3V0WL

Crystal structure of fab wn1 222-5 in complex with lps
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
DIQMNQSPSSLSASLGDTISITCRASQNINIWLSWYQQKPGNVPKLLIYKASNLHTGVPSRFSGSGSGTDFTLIISSLQPEDIATYYCLQGQSYPRTFGGGTKLEIKRGDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords WN1 222-5 Fab (IgG2a) light chain
publication title Antibody WN1 222-5 mimics Toll-like receptor 4 binding in the recognition of LPS.
pubmed doi rcsb
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2011-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v0wL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v0wL01
4NKIH 1I8IB 2AXHA 5ELIA 1P2CA 3MLRL 3LN9A 1IGJB 3S35H 4QRQA 1VPOL 3FFDB 3R1GH 2YRZA 3HZKA 3RU8L 2HJFA 4H0HB 2Q6WA 5HI4D 4OZGE 1IZKA 3TN0D 1J0HA 2BVPA 2XZCH 3EYFB 3HG1A 4LKCB 3SE9L 4BZ2H 3ECBB 4ZTOH 3AMLA 4GS7B 5LAXA 3S98A 1NGXA 3W0WE 3MR9B 2Y1VA 5JHDB 4NQCA 1L7TL 3TYGL 4WTZG 1L6ZA 4LVOC 5FYLL 5GZOC 2A9NH 3WUWA 5E5RB 3MQIA 2EYRB 1J5OH 2CXKA 5LCVL 2JELH 1LEIB 1KJ3L 3RJQB 1JRHI 4I9WD 5CZVL 3MACL 4XHJC 5I17B 4RZCB 4CNIB 4WW2C 5DD0H 5E8NB 5I9QC 3ARWA 4WVRA 4M1GH 3D39E 1JPGA 1R24A 3PL6C 1T66D 4NYLB 3VXOA 2O5XL 4JFXB 4OD1H 1A3LL 3ZYOA 1CFVL 4X99A 1CVSC 4OJFH 3RX8A 5JW4R 2OSLA 4ZFGH 2CIIB 5FO9A 3EYOB 5KVFH 2YPVL 5SWSD 4PP2A 3JUYA 4Z7UF 5F8QC 5GGRB 1JHLL 5TDPA 2WUBH 2F53D 5EN2A 5FYLE 3MNZB 4HKJB 1UM5L 4ODTL 1NCWH 1OAKL 2OJEA 4OBSA 4RRPA 3MUY1 3LVEA 2W9EH 3H7LA 1FSKC 1MCCA 4NO0D 1YN6B 5CKAA 4NUGL 4CW1A 2DI7A 1K4DA 5L8KB 2UV3A 3GNML 2FECL 3RWCB 5LQBL 4ZNCD 5LGJB 3HRPA 5ID0A 2OTPA 2FH8A 3CFKB 1FG2B 4P2QE 4ZAKB 1BPVA 5FHAL 5J12C 2XA8H 1LEGA 1P6AB 3L6FB 1K85A 3GIZL 1A6TB 1GL4B 4OI9A 5C0AA 5DRXA 1QSZA 1E4JA 5HDLA 5J13C 5ITBH 3CVHH 5KN5B 1RZJC 2C5DC 3S5LG 2C4XA 3MLZL 2WP3O 3ARPA 3RL1A 5D2LB 1IKFH 4LLQB 1NCDL 2RBLA 3BDXA 1CLYL 4OZFB 3Q6FA 2P43B 2Q1EA 3NN8B 1VACA 1KCKA 1A1OB 3UTZB 5EU4B 3KJ6L 1NANI 2R1YB 1FNLA 3LDBC 1PDKA 4K2UH 3OF6D 4EDXB 3IFLH 5EG6C 2EDXA 1QFUL 5HHNA 4PJ5D 1I9EA 4JCLA 5T3XD 3UJJH 1V7ML 2NX5E 5DT1H 5KSUB 5CHNA 1MAMH 1UYWH 5C3TA 3IB4A 2ESVE 4OIIL 3MJ9A 2IWGA 4XP9L 4N0FA 3QXVA 2DWDA 5ESQB 2NY7H 1Q9LB 2NTFB 2GITA 4KK6D 3ULVH 1FPTL 4MNQE 2X7LA 3IDMB 3K0WA 4PRPD 3U7YL 1F13A 1RHHA 4TTGA 5TE7H 2MCPL 2DL2A 2AK4A 1QTYT 3KYAA 5A2JH 1HHJA 5KAQF 5I18H 4QRTA 4R97C 1Y6KR 3HAEH 3KWWA 4LSTH 3N1QC 4OZGA 4LIQL 4ODSH 5D93C 5L2KE 3P9LB 3WHE0 2WQ8A 4WFFE 1AQDA 2X70A 4JRXB 1MRCL 4Z0BL 3W0WA 3S88H 2W1NA 4MSWB 1PY4A 1ZLUK 4AEIL 4YXHH 3B6SB 4ELME 1KULA 1OAYH 2DQCH 3GIVB 1BZQK 1FC1A 4PGBB 5JW4M 4HGWA 1BIHA 2NY0C 1TTGA 3EO1B 3LS4L 4U31A 4YXKL 5B21A 3FQNA 2AJVL 4X7FC 4M1DL 1M71A 1WV7T 2HT3D 1EFXD 3D39A 3OXSA 5T1MB 3G5YB 4NFBA 2BXZA 3P4LA 4NHCH 2CLRA 3MGTA 2E3VA 3Q0HA 1RJZA 3PV7A 4LIQE 4HXBL 2X1XR 1GSMA 3P4MA 4NWTL 3HNTL 2DKSA 1HOCB 3JWDC 3V6FB 3VXUD 4KK8D 3PL6D 4OFYD 1JUFB 1LO2L 5IROC 5DRWA 3ARBB 5ALCL 4S1RL 4U1IB 4QRUA 5DJXB 3MLWL 1NFDE 1VSCA 4YPGB 1PYWA 1EGJL 2BJML 2VABB 4PRHB 4BKLB 5T33H 2PO6B 2XV6B 4POZD 1J1PL 3CFEB 2CUIA 4MWFA 4G6FD 4OQ1A 3SJVE 5AWNH 4ZS7L 4X7EC 1R3IH 2WP3T 2DJSA 2DQEH 4XAWH 3QWRA 2E7CA 5IVOA 4Q0XH 1MJJB 3FQTB 5T1KB 3DYMA 3EJZC 1TJGH 4KI1A 4GLRH 3IDGA 2DM3A 4LVNB 3ZYZA 4P2QA 3FONA 4NJ9L 4Y16C 3QFJE 3S35X 4AL8L 5C9JA 5F21B 5FFLA 4I0PA 5HHQB 2H6PB 3TWCL 1FJ1A 2CR3A 2OR7A 4CADA 4Y4KD 3I6GA 1T1WB 1I9RL 4F58L 3LH2H 2JIXA 3B8SA 3QI9C 5FM4A 1IT9H 2DQDL 5DQDL 3O2WH 3QEHA 1XCTA 3PWLB 3MODH 1VFBB 1YEIH 2QSCL 2YZ1A 4DUXA 4JJHA 3IFNH 2VSDA 5CEXA 1T2XA 2Z91B 1TDQA 3OL2A 2O26U 2VB5A 4XRCA 3SDDA 4ETYA 5JPNA 3V79C 1JCKA 5HGBA 3LQAL 2ICWA 4J1UA 3CX5K 1TTFA 4JFOA 5I19L 2Y36H 2DQJL 2ESVA 1UWXK 3OKMB 5JXAH 2X4RA 4J23A 3MGAA 4PJFE 3L9RB 4RWYL 1HXMB 5D7LE 1C5CH 3BKCL 4MNQA 2BVTA 1NQBA 3LKOB 1MIMH 1T2QH 2W91A 5MI0B 1REIA 1FE8L 3OGCB 2IH1A 4OD2A 5C0DB 1YEKL 1NGWB 3KDMB 4NZRH 5F96L 2CIKA 2XNAB 4Z0XB 1I3GL 4KXZH 1QVOB 2PTTB 5DMKB 1U58B 2NY3C 3EYOA 1KENL 4Y1AB 3BDYH 4PS4H 2VQTA 3IETB 5FCSH 1RURH 4N0UE 1KLUA 2N1KA 5L2KA 1D3CA 3QWQB 3RJDA 1K9TA 5F6IB 4F7TA 5DJYA 5EZJB 1A6WL 3JVGA 2LU4A 5GSVB 2FO4B 4I5BB 3VMNA 3HZYB 3ZE2E 4X0KB 1F8TL 3TPUA 4ELMA 2HG5B 4JANB 3TH2T 4M6NH 4ODHH 4OF6A 4O02L 2O5ZH 1DE4A 2EDYA 4JZJA 3BEWA 4XP5H 3DUHA 3RWHA 2ZSWB 5BXFB 2XIDA 2QQKH 3SQOL 2UZYB 2VAAA 3CFKA 2X05A 4OZHE 3MRQB 1Q1JL 1DLFL 1A0QL 1ORSB 2NY0D 4LLVA 2E7LA 2Y5TB 4U6HB 2APVA 4UTBH 4BJLA 4KDTC 3ZTNL 2QHRL 3JV6A 5GRVL 5KN5A 2I24N 3MA9H 5C0CB 1P69B 1UWGH 3OZ9L 1SYVA 3FCTA 1IGYB 2R1WA 2XRAH 1S7SB 5DJZA 4TUOB 4EXPX 4GG6F 4Z7QF 3QIBA 3QISA 4KJYA 4OZFA 3BN9D 4AK1A 2FX8H 4FQLH 4X80H 3EOAA 1KTDB 5GJTH 1NFDA 1AKJB 1M05A 3C8KB 3QAZC 1A1MB 1ZTXH 2A6KA 3AAZB 5I1AA 3SJVA 1FFOB 1FO0B 1IEAA 1QRNB 2APBA 1WEJH 4I48B 3LRSB 1IGTA 5T3XH 4KH2A 2I07A 4OQTL 1IILE 1YY9C 2R2CA 5B3JE 3BH9B 3AVEA 2YPKB 5ADPH 5KZCD 1XGPB 1NEZB 3QFJA 4PGCA 1IM3A 2D0GA 1H0DA 3EJZD 1QHPA 3AU1A 2AS5M 2BY2A 1DEEB 3VFVA 5KTEL 3G6JF 4TPRL 4Y5XA 3C6LC 4KI5C 1MQKH 3SBWC 2IBBA 3L3HA 1EGJA 1FAKT 1CCZA 5B39B 3M07A 1J8KA 3VCLA 1MJUH 3IJSB 1INEH 2C1PB 1Y6MR 4JO1L 4TSBL 4FQQB 3BD5A 3RGVA 5IMOB 3TF7C 1XR9B 3E6FA 5TPWH 2HTLC 3HI1B 2A83A 3B2UC 4ISVA 3KPPB 3CX5J 1SHMA 5EU5A 3M1BA 4KUZH 1KXQE 2EDBA 1G7QA 2FRGP 5C2BL 2X4QA 2FEEI 5D96B 1AXSB 4WTXA 1KJ2L 3P73B 1RZ7L 3WFHA 3K81A 3GIVA 4ONFH 3MGOB 2DI9A 4KTEL 4W4NA 5HVHC 4L4TE 4HH9A 4UINL 2C3HA 5F71A 2A73A 5DJ2A 4PJFA 4PJGE 4CMMB 4EI5A 4NQVB 3LKPA 4FP8H 1NCBL 3V6BR 2IPKA 3P2TA 4CVWA 1OGAE 3W2DL 4GJTB 1Q9KA 1T89C 2VXQL 4RGND 3MRJB 3M8OL 4GO6B 4I0KA 4PB0H 5J4MA 1B0WA 1FIGH 3GB7B 3B9KA 4HS8L 2DM4A 3UZQA 4RFNB 1VFUA 1SEQL 1XZ0B 1R3KA 3ARBA 4N0UA 4MNHB 4GKZB 5DJXA 3WNMA 3V6OC 3BW9A 1A6AA 2PO6A 4D9LL 4KKAD 1MCNA 4JKWA 3QRFM 1I1YB 1X6NA 4LSSH 3BZFB 4G7YH 5IM7A 2BOBA 4LPXA 3OKNB 1NMAH 4NUJB 5CKGA 2FATL 2HLFC 5EOQH 2XKNB 4HFWA 5FYKU 2CDGB 1BJ8A 5EWIH 2I60L 2VLJB 4OZHA 4W4OC 4Q9BA 4ZUWB 3OR6B 1UM4H 3TBYB 3CK0H 4RX4D 4HF5L 1G6RL 5C08B 1OPGL 4JFEE 4M03A 5ANME 4I2XE 2YBRA 4JR9L 1EHNA 1OGTA 5DJ6B 2LAGB 4KTYA 1UFUA 1N3NA 4TVPL 3T0ED 4R6UA 1MRDH 4M5ZL 2BFVH 3G5ZA 4HWUA 3O9WC 3QDME 3ZKNC 1KBGH 3VRLE 2D31A 3MNVA 4UIKL 1ZMYA 4U1SB 3RZCD 2GT9A 2AI0H 2XZAL 1BBJB 2ED9A 2ATKB 3T2OA 4JFQB 4XNZC 4XNXH 4Y5YB 1QLEL 3EO9H 5FECA 5T3ZL 5AZ2H 4HC1H 1FFQA 1RJCA 3PWUA 2R23B 4K3JL 4OFPA 1JI1A 5F70A 1YY9D 3HCVA 1A7OH 5BCAA 3N85L 2ADIB 4GLRI 1NCCL 3OGCA 5I75B 1HWGB 1MIEH 1BBDL 3KPNA 1NGWA 2ID5A 4TVPE 3H0TA 5E6IC 3CJJA 5BVJA 3VWJA 2PTTA 3G08B 1NDGA 4G42B 4K7FB 2H26A 4XMPH 1IGIH 3QUML 4QHUB 5BV7C 4TULH 5KG9A 2EZ0C 2X4SB 1KLGB 4OQTA 4X8JA 3MREB 4POUB 3PGDA 4LLDA 5F88A 5T3ZE 3D25A 3UTTD 4WHYG 5C09E 3WEXA 3B2UD 3CDFA 3CSYA 5EUOE 3BO8B 3S35L 4BUGA 1OSPH 3H3BC 3R1GL 1U2CA 4FXLA 2IAMB 4QYOB 4JZNB 2KKQA 5FGCB 1ULVA 5HTSA 4F33A 4L4TA 1GXEA 2XZCL 4C83A 3TA3B 3TO2B 4BZ2L 4P4KC 3E0GA 5D6CB 4PJGA 3CIQA 1JL8A 2OCFD 2APFA 4PJCE 4MXVF 1ZHKA 1DQDH 1OGAA 5CBAB 1HH6B 2A9NL 3H2WA 3DX7B 4JQXC 4QXUH 1CVRA 5JW4Q 3RTQA 4DZ8B 3SDAD 1J5OL 4MCYB 5IJVA 4A6YB 3E3QE 2XICA 4N9GB 2JELL 5FYKH 1NBZB 1IGYA 4I0CC 1MFEH 5I1GH 5E94B 1KJ2A 4LPCA 3JWDH 5CP3H 5IB1A 4M1GL 5DRZB 3TIDB 4IDJL 4QXTB 1ADQH 3RX7A 2XTJE 3RKDC 1S9VA 2AV1A 4PYGA 4NPYA 1ACYH 5JDJA 2NXYD 5KVDH 1FO0A 2DQFB 4LCYB 4ZFGL 4Y7MA 3QNXA 4LMQI 1R5WB 5IOPB 2RAMA 2W9DH 5KVFL 3WJLA 4MCZA 5D1XA 2VO5A 2WUBL 3P4OA 3GKWL 3MFGB 5E95B 4XAKE 1ZKAA 2VDRH 4UILH 1AGCB 1NCWL 4H1LG 2HLFD 4DAGH 5F9DC 5FA4B 4U1GC 3LQZA 1AP2B 2W9EL 4RQQA 4K71C 3JV4A 4P5KA 4LRIC 4Q6IB 4JFEA 5ANMA 3CAFA 1FYTB 2X89D 4YZFE 4Y5VA 3T3ME 4ERSH 3BX7C 1NGZA 5ID1A 4K8RD 1AGEB 1XR9A 2XA8L 3SDCA 5ISZB 3ILQD 4YAQB 5HVFB 3BGFC 4PYHA 2H8PB 5IHZA 1A7RH 3CVHL 2WAHA 3QNYA 4XGZA 3QDMA 1IBGH 3QCTH 4OZIB 1CIDA 2Y25A 3L7EA 4Y88A 1IKFL 4U1HB 3ZDXF 2FEEL 1S7WA 4Z8FH 1FFNA 2BSTA 1G6RA 2V9RA 4HS6B 4PJ7F 4Y19B 5EBWB 1AO7B 5F3HA 1KTRL 1PX4A 5EO9B 5D5ME 5CD5D 1WCBA 3KPSB 3O41A 4IM8A 5AZEH 5DI8B 1D5IH 4K2UL 5HVWA 3IFLL 1H3UA 1RIHH 5I76A 3S37H 1F45A 5HYJD 1P1ZA 3UJJL 4HWZB 4HUXA 5H94A 3KPQB 1MAML 1FN4A 5SWQB 4YEFA 2FZ3A 2NY7L 5E6ID 1GHFH 3ULVL 3QUXB 4LP5A 1JV5B 4V2BA 4Z7UB 1UKTA 5TE7L 4UNTA 1I1YA 1UZ8B 2ZPKH 5EUOA 5I18L 1L0QA 2VLKD 1U91B 4F2MB 4LSTL 4ODSL 5IHUH 2CDGA 5I73C 3UBXA 4NN5B 2EYSA 2P42B 1JWSB 5FKAA 2HT4D 1D5BA 1XR8A 4FN0A 4PJHB 3S88L 1CGSH 1QEWA 3MJGX 5EORH 4YXHL 4FFWC 4PJCA 5JMOC 3ZE1F 5SX4H 5EIIA 5J06A 1CS6A 3QUMA 1OAYL 4P4KD 2DQCL 2AGJH 3ULVE 4Q9CA 1TJHH 1YMHA 3MRFB 2R9HD 2WMPA 3PJSA 1IGFH 3DTXB 4YDIL 3BUYA 3HLAB 4XNQB 1OY3B 5GGVY 4X7DC 4PJDE 3L95A 3FB6A 3H9HB 3BGAA 4PJ9A 2J5LC 5DSCB 4NHCL 2K7QA 2HVKA 3PDGA 3ZDZE 4L8DB 1GGUA 2XN9D 5T5NF 1DTUA 3VXTB 3RWIA 3FT3A 3LKRA 2DLIA 3CXHJ 4Y4FC 3RKDD 4U1SA 2F58H 4YFEA 3AM8C 2APWA 3IDNA 3MBEC 4ZUTA 5IWLC 4XNMB 1A6ZA 3EGSB 3IT8D 4P5TB 1JNHA 4ETQB 3STLB 1UJ3B 3BH8B 2YEZB 1JYXA 5T33L 1U92B 3EDJA 1DQJA 2JJSC 4M43L 5AWNL 3I3DA 1R3IL 1DSFH 4PGDA 2DQEL 4XAWL 3ROOB 1E27A 3Q6GH 1CFNB 2EXYD 3PXJA 4JDZB 3S4SA 2O93L 4JPWH 2H45A 5GGUA 2A6JA 3AS2A 3K2MC 1MJ7H 3ESUF 1CE1H 4YX2H 4P3DB 4D9RD 1A6UH 2ZCKH 1P84J 1ZK9A 4L3ED 4WW1A 4MJ5A 4BSVA 2BMKB 2D2OA 2NLJA 2CLZA 3O11A 2RHEA 4QEGA 1SBSH 5ITFB 5J8OA 5JOPD 4L1DA 5GS0C 3BIKB 5LGHH 1EJOH 3LH2L 2OTUB 3JBG7 3DMMB 4FMFA 4JJ5A 4R3SA 3BO8A 1IT9L 2KL6A 4TUKH 2H32B 4P23C 3O2WL 3GSNB 5IB2A 1YEIL 1NC2D 5IT2H 3G6AB 1BOGB 3IFNL 1OF2B 4ONHB 2DAVA 5E8DH 4FQ1H 2IQAB 15C8H 3BGMB 4GRLC 5D5MA 8CGTA 3TESA 4N90E 5JDSA 1Q9WB 4RSVA 1A4JB 1IGMH 5DJ8B 1MI5D 4HUWB 3NMEA 5C0BE 1JYWA 1DBAH 1TPXB 3QJHB 2W0LA 2P44B 2PTUA 4MCYA 4O2FB 4NNPH 1VGKA 5JXAL 3CVHA 4WENB 3QULA 1Q9OA 2WK2A 1I8LA 2V5YA 4QRRA 2DMKA 5JZ7D 5I1KH 1MCOH 1C5CL 4K9EC 4NRXB 4QXTA 4EOWL 1G7JA 1R6VA 1MIML 1T2QL 3DRQB 1U8JA 2APXA 4K3HA 2OZ4L 4F7CB 3QQ4B 3FQXA 1ZVYA 3U9UA 2BNQB 5F8RC 1T21B 4NZRL 3NTCH 1UB5B 2CPCA 2X4PA 4YHPA 5IOPA 5JNYB 1E4XI 3BDYL 4PS4L 1MLBB 3MRLA 4ZNEE 1T7VA 4BA8A 1LQSR 4NQDB 3OB8A 3VW3H 1RURL 2MKWA 1GGCL 1XF4B 4HULB 4LLWA 2QJDA 3FO9A 1GGBH 1AGCA 3RX5A 3L3GB 4I9WE 1D6EA 5H2BB 3LEVL 1J8HD 4NZJA 3RAJH 5AG8A 3BEVB 4E41B 3O3AA 4PV8B 3BRGC 5I8CB 3QXDB 1DCLA 5C07D 4M6NL 4ODHL 3L3IA 5EU3A 4NKDB 3IF1A 5B38B 5GGQH 1ES0B 3C60B 4FFWD 1FYTA 4L9LA 4OTXH 4XP5L 5I1LB 5I8EA 3D18B 2QQKL 2YD3A 3GJFA 5F1OB 4PJDA 4K8RH 4IMLB 4PY8I 5F7MC 4HG4J 5SWSE 3MMEA 3HAEA 5CJXA 3SDXB 1HQ4A 4UTBL 5I1JH 4P2OA 3UPRA 2F53E 3PWVB 2B20A 4OFDA 4JKLA 4C57C 1D5MB 5F3BA 1JYNA 4XC3H 4OV5A 3MA9L 1UWGL 3TIEA 2VR5A 1CZ8L 1JHTB 3BKYL 5B8CB 2WBKA 2XRAL 2VERN 1J05B 3RVTC 4GBXB 4OFVA 1AH1A 2NXZD 4S10A 2FX8L 4Y19A 3S37X 4FQLL 4X80L 3FFCB 5GJTL 3KVQA 1R3LA 3KR3H 2ZP0T 5L2JA 3MBED 5EO9A 3RVVC 3T08A 1W0VA 3GUTB 2MNUA 5DI8A 2RGSA 3QSKB 1O5DT 5DK3A 1TIUA 3VG9B 1TFHA 5C0JB 1WEJL 5T3XL 2YN3A 4Y4HB 2W0PA 3BMVA 5J56B 2BCKB 4C58B 1MVUA 3MUHL 3GMLB 4LPWA 5JOEA 5ADPL 1UZ6F 1N59B 3WLWC 4M8QB 4WRLA 1NC4B 1EIBA 1CICB 2AJYH 3WN5A 1F6AB 3BPOB 2HMIC 2DIAA 1MQKL 5C3LD 4IOIB 1UZ8A 1CD1A 1P9MC 1CLOH 3SCMA 4YHIB 2DS4A 3AY4C 1MJUL 1I8MB 1INEL 1G7LB 3EO0B 2K3TA 3QFDB 4XPGH 1MUJB 3J8F7 4FXKA 5GS0D 4PJ5E 5T3XE 5TPWL 5EZIH 4XCNB 4I77H 3TO4C 12E8H 1XIWB 2NX5B 4X5XA 4KUZL 1LEKB 2GFBB 25C8L 4BK4A 3WFZA 4MAYA 5HHOB 4P2RB 2GUOA 3VFSB 3IJYA 5C0BA 4CDHA 2YC1B 1QSEB 2H2PC 2X4UA 3EFDH 4GRLD 5L8JB 2LU3A 4L29B 4PRPE 1XGRB 4DKDC 5DTFA 4JO3H 1QO3A 4ACPA 1RZ8B 2A6IA 2FJHB 3T0VA 4HKBA 3BAEH 32C2A 1EBAA 1DLHA 4FP8L 2AQ3A 5C8JB 5L9DH 3H9HA 1JGVH 2DWEA 4GG6B 2C3VB 3TN0A 3QQ9D 3WIHL 5JOFB 1H8SA 2BVUA 5F93C 2E7HA 3FN0H 2V9QA 4PB0L 1FIGL 2AV7B 4ZNEA 4GW5A 3L3JB 1K5NA 1SYSA 5E6YA 4M93B 3PWPD 1ND0B 1UJ3A 2YS4A 4IEFB 1XF5B 1ZVHA 2FLBT 2PF6A 1UG9A 4YGVA 1T22B 4LSSL 4E5XB 1HH9A 3A6CH 4G7YL 4OGZA 4BH7A 1WAAE 4GAGH 1MWAH 1NMAL 5GRWA 1A2YA 5EOQL 1SJHA 5DC0A 1GGIH 2OZ4A 3AXLA 2M1KA 1BVLB 5EWIL 1N2RA 3G6JB 3VXUE 3DHMA 1NGQH 3ZDYF 2E9WA 5E56A 4CN4A 1Q0YH 5SWSA 1UM4L 2BMKA 1G7PB 1WBZB 4WI4A 2F53A 3TBTB 1X5FA 5FM8A 5IVNA 4YBQC 3HMXH 1SVZA 3OJDA 2FX7H 4UT7H 1G9MC 2P4AB 1A9EA 5D1ZC 5IQ9A 3RVWC 3MUJA 1YZZA 4NO0A 3LEYH 1WWAX 4CVZA 3ZL4H 2CK2A 4XT1C 3TVMD 3O3BA 3RUGE 2OTWA 3PHOB 2IPUK 5BQ7B 3B2VH 2F54E 3OV6A 4LLYB 1KBGL 1WFTA 3MPCA 1AR1C 4HUWA 4PG9B 2LV4A 3JXAA 1RJLB 2WQRA 4HAFA 2SEBB 1QPPA 4XNXL 3EO9L 2J8UF 5AZ2L 4PB9H 1CR9H 5DK0A 5E8PA 3BSZH 3T2QA 3HR5A 1A7OL 5DZOA 3TBSA 3QRGH 3IYLW 4NO3A 1WBXA 4BQCA 2Q8AL 3BP7A 3H9SB 2P1YA 4OUOA 1MIEL 1F02I 4MXWH 4B41A 1CF8H 4G6AC 3MRIB 1WK0A 3WLWD 2DB8A 1FNGA 4AM0A 3S96A 2DOCA 2VL5A 3RQ3A 4P57A 2H2SC 3DYPA 3DVFA 3PV6B 4WJ5A 4XMPL 5GRXG 1IGIL 4YHLH 2HMID 2F8OA 1VADA 3OWEA 4TULL 2E5EA 3MJ8B 3MRNB 4PJ5A 3O3EB 1RULH 1BFSA 1OT1A 2X41A 3G5XB 5TH2A 1MQ8A 4GQ9H 1EFQA 4CMHB 1JPST 1IFHL 4XCYB 4X9HA 4LASH 2P8MB 3BPNC 1I9JH 1C7TA 3T65B 1I1CA 5KZCB 4QKXB 1LO4H 1OSPL 1CG9A 5B38A 3IDJB 1MY7A 4PRPA 3N1GC 1OTUD 3C60A 3P4NB 3EOBB 4XX1G 4KK9C 4S1QH 5A16B 3VFNA 5CD3B 5SWZB 3DPBA 1MAKA 5F7DB 2XKSA 1XGTB 5KSBE 3ARDC 1F4WH 1YNTB 5D7JC 5SX5H 1FZJB 2EH7H 3UTOA 4LNRA 1K2DB 1DQDL 2AJSH 2V2WA 4NSKB 1QLRA 4QXUL 1HILB 5KVEH 4JLRA 5A2KH 2FEDC 3KPMB 1BQHG 1MHHA 4MB4A 2PXYD 2VAJA 1JHTA 4MHHI 4L1HA 3DUSB 1U3HB 3UC0H 1BFVH 1MFEL 2NR6C 3NCBB 5I1GL 1J05A 3JWDL 3SKJH 5INCA 1I85A 4LSUH 4XTRD 1F11B 5CEYB 1NFIB 1ADQL 3Q3GB 3MV9D 4RISH 1AD9A 5ETUB 2VDQH 2VDNH 2ZUWA 1YPZF 5D72H 4G3YH 3TJHC 5KVDL 4URTB 1EFXA 4JHAH 3GSXB 4WHDA 2W9DL 5IKCB 1FNEB 1A7NH 4I18A 4U2YA 3WIHA 1RUAL 5JPMB 5I1EH 4F37K 3FO2A 4LSDA 2IADB 3VXUA 2E8YA 2VDRL 3PL6A 3QXUA 4UILL 4DAGL 3VWKB 4OFYA 1LK2B 5FYKE 3ULSB 2VXSH 1EVTC 3IKCB 3ZT6A 2CLVB 1N59A 4TSCH 1TXKA 2R2BB 5IG7B 5IR1A 4C59B 2Z93A 1NC4A 3SKMB 1F6AA 3B4NA 2EE9A 4IOIA 2L4OA 4QF1A 4KK5C 2W65B 1MFDH 2XOTA 5DC4B 4DFHA 1JMXA 4QRPB 5GIRB 5GS0H 1HHGA 4JDVA 5MP6H 4DKAA 2CD0A 2DM7A 4I1NB 5BVPH 3RUGA 1A7RL 5D1ZD 3RVWD 1FLRH 2EIZA 3V52H 1OSZB 5JW4N 3P11H 1TMCB 2WINB 3HZMA 4ORGA 1AGBA 4R7NA 2MQ0A 1DDHA 1IBGL 3QCTL 1U8MA 3GSWB 2UYLA 1INQA 3GEWB 3VXME 5K59E 4PTTA 6CGTA 4L29A 5DDHB 3U6RB 1IQDA 3U36A 3CC5B 5I15H 1F00I 4Y4KA 1IM9D 2FJHA 3VJ6B 1JK8A 3EHBD 4WO4B 4QTHB 3S9DB 5AZEL 3FHAA 5E5MB 3HPLA 2DYPD 3T4YA 1D5IL 4QRSB 1RIHL 3VA6A 1HCFX 2ENSA 4NFDA 4ZUVB 1IKNC 3DV4B 4E42B 5HBBA 4DN3H 3TH3T 1AHWB 5K9QG 2CUMA 1TQCB 5EOTB 4K9EH 4G8GB 3LPGA 2Z31C 2P49B 4S2SB 4RFEB 4NZUL 4NNYA 2D0HA 2D7QA 1GHFL 1S7VA 4XBPA 5ACZA 1K6QL 4LLMB 5E9DB 3DBXB 4LRNH 4WI7A 1JZ5A 1IC1A 3Q5TA 4Z7NF 1BFOB 3WS3B 5E03A 3IDXL 1BJ1J 4E5XA 3LKSB 4PR5A 5D4QA 2ZPKL 2ZUQB 4G8EB 4MQ7B 3DV6B 1CLZH 4APQB 4RGOH 3QIWB 5IVZA 5EA0L 3QHFH 3WXVH 4RNRB 5IHUL 2MFNA 2EXWC 1L9MA 3FRPA 4RGNE 5IJKC 2X9WA 3GHEL 3IU4H 5KSBA 1C7SA 1I75A 3LKNA 4IOSD 2VN7A 3HC4H 1CGSL 3BP5B 4OCXH 5EORL 3QUZC 4Z78B 4KK9D 4QCIA 3U79A 1J0YA 2E7MA 1ZA3B 4QOKB 5CSZB 2AGJL 3U4BH 1I4FB 5D7JD 1TJHL 3NIGE 4ZPVB 4NRZA 4M61B 5JQ6H 1IGFL 3S3SA 5FA3A 5TE6H 3FJTA 5IW3A 5TDNA 1ZA6B 4XVUC 4DEPC 3WE6A 3QJFA 4F3FA 3BKJH 2A6DB 4MX7B 4WWKD 3D0VA 4UAOC 2NR6D 4XCFH 2ADJA 4TNVK 3MLYH 2FR4A 1CGWA 1A6VH 4LARH 1GVIA 4M48L 2EIBA 1W8OA 4JRYD 3SGKA 4CN6A 5EC1B 3FN9A 5JO5B 3NH7H 4MXVE 4JVWA 2BSSB 1A9BA 2D7NA 4JM2B 4L3CA 1G9NC 2PUQT 3ZLQC 1HHHB 1HI6B 3INUH 3ZTJG 4I2XB 4K55A 5DR5H 1A7BA 1K8DB 1OLLA 3VFTA 3QEUB 4G9DB 2VISB 2IGFH 1WZLA 5C7XH 3S36H 1DSFL 5EULV 5L6YH 4IDLA 3I6KB 4M6AA 5CCKH 3Q6GL 3FRUB 3T0EE 4LHUD 1KN4H 2RFXA 1ADQA 4JQVC 2CRYA 2WLZA 4D3CH 4JPWL 1ONQB 1MJ7L 4R2GD 1CE1L 4YX2L 4TSAH 1A6UL 2ZCKL 1I3VA 5F1IB 2MCG1 3KGRA 3RWJA 2ZOLA 4CU6A 3CFJB 5HYQA 4KK5D 4Q58C 3WUWG 3QG6A 3RY4A 5AG9A 2P8LB 4EUPB 4RDQG 4KGLA 5BZWB 2I9TB 1SBSL 2BC4B 4YBLB 2R1XA 3T0AA 3GMNB 1T1ZA 1ETZB 4NDMB 4XP1H 1EJOL 5LGHL 4R4BA 3MV11 4LHJB 1XF2B 3BZDA 3FN3A 4TUKL 5C1MB 4MVBD 1WWBX 2RB8A 1F4YL 3UXFA 4HV8A 3CZFA 3VGAC 5SX5K 1PQZA 2EE2A 1D5ZB 2NY4C 1S7UB 2M8XA 5E8DL 3O0RH 4FQ1L 15C8L 4HFUL 5TFSL 1IGML 3C5JB 3MRGA 5IVXF 2VIRB 1ZHLA 4UQ3A 2UUDH 4OCWH 1DBAL 4EDWL 5FGBC 3TFKC 4GXUN 1MCWM 4XMKH 2E27H 3MA7B 4NNPL 4XZUA 5HGDA 1NAKH 3UTTE 4JHWL 4OB5L 4RRPG 5T1LD 4G6KL 4J4PA 3NPSC 5C09B 1KCSL 5I1KL 1ERNA 4P99A 1XAUA 2WBJD 4JPKH 3MXWL 1NFIA 3MJ6A 5MEOB 2Z31D 2VLLA 1AI1H 1TVHB 5KSAD 5FB8A 3RWDA 2XYCA 3B5HA 1QSFD 4PJ7E 2VC2H 3I9GH 2JB6B 2C1OB 3NTCL 5C6WH 5JR1L 5DXWA 4D0BB 1MCQA 4YDVB 2COQA 1MHEA 3VW3L 4LVHC 5HYJB 4F7EA 3IDIA 5DEFA 4O2CA 5GS1C 4HWBH 1GGBL 1GAFH 3JSSA 3VWKA 3TCLB 4KRPC 3A67H 3O2DL 4PBWD 2UY6A 4EJ1C 5IG7A 2NW3B 1ZLSH 1MEXH 1PKQB 5ICZB 1IQWH 2K9UA 4M7LT 3QUZD 5IMKA 5JXEC 4OTXL 2IBZY 3DURB 4JHZA 4U1NA 1S9WA 2DQTH 3V6OE 2X1PA 4MLSA 3TNMB 4K8RL 1KNOB 3QO1B 1WBYB 1G9MH 3GSVA 5HGAA 3QZWA 5FOBB 5I1JL 2NY1B 3BZEA 1MAJA 4XVUD 1ZXQA 5TE4L 2YD5A 4L8SB 3DO7B 3B9VA 1I1RA 2B1HH 3X12A 2V5RA 2NZ9C 4PJIF 4MJIB 4NQXB 1H15A 4RX4A 4UU9B 1KPVB 1NCNA 1MFCH 4PRNB 1NGPH 5EOCJ 1KXTB 4G8FA 4JN2B 3UDWC 1CDJA 3KR3L 3VJ6A 1X5IA 4KZDH 3MRBB 2E9JA 4KY1H 3VFPA 3RNQB 4RMRA 4KDTA 4PRAA 4BUHA 2X4NA 4I0PC 5JIIA 1S8DB 1KJVA 5DVKA 4DQOH 2XI9A 4XXCA 3T0EA 2P7TB 3PP3K 2BNUA 2GW5A 4KPHL 4J8RA 4G8GA 3MRDA 3MUZ1 2J88L 4JPVH 2VOTA 4X98A 3V4UH 3MNWA 1PEWA 2EDJA 1OWWA 1HEZA 1DBMH 3A6BH 4NZDA 3RZCA 1F3JB 4OKDA 4GS7C 1VA9A 4U2ZA 1UCTA 3VH8A 1QQDA 2AJYL 4YFLF 4UQ2B 4WEBH 1BREA 3RI5K 3R0MA 1CLOL 5BRZD 1FNSL 4AT6B 4MQ7A 1TVBA 4ELKA 3NA9H 4XPGL 2QADB 5HD8D 3REVA 3JWOC 5JIKA 4CRPA 4BSWB 3VD5A 1RK0A 2Q86B 5EZIL 2V2XB 4NQSB 3HA0A 4I77L 4OCSH 5LXGH 3C8DA 12E8L 3K4AA 4FMKA 1RD6A 4KROB 4Z78A 4KKCC 3MYJA 1ZOXA 2NY6C 2NY4D 2WIIB 1VEPA 5ESVB 4NKOA 1OB1A 1TQBB 2AJZB 4HIJB 2XQYG 4D8PB 3QWOB 4JO3L 4EN3D 4NO2A 3FTGA 3CCHA 2P5WD 2AXFA 2EIEA 3UTTA 4DKEH 3BAEL 3O6FD 3TFKD 1CWVA 3RKPA 3E6HA 3TJEL 5DHVB 3B9DA 2VLKE 2H1PH 4R7DB 5TF1H 5L9DL 3JVGC 1FL5B 1JGVL 5EO1B 3EOYG 4WHCA 5CZKA 2HFEA 1GGTA 3VFGH 4PJ7A 2DMCA 3P0YL 1NJ9A 3FN0L 3DSFH 3HFML 4GT7A 1S9XB 4D0CA 5TGBB 5F7HA 5JO5A 5FDWA 4PTUB 3S36X 1J1XH 2BSSA 2VKWA 3TT1L 3N06B 4E0RA 1FL6A 1M7IA 3SDAA 1M7DB 4ZAKC 1D6VL 1T5WA 2HT2D 4HHAB 5DD6B 3ESVF 3D5OF 5EDXA 3OR7A 3L1OH 3P30H 1TZHB 4GAGL 1MWAL 5J6GB 5C2UB 5CINL 2EYTB 1XF3A 5EFIA 3ARGB 1JGLL 2XN9E 3HE6D 4KQ3H 2EDTA 5D1QD 4QHMA 4X7TB 1LK3H 4P46B 4X4YA 3CXDH 2EH8H 3JUZA 3MJ7A 1NGQL 3V6OA 5JXED 1Q0YL 1T04B 2W0FA 2XFXB 4PJAF 5J3HD 5DGQA 4IIQB 5JORB 1RAMA 1QP1A 4JFPA 5HHMB 2Z92A 1FDLH 1YEGH 4UV7H 5K9KB 4UZGA 2FX7L 3O8XB 4UT7L 4IRJD 5DJDA 5DQ9A 3H3PH 3O2DA 3O4LD 1B9ZA 1XGQB 2QQNH 4HEME 1HK6A 4J3WA 5E00B 3LEYL 4N0CC 1CQKA 3EBAA 2QTEA 3LN4A 3ZL4L 2OX5A 4W4OA 1D5ZA 1OTSC 3EDEA 2UUDK 4YHYC 1U8PA 1B3JA 1NAML 4G9FB 3B2VL 4I4WB 4D9RE 3WHXB 35C8H 4L3EE 4GKNA 2QV2A 4RAVB 4RWHA 4Y5XC 1U95B 4JY4B 4Q9QH 2HVJB 4N8VB 1XEDA 2FX9H 3PGFH 4JFFB 4GMTL 5LVEA 2FL5B 3VGGA 1ODAA 1BP3B 1IE5A 2CH8A 3N1MC 5BMFL 5JOPE 4PB9L 5EU6D 8FABB 1CR9L 4P5MB 3RGVC 1Q72H 3NCCB 5C9KA 1CBVH 3BSZL 3SKOB 3T4AB 4Q9RH 4MJ4A 4X5WA 1ED3B 1J0ZA 1JTPA 1ZT1B 2W07A 1TCRA 3LEXA 4X8XA 4D2NA 4MXWL 4LCWB 3DIFA 1CF8L 2BY1A 3MZGB 2G2RA 2KZ1B 5DEGA 4HW6A 2P47B 5JHDD 1CDHA 2L7UA 4D0BA 2PW2B 5IQ7H 1MI5E 4YHLL 5D7SH 1YEDA 2A9MH 1YEFH 3RWFA 5HYJA 5FYJU 1B0GB 4QWWC 1JVKA 1RULL 4GUPB 3B3IA 3D3VB 4R90L 4GQ9L 4EI5C 4UOW1 5JW3H 4LASL 1AFVH 1I9JL 1G7IA 4MS8D 5E6IA 1YYMH 3HE7B 3STBA 1G7MA 1KPUB 1LO4L 3FO0H 1DVFB 2IQ9H 4FA8A 1UVQA 2IG2H 1X4ZA 1WC7B 3BWAB 3PQYB 3BPCB 4L8CA 2GY7B 3B9KC 4S1QL 3DLQR 5E7BA 5EIVA 4UUJA 2DN7A 3ARBC 5EUKB 1F4WL 1IJ9A 3QB7C 4G6JH 3QO1A 5JTWA 2VLKA 3G5VA 3KLHC 5FAAA 1E6OH 1U8HA 2PO6C 1NLBL 2ZNXA 2AJSL 3BT2L 4ZYKB 4HMCA 7FABH 3CFDA 5KVEL 1WFUA 4AEHH 3QH3A 5DD1H 3MCKA 1J8HE 2BSRB 1G7HA 3IFPB 2G9HB 3UC0L 4MZ2A 1BFVL 3WFDH 4GH7B 2XT1B 4P4KA 5C07E 3SKJL 5E4EB 4YO0A 1RK1B 1XT5A 2ADGA 4LSUL 4LVNC 4OCNC 3MO1A 1WUNT 1HINH 2JB5L 3RNQA 4LCUB 5GQBA 2VDQL 2VDNL 5D72L 3OTTA 3CDCA 2VZ3A 4G3YL 5JMRA 2J8UB 4D0DB 1VCAA 4PRDB 3PWJB 5IF0B 3I3EA 5J7CC 4JHAL 4ZAKD 1KEMH 2IFFH 4F37F 2X44D 4KUCD 5DA4A 2XN9A 2BHUA 1ZHNB 3D85B 3IJHB 2G5BB 2YSSB 5FIEA 2AEPL 5IP4A 3V2AR 4G8IA 5KANI 1L9NA 1OW0C 2FHBA 3UPAA 3UYRH 2VXSL 1T3FA 2EO1A 4TSCL 2AP2A 1KUMA 2HAZA 1P7KA 2IALB 3BZ4B 2VUYA 3KLSA 4YHNA 3WSQH 1CFSB 2P8PB 5CFHA 2JF1A 1XH3A 1MFDL 2DQIH 2X1QA 4U1JB 5D6DA 5GS0L 2AXGB 5IEKB 1JF5A 5MP6L 4YDJB 1MWAA 3RNKB 5BVPL 2VN4A 2BP3A 2GAZB 4U1LB 1FLRL 3V52L 3WNLA 3O3DA 3CD4A 3MJ9H 3P11L 1GOHA 1U2HA 3OKOA 3NABH 4L3EA 4M6MH 1OTSD 1XGUA 1U42A 5IEHA 3HPJB 3HS0B 1S9YA 5ESVA 1DR9A 3EDDA 4MQTB 5FYJH 2GSIA 3DVGB 4PJBF 5I15L 1B4JH 1GIGL 3C2SA 3RIFK 1ZWIB 1Y0LA 4HXAL 1LE5A 4H25A 5AEAA 5IB4B 4OKVB 4J3XA 4MDJA 1TITA 4U7SA 1OLZA 3KNBA 4R7DA 2VE6A 3MRPB 4U0RB 5H37G 4TOYH 1NC2A 3NAAH 3ULUF 4G80B 2XPGA 4DN3L 3QQ3B 3QDGE 3RBGA 4HK0B 2PCPB 4K9EL 2D4FA 4XXDA 1WF5A 4JRXD 1NAMA 5CBEA 3BYTA 2VQUA 1YPZB 1MI5A 5I66A 2YRLA 2HP4A 5ACMA 2HRPH 3HI6H 4NQTA 3WFEH 4OBRA 4WUUB 4LRNL 1KC5H 1IAII 5C0GA 3VFRB 5I1HL 3G9AB 3LY6A 4NRYA 4OLZH 2P24A 3F5WB 1CTNA 2HKFL 4JB9H 3RTQC 3GJEA 1CLZL 1CGTA 4KUCF 4ODXB 4RGOL 2VR9A 2XWBB 1EERB 4Z77A 3QHFL 3V0VA 3WXVL 1F2XK 1ORQB 2ZKHL 4X7TA 3CPLB 3IU4L 3BVNA 5D2LF 1DFBH 3K8KA 5EO0B 4ZUUA 2HWZL 4MXQD 4OCXL 1YC8A 3S5LB 1N5YH 3ARBD 4O4YL 2CRZA 3PWPE 4HIIB 5M94B 5A2LH 1KIQA 3KLHD 4PRHD 2IJ0C 1J8HA 2PO6D 1N6UA 3MACH 5TE6L 4PV9A 3V6ZA 1EO5A 2YPLB 3RWGA 2VZTA 4GKOA 2I9LB 1KPRA 3BKJL 4OUUA 1FZOB 4LEOA 4XCFL 1RHFA 3MLYL 5T1KD 1A6VL 4WW2B 4NP4H 1S5HA 4JFZL 4LARL 5ICXB 1EEYA 4U6XA 1QBLH 1YDPB 1U95A 2HVJA 1FL3B 4TUJA 3D2UB 3K7UA 1JHLH 1R3JB 2PYFA 5IBUG 1HHKA 1PSKH 3VFWB 3DXAB 4HH8A 4Q74A 3CNKA 3QCUH 1KT2B 3INUL 5HGHB 3SDCC 3SKOA 3UMTA 4EXKA 2IGFL 2VWEE 5C7XL 3S36L 3UTPD 1ZT1A 3ARFB 3HUJB 4GQPH 4WV1A 5L6YL 3K4DA 5D96C 3GSUA 1JF1A 5CCKL 2V2TB 1KN4L 1NEUA 3AM8A 4D3CL 1EEZB 5IWLA 2Z4QB 2F54B 4TSAL 4X4XB 3TCXA 1LWRA 1Q38A 4GUPA 5C0IA 5FO8A 4NO5A 2JJSA 4KU1A 1PKOA 1MF2H 3LMJH 3IS1X 3NZHH 3JWOH 3U46A 5MENB 4OGAD 5J9PB 4IJ3B 4WHTB 4X6BB 2LFGA 5HYSA 4EVNB 4U6YA 1EEUA 1QA9A 2P45B 3TBVA 1DANT 3PQYA 1YEEH 1T4KB 1J0KA 3C6SA 4BSJA 1UC6A 3ZKQD 3KJ6H 4DZBB 1PZ5B 4V2CB 4KKLC 4Q97A 4Y1AD 3UPCA 3ILPB 4NCDA 4L5FH 5KS9F 1QFUH 4OCWL 4I3SH 4LVEA 2DLEA 5GS3A 4XMKL 3VXNA 5IW1B 2E27L 3LDBB 3P9MA 4LPTA 1NAKL 4WWID 4OIIH 3IXAA 5GZNC 4XP9H 3EYVB 2LAAA 1CGXA 2ZWLT 3F12A 2Y7QB 4B53A 4GRLA 1N6VA 1I3UA 3RVUD 2QLVB 1X5LA 4JPKL 3UAJC 4PJEB 1AI1L 4OF5A 3ZMRA 1OAUH 2FWOA 2VC2L 4AIZA 1PAMA 3JTTB 1AGDA 3LQMA 3DX6A 2Q8BH 3UX9B 3E3QC 3IVKB 4IMKC 3TZVB 1QZ1A 2OK0H 2PTVA 1FBIH 4HWBL 5A3ID 1ZV5A 4EBQH 3ES6A 5GSRA 2KZWA 1GAFL 5GXBB 4OLWL 3WL9A 5C0CD 3A67L 1ZEAH 1QR1A 4X6DE 4NCC2 3ZHKA 4PJ9C 2NZIA 2XTJC 1V8HA 5D93B 4OZFH 2DDQH 1AY1H 1ZLSL 1MEXL 5I2IB 2A77H 3NA4A 3PWPA 5F89B 1IQWL 3KPTA 3MV9E 3QDHA 3DX9A 1AKJD 5KOVC 2AAVA 4AJ0A 1W0WA 1HYSC 4G43B 3RDTB 4U1JA 4Z7NE 2DQTL 1FZMA 2ZOKB 1QRND 4YDJA 4KWUA 3V0AC 1YUHB 1G9ML 1N5AA 3T3PE 2YD4A 5FK9B 5K9OA 5GRYA 4WTZA 3U0TA 3VFOA 2F74A 3BP4B 1CXHA 3C2AH 3BRDA 3SDYH 2V7NA 1QR4A 4OM0H 3CLEH 5ENWB 3U4EB 2W92A 4OLYH 2B1HL 4JFDB 4X6FA 4I13B 4CVXA 5IW6B 5I16A 4UOJA 1MFCL 5ALCH 5IVXB 1NGPL 5EBLB 3F6LA 4X6EB 1ZWIA 2EKJA 4KY1L 4WY7H 3I02A 4PPTA 1M6OA 4OKVA 3LV3A 3IU3B 4AENA 2UVEA 1ZVSB 4MD0B 3MRPA 4ZS7H 3QPQC 5DQJB 2MPAH 5T5FL 5GRJH 1H3PL 3VXSB 3PABB 1LD9B 3MFFA 3TVMA 3UBXG 4F7PA 2YN5A 1KLFA 3TYFA 2R29H 3KYMA 2OQJA 2AERT 2IAMC 3V4UL 4Z7WF 5C0RH 2PW1A 3TA3C 3ROLA 1DBML 3A6BL 1MRFH 3OKKA 4NJ9H 4AL8H 2BVOA 2BNRB 1BVKB 3GGWB 4WUUA 4YNYB 3X17A 4DCQB 1BX2A 1S7TB 2JCCB 3RVXC 1HQRA 1BLNA 1LMKA 3RI5F 3VFRA 4WEBL 1I7ZA 3BYYA 3ZKXB 4Y16B 3F5WA 1QBBA 5CZXC 1JJUA 1HHIA 5SV4A 3NA9L 1GPOH 4TNWK 1T7ZA 2K1MA 1I3RA 1D5XB 5IMMA 5DD5H 3FQUA 1I8LC 3QI9B 4U49A 4QT5B 4PJXE 1B0RB 3WKNA 2XQYK 1M1SA 1KGCD 4PUBH 3NIFE 3T1FA 3U0PA 1P7HL 3UZVB 1C5BH 1RFDL 2Z35B 3N9GL 3T77A 3AY4A 1HE7A 3KS0H 4XI5C 4GG8B 3HC0A 3WCYA 4NNXB 3OKEB 4UDUB 4NIKB 1U3ZA 2ILLA 1DBJL 4Z95H 3FQWB 3VGEA 1JN6A 5AUMB 1QKZH 2H1PL 5TF1L 2I9LA 1E28B 3WS6A 2FYYB 4HUVA 4DOHB 5GZND 4H26B 1I1FB 4NBZB 3S4SG 3VFGL 2B39A 2BK8A 1HNGA 3IFOA 3B9AA 3ARSA 1JPSH 3X14B 1U8OB 1I7RA 4ZOAA 4WUKL 1YC7A 2EIDA 2VLJD 3GSQA 3DSFL 4ODWA 3L5WA 4MA7H 5AD0A 1T20B 4P3CH 3D2UA 4L9LC 4GAYA 1J1XL 5C08D 2B0SH 1KIPB 1UCBH 3HHRB 4YHKH 5TQ0H 2NY3B 1A6WH 2PXYA 1JZ6A 3I3BA 4X6DA 3KJ4C 3VXRB 3ZSSA 4P2OC 3L1OL 3P30L 3QA3B 1WCQA 1KB5B 3T0XA 3ARFA 1L0YA 5HHPA 4O02H 5L0QB 4KVCH 3MV9A 2HN7B 1JGEB 1E6JH 4KQ3L 2MHAA 1LK3L 2G75A 3CXDL 1YMMB 2EH8L 4H8WC 3K3QA 5J1AB 4JRYE 1FNHA 2X9XA 4JZOB 1U8KB 1A0QH 1RZIA 5ERWA 1F2QA 3D69B 1WT5A 3ZTNH 4AQOA 4FNLH 3TNNA 1FDLL 1QHOA 3HTLX 1NFKA 2PYEB 1YEGL 4HWBA 4WHTA 1NL0H 3L3OB 4UV7L 2CDFB 4KTDH 3OZ9H 4TTDC 2EECA 3DROA 5GGSB 4YR6B 2QQNL 4J3UA 2ZUTA 4BFIB 2ZSVA 2YUVA 3VFMB 1EHLH 4F8TA 4Z5RB 1JWUB 2CGRL 4IOFC 1L6XA 2WSKA 1TZIA 2ITCA 2YD7A 3QUXC 5DS8B 4HIXH 4QHNB 2W60B 1N0XL 35C8L 4NKMB 1BF8A 1IVLA 5K9JH 1ZT7A 4WEMB 2OP4L 3QAZB 3V5DA 2FX9L 1LO5B 1U6AH 3PGFL 5I8OH 1AGFA 1FZKB 2VITA 5C86A 3QPQD 1VKXB 2GCYB 1U93A 1VERA 4OZ4B 1Q72L 4LCCA 1CBVL 1M7XA 2QQLH 3KLAB 5IGXH 3CSGA 4BELD 4PJIE 1OP3K 2IAMD 4ZFOL 2FECI 1H3GA 3EIFA 1IM9A 4TVSa 2ICEB 3TA3D 3QNZA 5CS7A 2ICWI 2ITDA 2AKRB 2DYPA 2NYYD 2ZUYA 2D7PA 3JTSA 5IQ7L 3RVXD 3IVKA 1OP5K 5D7SL 3HAEG 3C6LB 3WBDA 2A9ML 2JK5B 1YEFL 2H9GB 1FHGA 4LPYA 5F1NA 4Z7VE 2VR4A 5F97E 4JO2H 1GZPA 4PJXA 3PWNB 1BM3H 5JW3L 2Y72A 2P5EB 1JMZA 3H7BB 4WI9A 4MD4A 1AFVL 4O51A 1YYML 4KMTH 1KCVH 4R26L 3FO0L 1JPFB 2IQ9L 5F89A 4LSRH 2BHZA 2IG2L 4PJAB 4ZOCA 1ZAGA 3PF2A 1UACH 1JE6A 4KRLB 4HJGA 3LSOA 1QSFE 3HG1E 3BDBA 4Z9KB 4M7ZB 1HIML 2QR0B 1PZUB 1FO0H 3DARA 1HXYB 4LKXA 4P5TC 4AIOA 4Q7DA 4XCCH 4AH2A 1UJ3C 1E6OL 2FSEA 5IB5B 3OSKA 3VXQB 1ZGLA 4QHLB 7FABL 4CJ1A 5FO7B 1YQVH 3LAFA 4AEHL 5DD1L 1T5XB 3PDOA 4GRWF 1RJYB 1C5DA 2NY2B 4WTWA 1D9KB 1U8NB 5CGMA 4WNQB 1UXWA 3TBWA 5HPMB 4YXLH 5IVXA 4JO4H 5D7JA 4PLNC 5F7YC 4X6EA 2B7DT 1DN0B 1FFPB 1HINL 1FYTD 4FXGB 1OAZH 4N1CA 2ICWJ 4MNGE 3HRZA 1ZHBA 1BZ9B 1F3DH 4KHTH 2VZUA 2OL3B 4ZUSA 3X3GH 1KEML 5ISZD 2IFFL 4WWKA 1VENA 3DI3B 3DMMC 2Z0BA 5TDOA 4MA1C 5FXCH 3OJ2C 3PDDA 4GKSA 4PG2A 4HIHB 3RPIA 3P77A 1Y18B 3A0OA 2Z9TA 5CJBA 5E8EB 4JRYA 5I0ZA 4GRMA 4R4ND 3UYRL 3P40A 5DVMA 5E70A 5I1DA 2EICA 1BQUA 4U7MA 4Y19D 3WSQL 1AO7D 3CMOH 4JCMA 4OV6F 2R2HA 1MFNA 4OAWA 1Q0XL 4KC3B 4JR9H 3KPSD 2PETA 3O81A 1MCLA 2VZOA 3FQRB 3C5SA 3IDYC 1JFQH 4Q2ZB 3VRJA 5E2WH 5ESAB 5HYEA 4PRIB 4LHUA 3I2CH 5J1TC 2PR4H 4HAGA 3V5KB 3EYUH 5E8OB 2FJFA 4LBEB 1B0RA 3LRGA 5SV3A 2H3NA 4N9OB 4Z76A 4U1KB 4IOFD 3RRQA 3NABL 5FOJA 2FH6A 2OS7A 4M6ML 4HIEA 2J8HA 3QUXD 5FYJL 3O9WB 2A1WL 1QACA 1DL7H 2CDEA 5F9AC 1QLFB 1RIUH 1B4JL 1DUYB 4LPVA 1S7RB 4FQJH 2GSGB 4K3JH 4XNUH 5BRZE 4RIRB 3MRKA 1SJEA 4PJIA 3U2SB 3GMQB 4TOYL 2Y9RT 3V7AE 3LS5H 2OXHA 1MCDA 4DVBA 1I8KA 4MD5B 3C60C 3W9DB 4X9GA 1BIIA 4H1LB 5KAQG 1NPUA 3HB3C 3HI6L 3WFEL 4Z7VA 3MOBH 3FMGL 3BHBB 4NN6C 5FYJE 3O45A 4U1MA 4X6CF 4QHKI 4KQ4L 1KC5L 2P5WE 1IKNA 5T1LA 5BV7B 2VMFA 4OLZL 3T04D 4JB9L 3CU7A 3HZVA 4D9QD 3F7VA 2WBJA 1KG0A 4XH2A 3QXWA 5DUBA 2X4OB 2Z31A 2GTZB 1KIRB 5KSAA 4ZFOA 4MMXC 1RZGB 1QSFA 4GW1B 5IFJB 1BEYH 4GBXC 2Q76A 1YMMA 4OZIF 5GRVK 2XQBL 4PJ8B 3PIQB 1DFBL 1ZS8A 3CFBB 1I85C 4RBPH 1Z9OA 3SQBA 3X11A 1N5YL 4LSVH 2HJKA 1YJDL 4P5TD 1IAKA 2PYEA 4YH6A 5ECJE 1K8IB 2HT3C 5E1AB 3GMRA 4CJ0A 5CGTA 3L3OA 2FIKB 4HKXB 2DJUA 1F6LL 3BMWA 4XCEA 3O6LL 4I18C 5IJKA 1CFBA 3IGAB 2QEJA 1Z9MA 1NGYA 1QPXA 2EEBA 2NNAA 3MXVH 4KK8C 3QPXH 3KAAA 4IDJH 3QUZA 3UTQB 1CE6A 3MUGA 3BXNA 4MNGA 4OCRH 4NP4L 4PJBB 2D7TH 1CICC 2C26A 1P4BH 4ZDHA 2HH0L 4NKMA 1QBLL 1T1XB 1HSBB 1UKQA 3KYOB 3FOLB 4POZC 3IXTA 5MHSD 1Z5LA 4NQEB 3GKWH 3LKQA 1PSKL 4M7LH 4QHKJ 2GCYA 2VZVA 4M5YH 5B22A 5CEZH 2XXCB 3QCUL 5DRNA 2CRIA 4Y89A 1K3ZA 3DMMD 4EIGB 3O4LE 3S7GA 1XIWC 1K4CA 3OJVC 4FFVD 4EI6B 2HTKD 4XWOC 1T0NB 1UXSB 1AXIB 4UTAH 1OD7A 5DYOA 4PJHF 1S9KC 3QEGH 5TJWK 2VRAA 3C9NA 4K71B 3RBSA 4KV5E 4DGIH 4U6TA 2R0WH 3MRHA 3IS0X 1JWMB 3FO1B 4JVUA 2YKLH 1MHPH 1RQ5A 5DHYA 4QNPE 5C0EA 4HQQH 4Y4KC 5DMGC 1J9CT 5DJCA 1CT8A 4A6YH 5GGTH 1MF2L 1QUNA 2XWTB 3PWNA 4ZSOE 3LMJL 5I71C 2XA3A 3E8UH 3NZHL 3JWOL 1N8ZA 5EU6E 2AABL 3M17A 2E7BA 4PRBB 5FKPB 4JQVA 1HSAB 3BGFB 3MLVH 4BH8A 1PVHA 1SY6H 5F7UA 1YEEL 1NKRA 3X13B 2BNQD 4U33A 4JN1L 2DLFH 5JHDE 5BRZA 4M93C 4HS3B 5F7EL 4RMTA 1QBML 4L5FL 2AJ3A 5FGRA 4NQDD 3VXQA 1RZKH 2J8OA 3SGDI 4I3SL 5DA0B 2GK0A 5DJ0A 1MCFA 2IH3B 4HKZB 2X4TB 5D7IF 2W9LA 2X9YA 2DF3A 4MB3A 3T8XA 2F9BT 3DRTB 2EC8A 4E41D 3UJIH 1P4LB 1RPQA 4JAMB 3MRRA 2YMXL 5HI5D 3L5XH 1FFPA 1KOAA 1WITA 3C60D 3MTRA 4EN3A 2P5WA 1OAUL 1UJTA 3HB3D 3R4DA 2IBZX 3O6FA 4K07A 3GJFH 5FGBA 1R3HA 2R0KH 2D7MA 1AD0A 4OM1H 1I7UB 2R4RH 3F6IA 3FB8A 4ZPTB 4OGYH 2Q8BL 3SOBH 4J3OC 5DZLA 4BFGA 4UDTA 3GI9H 2OK0L 3OXRA 1SEBA 1RZFH 3LRHA 4IHOA 1FBIL 1BECA 1SMAA 1I7TA 4N8CH 4PY7A 3ZSTA 3NCYP 4EBQL 2LTQB 1ZEAL 3STZB 1H3VA 4KJWC 43C9B 1EMTH 4H8WH 4KMQA 4GBXD 2DDQL 1AY1L 1C1EH 3O6KL 3S3PA 2A77L 3I6LD 3FFCD 2BZDA 1GGYA 2YA2A 2R2EB 3SGKC 3SKNA 4I8DA 4PGEB 4YDIH 1J0IA 3L3KB 5GS1A 3RWEB 5IFHH 3C8HA 4W81A 3QYCA 5HJ3A 3RIAK 5D9SA 1X6LA 1X5GA 2GJZA 4Y4HD 5DK2B 2XWJB 3V5KA 5KOMC 3DUUA 3HE6A 3I85A 5D1QA 3C2AL 1X5HA 3SDYL 1MJ8H 4OM0L 3CLEL 1GJIA 2BVQB 3BN9C 1R5IA 5HVGB 4J12A 4U1KA 4ZG1A 4OLYL 2CXGA 5JXEA 5D2LE 1G9EA 1G0XA 2R39A 1RI8A 4DJMA 1OTTD 1K3IA 2EDHA 4ZFFB 1GZQB 1NC4D 4ZODA 1CICD 4OZGF 4DWHA 5KS9B 1CI5A 2YD9A 1HDMA 4Y4FB 4XBEH 1R5VB 1LP9B 1MCBA 3E2HC 4IRJA 4WY7L 2QKIB 3O4LA 3QUYB 4M43H 2MKLC 2DD8H 4PREB 4K94H 4W6YB 1FVDB 2MPAL 2OMNA 1XCQB 1IL1A 5GRJL 1Q8MA 3L7FB 3DETC 3FB7B 3FRPG 5FV1L 3I75B 1AE6L 1XIWD 2R29L 2NX5D 5J6HA 2OI9B 5C0RL 4XWOD 3UDWA 4H1LA 4JFYB 5CWSB 1LNUB 5HHOD 4P2RD 3CH8A 3EJJX 3MZTA 1MRFL 5HY9B 1QSED 1N26A 3QHZH 4ZSOA 1MCJA 5H35B 2BDNH 5EU6A 1I8IA 4PLKD 5DMGD 1IGJA 4TNWF 3FFDA 5CSBA 3SDXF 2KPNA 1GPOL 4FQHB 3EYFA 5CMAB 4LKCA 5DD5L 3ECBA 4J4PC 1PW3A 1Q94B 3QDGB 1B90A 4JRXE 4P23B 4PJ8A 3MR9A 3CFBA 5JHDA 4NFCA 5F6HI 3PG2A 4EEEA 4PUBL 43CAB 3G04B 1C5BL 3F8UB 2ZG1A 1H5BB 2DIJA 2EYRA 2ORBH 4KDWA 4LGPB 4F9PA 3FT4B 3H8NA 2BOCB 4U3CA 3DGGB 2I27N 1LEIA 2GJ6B 1IAIM 4O58H 1OQXA 2EDRA 5I17A 4RZCA 4CNIA 4Z95L 3UBXI 5E8NA 4RGNC 5MEQB 4GW4B 1QKZL 4LDOB 4NYLA 2HJLB 3VWKC 1IZJA 4JFXA 4EOWH 2OZ4H 2I26N 2H41A 4J2XA 1JTTA 1JPSL 4CUCA 1ZLWH 2FGZA 3MV8B 2CIIA 1MCWW 3MV7B 3KYOA 1VFOA 4MA7L 4JPIB 4P3CL 4KKAC 5GGRA 4HUMB 3FT2B 1GGCH 3VXPB 5LKNA 1U8IB 3UTSB 1YY8B 2B0SL 1UCBL 3MNZA 4HKJA 4YHKL 5TQ0L 4PRHE 3T2PA 2EDWA 1TCMA 3LEVH 2H32H 3WJJA 1X9QA 1J11A 4Z7WB 4KJQC 4WU5B 3W9EB 2JKXA 3REWB 2EDNA 2VUOA 1YN6A 4KVCL 2XY2A 2MJWA 4LSPH 3KPLB 1IAMA 3WIFB 4KJWD 1E6JL 3NACH 4P4RB 4JGUA 3GSOB 5F9JB 4D94A 3WNKA 3RWCA 3VI3E 5LGJA 5F6HJ 3QEQB 1FG2A 4ZAKA 1FIEA 4YDLB 1W0YT 3DHJA 1X7QB 3VE0B 5IMLB 3L6FA 4H5SB 3RL2B 1A6TA 2ZCHH 4HX1B 3MCLL 4WO4C 4FNLL 2FNBA 3MLUH 4FG6C 1RY7B 1NL0L 3OHXB 1EX0A 1Z0NA 4KTDL 1CZ8H 1T2JA 3BKYH 4XXCC 5D2LA 4LLQA 3T0EC 2F19L 1TQCC 4XPHH 3UTPE 2CKBB 1EHLL 3H9SD 2RCSH 2JJWA 3NN8A 4P59H 1A1OA 3UTZA 5EU4A 3RZCC 2R1YA 4LGRB 2A74B 3LZFH 4HIXL 4EDXA 2YWZA 4WU7B 3SKUD 4R8WH 1FP5A 3NFSH 2NPLX 5K9JL 1GCFA 2HFGL 4FTVB 1KJMB 4ODVH 1U6AL 5I8OL 5KSUA 1OQOA 1ROWA 5CJ8A 2ZUQC 3GI8H 1IAOB 5D2NB 4LFHD 3QIWC 4JRWA 5ESQA 1P4LA 3DETD 1Q9LA 2NTFA 4O2EB 1MFBH 2QQLL 3GJFK 5IGXL 5D7LD 1FYHB 3IDMA 3QUKB 3SE3A 4ODUB 5ADOH 3O3UN 5SWZD 3VDBA 2FBJH 4HZLB 3CH1B 4Y1AE 1YN7B 1A8JH 3P9LA 1VFAB 4JO2L 1CDYA 4JRXA 1BM3L 1W72B 4MSWA 3STZA 25C8H 1U3HD 3B6SA 4FQXB 1EPFA 2CMRH 4C56B 3V7MA 1T6VN 43C9A 4J4PD 3EYQC 1WFOA 4YBHA 4KMTL 1KCVL 3TO4B 2FBOJ 3UCRA 4LSRL 4PGBA 1BD2B 1UACL 1PGRB 3NFPB 3EO1A 4DUWA 2M26A 1FO0L 2X5PA 2DQUH 5E2TH 1WWCA 4OLEA 4OSUH 1CDBA 4XCCL 3SDAC 1ZSDB 3U1SH 5T1MA 3G5YA 3AS3A 1S5IH 2JJUA 1DANU 3WIHH 2J3SA 2ARWA 4IRSB 3EAKA 4LLUB 1EXUB 4LL9A 1CK0H 1HOCA 1YQVL 2VLRB 4QGYA 3V6FA 2O61B 5C0CE 2C7UB 3VWKD 3WV0A 2O5YL 1JUFA 1VHPA 4ONGL 5CJ5A 5DMIH 4XP6H 2VXUH 4YXLL 5A43C 4U1IA 2NXYC 3VH8G 1C12B 3L3DB 2E6JA 4JO4L 3U9PL 1CGVA 4WFED 4YPGA 5FM5M 2VABA 4PRHA 4BKLA 1A22B 2Y4SA 5KSVB 1OAZL 3CFEA 3P9WB 1GC1C 1FRGH 4KHTL 4QRPD 1QRNE 2AQ1A 1G0YR 4YBLC 3X3GL 3TT3H 2F8XC 3U0WH 5EB9A 2IANB 2VQ1B 3I75A 1MJJA 3FQTA 5EC2B 5T1KA 4NHUB 2YK1H 4KJQD 2GI7A 4YFDB 1FV1B 3OX8B 3QP3A 5TQ2H 3QG7L 4JY6B 3GSRB 3AREB 2DKMA 5IB3B 4HBCH 1MHCB 3PUCA 2KUTA 2FLRT 5DVNA 5HHQA 2H6PA 1UB6B 3BE1H 3VFUB 4ONOA 3V5HB 3CMOL 4LF3B 1T1WA 4K8RC 3T2NH 3KXFB 3ILQC 4WO4D 5ALBH 1UEMA 3PWLA 1G84A 1VFBA 4XBGB 2JTDA 1JFQL 4FG6D 5E2WL 1OW0A 5I8KH 4UT6H 2WWMD 3I2CL 2PR4L 1MCRA 4ZO6A 3T0WA 3HC3H 3EYUL 3MRCB 1AQKH 2Z91A 4G8GD 3ZE2F 2IEPA 1BQHB 4GFTB 1QYGH 1YEJH 2RQ8A 4WCYH 3HNVL 3U48A 2IPUG 5E9DD 5CD5C 1I1AB 1DL7L 3DGGA 1RIUL 3OKMA 1UENA 2R56H 3NFNB 3W39B 3BI9X 3L9RA 4FQJL 5HDQH 5ICYB 1HXMA 4XNUL 2DTSA 4GRWB 1ZLWK 4APQD 5AYQA 3LKOA 3QIWD 4UNVA 1MLCB 2Q8AH 3LS5L 4MHHG 5FUZH 1YECH 5C0DA 4F7MB 1Y6NR 1OAXH 3KDMA 4Z0XA 2XNAA 5B4MC 1QVOA 5DMKA 2VNCA 5B3NA 1U58A 4Y1AA 3IETA 1CDIA 5MERB 5LJYH 3FT2A 4IS6B 4M8VA 1IGCH 4QOKD 3PHQB 3VRIB 2FJGB 3NVQA 3MOBL 4ZXBB 5EZJA 5GSVA 2FO4A 4I5BA 1IFHH 3RPKA 3HZYA 4M62H 4X0KA 4Z7WA 2HG5A 4JANA 4WU5A 5IV2B 5DHXB 1CL7H 2HT4C 1RUQH 2CR6A 5C0FB 1C16B 3BPNB 4P4RA 2ZSWA 5BXFA 3KYNB 1SM3H 5B3JF 3EYQD 2VJXA 1A6PA 1BEYL 3PHSA 5CP7B 1XFPA 3MRQA 5IMLA 5BS0B 3TV3H 5GHWH 1ORSA 3RL2A 2R9HC 4V1DB 5BO1H 2ZJSH 2Y5TA 4U6HA 5C08E 2BHYA 2UVFA 4LSVL 3U7AA 1PLGH 3C09C 1N64H 4FS0A 3PXHA 3ARDB 4JM2D 5C0CA 1V7NH 2ED8A 3DX8B 3MROB 2QBWA 3SO5A 1S7SA 4TUOA 3FHQA 1BGXH 2BXYA 3HNSL 3SE4A 1EAPB 1KTDA 3MXVL 1CXFA 3QPXL 4KXZI 1AKJA 3C8KA 1A1MA 2OBGA 3AAZA 2HFFB 4R96B 4OCRL 1NBYB 2D7TL 1A47A 1FFOA 4ZQKB 1P4BL 1QRNA 4KAQL 1IC7H 4I48A 3LRSA 5KBNC 5EBMB 3GKZA 3UZEA 3H42H 4GSDH 1Z2KA 4JQIH 1RUAH 3PNWB 1YA5A 5D6DC 4M7LL 5DGRA 4M5YL 5CEZL 3BH9A 2QADC 5DEZA 1IEBB 4PJGF 2YPKA 3IAQA 5INDB 1JZ8A 1XGPA 1NEZA 2EXYC 2ARJB 4L8BB 2VTFA 1ZT4B 1CN4A 3H9YA 3QUKA 1TJIH 1DEEA 4KROC 4L4VB 1UQSB 1HYRC 4UTAL 4FZEH 5B39A 4M3KB 3LN5B 2UWEB 3QEGL 2J4WH 4HZLA 5F44A 4X6CB 3IJSA 2C1PA 4DGIL 2R0WL 4BFEA 2GK2A 2YKLL 1MHPL 3NBNA 1OM3H 4FQQA 3DECA 4HQQL 5IMOA 3HI1A 3QDJB 2ERJB 3KPPA 4A6YL 5GGTL 1A14H 3E8UL 1T1YB 3F7YB 4JEGB 4Z7OF 1AXSA 5KW9H 5CEZE 5C70A 4WIQA 3P73A 5T3ZD 5IIEB 1AIFB 5EPMB 5C09D 1CFQB 3MLVL 3MGOA 1BWMA 1UWEH 2NW2B 4DK6A 5FGCE 1JRHH 1ZANH 4RA3A 3NFPA 1SY6L 5EZLB 1FAIH 1JTOA 2GKIA 4OCLC 2DLFL 1BZ7B 4CMMA 4NQVA 4N5EC 2OLDA 4MJ6B 4YC2C 3VMPA 1RZKL 4JM2F 3WLBB 2HA1A 4IRSA 2XTLA 1RUKL 4KKNA 5JZ7C 3KLDA 3MRJA 1U8LB 3KHQA 3GB7A 4NZUH 3P3YA 4QRRE 1XZ0A 3UJIL 2FB4H 1P2CB 4MNHA 4P46C 2D9CA 3CVIH 1K6QH 4GKZA 5B4MD 4QRQB 3L5XL 3HZKB 2HJFB 2Q6WB 5KJRH 4ALAL 2BVPB 3VGDA 3BZFA 3IDXH 3VRLF 2R0KL 3OKNA 4OM1L 5LAXB 1NGXB 3H6JA 1MY5A 4NUJA 2R4RL 3SOBL 4OGYL 4NQCB 1B2WH 5EA0H 2XKNA 2XKUA 3GI9L 2NY1D 4JHBA 1RZFL 3ZHDA 4NWUH 1N4XL 3WUWB 4N8CL 2ZUXA 3RZWA 3GHEH 1KCRH 2VLJA 3RY6C 4ZUWA 3OR6A 4HDIB 3UO1H 3TBYA 4MJID 3UYPA 2DBLH 1EMTL 1NBQA 4H8WL 5C08A 1C1EL 5I30H 1INDH 4QXWA 1JPGB 2J6EH 1FVCB 4X7CC 1FYTE 3VXOB 4IMKA 4YEEA 4X99B 4PLOB 5IFHL 5DFWH 2OSLB 5DJ6A 5TF0A 5FO9B 2ARJQ 4HT1H 2J2ZA 4PP2B 5TDPB 4DEPB 1MJ8L 5EN2B 1U9KA 2NXZC 4M48H 4WV1C 1BQHA 4TQEH 5EUOF 2OJEB 1BBJA 4BQ8A 2ATKA 4JFQA 4Y5YA 4Y19E 3KPRB 4YK4C 5CJOH 1E4WL 3OKYA 4XBEL 2QSQA 4CW1B 2R23A 2PKDA 1K4DB 3KPSE 1T03H 1MCSA 3AFLA 5D7IB 2DD8L 4HLZH 4K94L 1RU9L 2ADIA 2QADD 4AG4H 5F9WB 3SO3C 4R4FH 4Y8AA 1LEGB 4QXGL 5C0AB 3G08A 5DRXB 5IFAH 3T0DA 4G42A 4K7FA 3RY5A 5A40E 3P0VH 4KROD 1PJ9A 4NN7B 4QHUA 5I74C 5F9OH 3RL1B 2X4SA 5JW5B 1VEOA 1WIOA 1KLGA 1OT2A 3QQNA 3MREA 3QHZL 4Z7UE 3QIUB 2BDNL 2M2DA 3Q6FB 1VACB 5FUOH 1MREH 4C4KO 5CIPB 5C0FA 4QYOA 1F4YH 2IAMA 1KFAH 4JZNA 4PBVC 1EVUA 4M4PA 3TA3A 3TO2A 5HHNB 5D6CA 1B6UA 1V5JA 4PJHE 5CHNB 1OWRM 4HFUH 2VXVH 2DLHA 4PBXA 3VGAB 5TFSH 4N0FB 4DFIA 2DWDB 5CBAA 1CFTB 1HH6A 3DX7A 4EDWH 4DZ8A 2ORBL 2KBGA 4A6YA 5GGTA 2RIKA 4N9GA 3K8MA 4N5ED 3RHWK 2EDKA 4RGMC 1RHHB 1NBZA 2FD6L 4YZFF 4JHWH 4O58L 4OB5H 3T3MF 3QQ9C 4G6KH 5E94A 2AK4B 3NZ8B 4H0IA 4D9QE 1KCSH 5DRZA 3TIDA 4QRTB 3MXWH 1S78C 3ARGD 1SY6A 3KWWB 5BW7A 3MBXH 3MOAH 4OZGB 3NPSB 3U4AA 5IBLD 4P46D 2DQFA 4LCYA 1AQDB 4M7JL 2X70B 1R5WA 5GJSH 3U30C 3W0WB 5JR1H 1JHKL 2FCBA 2NY5C 1GC1H 4YDKH 1DUZB 5HDBF 4EUPH 3O4OC 5HHMD 1IEBA 4K23H 1ZLUH 3U82B 4XP4H 5FA4A 5D5MF 2AEQH 5HYSG 1AP2A 3O8XD 4HGWB 2OJZH 3O2DH 1ZT4A 1M71B 4Z6AT 3NGBB 4Q6IA 4KRPB 3D39B 3OXSB 4LSPL 1G1CA 2YUZA 3NACL 1A4KB 2CLRB 4NKQB 1QSVA 3MGTB 4G9FD 4X6CA 5DD3H 4UB0H 3P4MB 3OAYH 4NJAH 5FUCC 1AGEA 5ISZA 4YAQA 2ZCHL 4JFFD 3ARXA 5MHSE 2H8PA 5DURB 1FCCA 1JZ4A 2VDLL 1IC5H 4FFYH 5DRWB 4YUEH 4QRUB 2VWEC 2NQCA 4RMVA 4U0RC 5TE4H 3MLUL 3EDKA 1PYWB 3AB0C 4MQXD 4OZIA 4Y2DB 2X09A 4DW2H 2YZ8A 4U1HA 3TVMC 1WTGT 4MWFB 2MQCA 3ETBF 4XPHL 5ILTH 3GMMB 4ZO7A 1LGVA 4HS6A 5EBWA 2RCSL 1AO7A 1NLDL 4P59L 5EZLA 4GXVH 4LCWD 1SVCP 1NCUA 4ZO8A 3KPSA 1EO8H 3Q48A 4S0TD 2V9TA 3LZFL 3OBAA 4DGYH 1T0MB 3IDGB 4N68A 4R8WL 3NFSL 4P2QB 3ULVF 4C4KT 3FONB 4HWZA 1FG9C 4ODVL 3D3VD 3BKMH 5C9JB 3KPQA 1U8LA 5SWQA 3GI8L 5F7WC 4I0PB 3B5GA 4KPHH 4P3WA 1FJ1B 2J88H 2JJVA 4PJDF 4XPAH 3I6GB 4HJJH 4LU5H 3HE7D 4XB8A 2JIXB 1MFBL 1DZBA 3QUXA 1DVFD 4L3AA 1JV5A 1S7QB 1J0JA 3QEHB 1XCTB 4LEXH 3ZDZF 4Z7UA 5ADOL 3PQYD 3PP4H 2BNQE 2FBJL 1X44A 5CEXB 1URLA 2I25N 1FNSH 3RA7H 1U91A 4F2MA 4PY8J 4JDTH 4NQDE 4XRCB 3SDDB 4DGVH 5JPNB 4FQPA 4OGXL 1WWWX 5HGBB 2ICWB 3WO4B 1EHXA 1JWSA 4J1UB 1JF6A 4JFOB 4OCYL 4PJHA 3WS6C 1OTUC 2ESVB 4HDIA 4OLVL 4U3XA 2X4RB 4E41E 5F7KC 2CMRL 5E2VL 1AR2A 3HMWH 1UWXH 4MNQB 1FVCA 2HRLA 3FZUC 1TVDA 3MRFA 2C3GA 3IRZA 3DTXA 2IH1B 2NY6B 1MVFA 3HLAA 4OD2B 4XNQA 2DQUL 4J3SA 5E2TL 4OSUL 2CIKB 3TJEH 3U1SL 2GY5A 4XVSH 1S5IL 2PXYC 1CXEA 5DSCA 3SDXE 2CJUH 4WI3A 5DO2D 5A1AA 4BFBD 4L8DA 2CO7B 3VXTA 1KLUB 5GRUH 3GBMH 5L2KB 4FQIL 1P7QB 1CK0L 2DMBA 3CX2A 3D85D 3P0YH 5IK3B 3ARFC 1I9IH 4F7TB 2MQ3A 1T7WA 4HGMA 5DJYB 1E4KA 2R69H 1S78D 4XTRC 3S3JA 3HFMH 4B0MM 3CUPB 3BQUB 5DMIL 4XP6L 3TPUB 2VXUL 4ELMB 2ZUUA 4XNMA 3TT1H 3KPRA 4TRPH 3EGSA 3I6LE 4P5TA 3FFCE 4ETQA 3STLA 4W68A 1PX3A 3BH8A 2YEZA 1DE4B 4JZJB 1D6VH 1AXTH 3BEWB 1P5UA 1U92A 2VL4A 3RWHB 3DNKA 5D7IA 1FRGL 1WT5C 4GMSH 2VAAB 5CINH 4IJ3C 5JIPA 3ROOA 3TT3L 4HK3J 1CFNA 1X5AA 3U0WL 1X3DA 4JDZA 1JGLH 4LLVB 5D8JH 2YK1L 5SX4I 3JV6B 3GK8H 4P3DA 4W70A 1VDGA 3CGTA 1JZ2A 3EYSH 5TQ2L 4IBLT 4LPUA 1SYVB 3FCTB 1BHGA 4HBCL 5JW5A 2R1WB 4PGZA 5DJZB 3IAGC 4NM8H 3BE1L 3QIBB 4KJYB 2AVGA 3QIUA 4WI8A 3T0BA 5ITFA 3EOAB 1FVEB 3VDAA 3BN3B 1NFDB 3BIKA 3T2NL 1M05B 2OTUA 5DHVH 3DMMA 1PG7W 3OB0H 2A6KB 2H32A 2EEAA 5CIPA 2F5AH 1N0LA 2YD6A 5ALBL 3GSNA 5I1AB 1G0DA 1TETH 4JREB 3SJVB 1IEAB 1QFWH 3G6AA 1BOGA 1H3TA 5I8KL 4UT6L 1IGTB 1OF2A 2B8OT 2I07B 4LCCC 4ONHA 3HC3L 1AQKL 1NAMH 1LO3H 2IQAA 3BGMA 1GYAA 4XB7A 3C5ZB 1Q9WA 1A4JA 5DJ8A 5HHOE 4P2RE 1QYGL 1YEJL 6FABH 5A2FA 4XPFL 1CFTA 1QSEE 3EW3B 4YHYB 4WCYL 3QJHA 3EHBC 3QFJB 4PGCB 4GMTH 1IM3B 4O2FA 4WUUD 4S0SD 1H0DB 1HNFA 3AU1B 4N1EA 5BMFH 3VFVB 2R56L 1AC0A 4Y5XB 3TZVC 3NZ8A 1BMGA 3L3HB 5HDQL 5J11B 1NH6A 3GBNL 4KVNH 5GGRY 3VCLB 3LD8C 4NRXA 1CXIA 3BWUC 4GG6E 3DRQA 4Z7QE 5FUZL 2Y5EA 4F7CA 2W0KA 3QQ4A 1YECL 3RGVB 2BNQA 3E6FB 4J3VA 1T21A 1OAXL 2A83B 4ISVB 1UB5A 2N56A 5EU5B 3M1BB 5JNYA 1G7QB 1MLBA 2X4QB 4FQCH 4NQDA 1DUZA 1XF4A 3RDTC 3WFHB 1IGCL 4X9FA 4R90H 3ZE0F 2XZQH 1BQSA 3L3GA 5H2BA 4HH9B 4CDGC 3BEVA 4M62L 2A73B 1YQ2A 5DJ2B 4PV8A 4E41A 3CSBA 2F15A 3QXDA 5GZOD 5I8CA 4PJFB 5GS2D 4MYWB 2YPLD 4EI5B 4NKDA 3LKPB 5D7LB 1CL7L 3OAYK 1RUQL 2XACC 1ES0A 5KANG 4JKPH 2IPKB 4ZFZB 1V3KA 2GIYA 5I1LA 1A4KA 2B2XH 1NMCC 3D18A 4LHQB 4XHJD 1SM3L 4JY5H 3O2VL 3G6JE 4ZOBA 1Q9KB 4IMLA 1FGNH 3FZUD 4ZO9A 2WIMA 3PGCB 5GHWL 3TV3L 4OT1H 1IARB 1VESA 2HFTA 3B9KB 3D2UD 5BO1L 2ZJSL 1NLBH 3SDXA 4K7PH 3PWVA 3BT2H 1D5MA 1R3KB 1PLGL 4OD3H 1N64L 4N0UB 1TNMA 4FHBD 2C4FT 3DXAD 3MLTB 1V7NL 3BW9B 4Y2DA 5B8CA 1A6AB 4WWKC 2YXMA 4PG2C 4GBXA 1BGXL 1EZVY 3GMMA 3M45A 5IM7B 1MH5B 2BOBB 3ARFD 3FFCA 5HI3C 3HKFA 4LDLB 4LQ1A 2JB5H 5K93A 5E1HB 4HFWB 2ZG3A 3DWTA 3GUTA 4KZEH 2F54D 1T0MA 4DVRL 1IC7L 5C0JA 4Y4HA 4AMKH 4OZHB 3S34H 4XMLH 2J7LA 3ZKXC 2BCKA 3H42L 4GSDL 4MLIA 4JQIL 5MEND 4OI8A 3OJMB 3WNPA 5CLTA 2AEPH 1B4RA 2YBRB 3AROA 3GMLA 4M8QA 4RAHA 1OGTB 5DLMH 1S7QA 1CICA 1TJIL 4R2GC 3H9SE 5AYUL 1KN2H 4O00A 1N3NB 4FZEL 2J4WL 4YHIA 3OAUH 2FIRT 3G5ZB 1G7LA 3EO0A 4U0QB 1I8MA 3K46A 3QFDA 3BPLC 2AQ2A 1MUJA 2YR3A 5HHVH 1F90H 1OM3L 2D31B 3K8LA 3MNVB 5GISH 4XCNA 1DQLH 2GT9B 3WYRA 1OD9A 1XIWA 3TGXA 2NX5A 4MVBC 4HUKB 1A14L 1LEKA 2GFBA 5FECB 5KW9L 5HHOA 4P2RA 3VFSA 1WAAF 4LLAA 3PWUB 3FAWA 3OKDB 2Q3AA 1S7XB 2YC1A 1J87A 4DUVA 1QSEA 4Y8DC 1UWEL 5I1CH 3HCVB 1XGRA 4XPBL 1JRHL 1ZANL 4WW2F 1PFCA 1GIGH 1FAIL 1RZ8A 5SWZE 3KPNB 4HXAH 3H0TB 2AJUL 5BVJB 3VWJB 5C8JA 1NDGB 5D70H 5KVGH 3SGJC 2H26B 4GG6A 2C3VA 5JOFA 3SE8L 3TZVD 5F1KC 4X7SH 1P7QA 5KG9B 5HGGS 5IK3A 4X8JB 2WBJC 5IBUB 4R9HA 5L0QC 2B5IB 2AV7A 3PGDB 3CUPA 4Y0GA 4LLDB 3BQUA 5F88B 5KSAC 3HUJF 3D25B 3LPWA 3L3JA 1RV6X 2FB4L 2Z8RA 3WEXB 1F4HA 3CSYB 3CVIL 3LPFA 1ND0A 1DQTA 1X5ZA 3RUGF 1NCTA 4YWGL 2NY5H 2Y06H 2YWYA 1XF5A 5KJRL 4F33B 3NCJL 4L4TB 5I1HH 4C83B 3RDTD 1T22A 3J7HA 3FL7A 2HKFH 3K2UH 4PJGB 3F65A 4JKMA 4LHUG 4UOW0 1B2WL 5EZOH 5F7LB 1ZHKB 1OGAB 2ZKHH 4NWUL 1BVLA 2EC9T 3G6JA 4ENEC 3RTQB 2WBWB 1MSPA 5FHBH 1KCRL 5IJVB 4BZ1H 3EJYC 4JFDD 2HWZH 5FYKD 3UO1L 2DBLL 1Z6JT 1G7PA 1WBZA 1KJ2B 3OB0K 3TBTA 5I30L 4O4YH 5DFTA 5IB1B 3BD3A 1Z0MA 4GXUM 1INDL 4WFEE 1FVEA 2J6EL 1WIPA 3GRWH 3BISA 1S9VB 2AV1B 2G60H 2DKUA 4NPYB 4QRPE 4GAFB 4UI2A 3QNXB 2R4SH 3VXSD 4XNYH 5I6XB 4HT1L 4UV4H 3PHOA