 2F58H 3ULUF 5SX5K 5D1QA 2GW5A 1VGKB 4JFDD 4YZFE 2ZUYA 4R2GC 3AS3A 5TDOA 2GK0B 4R26H 1U8JA 5E94A 5BV7L 5C0BD 5JO5A 4IBLT 5JQ6L 3QZWG 2C1PA 1U8LA 2DD8L 2VZ1A 3QDJB 1Q9WB 4QOKA 5F3HB 2IAMA 1KBGL 1LO5A 3C2AH 2BVOA 5HHOA 4DKEH 3MJ9H 5E1AA 1HH6A 1CTOA 1E4XH 1SQ2N 3FONB 4ODWB 3RL1A 2X4NB 3KPRE 1F58L 1JF1B 1G0DA 5IB3A 5C09D 4Y2DD 4FQJH 2WUBH 4R7DA 5SX4H 3T2OA 5KSVA 4QRTA 4Y19D 1YUHB 5F7DB 5K9OB 1G9NC 3U6RB 2X1OA 2GI7A 1RUQH 4OCRL 5SV4A 2C4XA 4XMKL 4MXQC 5CIPA 2VXUH 2J6EH 4JY6A 3A0OA 1YYML 9CGTA 2CDFB 2DJ4A 2GQHA 2KDGA 1A6AA 5IJVB 3MZGB 2ICWJ 1GSMA 1G9ML 1U3ZA 4QRUB 4LBEB 3GBNH 4OGYL 1U8QB 4U3XA 5FCUH 3FO9B 4LPUA 3QDGD 5D4QA 3TFKC 2FR4B 3PGFL 3I2CH 3UTSD 3RY6C 3L9RA 5FYKD 4YPJA 3F7PC 1NGPL 2BSSA 1U42A 2OJEB 3U4AA 4Y16C 1TQBB 3IETA 2BY2A 1S7WB 3DVGB 3GSXB 4UTAH 4KI5D 3M17A 4GRMA 5C70A 4FXLA 2JB5L 3CUPA 5H35B 4PY7A 5GGTA 2VITA 4TQEH 5FYJE 4DGYL 1HHJB 1T22A 4NQDA 5MI0B 1EHAA 3P4NA 5EU4A 2MQ3A 1JN6A 5HHQA 1IKNC 2VZVA 3PWJB 2V2WB 2ADJA 1UH3A 1J9CT 5CBEB 1NCCL 1F4YL 2AGJL 1F6AB 4N68A 3TO4A 2JJTA 4XPAL 3IVKB 2D7NA 1FH5H 3HG1A 4GFTB 4YFEA 1GPOL 4M5YL 1Q0XH 2HLFD 3IXAA 2EDDA 2CJUH 2B4CL 3TA3C 2XNAB 3QUYD 5EO9A 4Y4KC 3MRHB 4RGNE 3K2UH 1PJ9A 4MNQD 2ZP0T 2JK5A 4XP4L 5T1MB 3QG7H 1BWMA 3O6MH 2FATL 3ARGB 4B5EA 4WWID 2AXFB 1ZHKB 3WFDL 3LS5L 3QUZA 3TBSA 1ZLSL 3D39E 1N0XH 2Z93A 1H5BC 4G9FD 4PRNA 5HDBE 4O58H 1VADB 1ADQA 3E6HA 3P9MA 1FLRH 2CH8A 1HHIB 5E5UB 1QBLH 1DBMH 1U8KB 1MLBB 3ZKQD 1JVKA 3BGAA 3ARRA 3IU4H 5JXAH 2BSRB 1DUYB 1YEGL 2DN7A 4LKXB 2C3HA 5CEZD 4X8JB 1N8ZB 2OZ4L 2X4TB 4EZMA 4YGVB 2MJWA 5EC1A 4ZXBB 4JM2C 1N4XH 4YUEL 1A5FL 5I1KH 2PXYA 3MC0A 4EI5C 35C8H 3WHE1 1G7PA 2XZCL 2YWYA 3WBDA 2FHBA 2A1WL 2JKXA 2DBJA 3OKEB 1P7QD 2VDQL 3TZVB 3F62A 4JO1L 4YDIL 4AIOA 1S9WA 2A9NH 1QEWA 3C60B 4IDLA 5GGUB 1NFIB 4K3EH 1X5LA 3F12A 4LHUA 3BGMA 3BRFA 3AVEA 5K9KA 2FX9L 5CILH 4XH2B 3TT1H 5D9SA 5CIPH 1MJJB 4PGBA 5C0RL 1EMTL 1NLBH 1CFTB 5D70L 5I8CA 4Z5RB 1EEUA 1VFBB 1HKLL 4V1DD 4Q9CA 2RFXB 4JRWA 4QRPD 3U30C 3B9AA 3S5LB 1OGAB 4MJ5A 4YIQA 4Y5YC 3LPFA 3CDYA 4GBXB 5ICXB 1EXUA 3NAAH 4MDJA 1NAML 4Q0XL 2DL9A 1AC0A 4QRSA 3WJJC 1JHTB 3ZT5A 4PJFF 4CDHA 1MVFA 4OLYH 2UZYB 4J1UA 4TNVF 1BHGA 4FQXC 4P2CG 1J0IA 3MV9D 3V6FB 3KPSE 4Z8FL 5HI3C 1ORSA 3O4LA 1AGFA 3OJMB 1MJ8L 3VD7A 3MA9L 5I1EL 4N9OB 1A02N 5E8NA 5GGRB 1Q0YL 4JZJA 3BJLA 3QEUB 5GGTH 1OLZA 1R5IA 2M1KA 5F1NB 5JNYA 2E8ZA 5HYFA 3UTQA 4DW2L 5J89A 2YA2A 1XGRB 3OKMA 4F9LC 4O2EA 1D9KB 1KGCD 3H3BC 5IEHA 4AEHH 4LHQB 2K9UA 3LRGA 2XZAL 2B4CC 4CN6A 5F7FA 1KLFA 1X5IA 4G6KL 4OF5A 5DJ2A 3MA7A 1FSKC 1N3NB 2DJSA 3T77A 5KVEL 5D7JC 4G7YL 3KXFA 4ELME 1FNFA 5F8RC 4JREB 3MBED 3IDMA 4JPIB 4GKNA 3RWGB 4ZFOL 2P46B 3ZYIA 2GCYA 3GO1H 1FYHB 1Z0MA 3QA3A 4OT1H 1FO0B 3R06B 1H3PL 3KNBA 1ADQH 4E42A 3QIUB 4HLJA 3OX8B 3CXDH 2XY1A 3NN8B 1XIWD 4XPHH 4DOHB 1LP9E 4HDIA 3H0TA 4L3CB 2X1WL 4UMGA 4E41B 2HMIC 4OTXH 3TO2A 4DCQB 3AXLA 3BH9B 1OAKH 4LARH 5DMIL 5TDNB 1M7XA 4PLKD 1I9IH 1AXTH 2CDEA 2DRUA 2AJVH 2E7HA 3CPLB 4JFHD 4J3UA 5SWSD 1DE4A 3U0PA 4JY4A 1UM4L 4FTVE 3REWB 1BJ8A 4HUUA 3W9DB 1MAKA 1DQDL 3QWRD 5IKCA 3DI2B 1Z6JT 3KPOB 4RGOL 4WO4D 4Y1AA 4ODUB 2QQNH 1C08A 4C4KO 1A7PL 2FJHB 1B6UA 3DX8A 3RWIB 1WFTA 1I75A 3MRDB 3QNZA 3RTQD 4JFZH 2E9IA 4YDLC 4KXZI 5D1XA 3MNZA 1YEFL 4L4TE 5DMKB 3QIWC 4H8WC 1SHMA 3QHFH 1OSPL 3TBWA 2YEZB 3RWJA 2GIYA 3D2UD 2P5EA 1YEKL 3SE4A 2H8PA 4G6FB 1T5WA 4CUCA 1NUDA 4F7TB 2PW1B 4LRIA 1NGYB 3V6BR 3O6KH 1A7NL 4N5EC 1G7QA 2VL4A 5F7NC 4LLYA 4PUBL 4KUZH 4HV8A 4NRZB 3HUJB 1AIFB 3IGAA 3O81A 3CAFA 4OF7A 4YK4B 1ZHLA 5EBLB 2HWZH 4EDXB 2D0FA 1NCAH 3QG6B 5HHPB 4W6XB 1UZ8A 3VE0B 1JGEB 1Y6KR 2EDWA 4FQQB 4M3KB 4M1GH 4JFDA 1K5NB 2JB6A 43C9B 2FHFA 5BW7C 2GTWA 4ZUWA 4BZ1L 1MCBA 2IGFL 3FT2B 2AK4E 2XOTA 4I4WA 2WW8A 2P5WD 3EYVA 4BSWB 3B3IA 4GAYB 5FDWB 3NIFF 3OBAA 2HT4C 3R8QA 4RDQF 2XZZA 1T6WA 2H2SD 2IPKA 1WSST 1R3HB 5EIQA 4FZ8H 4HK0A 5B8CC 4JJ5A 2W38A 1PLGL 1L7IH 2XTJE 5D1ZB 5C8JB 4Z7VA 5A1AA 3QCUL 4ZUVA 5CJOH 3EOBA 5C09A 4F37K 4X4XA 1EHXA 4JRXE 1IGCL 3LKOA 4Y2DA 3E2HB 4GRWE 4Z7QF 4Y19A 3HC3H 2VISB 3BT2L 3F7VA 2NXYC 1BECA 4GUPA 5CJQH 3BHBA 1NMCB 1A7RL 3RUGE 1T7XA 3HB3C 5DJ6A 4NC2B 1DN2A 2A0LC 5FGBA 1EEYA 1AGDB 4W81A 2YKLH 3VCLA 1N6QH 4YHOL 2W1NA 4PJGA 2Q3ZA 1I3RB 5IVOA 4FXKA 4JDTL 3OXSB 2FH8A 3PNWA 3W9EA 3BO8A 3ARED 3EFFB 3DTXB 3IRZA 3SCMA 3QDGA 3ALWA 4TVPL 3UTSA 5I1GL 3T0EE 1G7LA 4XC3H 4YHLH 4WUUB 3G6JA 1MUJB 1RHHA 3RY5A 1MHCA 4PRPD 2ATPA 4N90D 1PZ5B 2HVKA 3VI4F 4ZO6A 4MLIA 2YPVH 2DB8A 3KS0H 4JHAL 4AMKH 3MREA 1OAYL 4K3GA 3GBLA 4RMTA 3MRNB 1ZLUH 3MLTB 2OSLA 1KLUA 1Z3GH 3OAZK 3MLVH 5BVJB 4OZ4A 1MFBH 4UDUA 4UQ2A 1AQKH 4JRYD 4AG4H 4JO3H 4KPHH 3VFPB 4TULL 5FOJA 4XI5C 1KIUA 1VEPA 1ZEAL 1IQDB 2R1WB 3MJ8B 4ODHL 1OOAA 1N59A 1CICB 1Q38A 3AS0A 1KN4H 2Q7YB 4F7MB 1OTSC 1CLZL 4I3RH 3UDWC 1TZIA 1XF1A 2VERN 5KTEH 4CAGA 1RZFH 1P4BH 4LLWB 3QIBD 1B0GB 1HK6A 5GGSB 4PJDE 3DUHA 4KKLD 3O3EA 5IMLB 4CVWA 4EOWH 4HPOL 3QUYA 4K8RH 4RRPA 4LCUB 2G2RB 1GIGL 3OAYK 3DLQR 4ALAH 2YN3A 2B2XL 3HAEG 2HFEB 4MNQA 2R2EA 3WNLA 5C0FA 1BFOB 5AYUL 1UXWB 1IGIH 1EO8L 2HKFL 1YEHH 1X44A 4GW5B 5HPMA 5KG9A 1QKZL 1UKTA 1IAII 4NBXB 3DURB 1DBKH 1R3LB 4G9FA 1U6AH 4NQED 2MSPA 4ZPTA 1MAJA 2OXGA 3EOAB 5EPMB 3F8UB 1LEGB 4XHJD 1XZ0B 1MHPL 1CD9B 4KH2A 5DD0H 3B4NA 1WZ1H 2Y9RT 4WV1C 3DX7B 4P46C 2C26A 3A67H 4PJCB 5IB1A 3UYRH 4XBGA 4AIZB 3VDBA 1IGYA 3MV8D 3RA7H 5LGHL 4G42B 2QQLH 2IPTH 4PGJA 3O6FD 3LKPB 2J4WH 3KPQB 2DBLH 4O2FA 3D9AH 1WVZA 1KFAH 1NDMA 5DHVH 2NY6B 4XNYH 2CLZB 3LRHA 4HBCH 3WN5C 5KSUA 4HUWA 1ZHNA 3A6OA 4G6MH 4TYUA 1JYWA 2EDOA 3LCYA 4TNWF 3CZJA 3HC4H 4UT9L 1P7QA 4KVCH 1R0AH 4P2RB 1S3KL 4LSSH 4B7LA 1A7OL 2YSSB 1X5HA 4HF5H 4IRSD 2R8SH 1XF4B 5DJYB 2OL3B 3ZE2F 5IMKA 4HWEL 3EYQC 2DQHH 4Q9QL 3X13B 4P57A 4LPCA 3FQUA 5DQ9B 1PGRB 1TVHA 1OP9A 3BDBA 4YEFA 5ADPH 2NNAA 1GGCL 5ESAB 5H37H 3MFFA 3LKRB 1A6WL 4V1DA 2FEEL 5F9JB 3TBVB 5JZ7D 4QRPA 3LZFL 5LG1A 3RDTD 1IM3A 3FO0L 1RZ8B