3V18A

Structure of the phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
304
structure length
304
Chain Sequence
b'DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
molecule tags Lyase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
total genus 113
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v18A00
2ZKMX 4Q6XA 1DJHA 5T9BG 1DJIA 2O55A 1VD6A 1PTDA 2PTDA 2FJUB 2PLCA 4I8YA 4QJ5B 4F2TA 4I9MA 6PTDA 1QASA 1ZCCA 1PTGA 1DJYA 3KS6A 3V16A 3QVQA 7PTDA 4I90A 1DJZA 3NO3A 1DJGA 1AODA 4RW5A 3EA2A 5T9CE 3PTDA 4S3GA 2ISDA 2F9RA 1DJWA 2OOGA 2OR2A 5PTDA 1DJXA 3RLHA 4QJ4B 3RLGA 3H4XA 3H4WA 4PTDA 3L12A 4I9TA 4QJ3B 3V18A 1O1ZA 2P76A 1XX1A 1GYMA 1QATA 4I9JA 4R7OA 3MZ2A 3V1HA 3EA1A 4GNKB 4F2BA 1V8EA 2PZ0A 3I10A 4F2UA 1YDYA 3QR1A 3EA3A 3CH0A 1T6MA 4OECA 4RW3A 1T8QA 3KS5A 3OHMB 4RV3A 3QR0A 2OTDA 5T91A
chains in the Genus database with same CATH superfamily
4MYXA 4EK7A 1EUAA 2FJUB 4HHHA 4ORMA 1WXJA 2E28A 3G6LA 5U7SA 1UR0A 3E2RA 3M16A 4LSBA 2H3DA 3E0VA 4PUJA 3VD7A 1JF6A 4RPPA 5A8OA 2V81A 2R1KA 4AD3A 5C2CA 1DKWA 2CESA 2PBOA 4B4FA 1A5KC 1TPEA 3GXPA 1OFBA 4I8YA 4K38A 1DXEA 2XJ7A 4QSFA 3UA4A 2OQYA 4DELA 3R7MA 4C6QA 3WIJA 2VFHA 3AMCA 1ZNNA 2E5DA 3W82A 4LF1A 3B8DA 2QGYA 4JTRA 4XAPA 2VC6A 4CNUA 3MB9A 2DU2A 4UNIA 2WC3A 4S3AA 5A6LA 4CEUC 4ML9A 1NH6A 4DVOA 3WBWA 4LBRA 2G4FA 2FVKA 1MXGA 5A69A 4DN1A 4W7UA 1UP2A 2J27A 1A5BA 1HZYA 1NJJA 2VCBA 2PGEA 1TX0A 3U4FA 1P6WA 1RLDA 2QLYA 4CVWA 2FZMA 3AIUA 2I1OA 2W63A 5BRBA 2WZHA 1S5TA 3UJFA 4O54A 3UPWA 3BLLA 3RO6A 1UR9A 1A0CA 2WQDA 4HPHA 3WQ4A 1TIMA 1XISA 3IGXA 1FCQA 1J4EA 1PIIA 2CLIA 5REQA 3WDQA 2GJXA 4GIEA 4PE8A 3UXIA 3W25A 2ZXBA 1WCGA 3TXZA 3E38A 3MI2A 3LZ3A 5C7VA 2QCDB 4Q7BA 4WK9A 4IG2B 1F07A 1XLBA 1WB0A 3EWYA 3O9NA 1W5QA 4FALA 2YDAA 2J7DA 4H9YA 3MMDA 1PBGA 4O0ZA 4H6EA 2WVVA 3GR8A 4YWSA 2BNJA 1VYSX 3BAWA 3H7RA 3VDAA 5TNVA 3U2ZA 1A0EA 2GDQA 4C1KA 1KGXA 1DEDA 1F6YA 3SQSA 4QITA 1V3KA 5H8PA 4QFUA 2ZRYA 1YNYA 3HN3A 2OSXA 4DY1A 4HYVA 1M65A 4NAFA 1V77A 1Q7ZA 1G1YA 3TJIA 2HROA 5E6YA 3F5JA 4US5D 4GQBA 3I3BA 4IX2A 4I9JA 1R3VA 2TAAA 4ZE5A 4G8TA 3EX6A 3RX4A 2YBTA 2W66A 1EDTA 4EXBA 1I1XA 2P53A 3TX9A 5CPTA 3IRDA 4F0RA 1IZCA 1QNPA 3QHMA 1UH3A 1VRDA 2I16A 2QCFA 2HXUA 4UTKA 2BG5A 3TEVA 5A6BD 1GOIA 1SPQA 4N9EA 4A3YA 3W01A 1DQWA 1JZ6A 3OBKA 1BKHA 1ICSA 4WOZA 4Q4PA 3MKVA 2ZZ1A 1ZAIA 3STEA 4EPEC 5ABTA 1FDJA 3EOOA 4F3HA 2VGBA 5A6JA 2YDSA 1TKKA 4J7RA 4JQ2A 2CZVA 2WNWA 3MSYA 3PNUA 3ELFA 3MDUA 2BDQA 1E1CB 1PCKA 3AWOA 3O6DA 1OX4B 4UB9A 1JDCA 1R2TA 3VKDA 3ARYA 4YS1A 3XISA 4IPIA 4TTGA 1P48A 3FA4A 4POCA 3ZLFA 3GHRA 2HPMA 3MHUA 4KRUA 1EBGA 4OQVA 1FH8A 3DECA 4JHOA 1E9YB 2P10A 2QKFA 4O11A 2PWHA 3QC3A 1HN1A 3DGRA 1JPKA 3P2VA 4DXKA 5LHEA 3A5FA 1UA7A 2G95A 3Q4DA 3WMBA 4PH6A 1V6YA 2NVDA 4ILSA 1NSJA 1EGZA 4ASTA 1YIXA 5FJIA 1NAL1 1P7TB 4XTIA 4O28A 2YCLB 4BWLA 3P62A 1N7KA 3DG7A 3AIEA 1EWEA 1KQZA 3PWIA 3U0HA 2QVHA 1S1RA 5CSRA 3MQTA 4O4VA 1OFAA 5AYIA 3L0NA 4AH7A 2F38A 1NU5A 3CK5A 2RJHA 1A3WA 3EX3A 3SSZA 4R53A 1RSCA 4LU0A 1JUBA 1KBKA 1TE6A 2QPXA 4GZJA 1UZHA 3L0KA 4XK2A 1H0GA 4HP5A 3WK0A 2P1FA 4LC8A 1FQ0A 4WY0B 2ACUA 4EOUA 1ZUAX 3QV6A 3NQFA 3S5OA 4H83A 3VUPA 5M2FX 3CPGA 1T99A 1XDMA 2A3HA 4K36A 4LUIA 1XLEA 1VH7A 4HZ7A 2IQTA 3E5BA 2ASHA 3LD5A 4LY8A 5BXPA 2HK1A 3IAQA 2ZX5A 4PUMA 4HPJA 1Q6EA 4Y96A 2YL6A 5ABFB 4IPLA 3RO8A 2VOTA 4V33A 1JUEA 1QNQA 4LGXA 5DQPA 2DQWA 4HNTA 1DQUA 2HS8A 1K9DA 1XLMA 1JYWA 2VZOA 1WE5A 5CKSA 2J7HA 5D09A 3PHAA 3CS2A 3I7RA 1GG0A 4UCGA 4MFDA 4MF4A 3KOZA 3GNXA 3JVAA 5DT7A 1FWAC 1XRFA 3I6TA 3O05A 3NOEA 1AH4A 2DSWA 1AW1A 3FIGA 2CXGA 1QPOA 3C6CA 1UBSA 3QGKC 1CGUA 4H6QA 4YHEA 4NRRA 1JFHA 4GQGA 4GUFA 3WQCA 3BGJA 2OQLA 1VKFA 4ZO6A 3ID7A 2VT0A 1UWQA 1F3TA 3SRDA 5AB3A 2PU1A 5A6KA 4JTUA 1B3WA 1EIXA 3OYZA 3EXSA 3LPGA 4M0XA 1UH4A 3GK0A 4ZEPA 1B9ZA 3MA8A 4KCWA 1MNSA 2ISDA 1LROA 1AH3A 4Q32A 3QW3A 5HNNA 2XFWA 2YFNA 3QV7A 4LV4A 2IPGA 2V67A 2HNHA 5FF4A 1TTIA 4QS5A 1GCYA 3REQA 1QU4A 4I8DA 4AISA 1EFZA 4U10A 2VC5A 1SM9A 1NELA 4NNCA 4MVAA 2F2KA 3LENA 1UKTA 2EAWA 3QOKA 4PGLA 4MJMA 4GXMA 1UR1A 2R1NA 3L4ZA 3W37A 2H90A 5D9MA 4E4FA 3GHUA 1SW7A 1BXBA 2O7SA 2MUCA 1LQ2A 2UWFA 4H41A 3T42A 4LF2A 3OBEA 3FKKA 3WMCA 5CC6A 5TBOA 1L0PA 3CMFA 3FDGA 1SYTA 3P82A 3UFYA 3C56A 2J9YA 1MRAA 4NXKA 1JF5A 1OZMA 2HV5A 2WMIA 3CC1A 4NZFA 2E67A 3LCLA 1H49A 1LWIA 2Y88A 1V3IA 5CBJA 4RPQA 1T5AA 2OX4A 2DV0A 3W9ZA 4JQ3A 2C1IA 3GE7A 1V6TA 1TG7A 1YPIA 4GWEA 4UQCA 4B3ZA 3EDKA 1P6BA 2PD9A 3W7CA 1FWBC 1EEXA 5D4YA 3TNOA 4FP1A 3FKRA 1H1NA 5D37A 2J75A 3SFWA 2JKAA 3FJ6A 3G22A 3MW7A 1ZJAA 4AIEA 3QLLA 1FDZA 3VM7A 3TE9A 1EXPA 3A3HA 4GVFA 4QDPA 3EMCA 4MWAD 2GGJA 3QEZA 3V18A 3HQ1A 3T44A 4GYPA 2W4XA 2J88A 1VGAA 4JHZA 4D6CA 3W26A 4DNHA 3UCQA 3VKCA 2VEFA 5XIMA 1A5LC 3PBMA 3F03K 4NNAA 4XUGA 4GINA 3THQA 4DXVA 1XICA 3C2EA 5ABGA 2PP3A 1J01A 3PPFA 3EDJA 2FKPA 2XWDA 1UB3A 1F7BA 4XWUA 2XSAA 3IJ8A 3KL5A 2ZA3A 3WK2A 4L5ZA 5FJRA 2VQUA 1R5YA 4M56A 1R47A 5CSUA 3F4CA 4EF8A 1KFCA 4UMBA 2GVLA 3B9DA 1UH2A 2J62A 3IUIA 3L2IA 1GUVA 1KCZA 4F2TA 1PL9A 1V0MA 4H2CA 4QHRA 1E4NA 3M0YA 1JZ4A 4ZQMA 3ITOA 4GQRA 1THFD 4P2VA 1AW2A 3CL6A 2NV2A 2PZ0A 4Z1BA 1HKJA 1QXLA 2OSYA 3UWUA 4NT0A 1XYLA 1MSSA 3RMEA 4R85A 1YXYA 2ZVRA 4L4MA 1LG2A 1V3MA 2QCEA 4N6EA 3C2VA 1CENA 1J2WA 4RCXA 1NDVA 3CNYA 4JY9A 1EPVA 4RE2A 1E71M 5HPCA 4CKQA 2F84A 4EPBC 4R9OA 1HKVA 5E0CA 1T6MA 3KWXA 1J0YA 3BCDA 3AMKA 5JQ9A 1GVQA 4Z1AA 4ORIA 2XIJA 2X7VA 2D23A 1Q2SA 4IUOA 3SEPA 1TQJA 3AIBA 3OW1A 1B3XA 4LW7A 3V36A 3VIJA 4W7VA 2GJXB 1YTDA 3ABQA 2I9UA 2HBVA 4JIHA 2DT1A 1YPFA 3NZGA 1BXCA 1S5VA 2C7FA 1PX8A 4L56A 1W1TA 3F7JA 1X38A 3VKKA 3SUVA 3WNOA 2VWTA 4BF9A 2GVJA 1US0A 5B7ZA 4DO7A 5C70A 2F6XA 3WDRA 3DFHA 3LRMA 3PM6A 2TODA 2O56A 4E0CA 2QQ6A 3LX9A 1W1A1 5TQLA 2FZDA 3O6YX 3QKZA 3NZRA 5LIUX 4I5XA 1FWTA 4QG6A 1KB3A 4IMCA 4UOJA 1EJVC 2VFIA 2VFDA 4ZB2A 1XSKA 1YBQA 4RL3A 4O1FA 3TAOA 4UR8A 2JBMA 3ZFHA 3MSGA 5H91A 1OGGA 1PIFA 4BEQA 3N12A 4BQ2A 3B9NA 3HM7A 4DLFA 1KFJA 1TFVA 4DWSB 3QHOA 3R8HA 3ARTA 4UC5A 2ESCA 4C6EA 3VILA 2EPLX 1Q2RA 3C0QA 4C6KA 2P3ZA 4CN4A 2EJAA 2J7BA 2B0MA 1Z42A 1XG3A 2F6KA 1AQ0A 1Y0EA 1ZJBA 2OR2A 4HK5A 1K9FA 3VNZA 2QS8A 2B7NA 2BX7A 2D20A 5D2VA 4CLMA 4RV3A 3QN3A 1WP6A 3GXIA 3LV5A 3EOUA 4J3SA 1CLVA 1OCNA 2F9RA 3AYVA 2G41A 1R87A 2AAMA 4LYKA 1J96A 3TC7A 4XBJA 5HINA 2BVYA 1NQKA 1N55A 1YXCA 1QBAA 4WOQA 1VLIA 3Q45A 2IXUA 3E12A 1LLZA 4JL1A 1ITXA 2OT0A 4WKHA 4LYQA 2EHHA 1B54A 2OG9A 2A2IA 4GUHA 1H5YA 1E4IA 3NWRA 4PBFA 1N8WA 2YA0A 5DBTA 3V5CA 1MZRA 1U33A 4HHMA 3GFZA 3T07A 1VAHA 3LXCA 1HKKA 3W6MA 4G5DA 2O4MA 1WZLA 1Q6FA 3E2SA 3ZVHA 6XIMA 2ZDRA 1RXOB 1MRQA 3QQWA 1E9IA 1GOQA 3E49A 3VINA 5I3JA 2RDUA 3NZPA 2F7FA 1AD1A 3QTGA 3CUGA 4O53A 1MW1A 1FP8A 2D69A 4M7SA 1SW0A 1VFMA 5F2MA 4GUJA 1UD3A 3I65A 1SUXA 5H6HA 3AZRA 1RHCA 2AKZA 4GISA 9XIMA 1X7IA 4L9YA 3VYLA 1TR1A 3F2BA 3QPZA 1IV8A 4CD6A 3ATZA 1W5PA 4DJDD 1E0UA 3KZPA 4JIIX 3CIXA 2BY2A 4V28A 3DG6A 3W2MA 5DMNA 5BNKA 2V5DA 4QS6A 3WEOA 1KR1A 3MUY1 4XBKA 2QJHA 3NZQA 4F0LA 1UQYA 1NTHA 4GYKA 1O60A 4PULA 4ZO7A 4BI6A 1QWKA 4KFNA 5EMJA 3F4NA 3DZ1A 4IQLA 2VCAA 3EEGA 2V2HA 1XI3A 1EP3A 2WMJA 1MFUA 2NQ5A 2XM1A 4E6MA 4R34A 1JPDX 1QHOA 3B06A 4A3UA 3BZJA 1XLIA 3IK2A 2FZBA 3S9IA 4JX6A 3GIPA 2FMNA 4TTUA 1CW2A 1QCWA 1K4HA 4IFKA 3W3OA 3O06A 4H9UA 1MMFA 1TTJA 2OLSA 5FCZA 5KTLA 3CV1A 1HNYA 4RKAA 3UG4A 1DJXA 3VFCA 3A3XA 3A22A 4DAFA 3UWVA 4IPJA 1W3KA 5FAGA 4HJFA 4DJDC 4J28A 4FLQA 4Q6JA 1FUYA 1JCXA 3ZOAA 4HHPA 5DX7A 4KPLA 3DX5A 2Y8VA 3L4TA 3OGSA 3RK8A 1VEPA 3LCIA 3O7UA 4UZSA 3NSNA 2I9EA 2FGZA 2ZZ6A 5FL1A 1KKRA 1F05A 4QTGA 4IJRA 3IJIA 1CGYA 1I2RA 3WQDA 4RE0A 3I7QA 4ZOAA 4HCHA 3TQVA 1QPQA 3EOLA 5E93A 1F6KA 3SUUA 4L64A 4NQ1A 8RUCA 2F6UA 1Z41A 4H4IA 2SFPA 2YOCA 3BW2A 3IGUA 2X1RA 3URBA 1LM1A 3O0KA 2C18A 4J2MA 4GCAA 4C1NA 3CAQA 3VCNA 4JCLA 4Z42C 1TPFA 2V3FA 2W3ZA 1ZSXA 3PUOA 3M41A 1MUWA 3IIVA 4DF0A 1XLAA 2FPVA 1E0WA 1ICPA 3EWXA 3AXXA 1XYFA 3G1VA 1FWHC 4YTUA 2PBGA 3BJTA 1GVSA 4IXHA 4PMRA 4AZCB 1UR8A 3DIPA 4N4PA 3BJSA 1UOKA 1XIHA 2HVMA 5CGMA 4KF1A 4F0SA 1Q6RA 3KCLA 1CT5A 5MHBA 4Y6GA 1GVRA 2VEIA 2D2HA 5C9UA 4WR3A 2HEJA 3H2AA 1EOKA 3CUFA 1DJQA 5HMDA 1EYWA 2V3EA 4ZA0A 1EA0A 2E40A 4DF1A 1EZ2A 2OO0A 1UIPA 2AMXA 3EWDA 2E68A 3EDEA 4F79A 1P0DA 3W07A 2Y7EA 1ESWA 4XD6A 5KZDA 3W75A 2YYUA 4Y2WA 4YN5A 4W9TA 4NRSA 3BSHA 2VZTA 3B3DA 2WMKA 4N02A 3S9ZA 3RFAA 1RVKA 4UFHA 3G0XA 4B5TA 2DY3A 5REQB 4HOXA 1EPXA 4GVGA 4XO7A 1C93A 4RUBA 3MANA 3NURA 3HPXA 4CD5A 3OZMA 3S1VA 1B3ZA 1XH0A 1CI1A 1LBLA 2CBVA 4NAEB 2HCVA 1R9XA 3KBJA 4JCMA 3B8UA 3H7UA 5F4SA 3LCXA 3ITVA 5AC4A 5LNRA 2X09A 1TMLA 1QO2A 3SCQA 3TDFA 2XN1A 4FNUA 3TYBA 3G3MA 2EG8A 2YFOA 2Y5EA 4XO6A 4RZBA 4H7CA 3GNNA 2PDXA 3CUHA 4GVIA 4RZ6A 3MMWA 1XXXA 4GVHA 2W0UA 4AIBA 4A8NA 1EX5A 2VENA 4WF7A 3CIVA 3R6IA 2WMHA 3ZJ6A 5LNVA 3B0UX 4EANA 1X8FA 5GJMA 4GA8A 3P8JA 4FMVA 4GIYA 2IPFA 3NVDA 1RVGA 1Q65A 4WVXA 3S6OA 3BUVA 3T05A 3SJNA 5BW6A 5D9NA 1XFCA 2B31A 3N6QA 3OGVA 3QW4B 1JRBA 1F3EA 5CCZA 3GXMA 1GTEA 1YPXA 1IIGA 2GDVA 3NM3A 1XBYA 3I4KA 2PLCA 3V75A 2GUBA 1MNZA 4ZL1A 1TJRA 4H19A 4BQ4A 4J2PA 1NOUA 3EAUA 3PZTA 4C6PA 1O1ZA 2XSBA 3GZAA 4HNNA 1W1ZA 3DI1A 3N29A 1ZU8A 3WNLA 1ZS2A 2IKJA 1F76A 3D47A 2HVNA 1R7OA 4REQB 2QUUA 1E6PA 3N19B 2EQDA 3LLXA 3RLVA 4MNMA 3CBWA 4KIRA 4K3ZA 3DHDA 4ZO9A 3BSGA 1EJXC 3SCTA 1G67A 1YADA 3T6CA 4NASA 4FHAA 2HVOA 4DPPA 2FPYA 4EWJA 3PPHA 5K4ZA 2E1WA 5CXPA 4PSPA 3EKLA 1M6JA 4IIDA 4OOUA 3PY2A 4LUTA 3WUBA 2IQ0A 3MCOA 3W87A 2J4GA 4G2DA 5AHIA 5FIPA 3DG3A 4DIAA 2C13A 3EA3A 4LY4A 1XIEA 1OD8A 3WNKA 4MAZA 4HPXA 4WSKA 3WUEA 1BRLA 1ML1A 4PSRA 3ARPA 3F4VA 1JNDA 2H9AB 3TLLA 3RCYA 5BU6A 2BXYA 4LEFA 4A3RA 1UC4A 1UWSA 4U33A 2YZ5A 4AYGA 3OODA 3KDOA 1OBAA 4A21A 5DELA 3UXLA 4AZ5A 4UTTC 3Q2DA 3CUJA 1SZNA 3NG3A 2V5LA 1OGBA 1CXHA 4FNPA 4QAIA 2VC9A 4C7FA 4J3TA 2G3MA 4PL2A 2NUXA 3M44A 2VX4A 3I10A 1VYRA 1W54A 5HJLA 3BO9A 3QMSA 1JG9A 2GJLA 1R38A 2JEQA 4PMXA 5CG7A 4YYCA 1EQCA 5FF7A 2DZXA 2PDFA 4KETA 1FWRA 3S1WA 3FK4A 1WBJA 1ME9A 3P67A 4RDWA 4L1GA 4N4QA 3URAA 3N13A 1ZBVA 3P80A 1MUCA 4YVVA 3CHDA 4IMDA 1VYPX 4JKMA 3SO7A 3GFXA 1ZJHA 3MP4A 5IDIA 3W7IA 2ZUUA 3BTNA 3AHTA 3L23A 4IP4A 2ZVIA 4FNRA 4M29A 1KXVA 3HG3A 4UTMA 3OHIA 3LN3A 3AXHA 2YXOA 3W7MA 1WKEA 3S2LA 1Z89A 1AQHA 1J10A 3S5SA 3NQEA 4QISA 4R3UA 1BVWA 2WKGA 1DJGA 3ZMRA 5HR7A 3E0WA 5F1VA 3WH7A 4AHQA 3F4WA 2XGBA 4ADSA 1QATA 4FA3A 1J12A 4JDBA 1KWKA 4Q8QA 3HFYA 4PTXA 5L9FA 1LOLA 5IBXC 3V5OA 1C8YA 3UETA 1TPH1 4M24A 3EBVA 1AUSL 3K5XA 1F2JA 4FIRA 1R8LA 3K4AA 3CB3A 4HBKA 2UY5A 4UFMA 3G3DA 3T0CA 2HRWA 2VFEA 3KLKA 2ZX9A 4GUGA 3M64A 2Y61A 4FZIA 3KS6A 1SSGA 2BWGA 3BAKA 4A6GA 3ARVA 3UU0A 1A50A 4ECLA 1GONA 4PEKA 3JS3A 4PYSA 3BPWA 2DSUA 4YL2A 4XKYA 3VMPA 3S1XA 1AQMA 4J1OA 2FFCA 3SCVA 1JFXA 1KBIA 2PDCA 3UWZA 3FCPA 4YMZA 4AC7C 1YRRA 5CSSA 3WLTA 1QNSA 3GZ3A 4B5SA 1M04A 3VKBA 1SO4A 3RYSA 5MKGB 3NO1A 5DBUA 4QEHA 2QCCA 2GSEA 4LC6A 4DBEA 2NQ9A 1BG4A 2AGTA 2DUZA 4JTGA 2FVMA 5CGQA 2W9MA 3GBDA 3RPMA 4OE7A 2WBKA 4CQ8A 2O9PA 4DRSA 4NF7A 2OO6A 1FH7A 2BVWA 3KWSA 1SSDA 4LX4A 3MO7A 1GVOA 4ACYA 5A2BA 3U57A 3WMLA 4GYPC 1H5VA 1WDDA 5D8ZA 3IANA 2WBGA 3QXBA 2C79A 2ZADA 1H51A 4PMUA 3U4AA 3RG6A 3KRBA 1HO1A 3T9PA 5ABEA 4QEEA 5DFAA 1E51A 3GNDA 2QCNA 5HA7A 1UWAA 2ZRWA 3LHZA 2Z27A 2CZFA 1B1YA 3E5PA 1S5MA 4YIWA 2ISSA 2BSLA 4NNBA 3GVWA 3HPFA 4AMAA 4X60A 1PV8A 4M3PA 2AKMA 4YYFA 2WW5A 2D0GA 1TTPA 4MKSA 5BZAA 3LQGA 1H11A 5RUBA 4D6FA 1EJWC 1ZZMA 1K1DA 3KTCA 4RZ4A 4Y90A 4MZ8A 1KTBA 4BQ3A 1ENUA 2WLZA 4F0MA 4F66A 5CPQA 3WH6A 5CG0A 1X6UA 1KGUA 5G5IA 2H9AA 2X40A 1ONXA 2A5HA 4DJFC 3LUTA 1W8GA 3U6WA 2FIQA 3DESA 3MVTA 5AC5A 3GNOA 3CV2A 4A22A 2B81A 4NXSA 2AL2A 3W1PA 3WLKX 5LXEA 4Q8NA 1JZ7A 1K02A 1J9YA 4PZVA 1BYCA 1KM4A 1B3VA 3U2CA 1I2NA 1KR0A 1XDJA 1E70M 1OC6A 1PTAA 2NZLA 3S9YA 4ICNA 3LCGA 2XSXA 3VDCA 3WLOA 2FDSA 5BXRA 3PG8A 2GZXA 4JIPA 4DAIA 4Z17A 4PCPA 3TTQA 3WBXA 1Y8BA 3WEMA 1S46A 3VIHA 1ME7A 4GYFA 2YA2A 2CLPA 3HGSA 5E1QA 1O12A 2AOSA 1JZ2A 3SAZA 2UBPC 3DCPA 4Q4OA 2REQA 4L9ZA 3N2BA 4AWUA 3FEMA 2Z7KA 1F4HA 4NSBA 2XUCA 4OGZA 3C2FA 4HU8A 4CNOA 1E6SM 1M03A 1SFSA 4PL1A 5JIWA 2VOMA 4BEUA 1ZFJA 3CWNA 2QF7A 3SY1A 4QJ4B 4H9VA 3WFAA 1FHUA 1IEWA 4GIRA 4O10A 3WLPA 3E96A 1GJUA 4LCSA 3QZEA 1TB3A 3FVDA 1SMAA 1GVFA 3FYYA 5I2UA 4O16A 5D38A 3V3WA 1V7AA 3GKAA 5EA9A 3LPOA 1XW8A 1S5NA 1XRSA 3S5ZA 1D8CA 2FHCA 2JIEA 3R0KA 4F9DA 1OYAA 4JFSA 1UIOA 3LPFA 1W3LA 3N25A 4WLCA 2LLEA 4AG0A 2VX5A 2A0NA 2FTPA 4FPSA 1N2VA 3FV9A 3GG0A 2PF0A 2XN2A 3WQ6A 3R8RA 3ABZA 2GYIA 4J5NA 1ISZA 3SN1A 1POJA 5EMMA 3LQLA 3NIYA 2J25A 1OY0A 3S5YA 4IWWA 3C0LA 2PTZA 4MJ2A 3WH5A 4AD5A 2XFYA 1U5JA 4C6FA 2VD8A 1HJQA 4QCEA 4ZQRA 4JGDA 3UWYA 4OV4A 2I17A 2Y7DA 3PPCA 3LMZA 3GVVA 3GTIA 3AIQA 2V5JA 2WLYA 2AQWA 2G4JA 1C7SA 1VEOA 3HQOA 5KZ6A 2A85A 5I3FA 3AMLA 1F9CA 2OWCA 3W4RA 1VFSA 3UYCA 1VENA 2WJDA 1VRXA 3VDBA 1R3QA 3BLDA 3H12A 1TJPA 1XPYA 2VC7A 3FGCB 3PTMA 3O63A 3WBEA 4GOAA 5LNUA 3IJDA 1XSJA 3SCUA 4LAOA 2V8ZA 4OIFA 3NL5A 4AWTA 4LAMA 3NL3A 4IIEA 1HKMA 6ENLA 1E43A 4ZSTA 3GAKA 4MLJA 1T7LA 4PTNA 3RAOA 4C7GA 1A3XA 2CKSA 3N34A 1ZCCA 2WVTA 4BZYA 4D6IA 4P8VA 3AYSA 1Z69A 1U22A 2PI6A 4GGBA 5CPLA 3LTPA 3N4FA 4UUIA 2BB0A 1B3OA 4M1RA 3KEHA 3LLFA 3CZJA 4P7NA 1K6WA 1QK2A 1XYAA 2OX1A 3BURA 1ZALA 1Q4WA 1QASA 2A6LA 4W8BA 1A5OC 2WHJA 2FQIA 1L6YA 3VD9A 3L0GA 5FEZA 2I5IA 1XLHA 2RUSA 5HMEA 3RR4A 1CECA 1TQXA 2CHOA 3R0DA 2DZAA 2PUZA 1S2WA 1E40A 4ZVJA 2FGBA 3HOJA 1JDAA 3WD4A 4YTRA 3BG9A 2ODOA 1XYMA 3AMDA 2HQAA 1L8PA 4W7WA 3OO2A 1XDLA 1BF2A 2OKOA 8TIMA 4XSMA 5SWUA 3GLCA 1T8XA 1GNXA 1K77A 1KCLA 2DZBA 3B04A 4CNPA 2GOUA 1TV8A 2BASA 2PS2A 1W17A 2D3LA 1H09A 2D1ZA 2H6RA 3L9CA 3S46A 2QJNA 3UZYA 2I14A 5LA1A 4O50A 3NO5A 2PLMA 1QBBA 3ME3A 4IM4A 1FWGC 4LS2A 3UJRA 3N73A 1UASA 1NP2A 4LB3A 4UTJA 3NXLA 1UZ1A 5AKQA 2VX7A 3UJSA 2P0OA 5DMYA 1CGWA 3PJUA 1FWCC 1OYCA 4Y9MA 2XH4A 3FSUA 4O1AA 4IL2A 3LU2A 1Q6CA 1PE1A 3GM8A 4O15A 4U2YA 5HWNA 1E4LA 4IX0A 2WSQA 2C19A 1PYFA 1IIHA 3OLDA 4UTWC 2XGIA 1MQRA 3RX2A 1SW3A 4MWAA 1YXDA 2ZTKA 1SMDA 1FHLA 4IH3A 4PBEA 1TRIA 3QGVA 3CTLA 4NIRA 4E4PA 2UY3A 4UIOA 5LHFA 1RLCL 1SFTA 3C86A 1L6SA 4Q4QA 3PWGA 1XL9A 1N8FA 5HNTA 3E0IA 3HPAA 1FWNA 2ATMA 5E9AA 1BD0A 3SCWA 5EFFA 3NSMA 2VFGA 2IPWA 4KQNA 1G94A 1N82A 5JU6A 3CV7A 1EJUC 2BGNE 3OZPA 3T08A 1W5NA 3N6JA 1XCFA 4W5ZA 2BY3A 5A2CA 1JQVA 1RA0A 1ELSA 2PMQA 3OQEA 4ES4A 3AHVA 1XC4A 4LANA 4AX6A 2DSKA 3B8WA 2C1GA 2ZX8A 1Z6KA 4TX9A 1BWVA 2ZDSA 2OZ3A 1UD8A 1X7FA 5LYRA 2V6AA 4HCDA 1WXYA 2GGGA 2HXTA 1TWZA 3G1XA 5A2AA 5TAOA 3WLJA 4HMNA 5EL1A 5F2GA 3RHGA 3KS5A 5EFDA 1W9BM 5BOEA 4E2DA 4WJXA 1G7VA 3UQNA 4HJWA 2ZRUA 2HBXA 1GOKA 4UTLA 4C5ZA 4UQ9A 1LOQA 2E6YA 2G5WA 3KP0A 1DIOA 4Q8MA 1KLYA 4WSJA 4C90A 2P8CA 1NWSA 1QW9A 3TVAA 4QSHA 1GORA 3MDWA 1EJ7L 1L2QA 2EJ1A 1DPMA 3CYJA 1Q3NA 3AJ7A 1H7XA 2C15A 4D9PA 5JBEA 1JL8A 4EVZA 1P1XA 3ZJ8A 3PJTA 3TN6A 1XRTA 1OVDA 3RLUA 4V15A 4C6IA 3C2RA 4H8NA 1XWYA 1ONEA 2QUMA 2YBUA 4EPDC 1UUOA 2J7EA 1JYNA 3EA2A 1B5TA 1O4UA 4OVXA 4INFA 4CQCA 4OBTA 1HJSA 1NDWA 4QBXA 4E2VA 4RDVA 1R3SA 1CXIA 3MVIA 4KCVA 4XZBA 5CJNA 2VX6A 5FACA 5C71A 2ABBA 4YCPA 4FEZA 3N18A 4IZGA 1VEMA 1KCKA 5I07A 1UROA 4Y7EA 4B5VA 4K1WA 1PKLA 5I23A 1BEUA 3CQIA 4Q22A 4B4HA 1LDCA 3B97A 3O07A 4HNCA 4JFWA 5DRIA 1EHAA 1GZ1A 1XLGA 4MSSA 2ATSA 3N14A 4WEVX 3URQA 3MHFA 3AC0A 1KM5A 4H9ZA 1R2SA 2BOGX 4QLKA 1Q85A 3W2JA 1XKYA 4HGXA 4E4UA 3GBEA 3SB0A 3GUWA 2CLKA 3QGAC 1XD0A 4WDWA 3MV01 3GDBA 3WD1A 4B90A 3OEXA 2L5HA 4CQDA 2FVLA 4ROPA 3NSXA 5AOUA 1FHDA 4XAYA 4AIUA 5JBDA 4F48A 3M5XA 3PNZA 3O3RA 5DMLA 2FFIA 1DJWA 4LALA 1SR9A 1XLFA 3UR2A 3KP1A 7A3HA 4PFMA 3R8GA 2NX3A 4DI8A 1P43A 1NOFA 2IS7A 4GO8A 1REQA 3MKCA 2E77A 4NAFB 5CZSA 1X97A 4UR9A 1LWHA 3OJGA 1WAWA 1VFFA 1GHRA 3IIPA 4GRSA 4HMCA 5CC3A 3MYOA 2DT0A 2CPUA 2Y70A 1IEIA 4BJHA 4HMEA 3RUBL 2VL4A 4RNHA 4O52A 3VDHA 1MWOA 3T40A 1GYMA 2X30A 4M80A 3V1HA 2OEMA 1WQ5A 3N2XA 4DUOA 1IT8A 4Y9AA 5C2GA 1IWPA 2V5CA 2DT2A 1V02A 3BLFA 3R79A 2XDFA 3OLIA 3KXQA 1XBXA 3SCNA 3R13A 3AISA 1JZ3A 3VD3A 1OIFA 1XH2A 1TPVA 1WA3A 3PZ9A 2WC4A 5AYYA 1ISWA 3VNDA 4WQ6A 2GGEA 4O8RA 2NVCA 1ITUA 4JR5A 3S83A 4IIBA 4CNTA 1UA3A 1E1EA 1LOSA 4O1BA 5CPSA 4A2SA 3BLKA 3FGCA 1XUZA 1IXQA 3ZT7A 1UJPA 1J0JA 4Q8VA 1F3XA 3BGGA 2O0TA 3SUTA 4GNJA 1L6GA 2EPKX 1W5OA 3QTPA 5DCBA 5E0FA 1KBJA 4S2BA 2XIIA 3L68A 3AHYA 5I3HA 1JRCA 3NOYA 4JIRA 3EOSA 1F73A 1CIUA 1ZENA 4UZUA 1G0CA 2Y0FA 3GIQA 1DE6A 3EPMA 4MGGA 3QY6A 3CU2A 1HGYA 1TCMA 3CUXA 3MC5A 3DEQA 3FFSA 4HD5A 1K7EA 4CD7A 3W53A 3LERA 3KVMA 6A3HA 4J3WA 4M5PA 2IKGA 3TOYA 2C1HA 3THUA 4N0RA 3VNKA 3CL8A 3SI9A 1L6FA 2HZGA 3H6OA 3CQJA 5HATA 3R58A 2TSYA 4LEQA 3NR0A 2ISFA 1ZCOA 4JTEA 1IYXA 4NUWA 4L80A 4ZZ9A 3CPRA 2OB3A 3UYIA 5A5WA 3RXZA 2J8GA 4NI8A 2V63A 1FWSA 5AZ0A 3NTYA 1K7FA 2PRMA 2PTYA 4UXDA 5HQEA 1J0IA 2OYKA 2X0YA 1GT8A 5D04C 2NQJA 1TWSA 2XTKA 1I75A 3MZNA 3G8RA 3ABXA 5EMLA 4QG8A 1U83A 3WG6A 4PB4A 1KTCA 3PK7A 4FXJA 2WOQA 3WNNA 3OA3A 9RUBA 1J0ZA 4O13A 2WQPA 2GSJA 2D2GA 2HE8A 5I02A 2GK1B 1C8QA 1UMLA 2HS6A 3PS7A 3PR2A 3VZYA 3JRKA 4ATDA 3NYZA 4IIGA 1VJIA 4K6AA 2TRSA 3ARRA 3H54A 2NXIA 1OM0A 1TPUA 2C16A 3STGA 3MYPA 1EJRC 3WEZA 1VC4A 3TR2A 3LM3A 1GQLA 3OIHA 1PHWA 4BS0A 1JCNA 1H41A 1QFEA 3KOXA 1JR1A 4Q8PA 3BZGA 5BWFA 1VR6A 4US5A 3CZEA 3E0LA 4GC3A 1PPIA 4Z2IA 3EYPA 3OYXA 4HHLA 1RK6A 2W5FA 3AXMA 2IPJA 2OODA 4HQVA 5CC5A 4AIOA 4ZENA 3WX7A 1XX1A 4JTJA 4LVDA 2ACQA 4JHMA 1RQEA 3W7GA 3A47A 4H2HA 2E4TA 1W1PA 2WZIA 5C0QA 4J3XA 1F6PA 1XLLA 4HU4A 2OWXA 3SUWA 4JTHA 3W1NA 6REQA 1DTNA 3CJPA 2RHGA 1KM0A 3E9AA 4XZLX 4JN7A 3TJLA 3PZMA 4MY8A 4LUYA 3LA4A 1CTNA 1PTDA 5CSYA 4KWUA 3AS1A 3P60A 4PCNA 4IUGA 3E3HA 5LKYA 1JDEA 4Z1DA 4XIMA 3VNJA 3UWQA 1GEQA 3AWNA 4I9AA 2YLLA 2Q09A 4A35A 4CQBA 3KL0A 1V02E 3VIGA 1EL3A 5BYWA 4EAYA 5HNUA 2QJGA 5FF0A 5D9OA 5C5YA 1O5QA 4KWOA 5I3DA 1GKQA 4KT2A 3M0JA 2OQHA 3SCPA 1Y5WA 2QPUA 3VABA 3VKJA 2J13A 5FF2A 3GC2A 1GVYA 5KSWA 5T9CE 3PTDA 1L6WA 2DVXA 1TMQA 1VZWA 3O16A 2WSYA 4UFLA 1R2RA 1WDQA 1Z7AA 2Y89A 3AROA 1T8QA 5FI8A 3VKAA 3M5VA 1EGVA 4NG3A 2QV5A 3UGVA 1QW7A 1E5NA 1JQXA 1H4PA 4H8HA 3M0ZA 4DX3A 2OPJA 3LSBA 3S2CA 2I5GA 2RH9A 3LCWA 3VNMA 2QULA 3C2OA 4UWMA 7XIMA 3EB3A 2OELA 3TR9A 1B4EA 3TONA 3EX4A 3ZR4A 5IHRA 1R0MA 4IIFA 5D30A 3S5NA 1PZ1A 1OFDA 4K7VA 2DORA 1OX6A 2GGHA 4DLMA 3K8MA 3VZZA 2C3ZA 4H00A 4YTTA 1E6XM 3GDKA 4GI9A 1HJXA 4O1DA 4GBUA 4ZTYA 1W9XA 1M5WA 3CQ0A 3M46A 8CGTA 4LH8A 4GX9A 5CBBA 3CAWA 5AVNA 4ZQPA 3TAKA 2ZBTA 4N42A 1JD9A 1GQNA 1D9EA 4XVEA 4H3DA 2PDHA 2Y5JA 4S38A 1UBPC 1D2KA 2DP3A 2Y1HA 3ANUA 1H63A 1RBAA 4KW2A 1BWLA 1Q8AA 3W74A 2VRKA 1XCWA 4TVUA 1XP3A 1I45A 1J18A 1IWBA 2JFEX 1JJKA 3DU0A 5D05A 4LVGA 3FY1A 4CEXC 2PDNA 5LSMA 3TSMA 4EPKA 5C6MA 3C5QA 2C14A 2REQB 2ISWA 4J35A 4DBWA 3A3WA 3OU8A 1V6VA 1QOPA 4KERA 2P0IA 1I0BA 5KETA 2DH2A 1OG0A 3CO8A 4A8LA 1F8IA 4R7JA 5U4NA 5HQMA 1W3IA 1S2TA 1UOZA 5A6SA 1JZ8A 3WQ8A 2ZZ3A 3WJSA 3BL3A 3QHNA 4IFRA 1VJSA 5C9XA 2XH2A 4CD8A 4OWGA 4RE3A 3TZFA 2A6NA 1XIDA 4D1JA 3QVQA 1SGJA 4KEMA 4MG4A 3ARZA 5I6SA 2HJPA 3VGDA 3BLPX 3WDIA 1ALDA 3FA5A 3WQVA 4P7RA 2TPSA 2YB4A 2Q8XA 3DDMA 2ONEA 4Y8FA 1HT6A 4FXRA 2ZKMX 4A29A 3BOFA 1E9ZB 3DC8A 1X1ZA 3RCNA 3WF2A 2PWUA 4QNEA 1ZAHA 1YTEA 4DB7A 4UQEA 1GQKA 3GO2A 2CETA 5LIKX 4IGHA 4MB3A 3B8TA 5AYXA 2A7NA 4I3GA 1ITCA 3AALA 3UA3A 1OQFA 4E3VA 3NFUA 3ORWA 3PZGA 4LNYA 2NW0A 3WF0A 1PAMA 3WLRA 1XM3A 3CQKA 3UW6A 1MVYA 4GKTA 3IV8A 3EA1A 3ZSSA 2CZDA 1H61A 4LYPA 3WJXA 3PZUA 5K9CA 3CT2A 2HK0A 4P7OA 1WV2A 3A4JA 2FB3A 1TVPA 2VO5A 2QW5A 4FX8A 4XB3A 5EY5A 1C8XA 4E5TA 2DFAA 1FCBA 4O0KA 4J4KA 3AIRA 3COTA 3ABRA 5DMMA 2BBFA 4NZ5A 1L8NA 5A8QA 2DUAA 4QAWA 3LLDA 3RITA 1OINA 1M01A 5CGTA 1V3HA 1DV7A 4GBDA 5DLCA 3W02A 1JDFA 3VNLA 2VD9A 2ZUTA 2E6DA 2GUUA 4W88A 1J93A 4U3AA 3NGFA 1JULA 4IMEA 3DENA 2DSVA 4Z2KA 4RE4A 3SQMA 3OG3A 3TN3A 4LT9A 1KM3A 3UEQA 4XTDA 3E2QA 3TV8A 4LBUA 3PBGA 3UNDA 3ZT5A 1DJYA 1HTIA 1V79A 1QNVA 3KZSA 1D3GA 3VOFA 2PWEA 1M3UA 1CLKA 3VM5A 4DWSA 1ZHAA 4TOQA 2GQAA 3J7HA 2WKLA 1DYSA 3DYMA 4OECA 3T78A 2R9RA 4DXXA 2ZUVA 4S3JA 4RXFA 4MB4A 3THDA 3CB8A 3ITXA 4AWSA 2CBJA 2WNZA 2XFFA 3KRUA 1BKSA 4JTDA 5DT5A 1ZBWA 2WJZA 4US6A 1GPFA 3AI0A 5M5DA 3IS4A 4G6CA 1NWTA 4IL0A 2IXVA 3A21A 3NJ3A 1TVNA 2QDDA 3KW3A 3MBDA 3Q65A 2GGIA 3G1FA 4IMFA 4JNYA 4KH2A 5M03A 2PP1A 4G7FA 1A49A 1Q6LA 3M6DA 2E6AA 4XUYA 5AFDA 4C7DA 4C6JA 1FWJC 4PMVA 4XG1A 3C4UA 2FTWA 2OTDA 2KZHA 3CUIA 3N2MA 1OJXA 4PMOA 1VHCA 2O9RA 3SGUA 3VK5A 4ERGA 3BAYA 1O5KA 1UZ4A 4YPJA 3MJYA 1ZP3A 3IPWA 5GNXA 5AYBA 4MHBA 2YLAA 1YW1A 1LRQA 5E70A 1UYQA 4WRHA 1CCWB 3TOPA 4PB5A 3U3HA 5E0KA 3PVFA 1TV5A 3ZVHB 5IDZA 3EX1A 3GU9A 1UWTA 3BLEA 3EB2A 1NEYA 4LAUA 2B7QA 1ZPTA 3RPTA 3BV7A 1XIIA 1SJBA 3UWEA 2GOKA 1YBQB 4QQUA 3ITGA 2OYLA 1DWHM 1W6TA 1SJCA 1PO9A 1ISVA 2OOFA 3GW3A 2WYSA 3L4UA 3NEHA 4I6KA 2XH7A 3CHFA 1K6AA 1C92A 1GZJA 3U9IA 3NM1A 3STPA 4OZOA 2QIWA 4MUZA 1S3HA 1LYXA 2VUNA 3G2GA 4HB7A 2CFFA 4OBRA 2FH6A 1I2OA 2DQXA 4YJ5A 3SECA 1HJWA 4DZHA 4AC1X 2PCEA 4GMEA 4Z0JA 4JOMA 4ADTA 3CAKA 3KTXA 4MJ4A 4CVUA 4HCLA 1WKDA 3WFZA 1U2YA 2V0TA 4MY9A 4X63A 4LCQA 1E1FA 1EXBA 3MTWA 1B30A 1E3XA 1ZY9A 4IOTA 5AECA 1LUCB 4TMCA 2VGIA 1O94A 1O5XA 3NQ8A 2G0WA 4NX5A 2V2CA 1OSEA 1XHGA 3N15A 1VB9A 3CLMA 5BWAA 4V1XA 3DFYA 3G1YA 2WVSA 1BYDA 1E0TA 4MY1A 1AD4A 1QT1A 3U2OA 2XM2A 2VJXA 1FFRA 3GW0A 3M47A 4LV9A 3WN6A 3AAMA 3K30A 4Q4MA 3QFWA 1IHIA 4OUEA 2UY2A 5D2WA 2VZUA 3FEQA 4UTIA 3SIMA 1VPYA 3ITLA 1HXJA 1O95A 3DFNA 4XD4A 3N4EA 1TJ2A 4V1YA 2INFA 3KBNA 2HE5A 1JCMP 4EKJA 1PKMA 3H23A 1PS9A 2A3CA 3FA3A 3BWWA 3IVSA 1PB0A 5KZEA 2DJLA 3H26A 3G6MA 5A6BA 3W7KA 1PKYA 2YGYA 2CC0A 4M7TA 1UR2A 3RDKA 2ZTJA 2Z2AA 5I5RA 3VVGA 5BMXA 4YU1A 4WDTA 2DPEA 4MTVA 3OOQA 2G3IA 1ZBKA 3R94A 4ADUA 1SO5A 4AY8A 2PODA 3P8IA 5TD4A 3RRAA 4M8UA 2VZSA 2WMGA 3ITTA 4HZMA 4L7ZA 2QV4A 4CCCA 3QSRA 2ICSA 3GXFA 3QZ6A 2VWSA 1EUNA 2OT1A 2GSHA 4UR7A 1QOQA 3I6RA 1TMHA 3CWHA 4Q8OA 3QR0A 4P7LA 2PDJA 4I9MA 4QROA 4JX4A 4UTUA 3QY7A 3QMRA 4D1IA 3APTA 2EO7A 1RD5A 3BLOA 1XGEA 2H8XA 2V82A 4C6LA 2BZNA 2YCIX 1R6WA 4JYDA 3H22A 1OGSA 4DBDA 3Q37A 2CNCA 3RMJA 2BTMA 4O4WA 1RBLA 4XV0A 3B40A 1LL7A 5CLTA 3W2KA 2VHLA 3RILA 2ZYFA 3IV3A 3LTSA 2WNNA 1QI2A 1A53A 3QKEA 3LGDA 4C1LA 3N9SA 1NDYA 2E5BA 1QHZA 2FJKA 3VX1A 3EWZA 2PSNA 1R9ZA 2CYGA 2W62A 4GC4A 4NZCA 3V4BA 5FKYA 1GKPA 1CXFA 2VVNA 3HZ3A 4HNOA 3AUJA 3UJEA 4ZE4A 5A8PA 3A5VA 2OSWA 3WJZA 4Q4RA 2HSAA 4G1NA 3QM3A 2RKXA 1KCXA 3PWAA 1ODZA 3KHDA 1DWJM 2QIIA 2XVKA 3H2CA 2R24A 3SY5A 4GIAA 1XJBA 4H1ZA 3U7BA 5CZTA 1BWKA 3VXGA 1EJSC 4TV5A 3A64A 1TPWA 1HFBA 5B7YA 4DBSA 2PWFA 2PWDA 2X1TA 2J79A 2J8TA 4WZHA 4H8VA 1KKOA 3UY8A 5M1TA 3BG3A 1WXZA 4MNKA 1RZMA 2QCHA 1FXPA 3SADA 2Z6IA 3PZNA 3WUFA 1D7FA 4LUSB 1KRMA 1W0MA 2EBNA 4RR4A 1QNRA 3JW7A 1EYEA 4GACA 1ZTVA 1OCBA 3OVQA 4AEEA 3L5LA 2NQLA 1J5TA 5GQBA 4HU3A 2ZXAA 2F2HA 4U3CA 1DP0A 2RDTA 3FHQA 3TYDA 2B7OA 3M9YA 3HG2A 3VUSA 2QMKA 3UERA 3BOXA 1NY1A 3A9BA 5BROA 1EP1A 2CWXA 4LVAA 2VDHA 1YLVA 2ZRXA 2WC7A 4C6BA 4S23A 3KVKA 2V5BA 2XWEA 2Y63A 1G6CA 4ZQCA 1Z48A 3MO4A 5IBXA 1RD6A 4GFSA 1XC6A 3W1MA 1S38A 5MF5A 1GVEA 2UV8G 3PUEA 1VFHA 5C55A 3KBMA 3VI2A 4AU0A 2PB1A 4IMAA 5H8UA 3PFMA 5EMKA 4F4RA 1V0KA 4QM1A 3DXIA 1XG4A 1XIJA 1WUFA 3C52A 3O2LA 2DIKA 3B8IA 4GY7A 4YHGA 2PC8A 1XFBA 3AU2A 1A4MA 3MY9A 5G4HC 3OVRA 1GQJA 1VBRA 3B05A 4ZQOA 4KKXA 3WH9A 2OU4A 3KCOA 4WGXA 4BCEA 3S47A 4KFPA 1GK8A 1DIKA 2WV8A 3DFPA 3LHVA 5EPDA 4AY7A 3PJWA 1OWQA 1W3JA 2X7WA 1V03A 4X61A 3PUGA 4O18A 3K8LA 2OGJA 3TYCA 6ALDA 3G8EA 3MCMA 3K1GA 4U5KA 1LCOA 2WSKA 1I2QA 1UC5A 4MIMA 4RNIA 2WO5A 3M07A 1DVJA 1JGMA 2Z25A 4KCTA 2D2OA 4W5UA 3W76A 1PYMA 4HPNA 1QVBA 2WVUA 4QG9A 4A8IA 1X39A 1P0NA 1E55A 2ZUSA 3EOEA 3P3BA 4B2DD 2RJGA 2AGKA 2QNEA 5FJTA 2YX0A 4DUXA 5JH2A 1E6NA 3FSTA 4HN4A 3LHUA 5PTDA 5M17A 3LI0A 1WOBA 2NT1A 2CHRA 3BVJA 3HB9A 2YDRA 3WJWA 3DH7A 2Q3RA 1BTMA 2VTFA 5HQLA 3BW4A 1PUDA 1FY6A 1G7UA 1VCVA 4NL1A 4TV6A 3CM4A 1UQZA 1BYBA 2VNCA 1JCJA 5A6TC 3WLIA 4BHYA 3S3GA 1WPCA 3TN4A 4EWND 3ARQA 5CLWA 1Y5VA 2FB2A 3RNDA 3VC6A 1E73M 3L4YA 2YKKA 5G4EA 4MAVA 2VMFA 3S1UA 1NP0A 1VD6A 4AD4A 1W3NA 1UP3A 1V6XA 3M0KA 3UBPC 3H2EA 1BPLB 3W84A 4IP5A 3ITYA 1VQTA 1KW1A 3TH6A 1TSIA 1VHNA 2QAPA 3LEPA 3AMGA 3W7NA 3SN4A 5HWMA 4JYFA 2ZWZA 2QHAA 4PFHA 5FJUA 5I3KA 4ZOBA 2YJQA 4QNWA 1OADA 5I7GA 1VFLA 2DSZA 1UJQA 4XBSA 1EH9A 3H55A 3VFLA 4DO5A 4NZ1A 2NSOA 3ALGA 1G4SA 5DANA 5I09A 2Q8ZA 1GOOA 4UFKA 4ACZA 1IQ8A 3FJ4A 2PDGA 1DJZA 2FLIA 2PF8A 3WY1A 3CEUA 4QP0A 5GJNA 1YQ2A 1SZRA 4LQ1A 3GU2A 3TJXA 4GI4A 1LT7A 1QW8A 3TUUA 3MSRA 2XN0A 1H0IA 3FHAA 4RLIA 4XZWA 3STCA 3SY8A 3OZYA 3T55A 3ISIX 5BOOA 4HOZA 1UPMB 1WZAA 4H8UA 3LI1A 1NF7A 4MPKA 2QGHA 4TXEA 3L4XA 3KRZA 4P8UA 1E5JA 2CW6A 3GVGA 2CITA 4H01A 5F1UA 4LOCA 1J0KA 3TQPA 3TMQA 2NVAA 3W71A 4QLLA 1FXQA 1UD2A 3LCFA 3AS0A 4AZBA 2Y2WA 4J9JA 4D71A 3HGOA 7TAAA 4LPCA 4N9DA 1CX9A 1M7PA 3MUXA 3KRSA 5D9PA 3V5FA 1O6IA 8XIAA 5IXEA 3GKFA 2A3BA 3TFXA 8XIMA 1IXOA 1FTXA 1BGGA 4K68A 1LT8A 1PIGA 1DJHA 4RDZA 2PTXA 1H62A 1S5WA 4YVPA 3UP8A 4D8ZA 5KITA 4AXKA 1TV2A 3PZQA 1RR2A 3RN6A 4XZIA 4KFOA 5HUOA 3Q67A 4GH1A 3SQLA 5A6MA 5LXXA 2E9BA 4JIQA 4FS9A 4JICA 3UJ2A 1VFTA 4DPQA 4B91A 2R82A 2DDXA 3GQYA 5BOFA 2QAFA 3DN5A 3TW6A 5ABHA 2V9DA 3VGGA 4ZBCA 5I78A 2QUVA 5C8BB 3ZWSA 2WWCA 4B9YA 3A12A 3TTYA 4MDOA 1EIBA 4QE4A 5EGRA 1SO6A 3QF0A 3TN5A 2RDXA 4AZ7A 2J9ZA 6CGTA 1XV8A 2XINA 1GEHA 1V3JA 4UTTA 2FYMA 2D0FA 2Z2UA 2PDUA 7REQA 3W7HA 4GZEA 1CXEA 3GG1A 4F0KA 3EDFA 2WM1A 3JZUA 5DY2A 1W8SA 2OZ0A 3BLIA 3MPGA 3PP7A 1NARA 3SM0A 1OFPA 3TW9A 4NX0A 2NUWA 1QR7A 1UWRA 3NPVA 1W9DM 4S3EA 1T96A 9CGTA 1UD4A 2BOFX 1Z9AA 3AXIA 3IGHX 1WNOA 3THCA 4MLRA 4PMNA 1SVDA 1I60A 4XSLA 1CXLA 2WMFA 3B0XA 1OFRA 4BF5A 1OFEA 3E6EA 2CLLA 4QJ3B 4CCDA 4D6HA 4GPNA 2V3GA 1XLKA 3VIOA 5TF0A 3WQEA 4KIEA 3L7RA 4LFYA 5F7UA 2O9TA 3I3DA 1UKQA 3ARWA 4K8HA 2Z00A 2WAGA 4CCEA 2G37A 4MWAB 4JY8A 1TJ1A 3PF3A 1P6CA 5FEPA 1SZEA 5H1WA 4XZ9A 3RJXA 3GTXA 1MW0A 2OFJA 2VQTA 3F2DA 1F8MA 3QBUA 4FXFA 4CNNA 1AMYA 2YW4A 3K1DA 4KESA 3UZ5A 3HMJG 2GPTA 1HKIA 3M0VA 4HK7A 3W73A 3K4WA 2VELA 4IQDA 4F2BA 3L21A 3CGTA 4UCFA 1FDYA 3W7JA 4FOUA 3HF3A 3VGEA 5A3HA 1B31A 4UOQA 3TXVA 3KOFA 2Y85A 1KRBC 3NQ2A 5EBAA 1S2UA 3WLSA 1QI0A 4NYYA 2KAUC 3APYA 3T2OA 4AQLA 2QCLA 3H4XA 4RX0A 4ZB5A 3LXBA 3PN8A 4I5UA 1ISYA 2PGFA 1T40A 3ES8A 1J6OA 1CEOA 4TQTA 3EWWA 3QPYA 1I0DA 1BLIA 3EWCA 3CZGA 3EMQA 2YIHA 1V6UA 3P84A 1XH1A 2VI0A 3QH2A 3TTSA 4XKMA 4AZGA 1JPHA 3WELA 1QNOA 3W7RA 3IWPA 3S42A 2VVSA 2ZUMA 4LUSA 1RK5A 2XIQA 5GVJA 2A3LA 3UXDA 3LGEA 3THAA 4DJED 3GYCA 2O7QA 5FD0A 4GI6A 3LHWA 1U5HA 1FWWA 4MMWA 1PJ9A 1M9HA 4PRTA 3W72A 2V5KA 3IIZA 2CEQA 4JXCA 2D0HA 4XQ6A 2B7PA 1MFVA 1YDYA 3QLDA 2J77A 2ISVA 1NQ6A 3ZR6A 1TZ7A 4R9XA 3HQPA 3HBLA 1MI3A 5FJJA 2Z29A 4PODA 3VIPA 5LIWX 1SO3A 4I90A 3RRXA 3QMTA 3GWQA 4NJHA 1XCXA 3ZO9A 2Z2BA 1B90A 2POZA 3ZQ9A 5CAKA 5DF0A 1W1YA 1QAPA 3VNYA 1QRQA 3CZKA 4WDUA 4JTSA 3CYVA 5F4XA 1V08A 4U31A 3M4HA 3SCOA 1TREA 4RXGA 1M41A 4S3DA 3UF9A 1I4NA 2NQHA 2Y8UA 3FAWA 4XISA 2VXNA 4LXFA 3PC0A 3EKGA 5BRQA 1L9WA 4XZHA 4OOZA 3PZOA 4C91A 1FWFC 1S3TC 3Q58A 2NUYA 2GJNA 3L66A 1G4PA 1FWDC 1KQYA 4Z2HA 1M1BA 2E7FA 2Y4SA 3BAXA 2VEMA 5I24A 4MWAC 3HGRA 3ZXWA 2XFRA 2C0HA 3TKFA 1D7KA 4D6GA 5FJOA 3W00A 2OWWA 2CXEA 4NJIA 1H7OA 3HGJA 5HPOA 4IGNA 4OUIA 3B4UA 1Q6OA 1OIMA 4OTKA 2IMRA 2JKEA 1FOBA 3H4GA 3H2FA 1QK0A 4LUJA 2XVNA 3NQDA 1TV3A 1TV7A 4PC8A 4BR1A 5I0DA 4WIWA 3O6AA 4HVXA 3VD4A 3A9IA 2CCRA 3WYZA 1A47A 3FJLA 2Q01A 3G1RA 4S3BA 1B3YA 4QE1A 1YYAA 3M43A 4XAGA 2PE4A 1GHSA 2Q02A 1F4AA 3B4YA 4TX8A 1HX0A 4KMQA 4Z1CA 3B0VC 4XD5A 4XVDA 4AD2A 3TJ4A 1PTGA 3FW6A 1W9PA 3R0UA 4AAJA 3QJAA 3ANVA 3WCZA 4QDWA 5EMUA 3ZLHA 3FN9A 4ICCX 4L61A 3BMWA 2D73A 4RV8A 4QJ1A 2ZA2A 4B9ZA 4DJFD 4CU6A 3A4XA 1OB0A 2DIJA 3UG3A 4E8CA 2RGLA 4K1GA 1U1JA 4IPPA 3W29A 2WSRA 4Z2GA 2Z1WA 4L65A 1JCYA 4GO9A 2GQ3A 4QXIA 3ITCA 3QYQA 3JR2A 3ZWTA 3NQ6A 2VYOA 4GZIA 1XF0A 3M7WA 1K3UA 4HIBA 1F5ZA 4FNTA 1SJAA 4GHRA 6XIAA 4WHBA 1JPIA 4C5YA 2YL9A 1VCGA 2FTYA 1Q13A 4JTCA 4NZ4A 5K7JA 4G1KA 4P7QA 2ZICA 3LS9A 4PUDA 1KLZA 3BICA 3IVTA 2YL5A 1IR1A 4B5XA 1W2VA 4ZOEA 1JNEA 2JF6A 3RM8A 3GU1A 3E74A 4AZCA 3QR3A 3A13A 4R5EA 3ZSTA 4GXWA 4EF9A 4MZ1A 3R4IA 3VOHA 4PUEA 3VA8A 2VRJA 3CV6A 1U30A 5HNRA 4JS3A 4OKDA 4X9YA 4Q7NA 4FSAA 1HKWA 2VRQA 4AD0A 3NQMA 4E8DA 3H4WA 1HVQA 2X2YA 4A8RA 5HK4A 1RCQA 5HJYA 1FVPA 3ALFA 1VLWA 3LBCA 2X05A 3M5ZA 3TNBA 3G1HA 3NDZA 4MJZA 4ACZB 3XIMA 1RJRA 3B9EA 1WAUA 5C9RA 4JTTA 4GFIA 3G1DA 2GK1A 2J74A 3V0TA 2C91A 2NXHA 1YX1A 4L6HA 1BF6A 3VGFA 4MM1A 4OU1A 1IT0A 4PRWA 4H7VA 2VDGA 4UMCA 4WUIA 3VIFA 1C3FA 3D0CA 1VBJA 1AL8A 7REQB 1NM9A 3ABSA 4NVTA 4UTWA 3TIMA 1WYIA 4NAEA 3LG3A 5ECUA 1CB2A 1W9VA 1QO5A 1AZ1A 1BSLA 4S1FA 2WZMA 4YLWA 3USZA 1O1HA 4Y9NA 5EBUA 3NQCA 5HXMA 4U2ZA 4JTIA 1RALA 3S2NA 1ITQA 2E9LA 4GY1A 2ZOXA 2GLKA 4IXXA 3TA6A 4B2DA 3BCFA 2BODX 2POTA 1IXPA 3QRHA 2AL1A 4MNLA 5LNWA 2PAJA 1WO2A 2CLEA 3NAVA 2Z1SA 1LRNA 2BV9A 4ZSUA 4B5UA 3FYPA 4HA1A 1NFPA 4WXYA 3A6OA 1BG9A 2DGAA 3N11A 3L4WA 2XU2A 4K8GA 3OQ8A 4Z08A 1KNWA 1W37A 4J40A 3P74A 1CDGA 1I8JA 2XPKA 3N9KA 4JL2A 4QLJA 4FF7A 3R10A 2PZNA 3S2JA 3W6LA 1XRVA 2X1IA 4GH3A 4FO4A 1UPPA 2E1DA 3MUIA 5F2IA 5MKGA 1CPUA 3KM8A 2VR2A 1NFBA 4AZHA 2EKCA 5CJMA 3W0KA 3SGGA 2NT0A 2W67A 5K2ZA 4PBGA 1O68A 3H24A 3VMNA 3OB8A 1J0HA 3CTTA 5AC7A 3RM9A 4AVOA 3K8KA 1XIGA 3O15A 2NV9A 1WKFA 3P14A 3BE7A 1YMYA 2G8ZA 2WZEA 4L4LA 3RM4A 3AZTA 3PZIA 1TA3B 1WDPA 2Y8KA 1W2PA 4K8EA 2WZTA 1X1OA 1POKA 3WLMA 4QX4A 2JEPA 2FZ8A 4RW3A 3DHFA 3W85A 2R1PA 2ZZ7A 4HSHA 4DYEA 3WL0A 2R6OA 3GHTA 5L6UA 4PTDA 2BGSA 4CUCA 2GJRA 4MFEA 2PRHA 3QQ0A 4JTKA 4PUWA 4O1CA 2DH3A 3VC5A 4JFTA 4FLOA 1TX2A 3OHMB 1UP0A 3LK6A 2O4QA 4QCFA 3QYSA 1C9DA 5CEWA 1W1B1 3IRSA 4JTLA 3SR7A 3LBOA 3ENLA 4PCSA 4S3GA 2P5NA 5D32A 1OT2A 1RUSA 4E2BA 3R5EA 1CNVA 3V35A 1H7WA 2WHLA 1ZP4A 1KRAC 4OFCA 3DGBA 2BS9A 2J7CA 4CQ9A 4IF2A 3WQOA 4FXSA 3WLLA 1KA9F 4IG2A 1TUXA 4IPNB 2ZE0A 4LJ3A 5CH9A 3SN0A 4MDPA 3TYZA 5G2HA 3F5LA 3HV9A 4LS0A 2BLEA 2Z7GA 5JMUA 5CBIA 3CH0A 2BVDA 2A7RA 1KBBA 3H70A 1ZGDA 4ATLA 4WD0A 2H8ZA 3NQAA 2Q8LA 4DEFA 1KM1A 1X6LA 3FX4A 1IF2A 4J3UA 4PB3A 5DO8A 1IR2A 3BMVA 4BY3A 1KGWA 2UZ9A 1BFNA 1R3RA 3NGJA 3VX0A 1SFLA 1ADOA 3A24A 1NVMA 1W3HA 3GVRA 3H2OA 1WDWA 3W2UA 4B16A 1TO3A 3GYEA 4JTQA 2P50A 1LQ0A 3C2YA 4FNSA 1C7TA 4LWWA 1FKXA 5A8GA 4CNSA 5B80A 3NUKA 4G56A 1A80A 1T41A 1VFUA 3LSCA 4DHGA 4X2RA 1XIMA 3FXYA 3EDDA 4ZFMA 2PD5A 1HP5A 2DZUA 3PTKA 1H7NA 3NPWA 2FPTA 1VPXA 1FP9A 2BHYA 2QDHA 1GYLA 2JGQA 1FCVA 1G9HA 5IRPA 5DEZA 1XUUA 2MANA 2CHNA 4GUIA 3TC6A 4NHVA 3SCRA 1HQTA 3VOJA 4P5UA 2J6VA 1XGDA 3LCHA 3U5UA 1BQGA 1H7PA 2UY4A 3BQ6A 4GYJA 1R3TA 4XKYB 3W86A 3IACA 2FGLA 4ZOCA 7TIMA 1P0EA 4NYUA 3KVJA 3WK1A 2CBUA 2DZPA 4F9JA 1H2JA 2EF9A 3TU9A 1GOMA 3MI6A 3ECQA 4ROQA 2EPNA 3SRFA 1MDRA 1BGAA 2VUYA 1BQCA 1PX3A 3D5HA 1VIWA 1XKJA 3MWAA 3IJ7A 5J8LA 2W79A 1EO5A 3GX9A 1XQKA 3SFKA 3C0SA 1PZ0A 2OVLA 3TTOA 3GY1A 4C6OA 2CLFA 3T1GA 3AOFA 1OK6A 1IWAA 3KBSA 4FF5A 1NWUA 3LOTA 2R14A 4RJEA 2VGFA 4JX5A 3N6HA 5K9XA 4MZYA 1TPB1 2WJEA 4HA4A 4M6UA 3AXKA 1A5CA 3LYEA 5DXXA 3GNRA 4W85A 1HP4A 4UNLA 3B8VA 2ZUWA 3L2MA 3ERPA 2F61A 4JQ4A 1QPRA 4DWSC 3LDVA 5EB8A 3B0PA 2ZUNA 3A4AA 2EG6A 3BOLA 1SFJA 3WJYA 3TSDA 2YDQA 4EE9A 1H1YA 1B2YA 1AL7A 2G3JA 3AHXA 3DFSA 4LTSA 4AVNA 3LNMA 1B57A 3AZSA 5H8MA 4JKKA 1R9YA 3I4EA 3RR1A 4JBRA 3T4CA 2YCLA 4GNVA 2OEKA 3EPOA 3UR8A 1EC8A 4ZQNA 4AEOA 1GW1A 4DO4A 1OCQA 5HDRA 3W7DA 3LPPA 3HG5A 5GPRA 1MW2A 1OFQA 3U8GA 3S1GA 2HMCA 3RGTA 2IW0A 5I06A 1LZOA 2INEA 5D33A 5FA5A 4PTWA 1YDNA 4RNFA 1DWAM 3EEZA 2JGYA 1QUMA 3LGGA 3W1UA 1B0IA 2R8WA 3BW3A 2BMBA 1F74A 1OC7A 1GQIA 1I2PA 2B4GA 4NJKA 2ZX6A 4O57A 2PLKA 3UZZA 3IJQA 4W87A 3W2NA 1K8CA 4E3TA 1ZQ5A 1HGWA 2JIWA 3ARUA 3F1QA 1TWIA 3MUZ1 4NZJA 5HOSA 2VURA 3DKLA 7ODCA 3WF4A 1A5NC 4P8WA 1VPQA 4J27A 3CMJA 1TWDA 2Y62A 1AZ2A 3LBMA 3KOYA 1Q5MA 4MOZA 4S2CA 1W32A 1JVNA 2Y24A 3GHSA 1V93A 3UVIA 5JIPA 3U48A 2DZWA 3LB0A 4MADA 1DIDA 2VCCA 1JPMA 4DJEC 4KRZA 3FAXA 2IKIA 3G77A 2Y7FA 1K9EA 4PTVA 1M7JA 1W56A 1ICQA 2ZRVA 3CUZA 3KBWA 4W4QA 3A23A 3UZWA 4R7OA 4AB4A 3VAVA 5HAOA 5D8WA 2X16A 3VE9A 3S6TA 1V0NA 5CZJA 4AHOA 3MJMA 1A5UA 4A3QA 2NX1A 3XINA 5E9XA 1UCWA 3VDGA 4EAMA 2PDWA 1R46A 3GXNA 1OFOA 1IXNA 1KFLA 3P93A 4DM1A 2J7GA 1QI4A 5LGZA 9XIAA 4DZIA 1XLJA 4NU7A 1V8EA 3CL7A 1S39A 2QEZA 2PU0A 1EF3A 1GKRA 2PWVA 1EOMA 4A2RA 1KV5A 2PFHA 3WNMA 2DVTA 3B0YA 3N2CA 4CN6A 5T26A 3NDYA 1MZHA 1C91A 4Q8WA 3W7PA 5E5CA 1M7XA 4X3ZA 3N1AA 3WENA 3T0DA 2QR6A 3IEBA 2PRLA 4B15A 4GX8A 2E25A 1LP6A 3WF1A 3F2CA 3W1TA 1FKWA 1LLWA 4PUKA 1Z8AA 4Q6XA 4DJFA 4PMZA 3NXFA 3W27A 3N3TA 3ZM8A 4JQAA 4LS1A 4WJEA 4X9SA 5HMFA 3SDOA 1ECQA 1C8VA 1QDSA 1C9WA 3QZAA 3RIKA 3G24A 1KM6A 5K4XA 1RH9A 1UR3M 1MDLA 4EP8C 3C3UA 2OMAA 3P0XA 3H2NA 3GDLA 4URIA 3P6LA 5BMWA 3TFCA 2WXDM 1PSCA 4Z0SA 2QJMA 1C29A 5E6ZA 3D6NA 1WDRA 5G2WA 2FZ9A 3WMSA 4QGCA 3HURA 2XISA 1QJWA 1DOSA 1KFEA 2CKRA 4S39A 2ACSA 4CQAA 4DZ5A 2V38A 5G4WA 2G97A 4HU0A 1KC7A 2PDLA 4O14A 3RX3A 4IIHA 3KCJA 5J04A 1RQHA 5G2IA 5AC8A 4S3CA 2G3FA 3N9RA 3NYDA 3ZS4A 4PN2A 2VP8A 1X6NA 3KDNA 2YSWA 2Z0IA 5GNZA 3MSDA 5DXYA 3EGJA 1TUFA 4GNKB 2PDBA 4WGHA 4J3ZA 4YNGA 4KEZA 2HTMA 1O66A 3FJNA 1KWGA 1LBMA 3E1F1 5HWJA 3QY8A 1UD5A 3WQFA 1JCTA 3GXTA 3T7VA 1IZKA 4EIVA 2VKZG 3EZ4A 5AHEA 4JEJA 4DM2A 4S3FA 2WSPA 1RA5A 2I5QA 3SW6A 3V0SA 4A3HA 2O55A 4JZ5A 4CGTA 3OLEA 3T2PA 1UUMA 3WLQA 2GFTA 4QE5A 3EWUA 1AMKA 1WX0A 5FESA 2EGZA 4TVCA 2CLOA 4UQAA 5G1TA 3WQWA 4JFUA 3VZXA 5A6AA 3UR5A 3VOIA 3N17A 4RNJA 3W38A 3HTWA 3CXOA 1V6WA 3L2LA 3ZVIA 1ZLPA 4EXQA 3ZYZA 1NWRA 3HPSA 4X0VA 5AZ1A 4PR4A 2WB5A 4ZMGA 3WD3A 1E6RA 2OEJA 2CWNA 4IGSA 2CZ5A 1U1HA 1RJPA 2YB1A 1BHGA 3LHYA 4C6MA 4HK6A 3TA9A 2WCSA 3QC0A 3F4DA 1BSIA 1ZRQA 1MUMA 2YXXA 4KWWA 1FFQA 3T2QA 3N2OA 1XYZA 3WBYA 1A4LA 1AH0A 2PDQA 1MYRA 3GG7A 2BFGA 1PXGA 2YCKX 2NLYA 4NY2A 4FB7A 1PDYA 1VBUA 1BVNP 1G4TA 4W84A 2XIMA 1OD0A 4MYAA 2Z28A 1YE6A 3UY7A 1HIZA 2D22A 1UWIA 3M0HA 5HR6A 1E6QM 4RK8A 2BGQA 3I3EA 2YW3A 2JK2A 2Q71A 4N2YA 3FYOA 1X98A 2PDMA 1KFBA 1H1ZA 3ONBA 1Z3NA 1K8YA 1RP9A 3HIJA 3AS3A 4BI7A 1LLOA 1KFKA 2A7PA 3AIVA 4QDMA 4Q3MA 3YPIA 3MV11 1HL9A 1SU5A 3ARSA 3H53A 2EEXA 3GTNA 3PPGA 2ZZ4A 1S2AA 4MPQA 2NSXA 2RFGA 3N3MA 2CIPA 5BU9A 4I9TA 4MKVA 2NWSA 4L1WA 3WUGA 1KRCC 2QZRA 3AIWA 2PP0A 3ZR5A 2E0PA 4UOZA 2W92A 1L2UA 3STFA 3MP3A 1GTHA 2E6FA 4W8AA 2X1UA 1R3YA 2ZZ2A 1QWGA 1XIFA 4GQ0A 3CIWA 4O19A 3DC0A 3FOKA 1EKOA 3KBVA 4BF7A 2P88A 4K2SA 3VOGA 2Z1BA 2PDKA 3T0TA 1DORA 3WD2A 4LUTB 2RGMA 1MEHA 4R27A 3WQGA 4A4AA 1R30A 1F61A 1EC9A 3QQ1A 1KBLA 1HJVA 2ZZ5A 2ADAA 2W27A 3WH8A 1OX4A 2I56A 5K9DA 2PCQA 3HV8A 1V4YA 4PCTA 3SGZA 3GNPA 2P76A 3DBNA 3TQKA 4LNCA 4C1NB 3MWCA 2CZEA 1DBTA 1ECEA 1GOXA 3PULA 2PURA 4AVFA 7CGTA 5FAJA 3MUAA 3EX2A 4XAFA 2O9OA 3S8HA 4HMDA 5IFPA 3MI3A 4Q8TA 1TCDA 1P4CA 1LTDA 5DRCA 3W1RA 3W23A 1US3A 5D2TA 5D2YA 3N04A 2XH0A 3VTRA 3O8AA 4OBSA 3ARXA 3TYAA 1KXHA 4FX7A 1AODA 3VIIA 3C0JA 3WQ5A 3GRIA 2YCEA 4JPGA 5K3VA 2QCDA 4DNMA 1BAGA 1HVXA 3W1AA 3I6EA 3OVPA 4FK9A 1E4MM 1P5BA 2PDIA 3FNDA 2Z1XA 5HBFA 1NF0A 3CHVA 1ZAJA 4GE8A 5LA2A 2PDYA 1E0VA 2TMDA 4JYEA 3TP4A 3OZOA 5JXQA 2PGRA 2CLHA 3DYPA 2DW6A 1JUKA 2EPMX 3MHGA 5JBFA 3RU6A 2Z6JA 4C65A 1SQ7A 1JIBA 2GQ8A 1OT1A 4I7VA 5D02A 4XAZA 2G50A 4DYJA 1M53A 1Y7VA 4WXZA 4FR1A 4C60A 1OC5A 3BJFA 4MWAE 3N4AA 1XPGA 4WY0A 4Q8UA 3GIYA 4AX7A 4DJDA 1TZ9A 3NPXA 1EHNA 2BOEX 3Q94A 5EMYA 5C54A 1AQFA 4BK9A 3S6DA 2X8RA 2WCGA 5ENLA 3T8QA 5T9BG 5KMYA 1SZFA 1B9BA 5FOOA 4MB1A 3LHTA 3C61A 5IOBA 3R25A 3SUSA 1XINA 3D3AA 1UR4A 1RAKA 2OZTA 5F4WA 2HNEA 4G9PA 2ZA1A 4GQQA 3B8SA 1Q63A 3G1SA 1GVIA 1G4EA 3BG5A 3OGRA 4UTHA 1TWWA 4KEVA 2XVLA 3TYUA 1Q66A 4D6DA 3NA8A 1XYCA 3ICJA 4FX6M 3W22A 8A3HA 2BXVA 4F0HA 4PUUA 4XZMX 2A79A 3PG9A 4U28A 4IT1A 3CASA 1Y65A 1VCFA 2C8NA 1U1UA 2Q3OA 4M82A 4GJIA 4UFJA 3L65A 2QJIA 2WM0A 4GG9A 4W93A 1FH9A 3IJ9A 4L9XA 4C6DA 2E9MA 3NDOA 2WNQA 1FHVA 2RDWA 4MNJA 3B03A 1E1CA 3MKKA 3GD6A 3NPUA 3O0FA 4BI5A 2PPGA 5C9WA 1TIWA 1PZ2A 3IVUA 1JXJA 3AU6A 3FLUA 1MEWA 5IHSA 1EEPA 4LRTA 1TA3A 5IM51 4KWSA 5EU9A 4UTFA 4KBXA 3H8AA 1UW9A 2BXZA 1Q45A 3R12A 2QF8A 5I03A 5G1YA 1RV8A 2GL5A 3DYOA 4N9BA 3EXRA 1RY8A 5HJXA 5KEZA 1GWJA 1J11A 2AQVA 1V7YA 3RLHA 4YXGA 4D72A 1YKWA 1YNQA 4JAWA 2D24A 1WZMA 4O8AA 3POHA 5C2XA 1N8IA 3DFTA 1PKNA 5T8GA 4JD4A 3LMYA 2GWGA 4Y9OA 1QI3A 4ENLA 5HUPA 4NP7A 2J47A 4TUFA 3USBA 4HZ6A 1LORA 3B9OA 3SSJA 1AFSA 1JGIA 4DUWA 2A3EA 2J6XA 4PRRA 4LAZA 1O7AA 4N6FA 1V0LA 4KGLA 4HSNA 6TAAA 3GR4A 1UZDA 5DCEA 4HNLA 2X2GA 1CB7B 4IJBA 5DCDA 1Z32X 4PMDA 3NQ7A 3BQ5A 3PB2A 3PSVA 2WPBA 3LNPA 5ECVA 1CZ1A 1RPKA 2QMJA 2DW7A 4XX6A 2PLJA 4GCXA 4KS0A 2X42A 3E0FA 4HNUA 4FOKA 3CMGA 1KFWA 2ZC8A 1A5MC 4EACA 2OLAA 3BAIA 3AYTA 4GJ1A 5FL0A 1RP8A 3R43A 1CGTA 1DQXA 4HT3A 1E56A 1DXIA 4LAKA 2KX9A 4PCFA 3BGAA 1FCUA 4PUNA 2VFFA 3IARA 1TVLA 4UQBA 3UGRA 3IAPA 5GJPA 3WKZA 1BTCA 4AZIA 2WWDA 1H60A 4JFVA 3QPEA 1KD0A 3W7QA 1YDOA 3LTYA 5BXTA 1MO0A 1KTNA 3VD5A 2X41A 4L6OA 3WL1A 3UG8A 3KL3A 4WJ8A 1HF6A 1JAEA 4W86A 5CPNA 5LNSA 3CZ8A 4LBSA 1PHQA 1C90A 3GVQA 1LBFA 4R88A 4BKNA 2PGWA 3M6YA 1W5MA 3VGBA 4JKLA 1HJUA 2Y6ZA 2E5CA 2PC4A 3GFYA 4ZGYA 3IIOA 1SR0A 1GJPA 4G7EA 3VNIA 2D3NA 1OX5A 5KINA 4IHCA 1RQBA 1DTUA 4CU7A 3APGA 1TZZA 4FAMA 3UVAA 4F8XA 4U4MA 5T91A 4PTMA 4GGHA 3CHEA 4HN8A 4M6VA 4TR9A 3BH4A 5FSEC 7ENLA 4WX2A 3EPNA 3UCCA 2C0AA 5BCAA 1NDZA 4DF2A 3W6YA 3R89A 3TK7A 1GPWA 3WFLA 2XGZA 1US2A 1MXDA 2NQZA 4MKNA 3LM7A 3VPLA 3CZLA 3WZ0E 3ZJKA 5D03A 4D8LA 4GZ7A 1JD7A 2XYLA 3CEPA 1UKSA 5C7HA 4DYKA 3QOMA 1DHKA 3PAOA 3SJ3A 1Q7MA 3QR1A 4PMQA 5FSDC 4L6DA 5XIAA 3KAOA 4O1EA 1WOAA 3JZEA 3T4WA 1UWUA 4MB5A 4IFKB 4QR6A 1JYVA 3AHZA 3GUGA 3C3NA 4ONVA 1VIZA 4P8XA 3ANYA 2IKHA 2XHYA 2GJPA 1P0KA 1MW3A 4XD3A 4ZO8A 3CWOX 2V2DA 3PUDA 3T81A 1CWYA 1WBHA 2E3ZA 3KUMA 2GVYA 2A1YA 2V68A 4O12A 1P0BA 3R11A 5G1MA 1TV4A 4ZR8A 1KV8A 1FWEC 5TIMA 1K9TA 2C71A 1EBHA 3NNTA 1XR2A 2OXNA 4AD1A 4IGMA 2J66A 1EDQA 1E6ZA 4B92A 4JEQA 4Z2LA 3GXDA 5IFTA 3HO8A 3W1LA 1E15A 1PWMA 4Q7IA 2J9XA 4X2PA 4QIUA 3GDRA 1V51A 4M81A 2WHMA 3OA5A 5KZMA 1HW6A 2XG9A 3W7LA 4WDXA 3G0SA 3KHJA 1FX6A 5AHNA 1CBGA 4W89A 4CN1A 1A0DA 1D3CA 1R86A 2ALRA 3L5MA 2A3AA 3OLGA 4UBPC 2Z24A 2ON3A 1ONWA 2YR1A 5AY7A 1J6PA 5A94A 1FWIC 2YBVA 3P7YA 1QHPA 2FDMA 4ATWA 4LRSA 1Q8JA 3V0UA 2ZQ0A 1K8XA 4NILA 4B3LA 4R7WA 4IISA 2NWRA 2QYGA 2FZNA 2NV1A 1KXQA 1M68A 1KO0A 4TIMA 2AMGA 1UKPA 2WANA 4B5NA 1W1IE 4WSHA 3V7PA 1RCOB 2QXWA 2PA6A 4AHPA 3O1NA 3D46A 4LVFA 1W1VA 1W3TA 1DIEA 2JKPA 2V30A 1DJNA 2BHZA 1JZ5A 1WDSA 2ABAA 1ODUA 4WKFA 4FLSA 4CU8A 1V5XA 1K4GA 1UD6A 1EP2A 4ZXOA 5FF3A 3MP5A 4AMCA 3KX6A 4HA0A 2VR5A 3SRHA 2YPIA 4EXAA 4H9TA 3ABOA 5FEXA 4Q4KA 3AICA 1PDZA 1UHVA 3GAYA 1PX4A 4FNQA 2EKGA 2X1SA 4I5RA 4JNZA 3EWBX 3GB6A 3SURA 4K39A 3LRLA 1TTQA 1W91A 1UKOA 1XD1A 5I3IA 3W28A 1G5AA 2NX9A 4JTFA 4REQA 2EPHA 3GDTA 5LIYX 4K7YA 3WQPA 4IQEA 3AQUA 1JCLA 4UMAA 4E8GA 3G5EA 4H6RA 2DEPA 3NQBA 4YTQA 2QJJA 3PFRA 4ICMA 3FXGA 3OP2A 1IGWA 5A8NA 3GS6A 4U5IA 1DXFA 2XVGA 3AO0A 3HQNA 3WD0A 2BVTA 1RCXB 3T09A 3L67A 1AW5A 5CZKA 1OABA 5CPOA 3NCOA 4TVDA 3VOCA 4BFAA 3WLHA 4GY0A 4I7UA 3FDKA 2QDGA 2PTDA 5E09A 1G01A 4XZNX 4HPGA 3GDMA 3W24A 3JUGA 5AHFA 1J8VA 1LUCA 3TCEA 4AW7A 1V3LA 4E38A 1GJWA 4F2UA 5D2XA 1R85A 1XBVA 1EX1A 2FHFA 2W61A 3DBPA 3KE0A 2ZRZA 4HTYA 2INZA 1JI2A 1UUQA 3GSMA 3SRKA 2ZFAA 2OOGA 4UNKA 3UPBA 3T0AA 4NZ3A 2HDJA 3F5KA 3CT7A 5HULA 4LCRA 1CYGA 1B4KA 2DVUA 3DI0A 4P61A 4RZ5A 4Q4SA 3HJZA 4GI8A 2O92A 2BY0A 3UZXA 4JQ1A 2ANUA 3EMZA 3NO3A 2WHKA 2Q6ZA 5LZLA 1YTKA 2OYMA 3DUGA 2E09A 4M1BA 4AEFA 3AJXA 1QPNA 4D6JA 5AC6A 5HANA 1S2CA 4KRTA 6PTDA 3BK0A 2CBIA 4IMGA 3ZZ1A 5LIXX 1PZ3A 4JN8A 4OT7A 1FA2A 4BWLC 1WZKA 1OF6A 1J2BA 3LY0A 2X0SA 1LL4A 3PTQA 4D8AA 2GWNA 3NEVA 4JIEA 3HFTA 4ZCWA 4DBUA 3BCJA 4IQJA 4BQ5A 1XSIA 5CC7A 1BRLB 2F8QA 2ZCGA 1LRTA 3GH4A 3CH9A 4JN6A 2VGGA 2HISA 4O0QA 2JALA 3RCMA 1K8ZA 1CXKA 4D6EA 2TYSA 4V2XA 3MMUA 3TLQA 2EG7A 1WKYA 2QDEA 4X22A 1EJTC 4R33A 1XLCA 3DFQA 3P81A 3BDKA 4AXNA 1EQPA 1U5VA 3UXAA 3LRKA 3TW7A 3HPZA 3ZIZA 1I1WA 2AAAA 3PAJA 5I79A 3DFOA 2ZE3A 4X0NA 2WVVB 3BV4A 3MS8A 4HYRA 3BARA 3B9AA 4HOWA 4DZAA 3POCA 1GOWA 2CLMA 3IJ6A 1TR9A 4B5WA 4F40A 4DUVA 1HUVA 1I6NA 4IP7A 3RJYA 4TMBA 2YXGA 3SZ8A 3P0WA 3DAQA 4AYSA 1RPXA 3TC3A 1QPKA 4AF0B 2OCZA 5J5RA 2QCMA 1JYXA 4E2OA 3R2GA 3TYEA 1EGMA 4Z1YA 2IQDA 3BXWA 4KWVA 1XBZA 3TQ0A 1PEZA 1IGSA 1Q6QA 1IEXA 2Z4GA 3DKJA 1MQQA 4LVBA 1NFGA 2VEGA 1CGXA 3CPUA 3RPDA 5DY3A 4V27A 2QUTA 4UQDA 2VEKA 2JQXA 2GQ9A 3W1XA 1EO7A 3HJEA 3UWWA 4NI3A 4ZFCA 3CAVA 1ZB5A 3ZLGA 2QUNA 3UCDA 1UMYA 4WCJA 1DE5A 2EPOA 3DHPA 3M0LA 2ZWYA 1A3HA 1K70A 3P5ZA 1GG1A 3TWAA 1X8CA 2A4AA 4L4OA 3NQGA 1DWFM 3T0BA 1FRBA 2G3NA 4IICA 2GDUA 2A21A 2FHBA 1ONRA 2I7GA 4UFIA 3UXKA 2YZRA 3WNPA 3MT1A 4C6CA 3AYRA 1OG6A 3IIXA 2PDPA 4EX4A 4AFYA 1DL3A 3GR7A 4FLRA 1AG1O 2C6QA 4YVXA 3TSBA 3I68A 4YTSA 4GD0A 3IJLA 3RF9A 3ONCA 3S2MA 4HNVA 1XQLA 4HYWA 3LXAA 4ALDA 3PB0A 2YL8A 3R1ZA 1JDDA 3NZ1A 3QSTA 1HG3A