3V18A

Structure of the phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
molecule tags Lyase
molecule keywords 1-phosphatidylinositol phosphodiesterase
total genus 113
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v18A00
1YDYA 1O1ZA 2OTDA 1QASA 1ZCCA 2OOGA 3H4WA 3H4XA 4PTDA 4QJ3B 3V1HA 5PTDA 2ZKMX 2P76A 3L12A 3V18A 1DJWA 3MZ2A 1PTGA 1GYMA 4GNKB 6PTDA 3NO3A 1XX1A 3KS5A 3OHMB 3KS6A 4I9TA 4I9JA 3QR0A 3QR1A 5T91A 3EA3A 1DJYA 1V8EA 5T9CE 7PTDA 3EA1A 4F2TA 2ISDA 2PZ0A 4RV3A 4F2UA 1DJIA 5T9BG 3RLHA 4F2BA 3EA2A 3QVQA 1DJGA 4S3GA 1PTDA 4R7OA 3PTDA 2O55A 4RW3A 4RW5A 1QATA 2PLCA 4QJ5B 2PTDA 4OECA 2F9RA 4QJ4B 1DJZA 1DJHA 4I90A 3CH0A 4I9MA 3V16A 2FJUB 3I10A 1DJXA 4I8YA 1T8QA 1VD6A 2OR2A 4Q6XA 3RLGA 1T6MA 1AODA
chains in the Genus database with same CATH superfamily
1OJXA 3CQKA 3STCA 4LAKA 1XYFA 1MXGA 4F2TA 2XZ7A 2VO5A 3R4IA 1ZRQA 4LQ1A 2JKPA 3MV01 2WMIB 2XFYA 4NILA 2OELA 5U4NA 3TYBA 4BI5A 3FA5A 4V33A 4N02A 4IMEA 4LVGA 3KOXA 4M82A 3KWXA 1UUQA 2X42A 4GZJA 3GLCA 1EBGA 1M04A 4MJ4A 4YLWA 2A3LA 4O1DA 4RE4A 1ZU8A 4RPQA 4PCTA 2VZUA 4H8UA 1OT2A 4LEQA 4M1BA 4IMFA 3Q67A 2BOGX 2H8XA 1S5VA 3BANA 3VNZA 2RGLA 4Q7NA 3O2LA 1E15A 2NQ9A 1F3XA 4IH3A 3UGVA 1QAPA 3PSWA 1PYMA 3E74A 4DUWA 3W73A 1OCBA 3F4DA 2DSZA 4D1JA 1KR0A 1A3HA 3GVVA 4AZGA 3IGXA 5AYBA 4MPKA 3TTSA 2NV2A 3OQ8A 1S3HA 3R6IA 1C93A 5BRPA 3S1VA 4HPXA 1WDPA 3V0UA 1BLIA 3DECA 4QJ5B 1XRVA 3A4AA 2OEKA 3CYVA 1CGTA 2BVYA 3FXYA 3OZOA 5DMNA 3R25A 3ITXA 1YBQB 2X1SA 1FHUA 3M0KA 3LPOA 1SZRA 4ONVA 3LDVA 4NF7A 2PDCA 4UTHA 1FX6A 4IJBA 1RV8A 1V6YA 1UR4A 2O7QA 5DEZA 4ENLA 1I75A 3EX6A 3UXKA 3N17A 1EDGA 3TK7A 2F8QA 5I2UA 3UWWA 3WLOA 3DXIA 1KB3A 1UOKA 2EKCA 4AHQA 2Z4GA 1QJWA 2DJXA 2CLLA 1GKQA 3RU6A 4DVOA 4J3VA 1FHVA 2I9UA 5C7VA 3TV8A 5K4XA 4AEEA 1F9CA 4K6AA 1FCVA 4MG4A 3MVTA 4O4WA 1D7KA 3LCXA 5F2IA 1KR1A 3KBVA 5D33A 4Q4KA 4A4AA 3F2BA 3WDQA 1LT7A 3QV6A 4GJ1A 1DIEA 4Q8MA 4F0LA 1QOXA 1KO0A 3AMLA 4FMVA 4KWOA 4LNYA 1WE5A 5D9MA 3SJNA 1US2A 1O95A 3LCGA 3WLSA 2H9AA 2X7WA 3PN8A 3QM3A 5AHLA 1J5TA 4RLIA 3EOUA 5T91A 5DT5A 4XB3A 1U1JA 3PTQA 2NQJA 2I16A 3GBDA 1MXSA 3UZZA 4IQEA 3R58A 1TO3A 4UC5A 2J25A 4ZO9A 4D1IA 1NWSA 3MSYA 5HPOA 2ADAA 4MF4A 2X1IA 1XH2A 3WBXA 2BOEX 3JZUA 4MFDA 3RR4A 1GVFA 4NRSA 2CKSA 2H6RA 2YL5A 3GAKA 1TVPA 4V2XA 2PDJA 2QDDA 2JBMA 4A21A 3FVMA 4KRZA 4W84A 5HNUA 3E9AA 3QC0A 5J5DA 4H9XA 1LL7A 3I65A 3W3OA 3MSDA 1KC7A 5BCAA 1NVMA 1WKFA 1PWLA 3VKKA 3SDOA 3PWIA 3NJ3A 4OE7A 4J3XA 4PBGA 2BGQA 3P74A 3TYDA 2XZ9A 3RHGA 3LN3A 1EC8A 4A8IA 1P0DA 2QJMA 1RQHA 4Q8TA 5ABFA 3L5LA 1RBOB 4HNCA 4U33A 3CIVA 4MY9A 4K2SA 2EG7A 4Z1CA 1TQXA 1SR9A 1LQ2A 1RK6A 5DO8A 1QPQA 3PUDA 4YCOA 4RCXA 3AIVA 4H9YA 5FAGA 2WNQA 2FTWA 1OX4B 4KH2A 4FXRA 1A4LA 4O52A 1H11A 2X09A 1SSGA 4LYRA 3OEXA 5CPSA 3RX2A 2YA2A 3KUMA 2VDIA 3S0CA 3WIJA 1ADSA 2X0HA 2OZ8A 3THQA 2B7QA 3EDDA 2Y61A 4XVEA 1K9FA 2YSWA 3JZEA 4NNAA 4GQRA 4GUHA 2Z1BA 4H4IA 5FD0A 5AYXA 3TSBA 3LBOA 4JTTA 4PGLA 3QKEA 2QXWA 3C5QA 3D0CA 4JTEA 4PH6A 4H6RA 3F4NA 2WVUA 3FA4A 3ITLA 5U7SA 3H4XA 3DCPA 4L6OA 3SIZA 4MJZA 3TC6A 1R2TA 4HNUA 4LAOA 3SCSA 4JTIA 5HJLA 3UXDA 1OFPA 4LVBA 2YL8A 1K02A 3GVRA 1XKJA 3EYPA 2RKXA 3UG4A 1QO2A 3AWNA 3BW3A 3JR2A 4I6VA 1XLMA 5LGXA 1C91A 2ZCGA 4AC7C 4KRTA 5AZ0A 4GBDA 1UJPA 1BAGA 2VQTA 4Z1YA 4JIEA 2OO0A 1TWIA 3W37A 4QQ3A 4I5RA 2B31A 3WUBA 1S2UA 3SGZA 3ID7A 1EKOA 6REQB 3MMWA 3H22A 1M6JA 4IIEA 3C4UA 4K1GA 4ZBCA 2RDXA 2VM8A 2QR6A 3E5PA 2PU1A 3SB0A 2X40A 3IS4A 4EWJA 3AAMA 3GNDA 1GZJA 4YCPA 3GHSA 4P5UA 3PBYA 5DY2A 1EGZA 1VCGA 2WCSA 1EJSC 3P5ZA 3VFLA 4B5XA 2XIBA 4LUTB 1FWEC 1Q45A 4N9EA 5EFDA 4GINA 2DIKA 4K38A 1VJIA 5D2TA 3LUTA 2OSXA 5J5RA 1JYNA 1VHCA 1HJXA 2GZXA 1XLFA 3MHGA 2YFNA 3G1YA 6TAAA 3B8DA 4I9MA 5AFDA 1Q2RA 1R46A 2W4XA 3M0HA 3PNZA 1U1HA 1N82A 3K5XA 3A4XA 3M9YA 3MANA 3GX9A 3CL7A 4PRTA 1TCDA 3DHUA 4ACYA 3PZ9A 9XIMA 3NEHA 3WUFA 4YYFA 1XR2A 1TCMA 2YDAA 3DC0A 4KCUA 1M7OA 3WUEA 4FLSA 2F38A 3GC4A 4PMOA 2E6FA 2NX9A 1KTNA 1KA9F 1GVRA 2FHCA 4IPPA 1TV7A 5LHFA 4QXIA 4BWLC 1ZSXA 4P7LA 4Z17A 3N3MA 3GNNA 4E3TA 1JUBA 1UKPA 5CXPA 2DT3A 1UA3A 1TR9A 3BH4A 3MT1A 7ODCA 4ZOEA 1KWKA 3V5CA 3BMWA 3SW6A 5HMDA 1V3KA 2ZXBA 2ZUTA 3QEZA 4GLEA 3MPGA 4XISA 1HKKA 5HR6A 1H0GA 3ARUA 3WLNA 3W24A 3W71A 2ZWZA 1WKEA 4L9ZA 3T0TA 2Y8KA 2AGKA 3UWVA 4JTLA 1JCNA 1HO1A 1HP4A 2D1ZA 3UCCA 1IXOA 4J3SA 1OVDA 2HBVA 4HA1A 5TNVA 1PJ9A 3G5EA 2IQTA 4K39A 1J10A 4RE2A 4IIDA 2DW6A 2EG8A 1VS1A 1Q7ZA 3PBVA 1MDRA 3NEVA 3B4YA 2ZZ4A 2ZRYA 2CLEA 2QCHA 3EOOA 2DZVA 1SU5A 2FVKA 4DJEC 3UJEA 3S3GA 1UQYA 4AC1X 2RDUA 3U5YA 1ECEA 1FCUA 2W92A 2FKPA 2QCDA 3T07A 4IGNA 2RHGA 4PE8A 4F0HA 3TYCA 3L2IA 2Y8VA 3VI2A 5TD4A 1RY8A 2DVTA 5AC4A 1V3HA 2GFTA 3ITYA 3QLLA 1GEHA 4RZBA 4LWWA 1EZ2A 1TIMA 1KXTA 1I8JA 3S1WA 1H7NA 3Q65A 3QY6A 1ONRA 4GFIA 2FGZA 3UXLA 2A3EA 2XH0A 4OZOA 5D09A 4H1ZA 3W7HA 4F3HA 1FWBC 3NSXA 2ZADA 4MUZA 1QNQA 4I90A 1RQBA 4YS1A 2XH4A 1E0UA 3SGUA 5EKYA 1EO5A 1VBJA 4AIUA 4ZOBA 2B81A 3SSZA 3V1PA 3N6HA 3HFTA 1JI1A 2FPVA 3C2VA 1BSIA 3G8EA 1GJPA 3AS3A 3CV2A 2YDRA 4X0VA 1QPRA 4IMCA 4YHEA 4CU8A 4O0KA 4MDOA 3BURA 1AD1A 4AXNA 3ZO9A 3AISA 4AD0A 3IIVA 1KM4A 4I7WA 1M7PA 3CZ8A 3WLQA 3L23A 1UBPC 2OKOA 2GSHA 3UPBA 1YEYA 4JY8A 4W8AA 4F2UA 4JTUA 4B16A 1EJXC 3WDRA 1Y7VA 3L21A 4DO7A 2NXIA 2PLCA 4GI4A 2BY3A 2CWNA 5XINA 2J77A 1EYWA 4DPPA 1LBMA 5D8WA 3TZNA 5FEPA 4NNCA 5HQEA 4D8ZA 1PX3A 3ZLFA 4LCRA 1WV2A 5FACA 2C8NA 1X38A 4UWMA 4NZ4A 1A3WA 3UP8A 3VUPA 1F4AA 2H3BA 5A8QA 1XKYA 1TIWA 5EB8A 3V36A 1A47A 3N6QA 1UJQA 2DFAA 1EA0A 3DFOA 1ADDA 3WELA 4FF7A 4F0SA 4RW5A 5CLTA 1Q5MA 3USBA 1W1B1 3U5UA 4DXKA 3BAYA 4C1KA 4KQNA 1P0NA 2EJ1A 3MUCA 3MMTA 4HNLA 4EVZA 2X2YA 4NAFB 3W2UA 1WOBA 1B0IA 4JFSA 4H7CA 2PLJA 3IGUA 1KQZA 1KM2A 2XVLA 4R85A 4JR5A 3HV8A 4G1KA 2A79A 5LA0A 3BTNA 3N34A 3P14A 3QPYA 3W7EA 3CO8A 3WJWA 2TODA 4ZO8A 5FJJA 1E5JA 2X8RA 5LIKX 4NZ3A 2NW0A 3WK1A 2A3BA 4XZMX 4HMDA 5IXEA 2WVSA 1J11A 3B03A 1QMLA 3GTXA 1OZMA 1E4LA 2DZPA 3WBWA 4BHYA 3NAVA 1GZ1A 4LS1A 1JGMA 3O0KA 4C91A 3WH7A 1M1BA 4GZIA 3HTWA 5BMXA 1CXIA 4GJIA 3H7RA 5A94A 4D6DA 4DJFC 2WHMA 1TB3A 4JYDA 1GK8A 1Q13A 2RH9A 3C86A 3DI0A 3ZJ8A 4K7YA 4O13A 4PMJA 3VILA 2EO7A 2PPGA 4M80A 3PNUA 1Q8JA 1BYBA 2CZVA 4Q6JA 2W67A 3KVJA 1W54A 2C0HA 4M0XA 4IISA 2UZ9A 5A6LA 2XN1A 4J3UA 1DJWA 3E2VA 2POTA 2F7FA 1PB0A 1W1YA 1ENUA 4F4RA 1ODUA 3TW9A 1H1ZA 3DDMA 4IG2B 3O05A 3RPMA 1E6XM 3D5HA 3QOKA 4XUGA 1L6WA 2BY0A 3L2LA 3M16A 4K8HA 1UPPA 1RSCA 2Y62A 3ARPA 3FW6A 4PN2A 3PZUA 4PC8A 3TA6A 4QE5A 3GQYA 2ZICA 2VFIA 4U28A 3M7SA 3S42A 1LROA 3KVKA 5A8NA 5EMLA 2GDUA 4AZ6A 4MM1A 2DU2A 1U1UA 3GM8A 3QKZA 4S3CA 4QNWA 4QSFA 3GSMA 3I3EA 3FGCA 1XLLA 3SUWA 1Z44A 4UTIA 2A3AA 1XS2A 3VAVA 2PC8A 4ZSTA 4C60A 1W3IA 1W3LA 5JH1A 4GCAA 5EBAA 2FGBA 1HJQA 3VNLA 1YXCA 3P82A 3UWZA 4S3FA 3P6LA 2CC0A 2I57A 1H62A 4EK7A 1CENA 3NL6A 1DTNA 5BOFA 2WSKA 3BLFA 2DORA 3OIXA 4YWSA 5CBIA 2ZXAA 4JIRA 4TXEA 3WH5A 4JYFA 4UTTC 5IOBA 1DWHM 2ZX5A 3KBNA 3AHVA 2Y5EA 3N2BA 3UJSA 2WYSA 3W01A 3KWSA 2OZTA 1TZ9A 4LCQA 3CU2A 3VXGA 4DBUA 1WDSA 3GFZA 1VBRA 1RD5A 3O8AA 4WOQA 1SQ7A 1MUWA 4NRRA 2OCZA 5I79A 2AL2A 4JQ4A 1EF2A 3EXRA 3LGDA 2C71A 2NLIA 3GW0A 2D0GA 3VNMA 1OCQA 3WQPA 4G9PA 5F2GA 1OYAA 3MS8A 4QG6A 1TUFA 2HVMA 3AXIA 4Q8WA 3QOMA 1ZAHA 1OT1A 5I02A 4AY1A 2JEPA 2PGRA 4K1WA 2VHLA 3KBJA 1HGWA 4ZB0A 1I2OA 1TPUA 2CBJA 2JKEA 2YYTA 7A3HA 4LX4A 4GWEA 3O15A 2WMHA 2I17A 2ZZ7A 4LCSA 4K8GA 3IK4A 3NVTA 3ZQ9A 4OQVA 1X6UA 4HMEA 1V0LA 2VGBA 3GDTA 4ZQOA 5IM51 2VEGA 4JCMA 4P7QA 4PR4A 4D6HA 6CGTA 3CV1A 3M0MA 3FEQA 1EDQA 4IZGA 2EPOA 4HPHA 3HGSA 3LRMA 3SN1A 4DO5A 4WKFA 3HQPA 2XFRA 1T41A 3IJLA 3VTRA 3BAWA 3VABA 3V0TA 4W88A 4LVDA 4LYQA 2W79A 3A3HA 2Q09A 3OVGA 1S5TA 3TDFA 2CYGA 5FF3A 4CNTA 1WA3A 3SCWA 4DAFA 3R1ZA 4JS3A 1VYRA 1BYCA 1D3CA 1H51A 3MYOA 4O0ZA 2CKRA 2R1PA 4A8LA 3PTDA 2VT0A 1UW9A 3SN4A 1JVNA 3LHZA 4ZXLA 5M2FX 2V8ZA 1FWNA 3DHDA 3POHA 5AVHA 2VENA 5FF0A 3SIMA 4UBPC 3MV11 2GUBA 3EB4A 4OFCA 5GJMA 3M0YA 1P7TA 3GYCA 2E7FA 1NAL1 3PZIA 3FY1A 3QGVA 2FPYA 3MWCA 3CMFA 1BSLA 4PMQA 1E70M 1FP9A 1NOFA 4FZIA 5AYYA 4FLQA 4IQDA 1PUDA 1OK4A 3NVDA 3B3DA 4G1NA 4DYKA 3CHVA 5BU9A 3PF3A 4AUBA 1R9XA 1XD0A 1NIUA 1JGIA 1DWJM 3ABSA 1EHNA 3QSRA 3OBEA 2V63A 3GNPA 3BXWA 2QCMA 5ECUA 1H0IA 4DXXA 4BZYA 3B0UX 3SSJA 1VIZA 3WF3A 4LV9A 4JIQA 1W1PA 3DG3A 1EIBA 3NO5A 3HM7A 2DUZA 1HL9A 3P93A 1XM3A 3EZ4A 5K2ZA 2VC7A 2JALA 3BW2A 3SEPA 3AHYA 1QW8A 1XV8A 3MWAA 3ME3A 4GVIA 3W1MA 3G24A 4XZIA 4ZR8A 4A2RA 2J8TA 3NG3A 4YXGA 2JGYA 3ABXA 4TR9A 4E2VA 4LOCA 3G8RA 2WM0A 3GWQA 3SCTA 2ZTJA 3O1NA 4X0NA 4DBDA 4Z2HA 4JTRA 4RDVA 4FX6M 4PL1A 4B3LA 1RPXA 3PBMA 1K4GA 3GD6A 3RF9A 4W5UA 3TZFA 4NNBA 1OF8A 4ILSA 3W2NA 5M5DA 1QXLA 3QQ1A 1ICPA 3PAOA 4AAJA 2DUAA 2ZZ6A 2RJGA 5E6ZA 5J8LA 2P0OA 4FS9A 3WDPP 3M5ZA 3TXZA 1ME7A 3BOXA 3RK8A 1SMDA 3LENA 3OB8A 1FKXA 5CEWA 1HW6A 2X2GA 5DANA 3ES8A 3SUTA 3NQFA 3KAOA 2HE5A 4S3EA 4XSMA 3NSMA 5ABFB 2A5HA 5EBUA 3W2MA 4TTUA 4CEUC 5I03A 4GI6A 4Q4SA 3GC5A 1Q65A 4A35A 1WDQA 1NM9A 4GK8A 4LF2A 4EKJA 5D32A 1OG6A 1EP1A 3RUBL 2ZKMX 2PZNA 5HR7A 3SO7A 4XAPA 4UTFA 4WJ8A 1B9ZA 4CEXC 1R5YA 1QNVA 1SZGA 3ATZA 2O55A 1QPKA 1J4EA 3FLUA 1GORA 3W7PA 5CC7A 1SZNA 4DWSB 3S2LA 1LP6A 3KOWA 3B9NA 3CZEA 3R0DA 4YNGA 1V08A 3GRIA 1R2SA 5LIYX 3N19B 1HVQA 4F9JA 2XIIA 1BWVA 1FOBA 1HNYA 1CGVA 2QJIA 5CZJA 4HQVA 4NG3A 5BMWA 1YHTA 2PTDA 2C7FA 4DEFA 4MNMA 2IXVA 2HE8A 1OYCA 2G3JA 3U57A 1F2JA 5D9OA 1EX5A 1UKOA 1OGSA 2C13A 3TXVA 4KW2A 3L4UA 1QBAA 1VAHA 1RCQA 3FSTA 3NTYA 3EXTA 4DJED 1QI0A 2V6AA 1EFZA 4H2HA 3WH8A 2Z27A 1OFEA 4UTTA 3CGTA 5K9XA 3WQCA 4NT0A 3E12A 5T9CE 2WO5A 2OYMA 4IMAA 2WZIA 4H9ZA 4E8GA 5C5YA 3NWRA 1E3ZA 1KCZA 3PUOA 2NSOA 5LXEA 2ON3A 5LHEA 3B9EA 2OXNA 3ZZ1A 4N2YA 4CD5A 4A3HA 1ISXA 3PUGA 3RCYA 1W5PA 2H3DA 4ZO6A 3VIPA 1BPLB 5K7JA 3BPWA 1REQA 3WNLA 3STPA 1LRQA 4PMDA 4Q8PA 1M7XA 1I0DA 1UROA 1UR9A 3WDIA 1KRMA 3H24A 3BJFA 2VX7A 1B54A 4QLLA 1GVYA 1DHPA 1B3ZA 3PC0A 5AYZA 3NSNA 3CH9A 1JDCA 1YPIA 2AMGA 3G3MA 4WGHA 4JKKA 1RA5A 4I7VA 2RGMA 1YBQA 1TJ0A 4PUMA 3ITOA 4ZEPA 4ZOCA 4GBUA 1G4SA 4GO8A 4LV4A 4RNIA 1O66A 1ITQA 2V5BA 1JYWA 2XGBA 4EWND 3VZZA 4FIQA 2YZ5A 4UTUA 2WHLA 4NJGA 3PY2A 1X96A 1J93A 2CBIA 4UFMA 4IPJA 3WEOA 3F5KA 3DYOA 1FCBA 3SECA 3I6RA 1XUZA 2DSKA 4UNKA 4J9JA 3RJXA 3BZJA 3BJSA 1EEPA 4YYCA 1RJRA 3AYVA 3RM4A 3MJMA 1VLIA 2IXUA 2AAAA 1RUSA 2PSNA 1SO5A 4C6FA 1UBSA 3W1AA 4P61A 2FZNA 2JE8A 3AXKA 1F7BA 4AIBA 2NVAA 2D3LA 4GYPA 2BXVA 1XG3A 4B92A 1H41A 4A3RA 2VC6A 2I14A 1EO7A 3UU0A 4IUOA 3KHDA 5FEXA 3IUHA 2QF8A 3WF2A 3M0ZA 3E0WA 2REQA 4RNHA 5SWUA 3PFRA 4S3JA 1LJYA 3S9ZA 1EPXA 4M7TA 2BX7A 3ZR4A 3TOPA 1CCWB 3E0FA 5BOOA 3WL1A 1I2PA 4MNKA 1DP0A 1ZCCA 3WLMA 3NZQA 3W2LA 4JICA 5CPTA 2W9MA 5I24A 2G41A 5A2AA 2FHFA 3MSRA 3EDFA 3W7QA 2ZRZA 5CZSA 1AW2A 2A6NA 2ZZ5A 1KNWA 2HNHA 4OV9A 1DOSA 1JCYA 4OBRA 2VEKA 3W27A 1B3XA 4XAYA 4GOAA 3DBNA 3IGSA 3WEMA 1RJPA 3OIHA 1I6NA 1XHGA 4FNTA 1DJZA 4GA8A 3L4TA 1K4HA 1J0HA 1GPFA 4CKQA 1RLCL 2FZMA 1P7TB 1YX1A 2OEJA 3UA4A 1VFTA 4XBKA 4DJFD 4GYFA 5LNVA 5BNKA 1D8CA 3SFKA 2GJXA 1KBLA 1NWTA 1WUFA 4AMAA 3HZ3A 4LUSA 1TZZA 2DZSA 3BSHA 2Q8LA 2DZXA 1A5KC 5KEZA 4JXCA 1EA9C 3VIOA 3LV5A 3CIXA 2V5JA 4BJHA 3HPFA 2V81A 2XISA 4HJFA 3UY7A 2Q6ZA 4L4LA 3BLLA 1JZ7A 1JAEA 3LMYA 1OD8A 1XIFA 4HZ7A 1B4KA 4XAZA 4HNOA 4N42A 1D7FA 1LLZA 3MC5A 1VF8A 4OOUA 4B5SA 1XGDA 4V1XA 2VKZG 1XCFA 4CVWA 3DYMA 1DQXA 2O4MA 3T09A 3ECQA 1R3WA 5A6TC 2HCVA 3VOIA 2Y88A 2PZ0A 3FJ4A 3EWBX 1IQ8A 5HDRA 3I3BA 4AVOA 4GYPC 1DJGA 2VYOA 3E2QA 1XLJA 5LZLA 2CESA 3DUGA 4I8YA 2YA1A 5TF0A 3W29A 1W2PA 1BVNP 1W1ZA 3VX0A 4J40A 4S2BA 1ITCA 1HKIA 4C7GA 1FWIC 1LCOA 4DM1A 4AD1A 4U3CA 4QLJA 4PCFA 4FA3A 3NQ6A 4DJEA 4YN5A 3VIKA 2PP0A 1PKMA 3KL0A 3MI6A 2YDQA 3BAKA 3LRLA 3OVPA 4MB4A 3CB8A 4MLRA 3T8QA 5D2XA 3T6CA 4L6DA 2OU4A 2PDIA 1UIPA 2XYLA 3W76A 3W82A 1NOUA 3G0UA 1A3XA 4BFAA 3M0LA 1R3VA 3GHTA 3S8HA 2D73A 1WDRA 4WDXA 4Q6XA 2PTWA 2YB1A 3FEMA 4GD0A 1PIGA 4PYSA 1VFOA 2VDGA 4OTKA 1LDCA 2F61A 1GT8A 3ZVHA 5B7YA 3B0PA 3IAPA 4ZB5A 2PRMA 5G4EA 1O12A 1LG2A 2C15A 2HWGA 4HMNA 4XO6A 3VK5A 4ZGYA 1IE7C 1PZ1A 2EPMX 3OQEA 3S6OA 3ZYZA 3SADA 3WD1A 1O4UA 1NARA 1O1HA 5RUBA 3CZJA 2I5QA 2A7PA 3CMJA 4PB3A 4BI7A 5F1VA 1RBLA 1SJAA 3GTHA 4B2DA 1OWQA 4GZ7A 4C5YA 3MYPA 9CGTA 3FYPA 1TPVA 1HF6A 2POZA 3L4YA 3SY5A 1GNXA 2E6DA 4AW7A 2NQZA 1PIIA 1DE5A 3O63A 1GOOA 1SW7A 4NZ1A 2FH6A 2P8CA 4NI3A 4PTNA 4C6BA 4E8DA 2UY4A 2QCFA 3GR8A 1ITUA 4UQDA 1AW1A 4FHAA 1PKLA 5I3JA 3WD2A 3HQ1A 5KZ6A 4MYXA 1GGOA 4UIOA 3DFYA 2IKIA 4P8WA 4ZSUA 1JCMP 3HOJA 2O4QA 2VX5A 1M68A 2J7FA 4HSOA 4PTVA 4LNCA 2EGZA 2VP8A 1EOKA 1AH3A 2Y4SA 4Z1DA 3O06A 1OC6A 1TMQA 3KOFA 4I8DA 1ISVA 4U31A 3RLHA 4TVDA 2EPLX 5DQPA 5C2CA 4O17A 1GCYA 5HUPA 5BXSA 1R87A 3HG2A 2OO6A 1OHLA 2V5CA 3A4WA 5D4YA 4K8EA 4MZ8A 1GHRA 1ADOA 1IXQA 4JKMA 4MUPA 3HGRA 2ZUUA 4P8UA 3TQVA 1IGWA 4Q7IA 2WSYA 3TJIA 3GBEA 1NELA 3JRKA 2D22A 3UF9A 2W62A 1LOQA 1J6OA 1KFJA 1X39A 3QH2A 4RR4A 2R1NA 3T40A 2Y0FA 3WO8A 3EA1A 4EXBA 5I5RA 3B40A 1W56A 3GG7A 3TR9A 1E4NA 4LUYA 3UFYA 5K9CA 3F2DA 2PRHA 2F9RA 5HANA 1R86A 5E6YA 5CC3A 3CASA 1LTDA 5FOOA 2QQ6A 2Q02A 4IPLA 1S1PA 4ZQNA 1XIJA 1EJTC 3R0KA 3WFAA 3TLQA 4DJFA 1IT8A 1AL7A 2IKGA 3ALFA 2P1FA 4JQ3A 1CTNA 3QFEA 2OGYA 3SUVA 1J0YA 1HUVA 3KCJA 4W93A 3HB9A 5HUOA 4AWUA 4ZTXA 1F07A 2GJNA 3FNDA 1KFCA 3LPFA 1YE4A 3S6TA 1O94A 5C55A 1TV5A 1LWJA 3RG6A 1ISYA 1V5XA 3C3UA 3A22A 3MMUA 5I3IA 3UJRA 4A3UA 4H83A 3M0VA 3GDMA 3QZAA 4M1RA 1JPHA 3AIRA 5D8ZA 1UIOA 1FWHC 3A24A 4Z2KA 2Z1VA 1G4EA 1Q3NA 2C14A 4DWSC 3UW6A 1CB2A 1CXLA 4JTDA 4QFUA 2G3IA 2GVGA 1YMYA 2ZRWA 4OJYA 1OM0A 3WSUA 1ONXA 3DH7A 3PZVA 3WBAA 4LBUA 4EAMA 4JN8A 4HPNA 3EWUA 2FB3A 3UR7A 3C0SA 1YDYA 4WY0B 4V1YA 2QF7A 1BYDA 5CZ0A 4V15A 3MO7A 1JCTA 3HQOA 4UZSA 6TIMA 2J47A 4NU7A 1WXZA 1WOAA 2E1DA 1YNQA 3T08A 1C9WA 3G1DA 3OLGA 1EBHA 2ZOXA 4FI4A 4RNJA 3CIWA 4Y9MA 1LBFA 4ACZB 4DLMA 1QWKA 2UWFA 3PP7A 2H9AB 3SR7A 1OFDA 3PZMA 1JNDA 1N7KA 3N2MA 3QBUA 1U22A 1ZS2A 1PEZA 1UH2A 3VE9A 4FNUA 4O57A 2B0MA 3DU0A 4GISA 3KRSA 4HU0A 4Z08A 1DIKA 1E3XA 1KFKA 3TN5A 3GTIA 1OFOA 2ZX9A 1CLVA 3FKKA 1BG4A 3AUOA 2R94A 3MDWA 1XDJA 1OGBA 3GYEA 5BOEA 1J5SA 2W5FA 1KM6A 5H8MA 1QTWA 4CQDA 2DP3A 4JHMA 4E2OA 3VNIA 4PRWA 1GEQA 4IXXA 4MWAD 4F8XA 3EX4A 1W17A 3DGBA 2EBNA 1UZ4A 1BXCA 4JL2A 2G95A 4MADA 1ZAJA 1H2JA 3W28A 4XBJA 1J0JA 4S3BA 3KW3A 1N8IA 1E56A 1EC9A 4A3QA 4F66A 1TPEA 3L9CA 1Z42A 1GVOA 2F84A 4IQJA 5JMUA 3E02A 4BWLA 3WK3A 2G96A 2J9YA 3BZGA 1B57A 1L9WA 4HPJA 4M24A 3ARTA 2V67A 1ZAIA 3AZSA 1BHGA 4KEMA 4Q8UA 2BHUA 4NJIA 3QR3A 2OJPA 4NXKA 3T9PA 4MB1A 3GG8A 1NFPA 4Y6GA 4JNYA 1JQXA 1MZHA 1XBVA 3CAVA 1XLCA 3AMDA 4TU1A 1ZY9A 1JI2A 3VNDA 2OFJA 2FVMA 2OB3A 1UQZA 4IL2A 6PTDA 2E25A 1H63A 4UOQA 3C6CA 3GNXA 2DY3A 1V0MA 1B3VA 1XCXA 3UWQA 4PEEA 1GKRA 3LMZA 4NQ1A 1W1VA 3VCCA 5CQ1A 4H6KA 1YKWA 2TMDA 1UASA 1V93A 3TEVA 1VFLA 3VFCA 3FDKA 4KWSA 4H9TA 3RYSA 5LNUA 4ZVJA 3AYSA 3CUHA 3QZ6A 1SR0A 1AQFA 3DFPA 4F9DA 4HOWA 1DEDA 4LXFA 3PJXA 4AD4A 3M0JA 4C6NA 5H91A 1AZ1A 4DZAA 5A6JA 4U5IA 2PGWA 1RALA 3C2FA 3SRHA 2WBKA 4AWEA 4BEQA 4JPGA 2IPFA 2ISSA 1LF1A 4XV0A 3TWBA 3LHVA 4ZQRA 3U2EA 1U5HA 1T5AA 3OLDA 1J96A 1JFHA 1PCKA 1KW1A 5D02A 1TVNA 1DWAM 4B2DD 4PMYA 3HPZA 1HJUA 2DZTA 2Z28A 3F4CA 1GJUA 3WNKA 3W6YA 2QKFA 3GXIA 2QPXA 1WZKA 2WC7A 2Y7EA 3RXZA 1SJCA 4N4PA 3STGA 3P67A 1Q2SA 1LM1A 2WNNA 3FV9A 1QT1A 1SJBA 4ZXOA 1FWTA 4GYJA 2QCGA 5I3GA 3EDJA 4ZO7A 2EPNA 1UP2A 5XIAA 4HTYA 2EXOA 3W7RA 2CETA 1U30A 1UH3A 2GDVA 2NQLA 3L7RA 1FWJC 4UFIA 1TTPA 4KCTA 2DSUA 1ME8A 1XGEA 4LB4A 2RDWA 2G3NA 3B8SA 2MNRA 5B80A 1SUXA 4H01A 5CJNA 4N9BA 3T0AA 4YTUA 1I1WA 4CGTA 5HULA 1OFAA 1V02A 3M43A 1VPQA 3UNDA 2Y1HA 5IRPA 1IGSA 4RDYA 4UQ9A 2J7DA 3TE9A 3VIHA 1HJSA 4FOUA 4KGLA 3G77A 3E3HA 1QI5A 1GVQA 2QJHA 4MGGA 4DPQA 4QR6A 3IK2A 3WD4A 4HMCA 4MY1A 4JFTA 3POCA 4H7ZA 3BLEA 3JW7A 1BWLA 1G4PA 1VENA 3PAJA 4EIVA 4IICA 4R33A 1BXBA 1GOWA 4G2DA 1DE6A 2CLHA 1O5RA 1XBYA 1F6YA 4MAVA 2PDFA 1TPC1 1CNVA 3CTLA 3F2CA 4D9PA 3OLIA 3N2CA 3H2NA 2J7HA 3ZLGA 3K4DA 4XD6A 2GJXB 4TOQA 4R88A 1OY0A 2D20A 4GGHA 2QUVA 3CC1A 4MSSA 3VNJA 2BXYA 3L66A 1VD6A 8XIMA 2GSJA 3MCOA 3SURA 2VTFA 3KRZA 4DO4A 2WKGA 3VKCA 2E9MA 4GC4A 4JEQA 3W85A 3NOEA 3IAQA 3U6WA 2ZQ0A 1LLWA 1R7OA 2W63A 1UC4A 4ORIA 3R8GA 2Z1KA 1H1NA 3FVDA 3C0LA 5EL1A 3K8LA 1P0KA 4KERA 4Q8VA 4IX2A 2PDGA 2ZXDA 1LZOA 2HZGA 2Q8XA 3M5YA 1CLXA 3F4WA 1UB3A 1JEZA 2WJFA 4UTKA 5REQA 3RMJA 2CEQA 3H4GA 4CN1A 3IACA 5FESA 5JH2A 1XLIA 2IKHA 1XSJA 2BB0A 1POJA 4O53A 2DSWA 4BA0A 3EMQA 3H21A 2ZZ3A 1A0CA 3W7CA 2FLIA 5LNSA 3N4EA 3IJDA 4GUIA 1ZTVA 3GIPA 2PBGA 3K1GA 5DBUA 1OIMA 5CZKA 4I6KA 3QV7A 2OR2A 3IJ8A 2G37A 1F76A 2A3HA 3CNYA 3MCNA 4CCZA 4RNFA 4JOMA 3I7QA 4MHBA 4Z0SA 3GIYA 3LSCA 3DGRA 5FA5A 5G4WA 3KLLA 5K4ZA 3FIGA 3MP4A 2FZ8A 4IFOA 1Q6LA 2J62A 2ZUWA 1FFRA 3ARXA 4L56A 4L64A 4M81A 3NL3A 3VIGA 3VCRA 2HVOA 3H6OA 1HKJA 4FB7A 1VB9A 3TMQA 2I9EA 3VZYA 1CGWA 1YRRA 1KD0A 2YKKA 5HMFA 4JFVA 4WY0F 5CAHA 1FH7A 2HXUA 4TVCA 1RH9A 2BG5A 5D05A 4JTAA 4ES4A 3AHTA 3LI0A 3U4FA 1GQKA 2PGEA 2JF6A 4XWUA 3U8GA 3GTNA 1XXXA 3KZSA 4Q4OA 1R6WA 4DUXA 4XD3A 2FZDA 3VNYA 3B4UA 2QMKA 4IP7A 1UOZA 3PR2A 1NSJA 1XC6A 4KWWA 3CPGA 3Q45A 1U5VA 1SO3A 1YNPA 3TNOA 3II1A 3P62A 2OWCA 4RW3A 1SM9A 3GKAA 4CQAA 1US0A 4OECA 3UZXA 4ZE4A 3DX5A 4HYRA 1NP0A 3LLDA 3PHAA 4HSHA 3FX4A 5E0KA 1O5QA 3NQEA 3ATYA 3E6EA 3R43A 1W3NA 3KZPA 4I9TA 4L9XA 1Z32X 1PSCA 2H90A 2GYIA 2Z25A 2OKTA 4FXJA 2F2KA 2Y7DA 2OT1A 3VD3A 3OA3A 3AROA 4REQA 1Q6CA 3BSMA 1M65A 1X6LA 3TROA 4EPDC 5I78A 2NV9A 1W6TA 2AL2B 4DWSA 4RZ6A 3W75A 1PXGA 3NXLA 3T81A 3SRKA 3NQ7A 4JQ1A 2J6VA 1C92A 4HCDA 2CHOA 3AFBA 5HA7A 5CC5A 2X30A 4UOJA 5D9PA 4PMRA 4KWUA 1HZYA 3V5OA 2FFIA 5FJTA 4DYJA 1CXFA 1AH0A 1R7AA 2PDKA 4X2PA 2X41A 1JDDA 4N6FA 2PODA 3TTYA 3ARQA 1G1YA 1JIBA 2WJDA 2OWXA 4UTWA 2QT3A 2WVTA 1V0KA 3D3AA 2PB1A 4CQ9A 1NY1A 4ZFMA 3NPVA 1JUKA 1CIUA 1K77A 2VC9A 1Y5XA 4PUJA 2V0TA 3GVWA 2HS8A 5FJOA 3TSMA 2E1WA 3FAXA 2PDNA 3BE7A 1EYEA 1V3JA 1VFUA 4FP1A 3LSBA 1CGYA 2GJLA 3F1QA 2I7GA 2VWSA 1V7AA 2FIQA 1W8SA 3FYOA 1KTBA 3W02A 1V3LA 3LTPA 3SRFA 1QPNA 3GH7A 4B15A 3KBMA 4GIAA 4FR1A 4LUJA 2FDSA 3EAUA 1VKFA 2YFOA 3N4AA 3R5EA 1QW9A 3P2VA 4NYYA 1ZP3A 5LA1A 3OZYA 3RRAA 5I3HA 3LHYA 1Q6GA 4Q4MA 1OZQA 2J88A 3STEA 3BAIA 3FGCB 4WF7A 4IM4A 5FF2A 4DF2A 3VM5A 3V16A 1VIWA 4WCJA 1C8QA 1ZJHA 3CWNA 2DT2A 3D47A 1KFWA 2WHJA 4JBRA 4R27A 2OOGA 5F2LA 4D6JA 4U4MA 2Z29A 3A5FA 2QEZA 3TJXA 4XIAA 2I1OA 3UESA 1QOPA 4IGSA 1JQVA 3DHPA 4GKLA 3GXDA 3TJ4A 4KIEA 1JPDX 5B7ZA 3G18A 3K8KA 3CUFA 1E0VA 2R14A 5AOUA 1PBGA 3N25A 1GHSA 2INZA 2BS9A 4ZENA 2O92A 1DQUA 2VL4A 3NO3A 3RLVA 3DFSA 3KTCA 1ISZA 4IFRA 1KM5A 2P88A 4FNPA 5C9XA 3A21A 4ZFCA 5HQLA 3MZNA 4L61A 4RUBA 3CPRA 3TNBA 3ZR5A 1MNZA 3PBUA 1WO2A 4X9SA 1MW2A 2CHRA 3A5VA 1US3A 4UQCA 2GWNA 4CQCA 2P5NA 3WEZA 3G0XA 4AF0B 3W70A 5C2GA 3QQWA 1DJYA 1FHLA 4HOZA 1E0TA 2UV8G 3NDZA 5CLWA 3TWAA 1HKVA 3L4VA 3UR5A 2CLOA 3B0YA 4R9XA 5G5IA 1DYSA 5CGMA 3NFUA 4MFEA 4AH7A 2NT0A 2G5WA 1FH9A 2OLSA 2FHBA 2Y6ZA 3U4AA 3HV9A 1K9EA 3THUA 4PMNA 4XKYB 3W7JA 5H2ZA 3RRXA 3LGGA 1TFVA 4AVNA 4ACZA 3E38A 2JF7A 1VBGA 2G50A 1OD0A 4O18A 4PMXA 1TJ2A 3O16A 3QZEA 3H12A 2WVVB 2ZC8A 1CT5A 3IIPA 2PWUA 4KF1A 3LGEA 2VZSA 5A8OA 2QCDB 4GFSA 2WSPA 1MEIA 5H6HA 1XQKA 1NDWA 4JY9A 4O1EA 4LH8A 4NL1A 1NF7A 2CBUA 3O3RA 4JFUA 1A50A 3BJTA 4WLCA 3QLDA 3S2JA 1CGXA 4C1NB 2FPTA 3ERPA 1P6CA 4GRSA 3U3HA 2GGIA 3T2PA 1GOQA 3EKGA 2NV1A 4QCFA 2ZZ2A 3EXSA 4XTDA 2CLKA 4CN6A 3WYZA 4B5TA 2GVLA 4PB4A 3WENA 1GYLA 2RFGA 3QN3A 3QTPA 4G6CA 3Q4DA 3GXTA 3W26A 3OJGA 2B7PA 1HFBA 4IHCA 4GPNA 1W1IE 1GUVA 3HO8A 1UWUA 1XWYA 3W7DA 4CCDA 3AU2A 4WSHA 2DSVA 3HPXA 4A2SA 1TJ1A 2QZRA 2E6AA 1K8XA 4DY1A 1SO4A 2JIEA 1MEHA 1ZJBA 2J4GA 3K4AA 3TYAA 4B3KA 3LCHA 3NQ2A 4XTIA 4ZL1A 3EB2A 4O1CA 4ATWA 2DV0A 1PTGA 4NXSA 2O7SA 2XVPA 2ZX8A 3F5LA 3SCNA 1PKYA 2ACSA 1JRCA 4KT2A 3RMEA 3WF1A 3AZRA 4GGBA 1KGUA 3K2GA 3RILA 1OG0A 1TWDA 5E93A 2VWTA 1ITXA 1K7EA 1ZNNA 3D46A 2WPGA 3V3WA 3W6MA 3VOGA 1ZJIA 4HA4A 1LWHA 3ZT7A 1TWSA 5HQMA 1J2WA 1O6IA 3GR7A 2VFGA 3SY1A 3HG4A 4IIGA 3K8MA 3ARSA 1I2QA 4H8HA 3DOPA 2P53A 4GH1A 3H4WA 4J28A 3W86A 1G4TA 1BRLB 3OZPA 1E0WA 1MVYA 3S5YA 2JK2A 1BKSA 3EWCA 3MDUA 1BRLA 3IVSA 4Q4QA 2HXTA 1RVGA 3HBLA 1QVBA 1OADA 4C6JA 3GZ3A 1F8IA 1T8QA 2DT1A 1FWGC 2WC4A 1MFUA 3K4WA 2VVSA 2ATSA 2P3ZA 1ZUAX 4LRTA 1M5WA 5BXRA 3T44A 3VGDA 3KCOA 3O6YX 1XGZA 4UMBA 2FQIA 4HOXA 5CJMA 2AMXA 3VOFA 3O6AA 4RPPA 4YVPA 1KTCA 2XIQA 2EF9A 5CPMA 2DW7A 3HPSA 3AWOA 4RDWA 4H41A 1LUCB 3NQMA 3TA9A 4QE1A 1DWGM 1AK5A 4JDYA 4I7UA 4LYKA 2X16A 1Q6OA 1S5WA 3NGJA 3CM4A 3NXFA 4MZYA 1OIFA 3ABRA 4F0KA 4HNVA 3ZSTA 1MXDA 4E2BA 2BFGA 3UERA 1XSIA 2XHYA 2I56A 2NUWA 1GW9A 4CCEA 3ZJ6A 1V6WA 1MRQA 3AIQA 3P8IA 1I45A 4OIFA 4LTSA 3NM1A 3LV6A 1W9PA 1NP2A 4KCWA 3VA8A 3LXAA 4P7OA 3CT2A 4IFKB 5AC5A 1YTEA 3PJUA 4GX8A 1E1FA 2BGNE 3LBCA 3BOFA 2HQAA 4Q22A 4L4PA 2Y5SA 1YXYA 3N3TA 1WDWA 3LQLA 3UGRA 2WOQA 1XIMA 3UT0A 4YIWA 4OUEA 2I5GA 5A1AA 2OEMA 3SI9A 4Q4PA 3TYZA 3A9IA 3HG5A 3URBA 2EKGA 3RDKA 5FF7A 4Q33A 4AZ5A 4XAGA 1OQFA 1A5UA 4W8BA 1T7LA 2PWVA 4XZ9A 2WMGA 3MP5A 1TREA 3LXBA 3VKBA 1LLOA 2FYMA 3MP3A 5AC7A 3FJNA 5G4HC 1K70A 1VFSA 1A5LC 1JPIA 3QY7A 5JBEA 1KM3A 5DBTA 3REQA 4DUVA 3CV6A 4Y90A 5FF4A 1PE1A 1UWIA 4PUNA 2D2HA 3V75A 2GPTA 3LZ5A 1EP3A 3T0CA 3WX7A 3W00A 3N2OA 2OWWA 4IJRA 3WLKX 4F0MA 5EMKA 3U2ZA 4JTGA 2XGZA 3VDCA 1WB0A 2FTPA 5A6BD 1IEIA 2BSLA 4HB7A 1A5OC 1V8EA 3PSVA 3HJZA 2UBPC 1TX0A 2DZUA 6XIAA 4F48A 4M7SA 2KAUC 2PE4A 2EJAA 3N15A 1IIHA 4AVFA 3UZ5A 4L65A 2WMFA 4DF0A 2OTDA 3W88A 1V6XA 4KMQA 1IT0A 5HATA 4Q3MA 1RP9A 2PDBA 4K3ZA 2XM2A 2INFA 2PWDA 5LNRA 4UNIA 3UXAA 3BV4A 1AVAA 4JX6A 3QQ0A 1PKNA 3PVFA 3VC5A 4L5ZA 3CUZA 4O1AA 1VJSA 3VOHA 4HN4A 1XBZA 1MWOA 2R24A 1ZP4A 4MWAE 3P8JA 3VIFA 4DB7A 1O7AA 1GVSA 1V0NA 3VOJA 2WQPA 1XISA 1E6QM 1YYAA 2QMJA 3MB9A 3GUGA 3TX9A 5KINA 6ALDA 3PG9A 2VFEA 3JU2A 4NX5A 1W0MA 2PP1A 1J0ZA 4GYKA 1Q4WA 4BI6A 1DL3A 4M6VA 5HNTA 2PLMA 4C6IA 3B8WA 3VKJA 1BGAA 1NFGA 1MRAA 3F4VA 1ZBVA 4LC6A 3KX6A 2HEJA 4XKYA 4YTSA 1F3EA 3M1ZA 3WJSA 1TMLA 3LHWA 3PZGA 3MUZ1 5FIPA 1WAUA 3LXCA 1TG7A 1W9DM 3O07A 1EF3A 4AISA 4R7JA 5AN7A 1EGMA 5C9ZA 3LNPA 3E0IA 4NX0A 3K46A 2PDXA 4Z2LA 2CXEA 4URIA 1NFBA 4HP5A 3TYUA 2WK2A 4AZ7A 1RQEA 1WDDA 4DLFA 4DZIA 1FCQA 4HHMA 2VEPA 1LRNA 4KIRA 5HAOA 4CLMA 3HF3A 2VMFA 2B7NA 3O0FA 1TA3B 1PYFA 3PJWA 2E77A 3QC3A 4I5UA 4FF5A 3DN5A 4JZ5A 3QFWA 3IV3A 3DG6A 1YPFA 1OB0A 3OP2A 1E6ZA 1TV2A 1QDSA 3KXQA 4E3VA 2DGAA 4CN4A 3LHUA 2GUUA 3FSUA 4WJXA 1Q6RA 4PSRA 4B9ZA 3AICA 1XH1A 2ZIDA 3RITA 4AIOA 3N13A 3TU9A 3WDHA 3ZM8A 1PS9A 1ZB5A 2J24A 3GO2A 4EE9A 4O8RA 2OVLA 4LUSB 3SY8A 4XZWA 4GIYA 4MB3A 2NXGA 3R8HA 3VD4A 3H54A 3JUGA 4EP8C 1W5MA 1AG1O 3IRDA 2CZ5A 3ABZA 1Y5VA 5AC8A 4Z0JA 5LA2A 2J8GA 3VD7A 3LQGA 1M53A 4DYEA 4J5NA 7XIMA 4TTGA 5AHEA 1UKSA 4PBFA 2XN2A 1I2RA 4L80A 3R7MA 1BKHA 1HX0A 5ENLA 4JTQA 1K8ZA 2P8BA 6XIMA 3CV7A 5EMMA 1DTUA 4L6HA 1VJZA 3VDHA 1I0BA 3EWWA 4P7NA 2J79A 1TPFA 1TWWA 3PBWA 1LWIA 5F1UA 3M46A 2XSXA 3QXBA 4O28A 2HNEA 1EX1A 2OLHA 4E6MA 1IWBA 3WH9A 1S2AA 4P7RA 3PUEA 2OX4A 4W7WA 4NZFA 4XK2A 4AZCA 3RCMA 4Y9PA 4M51A 3WLIA 3N11A 4P8XA 3O6CA 2A0NA 1AD4A 4Q8OA 5JXQA 5C0QA 2PDUA 1X97A 1M41A 4CCCA 1XW8A 5HBFA 4QISA 3F7JA 2WCAA 1XI3A 2AKMA 4PTXA 4ZCWA 3TIMA 4LUIA 4XD5A 1VFFA 2HVNA 4W5ZA 4AEOA 3BG5A 5LIXX 4DZHA 1GZGA 5HXMA 5HJYA 4XIMA 3ZWSA 3G22A 3WH6A 1IEVA 1WZAA 3R0UA 1L0PA 3OGRA 1JL8A 4HYVA 4IG2A 5LNWA 2QUNA 5DT7A 2GDQA 3OYXA 3E49A 3PFMA 3GDLA 2PU0A 3LYEA 1PAMA 1CDGA 4UQEA 4C90A 4AD5A 2IPJA 1XYBA 3UR8A 5CH9A 2YB4A 3W72A 2TYSA 3EMZA 1HXJA 3TW7A 3M41A 1KBKA 1ONWA 4NASA 1A0DA 1FWAC 2J8FA 1BWKA 3OVQA 4M29A 1TJRA 1W9BM 3B0VC 2YL6A 4QDPA 5AY7A 1HKWA 4ERAA 4KEZA 1ALDA 3CBWA 2A1YA 3U2OA 4PCPA 2DZAA 2KZHA 1KFBA 3AS1A 4OGZA 3EGJA 3AZTA 1RR2A 2E28A 4O0QA 2WZEA 4V28A 4GABA 4C7FA 2Z7GA 3HGOA 3GXNA 5IFTA 1XX1A 3BUVA 3Q58A 5CSSA 3BAJA 6A3HA 4GI9A 3WF0A 4B5WA 4M6PA 1UZ1A 4RKAA 5EA9A 1E40A 1TWZA 2ACQA 1E6NA 3UJFA 1HKMA 4HA0A 4H00A 3LB0A 3AMGA 4Y9OA 3BMXA 3KS6A 3VGFA 4B4FA 4DXVA 2EEXA 4C65A 5DMMA 2OGJA 1AFSA 4AB4A 1MNSA 3NYDA 3G2GA 2WANA 2VJXA 2WB5A 4QIUA 3RO6A 1XCWA 2OPJA 3FHAA 4C5ZA 4M19A 5M03A 3EOLA 4NZ5A 5T9BG 3VCNA 3FA3A 4BEUA 1VYSX 1JG9A 3KBSA 4FOJA 1EJ7L 2D2JA 1AODA 4FNRA 4GY1A 3DC8A 5AHNA 3AYTA 2BTMA 4C1LA 5E09A 4EXQA 2V3GA 3MHFA 2ZXQA 4JQ2A 3ZT5A 5D2YA 5EPDA 2PF8A 3W2JA 2NSXA 4TUFA 3TTEA 1LUCA 1S2VA 1FP8A 2QIWA 5REQB 5FEWA 4REQB 2DZWA 2NUYA 1Z48A 3QR1A 3W23A 3I7SA 3BAXA 4FLOA 5CCZA 4C6QA 2UY3A 2VGIA 7REQA 4PFHA 1KGWA 4UTWC 1S39A 1PX8A 4FPSA 1XL9A 1E1CB 3NUKA 3VM7A 2G0WA 2DVXA 4YWIA 1DHKA 4QE4A 4AXKA 4J4KA 3TQ0A 1H49A 4GXPA 1R0MA 2INEA 4MZ1A 3SCPA 2VRJA 1FWWA 3O9NA 1IZCA 4MTVA 2VCAA 4X9YA 1KM1A 3KM8A 3AJXA 3WQ6A 2Z1XA 2CXGA 3AIBA 3THCA 3ZOAA 1XBXA 1XSKA 1UD4A 3IANA 4B4HA 4O19A 1OBAA 3W1NA 2DIJA 1VYPX 3LRKA 3SCOA 3C8FA 1KCKA 5CSUA 3DFHA 1QHOA 2ZUMA 2PC4A 3WL0A 3BCFA 4OT7A 5DCBA 3T42A 1OX5A 4QBXA 4XQ6A 1E9LA 2C18A 5T26A 4YTTA 4DELA 1QFEA 4S38A 4KCVA 3CLMA 3AXMA 2E5BA 1B4EA 1LL6A 5LIUX 3CHEA 3IARA 3ARVA 1I2NA 1VEMA 1DVJA 3DESA 3AO0A 4N4QA 2PTXA 1MEWA 1XFCA 3C0QA 3MY9A 2ZVRA 1FBAA 1UH4A 3TUUA 1W1TA 2AGTA 4G56A 4MYAA 4LSBA 1J0IA 1M9HA 1A4MA 1K9DA 5I3FA 2OQLA 1H5YA 4A22A 1UMLA 1Y5WA 4MWAB 3ABQA 5G1YA 4H8VA 1KXQA 1A5SA 2TPSA 2WCGA 2VRKA 1JCJA 1CB7B 2B7OA 3C2RA 2UY2A 1HL2A 3IJQA 5BROA 5KZMA 2PRLA 3W1TA 4QG9A 4FOKA 1GKPA 2QNEA 3NZ1A 1VHNA 4J3TA 4MAZA 4W7VA 5G2HA 3R8RA 3C2YA 3DYPA 3G1HA 1QI2A 3QYSA 3UG3A 1EB3A 3LTSA 4GJJA 2V82A 1XDLA 2VR5A 4H7VA 3TN6A 4AZIA 1G67A 3KFTA 3W7MA 5CAKA 1Z3NA 4BS0A 2GUYA 3BLKA 4FR6A 3NURA 5F7UA 3W7KA 1VCVA 3THDA 3I4KA 3U0HA 4UQAA 4OVXA 4FXFA 3NPWA 1Z6KA 4PUWA 3NQBA 1KBJA 3LLXA 4Y9NA 3TCSA 5I00A 4DIAA 2VGGA 3GKFA 3CUGA 2XGIA 3PANA 3OGVA 1R8LA 4CD4A 4LF1A 3CEUA 5CGQA 3EA2A 4NJJA 3H70A 2R1LA 3D3FA 3GZAA 3PTMA 4KESA 5I3KA 1XG4A 4EF9A 3OODA 3UG5A 1JCXA 2VFDA 1UZHA 4KRUA 2PBOA 1KKOA 4DI8A 2IPWA 1YLVA 4S2CA 4UR9A 3GXPA 4BQ4A 4AY8A 4L1XA 4BQ2A 4LS0A 4JTHA 2P50A 4AX6A 1VBUA 1QHPA 3TN4A 2WJZA 3TH6A 3GDKA 5I23A 4JFWA 1ELSA 2VQUA 1KRBC 3OG2A 1C8VA 3P84A 1VPYA 2A2IA 1XJBA 3MW7A 2D0HA 2XFWA 1PDYA 1YDVA 2REQB 3TP4A 4QJ3B 2E5CA 1QK0A 3FS2A 3GG1A 1C90A 4UQBA 2YCKX 3GIQA 4M8UA 2ZRXA 4LJ3A 4US5D 2G8ZA 1E0XA 4CU6A 1W91A 1YNYA 1HTIA 1XYMA 1WXJA 3S1UA 2VZVA 2F6UA 4CNSA 3GW3A 4B5VA 1ISWA 2WMIA 4HD5A 4BCEA 2GL5A 1RLDA 2BOFX 2E5DA 4ASTA 4FLRA 5D03A 3NIYA 4JN7A 1RZMA 3G1FA 5C54A 3VOCA 1A5BA 4W7UA 2ZTKA 5K3VA 4C6EA 1HO4A 1QNOA 1GTHA 2HJPA 1PVNA 1J12A 3BICA 2BVTA 5M1TA 3HQNA 1RA0A 2GK1B 4S1FA 2BGSA 1W9XA 2GK1A 1H3GA 3UY8A 3E2RA 2TAAA 4XZLX 4Q32A 4G7FA 3NGFA 1PZ2A 4ZODA 1Y8BA 4X60A 3R11A 3VU2A 2C3ZA 1OEPA 4ICCX 4M6UA 1G94A 3CL8A 3BGAA 2PA6A 5A6BA 4IGMA 4AQLA 2Z26A 4LUTA 3SBFA 3L68A 3IJIA 5GJNA 3MTWA 3EKZA 3EPNA 1A0EA 2PF0A 3MI2A 1GWJA 1FA2A 1GOXA 9RUBA 1W9VA 1K3UA 5E5CA 1H7PA 1NF0A 1KLYA 3GFXA 2V3FA 2GVEA 5DRCA 1QATA 3U9IA 3BGGA 4O10A 1NJJA 3GR4A 3S2MA 3N1AA 2A6LA 4GQBA 2QJNA 1TMHA 1ZBCA 3EX3A 3FJLA 3QPZA 1CXEA 4V27A 9XIAA 1I4NA 3N12A 1IWPA 4KS0A 1LOLA 1TTQA 1UG6A 1PHWA 4OWGA 5T8GA 1YTDA 2HK1A 1DJQA 3KVMA 1KV8A 1R3YA 1UR0A 2BV9A 3LPGA 4PL2A 1SVDA 3ZT6A 4D2JA 4ZB2A 3H23A 3L67A 4PRRA 1E9YB 2GQ3A 1V3MA 2VCCA 1WUEA 4HBKA 4N7QA 2QVNA 1ME9A 5AKQA 4C6KA 4HTBA 4J35A 4NKCA 3KP0A 3WNOA 1TV3A 3IPWA 3FAWA 3RM8A 1OCJA 1PX4A 3KEHA 3ZS4A 1QWGA 3T4WA 5LYRA 1H7RA 3UWEA 4ICMA 2FH8A 4Q8NA 3CMGA 3W9ZA 1V3IA 1JDFA 1FDYA 3H2OA 5FL0A 2YLAA 1Z9AA 3R89A 1M3UA 4D72A 4XX6A 4XZNX 4GUFA 5IHSA 5CZTA 2Z7KA 4WSJA 4F0RA 3PTKA 1MW1A 2Z1WA 1TPWA 4FIRA 2E9BA 1QW7A 1UUOA 4NAFA 4JTCA 1VQTA 3RFAA 4PMZA 1DXIA 4JTJA 1BTMA 1BVWA 7TIMA 3ZJKA 1LT8A 1XF0A 1N2VA 4PUUA 1E1CA 3SUUA 1XRTA 1LBLA 4GH3A 2J27A 3BC9A 3WQGA 3ZR6A 1EHAA 1EL3A 4D6GA 3BQ5A 3CAWA 4EPBC 3KE0A 2NZLA 1KLZA 1AQMA 4H9VA 1E6PA 2W27A 3OBAA 3I3DA 3M64A 3GTFA 4PTMA 2JFEX 5FI8A 3A13A 2GLKA 3WF4A 3S46A 4O4VA 3BGJA 1I9CB 2WZMA 3GY1A 1NQ6A 4AYGA 3VX1A 5DN1A 3VIJA 1HJVA 2RAGA 4GXWA 3H7UA 1WKYA 1MW0A 1Z69A 1ZBWA 2Y7GA 1YDNA 4IGHA 1P1XA 3M47A 4KFPA 1MYRA 3FKRA 4LY4A 2C0AA 4UNLA 4AHOA 1DKWA 1YQ2A 2Q01A 4DBWA 3VMOA 1KM0A 3UETA 5I6SA 1DJNA 2YZRA 4MDPA 1EQCA 3TQPA 1K8CA 4TX9A 1S46A 1SFTA 4DI9A 1TE1A 5JU6A 3L0NA 3R79A 3P0WA 1R30A 1GTEA 3VDAA 1O5XA 3WKZA 3ZJ7A 1A5AA 1RP8A 1LRTA 2AQOA 4LBRA 2YA0A 1UD6A 2A3CA 2ZDSA 3B8IA 1O1ZA 4GIEA 1W5QA 3DERA 4YVXA 4FK9A 4UR7A 4IUGA 2VEFA 3FK4A 2Z24A 5C7HA 3UPMA 1R3TA 1JDEA 1LOSA 1X6NA 4ZQMA 1K1DA 4O16A 5CSRA 2PDHA 5CJ5A 1PPIA 1QK2A 2QDGA 4JNMA 1JR1A 2GJRA 5BWAA 2G4FA 1A5CA 2CLFA 1S2TA 3BO9A 1GONA 2VUYA 2YDSA 3N9SA 3CQJA 2CCRA 4MY8A 1XLKA 3EWYA 3TAKA 4ADTA 4QITA 1CPUA 3LM7A 1XIIA 1B9BA 5FCZA 4YVVA 1KV5A 1YE6A 2R9RA 3WBEA 4MNLA 4QTGA 4I9JA 4J2MA 3RR1A 1PZ3A 3PWGA 3AXXA 2ZX6A 2A7RA 3D6NA 4RL3A 1VPXA 1YTKA 1PTDA 5DRIA 4UCGA 4QX4A 4DN1A 1FFQA 4H9MA 1AA1B 4X2RA 4I3GA 4AZHA 4CU7A 1X1ZA 4HU4A 1GYMA 3CAKA 3NZGA 3OHIA 4LEFA 2E4TA 1SSDA 1SZEA 1EC7A 4GG9A 1FWFC 3BQ6A 4C6DA 1UR8A 2PUZA 4W8LA 3G1VA 4UFLA 3F5JA 3GVGA 1QRQA 5G2WA 4QAIA 2YPIA 3KL5A 1XLGA 4CD6A 1XICA 3UQNA 1E4MM 1WNOA 1T96A 5GNXA 3V4BA 1W32A 5CBBA 2PFHA 3WFLA 1P43A 1Q63A 4Q4RA 1R2RA 1DWFM 1C8XA 1D3HA 4RZ4A 1Z89A 4D6FA 3B9OA 3DIPA 1YIXA 3LI1A 4DUOA 3WNPA 1ICQA 3K1DA 3NL2A 4QEEA 5AC6A 1GQIA 1RPKA 1PHQA 3LG3A 2YJQA 4MKNA 2ODOA 2XINA 5KZDA 2CZFA 3VD9A 3BCDA 4C6MA 3FOKA 1W3HA 4IIFA 4K7VA 1UUMA 5PTDA 4W85A 5KSWA 1GQJA 3QHNA 3WLJA 3EMCA 3CYJA 5AHIA 1RJQA 4HT3A 3TC3A 3HN3A 3FJ6A 1THFD 3PULA 2C1IA 2CERA 3WJYA 3BG9A 2HK0A 3K30A 4QG8A 1X1NA 3QV8A 1JYVA 2HDJA 4WQ6A 5I07A 4MVAA 2PAJA 1ESWA 2QCCA 3OHMB 3WMCA 3BLIA 4YTRA 4PMUA 1EJUC 3OLEA 2G97A 4ZTYA 3BARA 4KPLA 4JL1A 3ELFA 3CLWA 2WKLA 3P3BA 3CS2A 3UZYA 5IBXA 4LT9A 1XPYA 4GQGA 5E9XA 1TPDA 3F03K 1Q8AA 4LVAA 1B30A 1ZZMA 2WWDA 1FWDC 4GACA 3ARRA 3VD5A 1IHIA 1U2YA 1XUUA 4J3ZA 4LW7A 3B9DA 4GQQA 5A6SA 3RCNA 3RGTA 5AVNA 1NU5A 3CZLA 4J27A 4LAUA 3NPUA 2PD5A 3E0LA 1BYAA 1FVPA 3HMJG 4DWDA 1P5BA 1N55A 3W1QA 4P8VA 1H09A 1UWQA 1B90A 1CYGA 1OGGA 2JKAA 4QLKA 4QAWA 2NVDA 2QGYA 1C7TA 4YMZA 5D9NA 3DFNA 3EDKA 5DMLA 2IS7A 5FJPA 2NX1A 3W1LA 3LPPA 2ZZ1A 4JQAA 1IIGA 3MKVA 5AB3A 1HVXA 3B05A 3AIWA 1L8NA 2JEQA 4A8NA 2VR2A 2PDWA 1YDOA 2OYKA 2QAPA 3GE7A 3DEQA 7PTDA 3ENLA 3LA4A 1JYXA 1V6TA 3CL6A 2QCNA 5I3DA 4NUWA 2UY5A 4O15A 1VZWA 3GK0A 1R3SA 3NQCA 1GOIA 2VXNA 1TE6A 4CNUA 3QTGA 1XFBA 3HURA 1VEPA 2VEMA 3HPAA 4JYEA 4ROPA 4QM1A 1B3WA 1H7OA 1XLDA 1W31A 2X05A 2ZUSA 2PDMA 3LD5A 1HQTA 4QDMA 1FQ0A 4DWSD 3RN6A 3S47A 4NHVA 1XRFA 5DMYA 5EYWA 3QMSA 1WCGA 4JCLA 5HJXA 3COTA 4FALA 2WSQA 3WDJA 1E4IA 2YXGA 3QY8A 3W6LA 4LAMA 4HCHA 3WMSA 3LK6A 2VOMA 4JTFA 1BF2A 1AZ2A 3PZTA 2IQDA 3IIOA 3N9RA 4WXYA 5FAJA 2PWHA 2QDEA 4Y2WA 1A49A 4RK8A 3VGEA 1E72M 1AMKA 1QNRA 1B31A 4EAYA 2V2DA 1VEOA 2GGJA 4FEZA 4AHPA 3ARYA 2XFFA 1SFLA 3VKDA 1CX9A 1TPH1 3MKCA 1VCFA 3L5AA 3NDOA 3SJ3A 1LL4A 2PEVA 2CFFA 1POKA 4CD7A 2BY1A 3W1XA 5ABTA 4HK7A 1EP2A 1NEYA 4A6GA 1CECA 2YXOA 3UR2A 4JIPA 2YIHA 3SAZA 4DM2A 5DF0A 3R10A 3OA5A 1ZENA 3GS6A 4WGXA 5I0DA 2VFFA 2OSYA 3WK2A 2J13A 3MUIA 2GGEA 5L6UA 4DO6A 1QCWA 3BK0A 4GUGA 1Z8AA 3E1F1 3VMPA 2QW5A 4GKTA 1JZ8A 3GVQA 3INPA 2CW6A 4O54A 1JUEA 3AUJA 4WR3A 2XUCA 1UCWA 3NNTA 2IMRA 5K9DA 4WSKA 3W4RA 2PTYA 1BXNA 4POCA 1E71M 3WY1A 5CPQA 2Z2BA 1XRSA 2V30A 2VGFA 3T55A 4U10A 3HMCA 3HJEA 1NTHA 2DEPA 1VR6A 2VDHA 4NJKA 1HJWA 2PWGA 3N2TA 3LERA 1AUSL 1Q6FA 1T0OA 2NWSA 5DX7A 3ZIZA 1F5ZA 5IHRA 4KEUA 4Y8EA 2CZDA 3N73A 3R94A 3QHMA 1KBBA 8A3HA 1XIBA 1UC5A 1L2QA 4BF7A 3TAOA 1R38A 2ABBA 1UWAA 2Z00A 5EFFA 3H26A 1RCXB 1SJDA 3VNKA 3WMLA 2CLMA 4GVGA 3GDBA 3MKKA 3CB3A 5DY3A 3KS5A 4WDUA 5D30A 1XIGA 3C2EA 2JIWA 1IEQA 1Y0EA 1ODZA 4EX4A 3KRUA 4UTJA 2JQXA 1SPQA 3W7OA 3QSTA 3WQEA 1FWSA 3ICJA 1Q66A 3C56A 1FWCC 1PTAA 1WBJA 2XJ7A 3N18A 4TV6A 3CWOX 3NL5A 2OQYA 1SFJA 4S3AA 5ABEA 2XTKA 2L5HA 3RIKA 2ASHA 1LYXA 2E40A 1EJWC 1QI3A 1DXFA 1TRIA 3W7LA 5J04A 1BQGA 3KOZA 3K13A 1RBAA 2OX1A 1IV8A 2QPUA 3W22A 1YW1A 4NAEA 3E5BA 2ZE3A 4ZOAA 4WKHA 4C7DA 4WZHA 2TSYA 5D2VA 3ZVIA 3L4XA 4XUYA 4GY0A 1JF6A 3SGGA 4X63A 1UHVA 3GNOA 1ZJAA 1U33A 3VYLA 5BXTA 4WIWA 5F4XA 3EEGA 4JGDA 1F8MA 2OLAA 4AFYA 5AHMA 4JIHA 2HV5A 4WEVX 1JCLA 1M03A 3CQHA 4TO8A 1V77A 1ZL1A 4A8RA 2PDQA 5TQLA 5F4SA 3RU8X 2QCLA 2E3ZA 3EPOA 5JBDA 1J0KA 3SCUA 1XP3A 4HGXA 1GVIA 2GQAA 4ML9A 2QV4A 4C6LA 3HGJA 2NLYA 2WJEA 3V18A 1QOQA 3MJYA 1XLEA 4Z2JA 3WQDA 3XISA 1EOMA 3CK5A 2AL1A 1U83A 3G1RA 4R7OA 2IKJA 3MQTA 4BKNA 1UP3A 3T0DA 2E9LA 2NT1A 5BRBA 3W87A 3S5SA 1JZ2A 2W3ZA 4C6OA 3FFSA 3B9AA 2YCEA 3A3XA 4NVTA 4ATLA 1DIOA 4LB3A 3M6YA 1Q6DA 1YPXA 2X0YA 3L4WA 3ZVHB 2YCIX 1LG1A 5M3WA 4RJEA 3PM6A 1NQKA 3XINA 1UD5A 1VFHA 5GNYA 2XVKA 5HOSA 4INFA 5FKYA 1F6PA 1AW5A 1R3RA 3ZXWA 3UYCA 3VINA 3AHZA 2P10A 3WQ8A 4M3PA 4IFKA 1T8XA 3MI3A 1HG3A 4HHHA 4F40A 1FXQA 4GVHA 5E70A 2J7EA 2J6XA 3THAA 3QYQA 2DH2A 4NIRA 3PPHA 2YCLA 5A6AA 3I6EA 3LCLA 3L4ZA 1EWDA 4JNZA 4PUKA 4RE3A 5I09A 5GQBA 4ORMA 4U5KA 1HIZA 3KTXA 1QR7A 4PEKA 5FL1A 2V5KA 1F6KA 4H19A 3AI0A 1D2KA 1F4HA 2FFCA 5C9UA 4Y96A 3DFTA 2R1MA 2YBVA 4S3GA 1UD8A 4RXGA 3RX4A 2CU0A 3UXIA 3S5OA 1NDYA 2WMJA 1S3TC 4MPQA 3UWYA 3TTOA 4PUDA 3FXGA 4O50A 3HFYA 1TZ7A 4UB9A 5ECVA 3BV7A 4JX4A 2IQ0A 1IZKA 2VVNA 1VBHA 4ZA0A 3RJYA 4E8CA 4ZQPA 1PV8A 2HMCA 1QNSA 3ZMRA 3S83A 1JAKA 1V02E 3LOTA 1HGYA 1MO0A 5TBOA 1DJXA 4L7ZA 2C91A 5CPLA 1EGVA 2V69A 2Y5JA 3OW1A 4IQLA 3QGKC 2X1UA 4XZBA 3I68A 2PMQA 4NZCA 3U48A 1T40A 3FCPA 8CGTA 2J66A 2E6YA 3W53A 1UKQA 1VC4A 2C1GA 5BU6A 1PDZA 5EMYA 3CH0A 1GG1A 4O11A 3NOYA 3JS3A 4US5A 3M0XA 2ISVA 1XIEA 4CQ8A 4D6CA 1R47A 4OBSA 2E8ZA 4A29A 2X0SA 4UUIA 4KETA 2V5DA 4R7WA 3OYZA 4UFHA 1SMAA 2R91A 2ZRVA 4EPKA 2H8ZA 3EWZA 5IDIA 4KWVA 4IPIA 5CG7A 1YADA 3TFCA 1VLWA 1XD1A 4JIIX 2QJJA 1F05A 4KFOA 2X1RA 2ZWYA 4EOUA 3VKAA 3CUJA 3EEZA 4JEJA 1OX4A 4C6CA 1L6YA 4N0RA 5I77A 4ECLA 3OBKA 1JZ6A 4DQWA 3M5VA 3FDGA 3MUXA 3TC7A 4BF9A 3T0BA 2J7BA 5FJRA 5DLCA 1X7FA 4AD3A 1DBTA 1A53A 2J9XA 4MWAA 2E68A 4PUEA 2VX4A 2V5LA 3SCQA 4LYPA 3QGAC 3QRHA 5HMEA 1PO9A 4J2PA 3B8VA 4LANA 4H2CA 4MJ2A 2WLYA 3H2CA 3NDYA 3S9YA 5HINA 4G8TA 3GHRA 1ZCOA 1GQNA 3A6OA 4ZE5A 4PZVA 4IWWA 1WX0A 3CUIA 4BY3A 3QR0A 4QS5A 1EPVA 2WLZA 3BVJA 1R9ZA 4YPJA 5JQ9A 4IMDA 4YU1A 3TOYA 3NQ8A 2Q8ZA 3QMTA 4IOTA 3CO4A 2A21A 2C79A 1NWUA 1T6MA 3W84A 4O1FA 1XLHA 3A64A 1EUAA 7ENLA 3T7VA 3GG0A 5FSDC 1JXJA 2OMAA 3P5YA 3ARZA 6ENLA 3RO8A 1PIFA 3TFXA 1VFMA 3TKFA 1SW3A 1OABA 4JHZA 1DIDA 4GNVA 4E38A 4L1WA 3IGHX 3BSGA 2J78A 1V51A 4GI8A 3M5XA 2BVDA 4DF1A 4S23A 3RPDA 3L2MA 4B5NA 3H8AA 3MUAA 4UXDA 4BF5A 1E6SM 3UCDA 1VH7A 5L9FA 4DX3A 1WBHA 2QAFA 1VRXA 3M0IA 2YL9A 2QUMA 4C6PA 4YTQA 3AXHA 1P48A 4H04A 3WQ5A 3L5MA 4AX7A 2HRWA 3PWAA 4HCLA 5LIWX 1MQRA 4MLJA 4TIMA 3VE7A 3DI1A 1K03A 3ISIX 2DPEA 1I60A 3EB3A 2HROA 2OQHA 3P81A 3KCLA 1XYLA 4AIEA 3CHCA 2Y24A 2BP1A 1MQPA 3SZ8A 4DJDC 5LKYA 3IV8A 3B8TA 3ES7A 1DJHA 3A9BA 4W87A 4WY0A 3AALA 5D2WA 4GZEA 1JFXA 5IFPA 1R85A 1H50A 5HMSA 3W83A 1TELA 3G1XA 1OFRA 4X22A 1J8VA 4QCEA 5DXXA 4US6A 1I1XA 4JX5A 4GMEA 3URQA 2CIPA 2O9PA 1XPGA 3CZGA 2QDHA 2ISFA 5A8MA 1TPB1 4GIRA 1OK6A 3AHXA 3CUXA 2ZC1A 2V9DA 1B2YA 2WHKA 4DJDD 3UBPC 4U3AA 5MF5A 2NWRA 2XN0A 1Q7MA 1ECQA 3ALGA 1R3QA 1ZLPA 3V0SA 3BL3A 3H2EA 2J7CA 4LBSA 1E73M 4GC3A 2D0FA 4MB5A 4DAIA 1JF5A 3GU9A 2J74A 3BLOA 3UYIA 3PBGA 3APTA 4XG1A 1EH9A 3C3NA 3EKLA 5JUVA 2BHZA 2J9ZA 4B90A 2KX9A 4WHBA 3B04A 1BFNA 1SFSA 5HK4A 1UR3M 2BNJA 4UFKA 1RCOB 2QCEA 3G3DA 3W1PA 1J18A 3NQDA 1IXNA 3R2GA 2YW4A 3NQGA 4UMCA 3EA3A 4AD2A 5TIMA 4FNQA 3QVQA 3Q37A 1E9IA 2FVLA 2QUUA 3REQB 3FN9A 3MO4A 3T4CA 2R1KA 1A5NC 1K8YA 1TJPA 1B1YA 3S1GA 5E1QA 5E9AA 2ESCA 5IBXC 4X61A 4CD8A 2XU2A 2D2GA 4J7RA 3SQMA 2NUXA 2R8WA 4O1BA 3TONA 4E4UA 1WXYA 2WWCA 1OC5A 4E5TA 2CBVA 2G3FA 3NM3A 2WZTA 1JZ4A 2CZEA 1IR2A 3LHTA 5A69A 1JPKA 3V1HA 2YOCA 3I7RA 1TV8A 1TX2A 1TTIA 2YR1A 3UEQA 3BG3A 1KQYA 3WK0A 4XO7A 1T99A 2VZTA 2ZA1A 5GNZA 3WQOA 5DCDA 1W37A 1ONEA 1V6VA 1UWTA 3ONCA 4GVFA 3T2OA 1KCXA 2X1TA 1SYTA 5KETA 1CWYA 1U5JA 2WPBA 3KL3A 3MZ2A 4A05A 2W91A 2FDMA 2YYUA 3MBFA 3PZNA 4Z1BA 4QHRA 3M4HA 1XC4A 5HWNA 3BDKA 2RDTA 1GG0A 1VGAA 1V4YA 3BCJA 1S2CA 1Y65A 1OX6A 1JD9A 3PS7A 5EMJA 3VPLA 2GVJA 1HT6A 4IIHA 3AMCA 5ABHA 5CBJA 4WXZA 1WKDA 2HSAA 1L6SA 4CUCA 3KP1A 3L0KA 4UZUA 2ZA3A 2J75A 3EPMA 1C9DA 4N9DA 1IYXA 3GC2A 4WUIA 3TTQA 4ADUA 3V35A 2CLPA 1OFBA 3WUGA 4EPEC 4LY8A 1E1EA 2PD9A 2WAGA 2Y70A 3GXFA 4HK5A 1F74A 5CC6A 1IR1A 3CXOA 2QHAA 1QI4A 3EX2A 3UWUA 2WKJA 3GHUA 1KBIA 1A80A 1DWIM 3CTTA 4HK6A 3DG7A 3H53A 1FUYA 1L2UA 5AZ1A 3W7NA 3LTYA 1W9UA 1TV4A 1L6GA 4GY7A 2MUCA 1O68A 3FYYA 4IL0A 4KEVA 3WN6A 4JTSA 5A2CA 1JRBA 1MW3A 4ICNA 4NI8A 2BODX 1J2BA 2FJUB 3SQSA 4WDWA 5JVLA 2IPGA 2VNCA 1KWGA 2WC3A 3L65A 3DENA 4QS6A 2DVUA 3OZMA 4LVFA 2E0PA 4QNEA 1EXBA 4PODA 4GX9A 3A12A 5BWFA 4UTMA 2BMBA 2R82A 3QW3A 1RD6A 3GH5A 3VMNA 3NO1A 3W0KA 4HU8A 2AQVA 3WZ0E 1BQCA 2EQDA 2ZRUA 3VIMA 5EY5A 5CG0A 4EANA 4E4PA 4PB5A 1UP0A 4QDWA 3VGBA 2YGYA 2FZ9A 4WOZA 1TRDA 2Z6JA 4TMBA 2QJGA 3IJ7A 4OOZA 4AYSA 2PDPA 3LBMA 3NPXA 5DCEA 3N4FA 2QUTA 2RJHA 4X3ZA 4XSLA 4GNJA 4H3DA 2XIJA 4EF8A 1AJ2A 4I5XA 5AHFA 4KGJA 2I5IA 4UR8A 1QU4A 2C1HA 3MBDA 2EPKX 5FJUA 3UA3A 3H2FA 2Y7FA 1LQAA 1S5MA 2OT0A 3PJTA 1CI1A 2Y63A 4M56A 5DXYA 3VVGA 3VIIA 5C70A 4WX2A 5D37A 4FXSA 3WBYA 5LGZA 3M6DA 4LAZA 4Z1AA 2ABAA 3KVLA 4WDTA 2DH3A 3AMKA 1IXPA 2AQWA 2O0TA 8TIMA 1S5NA 4C1NA 4YHGA 1G6CA 1MZRA 3W38A 3CQIA 1RK5A 3ARWA 1EDTA 4IIBA 4KFNA 3N04A 1HN1A 1OF6A 1X98A 5I7GA 4FX7A 3VGGA 2QS8A 1REQB 1W3JA 2Z0IA 4RXFA 3HA1A 3RX3A 1MUMA 1W5NA 3IJ9A 3UNTA 1C29A 4QSHA 1MI3A 1NWRA 2V3EA 3EBVA 2Q3RA 1ZGDA 3VUSA 1LQ0A 1H61A 3TCEA 4DBSA 4CNNA 1A5MC 3AQUA 4GHRA 4UMAA 3SQLA 3GAYA 3UG8A 1Q6EA 1F3WA 2OZ0A 3LY0A 4HNNA 3S9IA 2ZUVA 1EEXA 3BLPX 2BBFA 4MMWA 1HP5A 2VX6A 1DXEA 3H2MA 2YXXA 4XZHA 3SCVA 1MQQA 2ONEA 5A8GA 1KXVA 3BLDA 3IIXA 1X8FA 1TSIA 3E0VA 4LC8A 4AG0A 4G7EB 4WKAA 2PWEA 1J01A 1G5AA 3WMBA 1OINA 3IRSA 3MUY1 5KITA 1TVLA 3KTSA 5BXPA 3W07A 4HIBA 2V3DA 1G9HA 3KRBA 1XIDA 2ISWA 4ERIA 4H9UA 4QROA 4JHOA 1TR1A 2PDYA 4R53A 4FSAA 2PGFA 2NQ5A 1CGUA 2EHHA 3P60A 1LORA 4NYUA 3WJZA 1X8CA 1KRCC 1M01A 1UD2A 1MDLA 3CHFA 2E8YA 5XIMA 1G7UA 2QVHA 2FMOA 3C52A 3IUDA 4IF2A 5A2BA 1AQHA 2VRQA 1E55A 5E0CA 1UZDA 1CLKA 2C19A 1Q4NX 3W7GA 4H6QA 3UVAA 4AMCA 5BW6A 1B5TA 1K6AA 4L4OA 3M7WA 1UD3A 4Z42C 3OG3A 3VZXA 5HNRA 4AWSA 1BG9A 2CITA 1QASA 1NOWA 8XIAA 1MFVA 4NSBA 5C8BB 8RUCA 4S39A 1FH8A 3DKLA 4NAEB 1AJZA 1BD0A 1WPCA 2GOUA 3P80A 3NR0A 1UR2A 1UKTA 2ZDRA 1BF6A 4AWTA 4TVUA 4E0CA 1J9YA 3C8NA 1FRBA 3SUSA 4OBTA 4ERGA 2C6QA 2E09A 3MA8A 2Q71A 1QPOA 1KXHA 1BVZA 1CBGA 2QGHA 5TAOA 3TR2A 3QMRA 4RV3A 3EWXA 2XG9A 3BWWA 1SGJA 3V7PA 4BQ5A 5C9WA 1H7XA 4ZMGA 1UPMB 5JBFA 2ACRA 3U2CA 1XINA 1GJWA 3O6DA 4HA3A 1WQ5A 3JVAA 3EDEA 4HHLA 4RZ5A 2XSBA 2Z1SA 3EOEA 3UD6A 2C16A 3W1RA 1IEWA 2ISDA 3OU8A 3WQ4A 1EZWA 2QIIA 1CXKA 3PPGA 1H60A 4QEHA 2HS6A 4WRHA 2JGQA 3AC0A 3DAQA 2F2HA 4H8NA 4JKLA 1O5KA 2BY2A 1E43A 1G69A 1QNPA 1IZJA 3W81A 1J6PA 1XDMA 2VZOA 3WD3A 2ALDA 4DJDA 2F6KA 2TRSA 1W5OA 3ZWTA 4Y9AA 2ACUA 4DNMA 1TTJA 4QGCA 5H1WA 2B4GA 4P2VA 2EG6A 1EWEA 4RX0A 3EOSA 1N8WA 4PFMA 5D04C 4PTDA 1QBBA 4CNPA 1Q7QA 2FTYA 4JD4A 1AQ0A 2VOTA 4QRNA 3GU2A 3W7IA 4WJEA 2W0UA 4L4MA 3IIZA 4S3KA 2O9TA 4ML4A 3QV9A 2O9OA 3BMVA 1WZLA 2NX3A 2V2CA 4UCFA 2Z2UA 2WNWA 2D23A 1D3GA 5MKGB 3RLGA 4WVXA 4LGXA 3RLUA 1N8FA 1E6RA 4IX0A 5EU9A 4YJ5A 2BASA 3G0SA 1EJVC 1JJKA 3DKJA 1DV7A 2A4AA 5IDZA 3PPCA 4WD0A 1F73A 4D6EA 2CHNA 5CGTA 4TV5A 2P76A 1XH0A 3WD0A 4FX8A 3T2QA 3NZRA 1OCNA 4QQUA 3G1AA 4DRSA 1L8PA 1W3TA 4MNJA 3NZPA 5CKSA 3CQ0A 2FB2A 2WMKA 2VCBA 3G6MA 3LZ3A 1ML1A 1AL8A 4A3YA 4DBEA 2CLIA 2V2HA 1WAWA 4W89A 2O56A 3CHDA 2QV5A 2HPIA 1JZ3A 1M7JA 3APGA 3DBPA 2MANA 1JPMA 3VO0A 3T78A 2DIEA 1D8WA 1JULA 5GPRA 1EQPA 2OSWA 3UPWA 1O60A 2SFPA 2VD9A 4OKDA 3WNNA 1W1A1 3KHJA 3ITCA 2Y89A 5C71A 4B91A 1WYIA 4O14A 3B06A 2GWGA 1Z7AA 4QJ1A 1P6BA 3I10A 3SCRA 3CJPA 3E2SA 3S2CA 3AIUA 4ZQCA 2AKZA 3OOQA 3EX1A 4UFJA 3SFWA 3IJ6A 3I6TA 1KRAC 2PDLA 5M17A 4HKPA 3ABOA 4BK9A 2ICSA 4HSNA 2WSRA 7REQB 2VR4A 5E0FA 1XYZA 2GOKA 2P3EA 1ZHAA 4KBXA 2LLEA 4NY2A 1UMYA 1L6FA 1DPMA 3DHFA 4ATDA 2BHYA 4FNSA 4Z2GA 4W86A 2VI0A 3NYZA 3UZWA 1FTXA 3OTRA 2G4JA 4IPNB 4LFYA 4AZBA 4S3DA 3GDRA 3PPFA 2W6RA 1JDAA 3H2AA 1V7YA 4HZ8A 2CNCA 3LU2A 7TAAA 3QPEA 3IEBA 3GU1A 3RNDA 4RV8A 1XIHA 2XDFA 1FDJA 4OV4A 5FEZA 4XKMA 3NQAA 4E2DA 5BYWA 3VC6A 2GJPA 3WLPA 2GQ8A 1E5NA 3EWDA 1P0EA 2DJLA 3RM9A 5A5WA 4G5DA 2QYGA 3WCZA 3GNRA 5HWJA 2ZE0A 4LALA 2Y8UA 3UJ2A 1B3YA 4W4QA 5CPOA 5HWMA 5FSEC 4L1GA 2ZVIA 3PB2A 3V5FA 3CAQA 2WVVA 3AOFA 1X1OA 2BVWA 3HIJA 4ROQA 3ONBA 3LCIA 5DELA 4BR1A 3PB0A 2DZBA 3LM3A 4JN6A 4AEFA 1ICSA 7CGTA 2OOFA 4F2BA 1XQLA 2XWEA 1JD7A 4QJ4B 3WNMA 5F2MA 2EAWA 4GE8A 3AIEA 1BTCA 2GGHA 2GGGA 3W1UA 2YX0A 2A7NA 1EUNA 3CZKA 3ZFHA 1S2WA 4PA8A 4CQBA 1UR1A 4IXHA 4KKXA 2VEIA 1SZFA 5C6MA 2DDXA 1OYBA 1V6UA 5JIPA 5D38A 2VELA 3A4JA