3V18A

Structure of the phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
molecule tags Lyase
total genus 113
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v18A00
7PTDA 4QJ4B 2PLCA 3EA1A 3PTDA 3QVQA 1T8QA 3V1HA 4QJ3B 1DJGA 4Q6XA 4I9TA 3OHMB 1QASA 4F2BA 1V8EA 2O55A 3QR0A 1XX1A 3KS5A 6PTDA 4S3GA 1DJXA 1ZCCA 1GYMA 3EA3A 3L12A 1YDYA 3H4WA 1DJHA 3H4XA 1PTGA 4I9MA 2OOGA 3NO3A 1AODA 1O1ZA 2P76A 4R7OA 2OR2A 3V18A 3RLGA 3QR1A 2F9RA 4RW5A 1VD6A 4PTDA 3RLHA 3I10A 4F2TA 2ZKMX 4I90A 4RW3A 1DJYA 1DJZA 2OTDA 5T9BG 4GNKB 5PTDA 4F2UA 4OECA 1PTDA 3CH0A 3EA2A 5T9CE 2ISDA 1DJIA 3V16A 4I9JA 3KS6A 1DJWA 2PTDA 1QATA 4I8YA 2PZ0A 1T6MA 2FJUB 4QJ5B 5T91A 3MZ2A 4RV3A
chains in the Genus database with same CATH superfamily
1XG3A 1OFAA 2ZCGA 2O9OA 3WQVA 4YTTA 1AMKA 4DWSB 1SO3A 3P93A 1YE4A 2IKIA 3H8AA 3WFZA 5JIWA 1S2TA 4DIAA 1WDSA 2WHKA 3WDPP 1UR3M 3EKZA 5DMMA 3W7DA 4DXKA 2YDAA 1VRDA 4Q4SA 3B3DA 3GTIA 2Y61A 2Y7FA 4GYJA 2DUZA 1R9ZA 2XIIA 2BVWA 4H41A 3KLLA 4YTRA 3UWWA 3FJ4A 3WZ0E 3TYZA 2XVPA 3NQVA 2B0MA 4RNJA 4WY0B 4A22A 6ALDA 2WMJA 4JY9A 2DT0A 4M6VA 1D7KA 4RZ6A 2QHAA 3C6CA 3LENA 4R88A 3S5NA 2MANA 1R5YA 2TRSA 3IIVA 2E5CA 2O9PA 4D6JA 5AC7A 4WHBA 1RA5A 3E12A 3S42A 3BG9A 2WQPA 3H2CA 3WF1A 1LWIA 2YX0A 3TYAA 4MB4A 1ML1A 1LOQA 3VUSA 3NL6A 1ELSA 4AYSA 2D73A 3SUSA 1J11A 3L0GA 2GSEA 4QHRA 3O7UA 3A4WA 3M4HA 3WFAA 1ZAHA 4GY1A 3GXDA 3RM8A 4XUYA 5TIMA 3C2FA 3HJEA 3W84A 2OYMA 2YZRA 4LY4A 3LI1A 5CGMA 4UNIA 3AMLA 1VBUA 2NV2A 3OIXA 3CL6A 1S39A 3PR2A 2QJJA 3PTDA 4GPNA 2VZTA 4CNSA 3AXXA 3NR0A 3HMJG 4PE8A 2XN0A 1RP9A 2EQDA 2CLOA 3WD3A 5HA7A 3CQHA 4Q6XA 4DN1A 5H2ZA 1JQVA 1MEIA 4W87A 3TYBA 4EIVA 2O55A 2ZWZA 3N15A 3PTMA 3WLSA 1V0NA 5A6AA 2Q8LA 4B5VA 3NDZA 5CC5A 4LC6A 3AISA 1ITCA 5H8PA 1U1JA 1H2JA 2NWSA 2RDWA 2IPGA 4PBFA 3JVAA 1NWUA 3HQNA 4Y2WA 2HS8A 4FX8A 5J04A 3NQ2A 4HD5A 1ISZA 1LQ0A 1KA9F 1LOSA 1R2RA 3QYQA 3BAYA 2V6AA 4ML9A 4JCLA 3N17A 2KX9A 3VDGA 4Q8PA 3DFSA 1CPUA 3PC0A 3L2IA 3LN3A 4K38A 1Q85A 5AC4A 2BV9A 4YWSA 4A8NA 2YL9A 3KUMA 4B3ZA 3CPGA 3WDRA 1B5TA 1OX6A 1W1IE 6REQA 1HZYA 2XSXA 5AHFA 1NDYA 4B92A 4POCA 1W3JA 2TAAA 3DHPA 3KM8A 3EOSA 4W8LA 1C8QA 2XIQA 3SR7A 4M80A 2O4QA 4H8UA 1PUDA 2GSHA 1FY6A 2PGFA 1SJDA 4PRRA 2VRQA 3LRLA 2XZ7A 2E77A 2ZUVA 2A2IA 3FV9A 1EJXC 3NCOA 1AQMA 3B0VC 3S3GA 3GBEA 2QULA 3P60A 4ASTA 2R1KA 4IHCA 1PV8A 2WSYA 4RE3A 3TWBA 2HVOA 4H8NA 3QBUA 4JTGA 2GGIA 3EXRA 3QY8A 4TMBA 1FA2A 4HHMA 2YPIA 1QWKA 1XF0A 1HXJA 3WQ4A 3ZT5A 5I78A 3BW4A 1IT0A 3BURA 3NQGA 2CU0A 1BYDA 3G24A 1NJJA 4V27A 4C1NB 2BLEA 3CWNA 3IGHX 2C8NA 3UG5A 3PNZA 2BGQA 1QVBA 4GFSA 4NAFA 5F2MA 1DJZA 2VRJA 4G56A 3CV1A 1MXDA 2ZRUA 2FPTA 3G1YA 2X1IA 5DFAA 2WM0A 3CAKA 3T8LA 4EF9A 1R85A 3C0LA 4LAZA 3R8RA 4W7UA 2GGEA 3FKKA 3NG3A 3T0TA 1NVMA 3WF2A 3M5XA 2ZA3A 3R0UA 4NNBA 2ZX9A 4MDPA 3QHOA 2OKTA 3B9AA 1TPUA 4E2VA 1B9BA 3CUJA 2VGIA 4IIEA 1BTMA 1EJ7L 2AL2B 1J6PA 3C3UA 3H7RA 3PFRA 3M0ZA 1XFBA 3CGTA 1TRIA 4PCPA 5A6JA 4IQJA 4F48A 3GVRA 3D47A 1Q5MA 2Y85A 3L5AA 3FOKA 2Q01A 2Q3OA 2DH3A 1XCXA 2ZXBA 4N9EA 3HPXA 5A6TC 4WXZA 5G2WA 2QVHA 3UWUA 3CIWA 1NOFA 3PWGA 3NGJA 5A6KA 4AWUA 3MW7A 1SJBA 4PTDA 1XCWA 4XAGA 2DZTA 3V0TA 1X96A 1ZALA 3ZR5A 3C52A 3WFLA 2D3LA 1F3TA 3NZRA 3ATZA 4MOZA 1H49A 4OQVA 4ATDA 7TIMA 4QNEA 4AZHA 2VMFA 3M43A 4D6EA 5BCAA 1K4HA 4I9JA 1YNPA 3SECA 2A6NA 3MI2A 2V5CA 2PP1A 3THQA 1OSEA 2WNQA 4KFPA 1E73M 1OCBA 3UY8A 2HVMA 2PDPA 1E6QM 3TKFA 2O7QA 2GVYA 4GYFA 5DXYA 5FEZA 4JTFA 2VVSA 1F7BA 3ONCA 5D2TA 1AJZA 4IXXA 3CPUA 5ECUA 3II1A 1OFDA 3I4EA 2E8YA 3EDJA 5HPCA 4OZOA 3VNIA 1OF8A 3EA3A 3NQEA 1I6NA 3TXVA 1VYRA 3HF3A 2WLZA 5K4ZA 3VIOA 3Q4DA 4C90A 3MA8A 1FWGC 2F9RA 3O6AA 2VFGA 3W1AA 4ZO8A 2OKOA 4PR4A 4W8AA 1TVPA 3MP3A 8A3HA 1K03A 4UFLA 1XYCA 3BG3A 3M0IA 3SCNA 2PSNA 4P61A 1P5BA 4KMQA 3I3BA 3MO7A 3KLKA 4FIRA 1GORA 4ZO6A 2ISSA 5BNKA 4ZB2A 4LNYA 1P7TB 1ISXA 3VCCA 2XPKA 3N12A 4BF7A 1Q45A 1VBGA 2HSAA 5HNNA 5D2YA 3ZLFA 3CZLA 3L4XA 3LRKA 3SCQA 4JN8A 2QDEA 2D2OA 4URIA 2YYTA 1HW6A 7ODCA 1TQXA 1W32A 1FCBA 2OGJA 5I3GA 2B7NA 3VOJA 2PCEA 5C2CA 3G1FA 1JZ2A 1VFSA 2VFHA 1H1NA 1SUXA 3ZQ9A 3DFOA 2Y8KA 4JQ2A 3VIKA 4IQEA 1V0MA 4IJRA 2WQDA 1OHLA 4LVBA 3SQMA 3GNPA 3EWZA 4ZR8A 4EPDC 1A5MC 3ENLA 2AQVA 4FF7A 4OTKA 2ISFA 2D0HA 5BMWA 3W88A 2C3ZA 3WJSA 1DWGM 3E0IA 5CXPA 4UTHA 3GVWA 3KOYA 4GBUA 1V77A 5DBUA 2Z1BA 1R87A 1YLVA 3HG4A 4I5UA 1BXCA 4R7OA 3W27A 1JPKA 1V51A 2PGRA 3MKVA 4YTUA 5HMSA 2XVKA 1EGVA 1WDPA 1XW8A 2HNHA 5HPOA 3U0HA 4DF1A 1PAMA 3DYOA 4N6FA 1RR2A 4AX6A 3LG3A 5CPOA 3N29A 5CJNA 2BXVA 4LUSA 1E6RA 1CT5A 1EGZA 3ARVA 1EA0A 4L7ZA 2VELA 4BWLC 1MI3A 1HVXA 3G3MA 1WBJA 3KDNA 4XAZA 3BAKA 3WH9A 1Q6DA 4O16A 3N4FA 5HQMA 1XC4A 3W23A 4NY2A 2F6UA 4FXRA 3WD4A 4NX0A 4PTNA 1GUVA 1R7AA 4RCXA 5JUVA 3H12A 1OINA 3VGDA 1KCLA 2PA6A 3AXKA 1R3YA 1EHNA 4R7JA 1TPH1 3UXKA 1GQNA 2X1RA 3WNPA 4IM4A 1JYXA 3AIQA 4K8HA 5F7UA 2G3JA 3KRSA 5I07A 1X1OA 3VINA 1PZ2A 2OT1A 3RIKA 2A7NA 5HJYA 1UYQA 1YPIA 3S1UA 3BW3A 4ICMA 4NXSA 5EMYA 2WBGA 1PX8A 2QAFA 1RH9A 5FAJA 4KEVA 4N9BA 1Q7QA 3CL8A 3DG6A 3KRZA 4A3QA 4AEEA 4H9VA 2YW4A 4W84A 4O0QA 4LX4A 1A5KC 4ZTYA 2X1UA 1JCYA 4L80A 4FNSA 1UMYA 4JNMA 2Z2BA 4HNTA 3ZYZA 3WK1A 1ZLPA 1QHOA 1VFMA 1P48A 1BF6A 4UTIA 4XQ6A 1TX0A 2CCRA 3NVDA 2POZA 3MBDA 5ABTA 1JG9A 1TR1A 3MHGA 2V63A 3TZFA 5CSSA 1UKTA 4WRHA 1AQ0A 4ENLA 4ICNA 3NQFA 1DWIM 3IJ6A 3B0UX 1H7RA 1S2VA 5EMUA 1RAKA 1QW8A 1NWTA 1K77A 4LU0A 1W1ZA 1KFBA 1R9YA 1EPVA 4GINA 4UTMA 4HPXA 4V33A 3AS1A 4Y6GA 1JFXA 1KXQA 3MKCA 4LBSA 3N04A 2AQOA 3BZGA 3UYCA 4AD0A 4FOUA 3VD4A 1O95A 1E1CA 1MW0A 3VGEA 3T09A 1KM2A 4MF4A 3B0XA 4KGJA 1RK5A 1SFJA 3R8GA 1TTJA 5KMYA 1VHCA 3TC6A 4TV6A 1K9DA 5DO8A 3BG5A 1OABA 4GH3A 2IMRA 3EWBX 3BCJA 1UR1A 4AAJA 1R3QA 4JXCA 3GM8A 1OT2A 2I14A 4AX7A 4WZHA 1BTCA 3H4XA 3QQ0A 2XSAA 1XBYA 5F2IA 1UIOA 2HCVA 4LEFA 3UG8A 3LX9A 1Z44A 4JS3A 5E9AA 1G5AA 2Q02A 4LANA 4XAYA 5LNSA 2EKCA 2A1YA 4NZ1A 4G8TA 3RUBL 1E4MM 2TODA 4FLSA 1XIGA 2EPMX 3XISA 4L9ZA 4BK9A 3FSUA 3STGA 3ONBA 5HJLA 3QV7A 2GGHA 3IJDA 3W1XA 1OK6A 4GZEA 4KF1A 3UCDA 3IGSA 1B3ZA 2WZTA 3CZJA 5KZDA 4WGXA 5DCDA 3TYUA 5BXSA 4L56A 1VYPX 5CEWA 2Y4SA 3M64A 5CKSA 4WSJA 4E5TA 3LCWA 1SO5A 4H00A 4A2SA 5M2FX 2DIEA 3PBUA 1MWOA 3E2VA 1HNYA 3VIMA 1YTKA 1KBJA 1O7AA 4XWUA 3B0YA 2VD9A 3ITTA 8XIAA 3HGJA 2XFYA 3MJYA 1E56A 3JZEA 4GJ1A 3RMJA 1XFCA 1UC5A 3WD0A 2YBVA 3RCMA 3USZA 1SJAA 2HJPA 2FHFA 1P6BA 1G4EA 2XFFA 1V6TA 2FFCA 5CPSA 3W7RA 1PZ1A 5HMFA 1UQYA 2DIJA 1YBQB 3VYLA 1MW2A 1MMFA 3OZMA 3TH6A 4ZQPA 1W2PA 4M8UA 3DYPA 5FF2A 3SY5A 2QDDA 1LUCB 3TYCA 2VRKA 4QE4A 1X8CA 3BLFA 4AH7A 3SGZA 1BQCA 1GTHA 1D3HA 3FHAA 2OEJA 3SCPA 2QIIA 1SMAA 4LEQA 2DVXA 4JFVA 1PCWA 2G3IA 1E6PA 3VOFA 3AALA 3GG8A 3OG2A 1P0BA 1XGZA 4L4MA 1XSIA 4ECLA 1TMQA 4HTYA 4JL1A 2OSYA 3KCLA 1W9DM 4PL1A 2OWCA 1F6KA 2VOMA 3MO4A 4NJJA 2WMGA 2YBTA 4KCVA 4PH6A 1CB2A 3NPUA 1H51A 2Z1WA 1MZHA 1CGYA 4DJED 3FAWA 3H23A 1V02A 2GLKA 4ERGA 4H4IA 5AFDA 3KXQA 1FWNA 1K8CA 3NSXA 1AH0A 4DQWA 1UROA 4DPQA 2ALDA 3AYTA 4GISA 3V0UA 4MWAC 1S1RA 4CLMA 3AWOA 1TIWA 3ID7A 2CLEA 2G95A 3R6IA 3ICJA 3O63A 1E3ZA 4DI9A 1C91A 3P5YA 2QCLA 4XBSA 4JZ5A 1KLZA 1AL8A 3I4KA 3RHGA 1G4SA 1H60A 4Q22A 2E6DA 5CZJA 1O1ZA 3EX2A 4H6QA 2PDCA 5G4WA 1VFUA 4X2RA 1WX0A 1OFBA 1BVZA 2CPUA 3VOGA 3NYDA 2DSVA 5U7SA 3VD7A 4Z2JA 3THDA 3U5YA 4B3KA 2VHLA 4CD7A 1KCXA 3PZVA 3QY6A 4HMCA 4K36A 1SPQA 2YCEA 3N6JA 4LS1A 1VYSX 1M6JA 4G9PA 3TE9A 4CQ8A 1M5WA 2QCMA 3SCRA 4UCGA 5HUOA 4GOAA 4FXFA 4C6EA 2WCGA 4KCTA 3ITCA 3APYA 4XIAA 3WK0A 4DYJA 2YXGA 4UR7A 3LLDA 1M9HA 1X7FA 4LW7A 2WW5A 1HJSA 3VD5A 1EQCA 2CLHA 3LXAA 1VF8A 5LNWA 3PM6A 4Y9MA 3SN4A 3WMLA 3IWPA 2GJNA 3GG1A 1ZFJA 3N2CA 4KERA 1F8MA 4W7WA 3EX3A 4DRSA 3T4WA 1EGMA 5E6ZA 2WV8A 3ZO9A 4IISA 4IH3A 1L6YA 1G9HA 1NIUA 3N2OA 4I9MA 1DTNA 3PBVA 3WN6A 1D8CA 2V30A 3AS3A 1KXHA 3SRDA 3EXTA 2AL2A 4LV9A 3CV7A 1HFBA 1RZMA 2W0UA 5HXMA 2XH7A 3NO5A 3LCHA 1FP8A 3FEMA 1LTDA 3NFUA 4DY1A 4DUWA 3TTYA 3G8EA 3OA5A 3LK6A 4O14A 3DFHA 2QKFA 3WD2A 4M24A 1O1HA 5PTDA 4ML4A 4DJFC 5CC3A 3QYSA 4AZ5A 4WKFA 3WMSA 1VPQA 3MY9A 1B3YA 4JIHA 3AAMA 4CNUA 2PWHA 3QZAA 4IMEA 1XH1A 4PTVA 3TTEA 3FXYA 1VKFA 2E8ZA 4ATLA 3ELFA 4XB3A 1ICPA 1BYBA 4S3CA 4CN4A 4JAWA 3G1DA 2YXXA 1W9XA 1HO4A 4RXFA 2QJGA 2DSWA 3P67A 5LIUX 4AZGA 3N3TA 2AMGA 4UQCA 5HNTA 2VZOA 3KEHA 1GOKA 1IEQA 2GDVA 3KDOA 1PBGA 1EKOA 1JZ8A 3N2MA 1W1B1 3QV8A 1G67A 2INFA 6PTDA 3G3DA 5K3VA 1DV7A 5HR6A 1UBPC 3GDMA 4HSNA 4AIUA 1YDYA 2ZUTA 1W3IA 1C9WA 4O10A 2WVTA 1OX5A 4LSBA 2X40A 4AW7A 1UPPA 2DZPA 1OF6A 3L23A 5LIXX 3GH4A 4KEMA 1YW1A 3SN1A 1PTAA 1TVLA 2ZOXA 4UR9A 2Y7EA 2WHMA 1S38A 4FLRA 4W89A 3VMOA 1QRQA 3A5VA 4RW3A 1F6YA 3CB8A 4F9JA 4LTSA 1TE6A 5E09A 1W9PA 1KFWA 3M7WA 5M03A 4N9CA 1V03A 3E6EA 5CBIA 4NYYA 1G69A 3RR1A 3H7UA 4L65A 1JDDA 3CZGA 3QJAA 4ONVA 4F4RA 4UZUA 1C90A 1QU4A 3MSYA 3VE9A 2NW0A 2VKZG 1C7TA 4L4OA 6XIAA 4N42A 2J79A 2DSZA 3BC9A 3SSZA 4LF2A 3LCXA 4FSAA 4LUYA 3TQPA 1H5VA 1H7PA 3FA5A 3WLMA 3RMEA 4ZOBA 4KT2A 2PDNA 4LBRA 1E1EA 4P7LA 4ZQNA 1ITQA 2H6RA 4CCDA 1X8FA 4ZMGA 1XIIA 4O8AA 1OZMA 3C8NA 3BLPX 1JZ4A 1E15A 1P7TA 3LHUA 4IFRA 1L0PA 2ALRA 4WD0A 1IHIA 3BQ6A 1XIMA 2BOFX 3RLVA 1YE6A 4PB3A 3VI2A 4PMUA 2CXEA 2QAPA 3VCRA 2GL5A 1B57A 1A0CA 3KL5A 4OUIA 4AIEA 1EDGA 2VEMA 3RLUA 3OLEA 1GQJA 1OCJA 3SIZA 4DBWA 3WQDA 4HMNA 1JXJA 2WCAA 2GSJA 4QG8A 4QP0A 1IF2A 5C9WA 2YJQA 3BAIA 3AFBA 2V0TA 4HJWA 4LAKA 1WV2A 1XIFA 2R9RA 1MRAA 3WK3A 1YRRA 2FJKA 5F4WA 1JRBA 1A4MA 3TAOA 4Q8WA 3I7SA 1B54A 3PUGA 1KBBA 4XZ9A 3S1VA 2HTMA 4HGXA 4EPKA 3UP8A 3K4DA 3F7JA 3MC5A 4MJ2A 1FWBC 4KESA 3LLFA 2H9AB 3SW6A 1NSJA 1W1TA 1W8GA 2EPNA 4JFSA 5EA9A 3H7VA 4W5ZA 2PDQA 2PTWA 4FR6A 4E8GA 3CUHA 1AQHA 1C93A 2AQWA 3RX3A 1DJXA 2REQB 4UQDA 4Y9OA 4J5NA 1EPXA 1KFLA 4B5NA 4OHQA 2WCSA 3A23A 2OOFA 4JDYA 4Q4RA 2WNNA 1OEPA 2QV5A 3U4AA 2BY3A 3PULA 4QGCA 3PB2A 4XZLX 2XG9A 3VNJA 4PYSA 2QJMA 4PUKA 2QCHA 4GKLA 2PDHA 3PZOA 1PKMA 2E9MA 4LV4A 4D6DA 4O57A 5CCZA 5A6SA 1G7VA 3DECA 1XLMA 2PWUA 8RUCA 3F4WA 1XC6A 1RQHA 3G1XA 4CD6A 3WJYA 4A05A 3URAA 2Q3RA 1JFHA 4GI9A 3MUXA 2XWEA 3IGUA 1RVKA 4ZEPA 4WJEA 1XG4A 4IFOA 4FX6M 4NZCA 2NUXA 3FFSA 2WYSA 1VBJA 1O4UA 4P8VA 3MZNA 3PZIA 3PBYA 2VQTA 2I56A 1I0DA 3GIQA 4GQQA 5F1VA 5JMUA 4GYPC 3KBNA 1N2VA 1HP4A 3O6YX 4FX7A 1I75A 3PPHA 4KIRA 3K30A 1L6GA 4JTUA 1ISWA 5EU9A 3OYZA 6XIMA 1VIWA 3HPAA 3VKKA 1F2JA 1FVPA 2Y88A 1GVSA 4PEKA 1JI2A 3LBCA 3GNXA 2BOGX 4IQLA 5FCZA 4UTJA 4PB5A 1D3GA 2XGZA 3KOXA 3MP4A 1UC4A 3WLQA 1REQA 4JTHA 4GZ7A 3G22A 3WLIA 4ZOEA 2BVYA 5GQBA 2Z1VA 4V28A 4PSRA 2R24A 5FIPA 2C79A 2D23A 3GZ3A 3CQIA 1W8SA 1B90A 3TW6A 2VUNA 3F03K 2WBKA 3TOPA 3P6LA 4QISA 4ACZB 4Y7EA 1EWEA 3VX1A 4CQ9A 4NL1A 1UP2A 1V7YA 3VOHA 2CZFA 2YFOA 4JN7A 4J3TA 2ICSA 5FJUA 4CU8A 3PK7A 1KC7A 1QOQA 3T55A 3WDIA 2QCDB 3EA2A 3TNBA 5A8PA 2PAJA 2ZYFA 4KS0A 5FL0A 3LCGA 1FWTA 4DO5A 1HF6A 2FFIA 3RPMA 1J0IA 2C0HA 4PSPA 1TJ0A 5C7HA 3EPOA 1XISA 3T0BA 1QJWA 1FFQA 1RD5A 4S23A 3IJIA 5E9XA 1ICQA 1XBXA 1D2KA 1UB3A 3BSHA 1MFVA 2X0SA 3ITOA 1DE6A 5C70A 3M47A 3QHMA 3MDUA 4TU1A 4C6NA 4CN1A 2JQXA 4DBSA 2DPEA 1J8VA 5ABHA 3BMXA 3LI0A 2OLSA 1BG4A 1OFQA 5TF0A 3SCUA 2P8CA 2PEVA 2QGYA 1UASA 4ZQMA 4UTTC 5FJRA 1TVNA 4BA0A 4AFYA 2YCIX 3HG3A 3QLLA 4JHZA 2DORA 2OLAA 4WF7A 4RL3A 2J25A 1KTCA 1QHPA 4KH2A 1K70A 4ATWA 3TEVA 4O28A 1R3VA 4RW5A 5CSRA 4GK8A 1IEXA 3RLHA 4ZTXA 4D8LA 4DUVA 2F7FA 1LBFA 1EEPA 1W0MA 3GFZA 2CLKA 1G4PA 1RQEA 1JYVA 2JIEA 1PCKA 1VLIA 2VM8A 3ECQA 3HB9A 5JH1A 1XH2A 1YBQA 4OBSA 1VZWA 4DAFA 3KRUA 1UKSA 1NTHA 1TV3A 1UOKA 3HIJA 4K2SA 5I3JA 4UTWC 3AHXA 1A5UA 5D33A 3DOPA 1T6MA 2VL4A 1GYNA 4S3FA 3V1PA 3W01A 5JBEA 1C8XA 2AGTA 1X97A 2C71A 3IAPA 4CQAA 2DW6A 2YA0A 4IIDA 1ZTVA 4W93A 3AROA 3NJ3A 1EA9C 1SR0A 1EO7A 3I6RA 4I7VA 5DY2A 3WQWA 5FKYA 5C6MA 4QCFA 4HZ7A 2PBOA 4I9TA 2YDSA 5GNZA 3GBDA 1QNVA 4DYEA 3O15A 1XLAA 3NL2A 2ABBA 2PTXA 1IXPA 2C6QA 1I2NA 2ASHA 4P8UA 3M0LA 3H2MA 4GJJA 4H01A 4GX9A 4KRZA 3SIMA 3A5FA 5DMYA 3T4CA 5FF3A 4UNKA 2BFGA 3GK0A 1J2BA 1TWZA 3KZPA 2HS6A 1VC4A 3HG2A 3HURA 3NO3A 1N8IA 2YZ5A 1XP3A 3KBWA 3WEOA 4UR8A 5KINA 4P7RA 2BOEX 2VYOA 3WH8A 3PUOA 4PUJA 4PMJA 1LCOA 1W3TA 2WZHA 3WQCA 2P53A 3IGXA 2XSBA 3NM1A 1C8YA 1OM0A 4AIBA 3WLOA 3QC3A 4HQVA 3BMWA 1NEYA 3QW4B 1XH0A 1TPC1 2CETA 3TMLA 3MMUA 4YYFA 2V3EA 1V6XA 3W74A 2PP3A 2EG8A 2ISWA 1NM9A 3TJXA 2OEKA 1O5KA 5B7YA 3TW9A 2ISDA 3B40A 3S47A 4JTEA 1E0UA 3T05A 4H6EA 5EBAA 3THAA 4NU7A 3LTPA 4S3KA 3UR5A 5T26A 3W1UA 4M1BA 4R85A 3UWYA 2PD9A 2VJXA 2GPTA 3KP1A 4MFDA 5CJ5A 4NZJA 2DSUA 4QEEA 3U2OA 5G4HC 2GJLA 3EMQA 4H19A 2Z6IA 2J7FA 3GAYA 2C1HA 4KW2A 3W6LA 4GGHA 1XIBA 2DZAA 3W85A 3QKEA 4YLWA 4HNVA 3MYPA 3STFA 1BWKA 1C92A 3NEVA 2PC8A 1XIJA 3GH7A 1SSGA 3OVQA 1LP6A 4QFUA 1NWRA 2G8ZA 3MI6A 3W1LA 5D02A 3W7JA 5FEWA 4RE4A 1W37A 4KETA 3TZNA 3WIJA 2GDQA 3POHA 1N8FA 4GC3A 2WVVB 4JFTA 4WQ6A 4PBEA 2HVNA 5GVJA 3RO6A 3CHFA 1WBHA 3PTKA 1KM5A 2Z6JA 1V6VA 4IP4A 3APGA 1E6SM 2RUSA 1QWGA 3VDAA 5C0QA 1I2QA 2VX6A 1DWJM 3PTQA 3EMCA 2OZ0A 3G0XA 3W2LA 3AHTA 4Z0SA 4FNPA 4RDWA 1Y7VA 4GCXA 2DT3A 1U1UA 4PCFA 3UWQA 4LYRA 3VFLA 1IEWA 4XO6A 4DBEA 1HT6A 5HWJA 3UZYA 5D8WA 2IQTA 2P10A 2ZDSA 1NY1A 4XO7A 5I02A 4AIOA 1OD8A 1DQWA 3W1TA 3WNOA 1BSLA 3IK2A 1UD6A 3AICA 1TPDA 5HDRA 2A7PA 1XYZA 4DELA 3VU2A 3GC5A 4IPNB 5CZTA 2ZA1A 1PIFA 4YHGA 1FFRA 2J62A 3UR7A 5LIKX 1XDLA 3GXFA 2E6AA 4AHQA 3TOYA 3I3DA 4GQGA 3DH7A 1PVNA 4TX8A 1I45A 1XUUA 4LCRA 5CZSA 1TJ2A 3V18A 4Q4MA 3G1SA 5I5RA 5J5RA 4AZ7A 1D3CA 4D6HA 4F2TA 2PU0A 5HATA 3RCNA 3GUWA 4X9SA 1V3MA 3CMGA 4LAOA 4UTUA 3UCCA 2NXGA 3FCPA 3PHAA 3URBA 1CZ1A 1YADA 1GZJA 2WSQA 3MUAA 3N2TA 2G5WA 4RZBA 2D69A 2A3AA 2YLAA 3PSWA 1HKIA 2GJXB 1VFHA 3G8RA 4GXMA 3NYZA 5BU6A 5C54A 3N11A 2OYKA 4HHLA 4TMCA 3WLHA 1GOMA 3S0CA 4DWSC 1OX4B 4P7QA 1P0NA 2W66A 1GVYA 3MPGA 4QG6A 5A8NA 3UFYA 4ZENA 4AF0B 5D9PA 2AKMA 3E96A 1F3XA 3WBAA 2WSPA 3TW7A 5A6BD 1SW7A 3F2DA 3QPEA 3GDLA 5AZ0A 4DJDA 4U3AA 2QDGA 4GUIA 3A12A 3QH2A 4ZQCA 4NI3A 1TWWA 3GWQA 3ZIZA 3O9NA 1ZNNA 1VB9A 3IVUA 3SN0A 1QNRA 1KKRA 3VNLA 4O4VA 4L6OA 1Y65A 4EE9A 5E6YA 4IPJA 4RE0A 1G6CA 4EKJA 1OYAA 3VGBA 1A5CA 3CT2A 2FHCA 4JHOA 4NNCA 3KHJA 1KXVA 2ISVA 3UJFA 3GX9A 3M5VA 2CLLA 2G4JA 2EHHA 3AIEA 2OSXA 1EC7A 4UNLA 2P0OA 1KM6A 1QCWA 2GWGA 4E8CA 3QM3A 4MY8A 2OCZA 2HNEA 3PZGA 4DO4A 1R3SA 1KTBA 1BXBA 1YXCA 3ANYA 4MUPA 4PN2A 4FNRA 3L4ZA 2V81A 1HO1A 1VENA 1IGSA 1E5JA 1XRTA 2ACSA 4GA8A 3D6NA 1GZ1A 4EAMA 1XIDA 1FCQA 3KVJA 2PTYA 2O9RA 2X42A 2PDIA 4HSOA 1A80A 2E09A 4L61A 2P8BA 2ZVRA 4QEHA 3QSRA 2VO5A 2I1OA 1UJQA 2JKEA 4WGHA 1HJWA 4WDUA 1DXFA 2RHGA 3NSMA 3BK0A 1GKPA 1DQUA 2C16A 2QCCA 4F40A 1WQ5A 2PF0A 4EXAA 4S3EA 1H7NA 2WHJA 1QPQA 1H3GA 1EHAA 1B3WA 2PFHA 4C7FA 1K8ZA 1QI5A 3MSGA 1LG2A 3JUGA 4HPJA 1UG6A 3E0FA 1OYBA 2XZ9A 4B5SA 1OT1A 1AODA 3GDBA 4N4PA 1UKQA 2V69A 3VIFA 5B7ZA 1VGAA 4IP5A 1JL8A 3KWSA 4P2VA 1FP9A 2FQIA 5JVLA 1AA1B 1A47A 1ONWA 2G41A 1EJVC 3F2CA 1DIOA 1S5WA 2AAAA 1XL9A 3HTWA 1DJYA 1TPEA 4TV5A 3EMZA 2BY0A 3UWVA 1RK6A 3EDKA 4GNKB 5E0KA 3S2NA 2G3NA 2E9BA 5IXEA 2ZC8A 4J3XA 4MWAD 3BSMA 1E6ZA 4K7YA 1XYBA 4UQBA 1B2YA 1PWLA 1V3KA 1L2UA 3MV01 1WP6A 2IUZA 3QFWA 4NI8A 1S5NA 2PWDA 2EG6A 4C7DA 3KFTA 4P7NA 3B9NA 4P8XA 3WD1A 1Q6QA 4QTGA 2DQXA 3UESA 1FBAA 2PWVA 2ATMA 1TUFA 1HKJA 5CZKA 1EX1A 3O6DA 5CPLA 1WZMA 4Z0JA 1VBRA 3BCFA 4CCEA 1O94A 5HANA 2WPBA 5DBTA 5I09A 4J28A 3VD3A 1EP1A 2QPXA 1PZ3A 3PJWA 2Y6ZA 1J6OA 3ARWA 4ZO9A 5AHEA 4MSSA 4IICA 5I2UA 1G94A 3M1ZA 1SFSA 1ECEA 3BPWA 1CNVA 3TYDA 4QBXA 3M16A 1SMDA 3W2JA 5C2XA 1YEYA 6ENLA 2QEZA 2BXZA 4MB1A 4Z17A 4RDYA 1PZ0A 2DZUA 5EMLA 2D20A 3KZSA 4ZQRA 3R12A 5MHBA 3OJGA 5DEZA 3V16A 4CEXC 4XZMX 3PZUA 3UPMA 4V15A 1QATA 3MHUA 1EO5A 3PZMA 2FJUB 4NZ4A 4J3ZA 4ACZA 3HGOA 2XISA 3DENA 4JIIX 3BSGA 3W7KA 1CECA 2FTPA 1UWTA 4A8LA 2A7RA 2QCDA 2GWNA 1UA7A 3TLLA 4AY7A 2UY2A 4DM2A 5LA0A 4L4LA 1WE5A 1KM1A 4PRTA 2Z27A 1SZGA 5EYWA 2WM1A 2WKLA 4DJFD 4HHHA 1ZB5A 2PGWA 3RNDA 2CW6A 1E9LA 4L5ZA 1KBLA 1TX2A 1VFFA 2QMKA 1JI1A 1P1MA 3LHTA 1GYLA 1TG7A 1C29A 3TQVA 2RAGA 2WANA 1U33A 4PMNA 2V8ZA 5ENLA 3EEZA 3K5XA 2Z2AA 3UZWA 1EUNA 4QDMA 2G37A 4KGLA 2WB5A 4EACA 1VFTA 3FIGA 4S1FA 4O12A 3BGGA 2E6FA 3LA4A 2Q6ZA 4PMVA 3A4JA 3GDKA 4LUTB 1FWDC 4E2OA 4MAVA 1E0TA 3DHUA 3W83A 3VIJA 4IQDA 3B8DA 2A85A 3IUDA 2QT3A 5IFTA 2CZDA 4FLOA 1B9ZA 2C0AA 2E1WA 3UPWA 3OVPA 1UMLA 3IJQA 3QRHA 4W9TA 2X2GA 4ERAA 3DC8A 4WEVX 3AS2A 4IZGA 4DJEA 1Q6CA 1VFOA 1Z42A 3BGJA 3R0KA 2PPGA 2EBNA 1JYNA 3PZNA 4O1CA 3GR7A 3TC3A 4QLLA 1A3HA 3NIYA 9RUBA 4LOCA 4IPIA 3M0VA 5C9RA 3GXIA 5CAKA 4GGBA 2GDUA 4QROA 1BYAA 5KSWA 1U5VA 2WKJA 3G0SA 1OK4A 3N4EA 2FHBA 4JX4A 1OJXA 3A3HA 1SQ7A 3C2EA 4W86A 3W1NA 1NP2A 4P7OA 5AKQA 2A3CA 4GVFA 3EWDA 5AVHA 3GG0A 4PFMA 3BWWA 1KQYA 3L4YA 1A5OC 4GO9A 1R3WA 2W9MA 3OU8A 4IUOA 2XVGA 1V5XA 1TIMA 4C5YA 5LNVA 1DIEA 1X1ZA 2J9YA 1JIBA 1RJQA 2WMKA 1GVRA 4AUBA 3CHDA 4M6PA 4FMVA 4N0RA 2WVUA 5BOFA 4YHEA 4ZGYA 1Z89A 3I65A 4MG4A 5REQB 3W26A 1IGWA 2NXHA 4HB7A 1I2PA 3HMCA 5G1YA 1Q2RA 2VC5A 4IL0A 2PRHA 4LXFA 3OVGA 2VFDA 3PG8A 2J66A 1V7AA 3UG4A 2D2HA 5DELA 3W2MA 3P0WA 4XAPA 3M41A 4BFAA 1YDNA 3V1HA 4DUOA 3CIVA 1G7UA 3R10A 2JFEX 1K9TA 3GXPA 3SM0A 1IWPA 2AOSA 1DYSA 4GUGA 2ZXAA 2HV5A 4RPQA 4PA8A 3WCZA 4GVGA 3BOXA 4H7CA 3C56A 4RPPA 4MJ4A 4Q8MA 5K9XA 2FPVA 1BVWA 1W54A 3T2OA 4DAIA 4YNGA 4Z2GA 1F07A 4WDWA 5BMXA 4D2JA 2B81A 3QTPA 3AU2A 4O1AA 3AZSA 4X2PA 3GKFA 5D9MA 1NARA 1QOXA 2FIQA 1EZ2A 4F0RA 1J79A 5XIAA 3SFKA 4N9DA 3SJNA 1G0CA 3WNKA 3ANUA 1JPMA 4K6AA 3U9IA 4E4UA 5CPQA 3S5OA 3UJ2A 3O2LA 3NQAA 3THCA 2ZTKA 2XIBA 2O0TA 4GUJA 3V5OA 3EKGA 3VX0A 2ZWYA 4AVNA 1JDAA 1YDVA 3W7QA 4TR9A 3AIBA 1VEOA 2W61A 3WMBA 3L9CA 4CUCA 1X98A 4NJIA 4WCJA 1RLCL 4LF1A 2HRWA 4JL2A 2D24A 2WVVA 2Y0FA 1EUAA 5AC6A 3GVVA 4KWWA 3HFTA 4ZOAA 3KBVA 3NQ6A 3GB6A 3H2AA 2WWCA 2OVLA 3GXTA 3I7RA 1UUMA 2G0WA 5D04C 2W27A 4FNTA 4Q8QA 5E0CA 5D9NA 4Q7NA 1GT8A 3PBMA 1EXBA 4TQTA 4UTFA 2XU2A 1JZ6A 1HKVA 3W28A 2WMIA 3L2LA 2XIMA 3H26A 4F3HA 1M03A 1M3UA 4JKMA 2FZNA 1KGWA 1P4CA 3TLQA 4LFYA 3IK4A 1DORA 4DNHA 3PS7A 1J18A 3VUPA 1E5NA 2QNEA 4LUJA 3EAUA 1W5PA 2OZ8A 4LQ1A 1V93A 1UR0A 5M5DA 3AJXA 4V2XA 4GIRA 3GTFA 3CAWA 2QUTA 1P6WA 5LA2A 2RKXA 2POTA 3FJNA 2WJZA 3BLIA 2OFJA 3MBFA 4HCDA 3C0SA 3UU0A 2Y24A 3PAJA 4F0MA 4D9PA 3W9ZA 4OBRA 4MMWA 4JTLA 3N18A 4QJ4B 1NQKA 3TN3A 3OQ8A 1UD2A 1NQ6A 4HA3A 5CBBA 3SCOA 2GUYA 3TWAA 4BCEA 1QPNA 4C6FA 3E0WA 1WUEA 1T99A 7XIMA 4KEZA 4X0VA 3ABXA 3DERA 4INFA 3WL0A 3IIZA 2GJXA 4JYFA 1FWEC 3D46A 3RILA 1KLYA 1ZJBA 1N55A 4M81A 4XIMA 3PF3A 1SVDA 2ON3A 3OO2A 5CPTA 1OZQA 3LHZA 4IMDA 3WYZA 4Q4OA 1ME7A 1CLVA 1OX4A 1ZU8A 1XGDA 4Q8NA 1UZ1A 3U7VA 5SWUA 4UC5A 2W6RA 5CPMA 1GGOA 5E5CA 2YB1A 3SGUA 4B15A 3IVSA 1SM9A 4ZXOA 2RDUA 2I7GA 1OG6A 4JHMA 2KZHA 5LHFA 4Z1AA 3REQA 3H24A 3WY1A 1MVYA 2OTDA 4IJCA 1CENA 3HV8A 4B9ZA 3GTHA 3AWNA 1O60A 4AZBA 1EEXA 1NFPA 2J27A 1FDYA 1QR7A 4JN6A 4G7FA 5DQPA 1H62A 1M01A 4I6VA 1LL6A 4Z08A 3PB0A 1LQ2A 4K8GA 1LWHA 1P43A 2YL8A 4MAZA 4IOTA 4FAMA 3SRKA 1GVEA 2ZXQA 3ZWSA 2ZZ7A 2WJFA 1LBLA 4A3UA 4Z42C 3FDGA 2FH6A 3UA4A 1HKKA 4F0LA 4IFKB 1OD0A 4K37A 3DU0A 3DKLA 1D7FA 2VZUA 3P0XA 4Q32A 2F2HA 4HNLA 4M0XA 3OIHA 5LKYA 1EDQA 1QNOA 3RRXA 1OGGA 3E38A 2PC4A 4I3GA 3TTOA 1NFBA 1TJ1A 2BTMA 3G1VA 1E70M 2JEQA 1TWDA 1BYCA 1U2YA 3CTTA 3CWHA 5HULA 4W85A 1DP0A 1ZAIA 1E6NA 2H8ZA 4PMQA 1S2WA 1JCTA 4O0ZA 2RGMA 3VKAA 1MYRA 1CEOA 1PTGA 3ISIX 4MUZA 2AL1A 4QDPA 3HV9A 2ZFAA 4OOUA 4XK2A 3WBEA 4BF9A 4JQ3A 4OIFA 3N14A 3BARA 4MWAB 1WKDA 1K7XA 5EPDA 4HA0A 1YXYA 1W1A1 1MFUA 4HOWA 1GG1A 3ITGA 4ZB5A 1SO6A 1S2CA 3CWOX 2VFFA 4Z1DA 3W7OA 3QQ1A 3N2BA 1FKXA 2QGHA 4NSBA 5IRPA 4GI6A 4KQNA 4O0KA 1TQJA 5DMLA 5HWMA 3E02A 4R9OA 3UPBA 3ARPA 3VMNA 3ZSSA 4MKSA 5D30A 3K1GA 2BASA 1H5YA 3QFEA 5AHMA 1PDZA 1E72M 2IKGA 1WDQA 2OGYA 3VNDA 3U4FA 1P0KA 2GVJA 4US6A 1ITXA 2E5BA 1IXQA 4PUNA 1N7KA 2QCFA 2PU1A 4CQBA 1IWBA 1OC7A 2OJPA 3DFNA 3UJRA 1DWFM 5FAGA 4S3DA 2ZIDA 2WC4A 3O16A 3KBSA 1J5SA 3K46A 1QBAA 3MP5A 4LVFA 4Q4PA 1JNDA 3TP4A 3F5JA 4CNPA 3M6YA 4D6CA 3GD6A 2RJHA 2QR6A 4L1GA 1MW1A 4RZ5A 2WSRA 3L68A 1J9YA 1XLBA 1VJIA 1FX6A 5L6UA 4A4AA 3U2CA 2NX9A 3S5YA 1Q6LA 4PTWA 1JAEA 2Z1XA 3W2NA 1QNSA 2RFGA 1XLIA 4EX4A 3BJFA 1VBHA 3CUIA 3XIMA 2NQLA 2XVNA 4ZE5A 1PL9A 5J5DA 2J6XA 1Z7AA 4MADA 2C7FA 1PJ9A 2FDMA 4YL2A 3WNNA 3M6DA 3DI0A 4D6IA 1MEWA 3LY0A 2VUYA 3BAWA 3E1F1 4O1EA 1JF6A 1QO2A 1A50A 3OLIA 3TU9A 2QJIA 2ZC1A 2ZRXA 4EXQA 2PDLA 5ABGA 3EZ4A 2J7DA 3QZEA 1F6PA 4UFHA 3WJWA 4D8AA 3HFYA 1UHVA 4NKCA 1WB0A 4GCAA 4H2CA 1EJUC 3N25A 3ARZA 1GZGA 1ODZA 2QF8A 3IIXA 2E68A 1R38A 5FJOA 1PYFA 3T81A 3NDOA 3QPZA 1FWHC 5E93A 4GX8A 2XFWA 3WKZA 1BLIA 2YBUA 5C55A 1EZWA 2INZA 3CM4A 5EBUA 2DDXA 1EF3A 1IE7C 7CGTA 3NPXA 1AJ2A 3HPZA 2OT0A 1Z69A 4FNQA 1XPGA 1CGUA 1RY8A 3M0MA 5D32A 4EAYA 3FJLA 2P76A 4HMEA 2PF8A 4IIBA 3TCSA 7REQB 4B9YA 3HQOA 5CG0A 3LNPA 4KCUA 2O56A 4HYRA 3M5ZA 1TFVA 4C6LA 3OBEA 1OQFA 2PZNA 2WHLA 2BY2A 2XM2A 3FX4A 4O17A 1HGYA 3ARUA 3RCYA 4U31A 1AVAA 1CLXA 2EPOA 5BRPA 3P8JA 1EYEA 1TRDA 3KL0A 1GOIA 1A0EA 3AYSA 5G4EA 1E0XA 3S1GA 4YU1A 3LSCA 4UIOA 3VDBA 1JYWA 3HA1A 5JBDA 2AMXA 1YDOA 2J7EA 3G18A 3UZZA 1EJRC 2FGZA 3P3BA 2JF7A 1XV8A 4PUWA 2P3EA 1OFOA 5DLCA 3E3HA 4P8WA 4N2YA 4RLIA 1WO2A 5HBFA 3TFXA 2RJGA 3KW3A 1UD4A 5F4XA 2QJHA 1B4KA 3LGDA 4LVDA 3HOJA 1BG9A 2YYUA 1Z41A 1E9IA 3KBMA 4LUTA 2CESA 3P62A 3L65A 3P80A 1Q6GA 4JTIA 4L9XA 3B8SA 4A2RA 3NOYA 1GG0A 1EQPA 5FF7A 1Z3NA 3PFMA 5HWNA 4DZ5A 1CWYA 1NH6A 4XZNX 2J8GA 3FW6A 1ISYA 3VOCA 2B4GA 4HYVA 4O1FA 2ZX7A 1ZJHA 3RR4A 4JNZA 4MVAA 4M6UA 2W5FA 1FWSA 4K1GA 3N19B 3O1NA 3TCEA 4KPLA 3SGGA 2D2JA 1ALDA 1JCNA 2VFEA 2PODA 2DT1A 2NVDA 3WF4A 1J0JA 4S3AA 4HPHA 3VM7A 4M7TA 4BZYA 1QI0A 2B31A 1XYLA 3NZGA 1QT1A 3MUZ1 5DF0A 1W9UA 3KWXA 4Q4QA 2EEXA 3OW1A 1X6NA 3UG3A 3TXZA 3EB3A 3T78A 1ZY9A 1NFGA 3QR3A 1HQTA 1E4IA 2GZXA 3W0KA 3E5BA 4MB5A 3GHSA 3MTWA 4NAEA 4Q8OA 3KOFA 3GIYA 1ZBKA 1GOOA 3UXLA 3OGRA 1KFJA 5DT7A 1TE1A 1OB0A 4Y8FA 1V8EA 3TN6A 2V5JA 5KTLA 3DKJA 3ALGA 5REQA 3VKBA 4GO8A 3JR2A 4V1YA 3M46A 3JRKA 1IEIA 3BW2A 4Y9NA 4CU6A 3N73A 1JXKA 3FGCA 4W8BA 4CVWA 3F4NA 3WEZA 3BCDA 4CVUA 1DJHA 3K4WA 4NVTA 4BWLA 3UXDA 3FSTA 2YIHA 2G97A 2GUBA 2CBJA 4FXSA 4HYWA 3CIXA 4UOJA 1IT8A 4PRWA 3EX6A 1FXQA 4G5DA 4FALA 2G4FA 2FB2A 3SAZA 2VEGA 3WDHA 3VDHA 1GONA 4GIEA 2ZX8A 1WZAA 3R58A 2PB1A 3TMQA 3AS0A 2E0PA 2Y89A 1EOMA 4AC7C 4JIRA 1U5HA 2G3MA 1YQ2A 3PUDA 4KKXA 4DJDD 3TC7A 1DJWA 4US5A 4KBXA 2NVCA 1TWIA 4JTAA 4PTXA 1JD7A 5C2GA 3WDQA 5EFDA 1BEUA 1AD4A 4IPPA 4NP7A 5T91A 4F0HA 3MI3A 5CSYA 1UWRA 1M1BA 1YX1A 3MUCA 3P2VA 1WYIA 4RNHA 3LPPA 4O4WA 3M7SA 4PULA 3ATYA 5KETA 4I7UA 4BKNA 5KZEA 2GOKA 4WJXA 4C6JA 3WQPA 2BBFA 2FZDA 5DRCA 1UWAA 3PWAA 3STCA 2XGIA 4A21A 5DN1A 3Q94A 3CQJA 4PMXA 3HGSA 4EPBC 5HMEA 1WOAA 3KP0A 1J0YA 2OQYA 4J27A 4QITA 1C8VA 5DXXA 1YNYA 4Q8TA 4O53A 4V1XA 1UA3A 5I6SA 5L9FA 2BMBA 2CZVA 2X30A 4DZIA 1H50A 4PGLA 3NZ1A 2OX4A 3WQOA 5A8QA 1PHWA 3WLLA 1UWIA 1TSIA 2CHOA 2QYGA 1FHDA 2PE4A 9CGTA 3ERPA 2PTZA 3KAOA 3ALFA 1US3A 2ESCA 2NQZA 2CHNA 4RUBA 3U7BA 1XM3A 2XH4A 2V68A 3BAXA 4NRRA 1RHCA 2YB4A 4HNOA 1MRQA 3W1MA 4O18A 4XAFA 4AYGA 4HK6A 3NDYA 3BAJA 3DFQA 1J96A 2OELA 2XN1A 4FO4A 1ZJIA 3LOTA 4H8HA 1TJPA 4XSLA 4EOUA 1WDWA 4I7WA 3CT7A 4JPGA 4PEEA 1ONRA 1NP0A 5G1MA 3BL3A 3U48A 1RPKA 4KWSA 3V5FA 3W7HA 5A6BA 3ZZ1A 2ONEA 3TR9A 3F4CA 3QW3A 1OWQA 2DZWA 3ZWTA 5JXQA 1ADDA 1BAGA 3I6TA 4PUUA 3IUIA 3K13A 4BS0A 3R25A 5EB8A 3H55A 3S1XA 2CEQA 5GNXA 4H9XA 3UWEA 2GQ9A 5CJMA 4FOKA 2BDQA 3KBJA 2QLYA 2Z7KA 1WDDA 4D1IA 4J4KA 1VCFA 4J2PA 3DFYA 4JBRA 4RNIA 1UP0A 1Z32X 3T6CA 1UP3A 1REQB 3SDOA 2BY1A 1KFEA 1LRNA 4ILSA 4F2UA 4AD4A 4A8RA 3CO8A 2DQWA 2F6XA 3TV8A 4WK9A 4WSKA 3QGVA 5GNYA 3DDMA 4AMCA 1YTDA 1DIDA 1WXZA 1XXXA 2R91A 4F9DA 2PURA 3R13A 2PZ0A 3Q58A 1RPXA 2R6OA 5CG7A 1SJCA 4AVFA 4LS2A 1HG3A 3INPA 2H8XA 2QPSA 4GI8A 5IBXC 1NF7A 4AZ6A 2BODX 1JZ5A 4LCSA 3H22A 4XVDA 5I3FA 2I5IA 4FZIA 3CASA 3TROA 2NT1A 1ZPTA 4R9XA 1GQLA 4GHRA 1XX1A 1A5LC 1KNWA 5GJPA 4QM1A 4BI6A 5E1QA 3W02A 4PODA 3PUEA 2P88A 1EL3A 4C6PA 3W7LA 4NHVA 4IFKA 1ZQ5A 4NASA 5AY7A 2WZMA 2QS8A 3A22A 3VO0A 3GVGA 3GC2A 4QJ1A 2PBGA 3NZQA 4LAUA 2WMHA 3GNDA 2UBPC 1J0KA 3IIPA 3IVTA 1XSKA 3C2YA 3RJYA 1H0GA 1GTEA 1W31A 4AD1A 2QCNA 3GLCA 3W82A 1XQLA 4FK9A 3VKDA 2YA2A 1HX0A 1LL7A 1TKKA 2Y8VA 5LA1A 2VR5A 3WUFA 1CGTA 1WKEA 1DJIA 1SGJA 4H04A 1O5XA 4I8YA 1EF2A 2VEPA 4MWAA 1FRBA 3L4WA 5G5IA 1GHRA 5BYWA 3HU7A 2G50A 4JTTA 1KD0A 4OU1A 3N9SA 4Q7BA 3LSBA 2HK1A 1SZNA 1LORA 4AY8A 1ADOA 3U57A 2OZ3A 4GD0A 4WOZA 1QASA 5BW6A 4XISA 5IHSA 4DXXA 3WEMA 1XLCA 3VE7A 2XIJA 3ZVIA 4C6IA 2GQ3A 4ICCX 4KCWA 5AYIA 1MW3A 2QZRA 2PP0A 4OWGA 2Y5EA 2E40A 1BGGA 5FF0A 5AVNA 3WLTA 2Q8ZA 3HG5A 4JIQA 1EC9A 1IZJA 1F4AA 2X41A 2VX5A 3W87A 1I8JA 1J5TA 2D2GA 3PPCA 4JR5A 1M7PA 3NQBA 4TX9A 1TMLA 1V3IA 3BOFA 1TPVA 5EMKA 3GXMA 2J24A 3CUGA 3B0PA 2XUCA 1JZ7A 3EDEA 1G01A 2V67A 3LGEA 1LLOA 4CKQA 3RM9A 4JTKA 3E74A 2QUUA 3F4DA 4MHBA 3WK2A 3IANA 4AXNA 4X22A 4H6RA 1ONEA 1KM3A 1DHPA 1JUBA 1Q8JA 1XYMA 1VFLA 5GJMA 4DF2A 5U4NA 5CLWA 3VNYA 5FEPA 3W71A 5EKYA 2XDFA 2ZUUA 3W81A 1NDZA 4XTIA 2E28A 2CERA 1EP2A 4PL2A 4TVDA 5FOOA 2J75A 4IGHA 1ZZMA 4QDWA 2QCGA 1T8XA 3UNTA 1JDEA 1S2AA 1WDRA 1KM0A 4AB4A 3GE7A 4UQAA 4LRSA 1E40A 1UH2A 2CKSA 4TO8A 4JQ1A 4IMCA 1TB3A 3QOMA 4CU7A 1CTNA 1DJQA 5KZMA 1XWYA 3FNDA 3MJMA 3WJZA 1JZ3A 5I77A 3QTGA 3DC0A 5ECVA 1WKFA 1JUKA 1LWJA 3WJXA 3ZOAA 4C65A 1E51A 5CSUA 2ZZ3A 1TCMA 3A4AA 1F4HA 2FKPA 2AKZA 3SI9A 2A0NA 4DBDA 3VZXA 2VD8A 3RAOA 4DBUA 3CXOA 3EOOA 4DJFA 4KWOA 4Z1CA 5JQ9A 3RLGA 3IUHA 1S3HA 5A8OA 3LXCA 3WBYA 3L0KA 3P81A 3FVMA 3C0QA 1Q2SA 2TYSA 2OSWA 5AYBA 1FH7A 3MUY1 5LIWX 1JNEA 3WDJA 1AW2A 5DX7A 5IOBA 2NV9A 3A13A 2ACUA 2W91A 4JD4A 2NUWA 5K2ZA 1E0VA 1S3TC 4QAIA 3K2GA 1UD5A 1SZRA 3VMPA 4HU4A 3T40A 1ZS2A 4R3UA 3RDKA 1Q4WA 7REQA 1X7IA 3KRBA 2B7OA 3FVDA 5I7GA 2VTFA 3UBPC 1V0LA 3WENA 3W6YA 2R82A 5FSDC 1PXGA 3EOLA 3FY1A 3P8IA 4KIEA 3EWYA 1K8XA 3RN6A 2J6VA 3BMVA 1LL4A 3K8LA 4HZMA 4NQ1A 1CGVA 1XYAA 3CYJA 2AAMA 1R3RA 1V3JA 3O0KA 2VDGA 1DWHM 4H2HA 5GJNA 3H53A 5FEXA 1ZCCA 3WX7A 3TA9A 5HQEA 1H1ZA 1KBIA 2WJEA 3GFXA 1KRAC 3S2CA 1UKOA 4CNTA 3CQ0A 3K1DA 4Y8EA 3GNRA 4CEUC 2ZX5A 1C9DA 4IPLA 2RH9A 1RA0A 4F79A 1FDJA 1XR2A 2SFPA 1K6AA 3V36A 1PKNA 5CC6A 1QK2A 1S46A 4KRUA 2DIKA 3HN3A 1WNOA 2WAGA 1FWIC 1PKYA 3BE7A 3UZJA 4PCNA 3VC6A 1KQZA 2IKHA 1TPFA 3V75A 3MT1A 3IRDA 4B3LA 1W3HA 3WUBA 2BP1A 1DJNA 3AZRA 3GHUA 2WXDM 4R27A 4BEQA 2BGNE 3BOLA 2A3EA 3PJXA 3MZ2A 1E55A 5RUBA 3L0NA 3S6TA 3OBKA 1E6XM 2X0YA 3F4VA 2CBIA 3FYYA 2XYLA 4AQLA 5I3IA 1I0BA 3AI0A 2X7WA 1JVNA 1GOXA 1XGEA 1GW9A 1J0HA 1M7OA 3GIPA 4M3PA 5BXTA 4E2DA 3H2NA 2E67A 3QSTA 3W2UA 1LF1A 3CZ8A 4GVIA 1H41A 4HP5A 3W2KA 4MWAE 1SYTA 4KWVA 3UCQA 4JX5A 3EDFA 4ZODA 4RDVA 3ZVHB 2XH2A 3N13A 1TPB1 3RJXA 4DI8A 1VJSA 1DXEA 2ZBTA 4WOQA 2W67A 4M56A 3SSJA 3M0YA 2X8RA 1GOWA 4HPNA 2DFAA 2XH0A 4YCPA 1AMYA 3WF3A 1LLZA 3GU2A 2J7HA 3UVIA 2VC6A 1KFKA 2XVLA 3KL3A 1FWWA 4AWTA 1CYGA 2J7GA 4NT0A 4WDTA 2Z1KA 1RUSA 3F5KA 4GIAA 5A1AA 4QE5A 4XX6A 5FSEC 5FD0A 4O8RA 1BRLA 4MNKA 3NXFA 3E5PA 4O50A 4ZBCA 4DO7A 3CK5A 5EGRA 2JKPA 1LT7A 3OLDA 3MVIA 3ITVA 4HA4A 4NNAA 3R11A 3SUTA 3OG3A 4O15A 4IMAA 4AEFA 4EF8A 1I1WA 1YYAA 4UQEA 3QGAC 2EKGA 3VVGA 1V02E 5HK4A 1BGAA 3QQWA 3IEBA 3AHZA 4RXGA 1BD0A 4DWDA 1VEPA 2Z2UA 3M07A 1UZHA 2WPGA 2J8FA 3U2EA 2WOQA 1S2UA 5G2IA 3C2VA 3VXGA 4BI5A 1E71M 3CC1A 3UY7A 4ADSA 3WQ5A 3N9RA 4R7WA 2J7CA 1E3XA 1XLFA 4IG2A 4FHAA 2QXWA 1VCVA 3FK4A 1E9ZB 3GU9A 2Z29A 2O9TA 4NZ3A 5M1TA 3WBXA 2F8QA 2V5KA 3W70A 4YCOA 2CC0A 1RCQA 3M0XA 4JNYA 4GYPA 4M19A 1MUCA 4LCQA 4HVXA 2VP8A 3C2RA 5A2CA 2OXNA 4JFWA 1NELA 1IIGA 4GACA 2DZVA 1ZAJA 1Y8BA 1MEHA 4J35A 2R1NA 2XGBA 1GVOA 4AHPA 1WPCA 3JS3A 1Q6OA 3M0JA 1IXNA 2JGQA 4AHOA 1Q7ZA 1KRBC 1R30A 3PY2A 5LHEA 1RCOB 1B3OA 3M0HA 1TTIA 1XLKA 1FHVA 1TV2A 3DEQA 4TVCA 2CLPA 1XLDA 4DNMA 4O54A 1I2OA 1VP5A 1IZKA 1XD0A 4XZWA 2VDHA 2CXGA 6TAAA 3LERA 3BVJA 2J7BA 1DJGA 1F5ZA 4HSHA 5FJPA 4ROQA 4MLJA 5B80A 2NQJA 3KS5A 4BQ4A 5CGTA 1PIIA 1OG0A 5HINA 1V0KA 1JUEA 5AOUA 1ISVA 4UBPC 1PB0A 3CMFA 3LMYA 3GDTA 3GHTA 2VR4A 3GNOA 1M7XA 1TCDA 2V3DA 4LRTA 3TQKA 4X61A 2J74A 2NSOA 1Z48A 2PDFA 4LH8A 1E4LA 1CXKA 4CNNA 2DP3A 2WSKA 1ESWA 3G2GA 4ZVJA 3FYOA 3FN9A 4CD8A 1XHGA 4XUGA 1EC8A 3GU1A 2PD5A 2PWGA 1XBVA 1TV8A 2JKAA 2BZNA 3ZFHA 1ZL1A 2G96A 1AL7A 1DKWA 4A35A 2QW5A 2QDHA 3A24A 5T9BG 4HT3A 3LM7A 5DCEA 1E4NA 3LQLA 3WLJA 1UJPA 5HNRA 3OOQA 5C5YA 3NQ7A 3IPWA 1M65A 4DB7A 1H63A 3G6MA 3BGAA 3BZJA 2BX7A 3L21A 2HWGA 1S5VA 1FH9A 4DZHA 1ONXA 3VNZA 2B7QA 4UTTA 4XTDA 4E3TA 3SRFA 3CPRA 4HNCA 2ZUSA 3EGJA 3R5EA 1VLWA 3EB4A 1R2SA 3FLUA 4LYQA 3ARQA 1DE5A 4ZZ9A 4R5EA 2PS2A 2PDMA 2XJ7A 4RDZA 1FWRA 3LS9A 3LM3A 1N8WA 3GAKA 4UQ9A 5LIYX 3RPTA 5T8GA 4CD5A 2X7VA 3HZ3A 4AWSA 1L6WA 4C6QA 4JDBA 4WUIA 1Q66A 2FZ9A 1XICA 2ZZ4A 1EIBA 3OA3A 2YFNA 3AC0A 4LJ3A 4KEUA 1LLWA 3LHYA 1KGXA 3CNYA 2OWXA 1SZEA 4A3RA 1O6IA 1QBBA 2WZEA 4HNNA 1LM1A 3IJ8A 3UVAA 5AYXA 1HJQA 1KCKA 3OBAA 4UTWA 4MKVA 1OADA 3LMZA 4O1DA 3C8FA 3QMTA 4GIYA 4MTVA 1MSSA 2E5DA 2PDYA 2YL5A 4IP7A 4HA1A 1MUMA 1XQKA 1K7FA 2PWEA 3KHDA 3W76A 4W88A 4PMOA 1A49A 3AJ7A 4CN6A 3ZM8A 4PUDA 1KWGA 1ENUA 5FF4A 1EB3A 3Q2DA 2Z24A 3WBWA 3PBWA 5H1WA 1TV4A 4TXEA 3BJTA 3P14A 3TVAA 1I4NA 4JGDA 4U5KA 1GVIA 3SUWA 3DUGA 5BRQA 3W37A 1X1NA 3ITLA 1FOBA 1ZBVA 2OPJA 4GRSA 4S3GA 4PZVA 4N6EA 1FHUA 2PUZA 3FJ6A 2UY4A 3AU6A 1CI1A 1EP3A 1KR0A 2X16A 3CLWA 4AC1X 1M68A 1UUQA 1ZBWA 3NQCA 3EBVA 4MNMA 2V5DA 4UXDA 3UT0A 3QN3A 1RY0A 2ANUA 3SURA 1B3XA 4FI4A 2EXOA 4YTSA 3PZ9A 4AZCB 3F2BA 1LOLA 3W7NA 3W1PA 4BQ3A 2BVTA 3HJZA 3O8AA 2EPHA 1YMYA 3L4UA 4L64A 4O11A 3OHIA 1F3WA 3EWUA 4IUGA 2GVLA 1D9EA 3A6OA 2ATSA 4IL2A 1ZHAA 5E70A 3B06A 3DHDA 1S5TA 2DGAA 3R89A 5LXXA 5LZLA 2Y7GA 2Y62A 4MFEA 3OPSA 3LPGA 2Z00A 2Y8UA 3Q45A 3VIHA 4FOJA 3OZYA 3CAVA 5DMNA 2ZE3A 3L66A 1OFRA 2VZSA 3CJPA 2A6LA 1PHQA 2ZVIA 3H2OA 1GOQA 3TAKA 4Z2LA 3PVFA 4G2DA 1H1YA 2KAUC 2XINA 3WH6A 1CXIA 5XINA 3BV7A 3TSMA 2R8WA 3KOWA 2X1SA 3SQLA 3UQNA 1X6UA 4XBJA 2I16A 4IIHA 1W91A 4H6KA 1UR9A 2MNRA 5EMJA 1ZENA 3W7IA 4C6BA 4U10A 4S38A 4BQ2A 5DT5A 4UOZA 3TX9A 7ENLA 3QR0A 1HJVA 3C3NA 1U83A 5CLTA 2DJLA 4RZ4A 2NWRA 3JZUA 5HAOA 4O52A 1YPFA 4QLKA 3LNMA 3ZR4A 3IACA 4EK7A 6A3HA 2Q8XA 3V4BA 2PI6A 3W29A 5JH2A 1XUZA 3TN4A 2JALA 5HR7A 5MF5A 2QJNA 1BWVA 1E9YB 4C6MA 4YYCA 3LB0A 3GW0A 4K7VA 4GE8A 4AXKA 3LHVA 1SW3A 3ARTA 4JKKA 3C2OA 3R43A 4UMAA 4QR6A 3EX4A 4MYXA 1TJRA 1VJZA 1V6YA 1XDMA 3IIOA 4NYUA 1PWMA 4NIRA 4AD5A 4LT9A 2I9UA 4GH1A 4U28A 2D22A 3W7EA 2A3HA 3STEA 4WDXA 3D5HA 3FA3A 3U8GA 5FL1A 1FQ0A 3CMJA 1POKA 2NQHA 4O19A 1XINA 1GQKA 3NL3A 1QTWA 3Q65A 1MNSA 4TTGA 4LVGA 2ZICA 3MCMA 1FWJC 3LZ3A 1T8QA 2W4XA 1RVGA 1HN1A 2A21A 4YPJA 4DYKA 2ZTJA 3MSRA 1VH7A 2WJDA 1HIZA 3Q67A 3UW6A 1ECQA 4WKAA 4X3ZA 5I06A 1Z6KA 1GVQA 2GVGA 1B4EA 3MSDA 3B04A 1V6WA 2FZBA 2P50A 3BQ5A 3S6DA 1X38A 2OWWA 3W7GA 3MUIA 1QNPA 1L8PA 3VFCA 3FXGA 4US5D 3VKCA 3VZYA 3B97A 2FDSA 3MB9A 3TJLA 2BG5A 3SUUA 1H11A 5KEZA 1QFEA 3CLMA 2V5BA 3T8QA 2YDRA 3VPLA 1OGSA 4YN5A 4WY0F 1UR2A 2A3LA 3ZR6A 1JGMA 4JQAA 2E3ZA 1UUOA 2WMIB 3WQ8A 3IARA 4DWSA 4GZIA 1J4EA 5AHIA 3LCFA 1E43A 1X39A 3LEPA 2XHYA 1XIEA 2VGGA 1RP8A 1OC6A 1P0EA 1HL9A 1V3HA 4MNJA 3HM7A 4JFUA 2BNJA 2PTDA 2WZIA 4RE2A 2YA1A 4YVXA 5TAOA 1T0OA 4QJ5B 1A4LA 4GNVA 3SRHA 2FLIA 1F76A 4GUHA 4AVOA 2ACQA 4WY0A 1HP5A 4A3HA 2ZDRA 2X0HA 2BS9A 2FMNA 4LPCA 4MM1A 3MYOA 1FCVA 2PGEA 2W92A 5MKGB 1HGWA 4FB7A 1ZGDA 1QPRA 3MU7A 3WG6A 4D71A 5AC5A 3A47A 1FTXA 1S1PA 5D2XA 2GGGA 4FF5A 5BU9A 4B4FA 1BPLB 1NOUA 5D4YA 2IPFA 1LT8A 3UXIA 3GY1A 3GDRA 2TMDA 1US0A 5LXEA 3GUGA 4ZA0A 4HOXA 1H7OA 2DZXA 1S5MA 1BQGA 4DLFA 5GPRA 4QAWA 3UF9A 1FKWA 4RJEA 4H9MA 1TV5A 3R7MA 5C8BB 3I10A 3VA8A 3C4UA 4KRTA 3LXBA 3PG9A 2AGKA 1AZ2A 2FVKA 2YDQA 4AEOA 4DHGA 3PBGA 4N4QA 4ZE4A 2CLFA 2WC7A 1GJWA 3ZVHA 3NPWA 5HQLA 1VPXA 5IDZA 5AHNA 5I3KA 1W5NA 1GQIA 2NUYA 3REQB 3GO2A 3U3HA 3R94A 2BHZA 4HCLA 2Z26A 5M3WA 3PPGA 1IV8A 5D8ZA 3T7VA 4GBDA 2R1LA 1PDYA 4XD4A 2DEPA 1I2RA 2E4TA 4PMZA 8CGTA 4LBUA 1HL8A 3N9KA 4WKHA 4U5IA 4JOMA 2VC7A 4U33A 3NO1A 3R2GA 3OP2A 1EJTC 4GC4A 1VR6A 2Y63A 3L4TA 4MIMA 3T2PA 1PIGA 2ZZ5A 3DBPA 1QI4A 3PPFA 4Q3MA 3GVQA 4CCCA 3OB8A 2ZXDA 2DH2A 4H9UA 4M29A 3S5SA 1PKLA 4W7VA 3W00A 5K7JA 1NOWA 2GJPA 3DGBA 3LDVA 3UJEA 2VURA 1PEZA 1UIPA 4I6KA 4JTRA 4OFCA 4PFHA 1R3TA 4MY1A 1ODUA 3I7QA 4E3VA 3ARXA 2C18A 1XS2A 2CBVA 1H09A 1P1XA 1Q6RA 2IPJA 1T7LA 3DAQA 2WK2A 3GSMA 1XJBA 5KZ6A 3CEPA 1SSDA 3LUTA 4HIBA 3QC0A 4S3JA 1W9BM 3VC5A 4HMDA 3BLLA 2QMJA 4PMDA 2PRLA 1FXPA 3QKZA 3MMWA 3S1WA 3MV11 2VQUA 3B8IA 2HPIA 1MQQA 4YVVA 3VILA 4ZL1A 4JIPA 3AMGA 1IWAA 2HE5A 3W6MA 1A5SA 4R34A 1J10A 3ARSA 3L4VA 3W22A 3OYXA 1AK5A 4LYKA 4RK8A 3W7CA 1UOZA 2X05A 1LZOA 3NUKA 2XWDA 4C1NA 1W56A 1BKSA 2DUAA 1NU5A 3AOFA 4ZQOA 3EPMA 4CGTA 2ZX6A 1R47A 3G5EA 2HROA 2J13A 3ES8A 3NGFA 3MQTA 1F8IA 1CBGA 3QV6A 1TZ7A 5CGQA 1TZ9A 5A2BA 4LC8A 5BWFA 3N6HA 5M17A 4IIFA 1PO9A 2VX4A 2IQDA 4GY0A 4Q6JA 4AD2A 2C19A 3PN8A 3NAVA 5F4SA 3AHYA 4C6DA 2Z7GA 3SCVA 1QK0A 1CXHA 1NDWA 1W6TA 3E2RA 3VZZA 2W3ZA 3PWIA 1TWSA 2NQ9A 3RK8A 3GXNA 4GXPA 5F2LA 2VXNA 4IGNA 2GQAA 6CGTA 3O07A 5IFPA 3KTXA 1NF0A 3MVTA 4G1KA 3KTCA 7PTDA 1IQ8A 2J8TA 2DVTA 1HJXA 2QUNA 3WO8A 3GC4A 4HHPA 1KKOA 3ABOA 4LYPA 4TUFA 5J8LA 4XKYB 1QI3A 3AYRA 4H7ZA 1DXIA 3EKLA 4M7SA 2VI0A 3RU8X 2YL6A 4JY8A 3FAXA 3WMCA 2X09A 4ADTA 1DEDA 3CHEA 3E0VA 4MPQA 3MS8A 4NZFA 4UMCA 4HKPA 1XLJA 3W72A 4XBKA 1KGUA 3GFYA 4I5XA 1MXSA 4X0NA 3UA3A 2IPWA 1T96A 4GJIA 5A2AA 3PNUA 1AJ0A 1TYGA 4OJYA 3EX1A 1AH3A 4HU8A 2JBMA 1UCWA 5JBFA 4WJ8A 3U2ZA 4U3CA 4C1LA 3NPVA 5JU6A 1R0MA 3IJ9A 3MMDA 4ES4A 2IKJA 5BXRA 1LJYA 1EYWA 3DESA 2W79A 1A3WA 2OX1A 2DT2A 3LTSA 2GGJA 1M04A 2D0GA 3CH9A 5T9CE 1GKQA 2QPUA 3NM3A 1AD1A 1F74A 3EDDA 1YKWA 3JW7A 2ZRYA 1CXFA 5G1TA 2OO6A 3Q37A 1MDLA 1DIKA 1RALA 1LRQA 2CNCA 4L9YA 4C6CA 1YPXA 4PBGA 1H0IA 1O5RA 2FH8A 2BSLA 1EFZA 3TDFA 3T08A 2W62A 1KTNA 3T0DA 3WQ6A 5BOEA 1KXTA 3BXWA 2ZQ0A 2RDTA 3UJSA 1CGXA 3MKKA 4LGXA 3THUA 3GTNA 3D3AA 1W5OA 1W1PA 4E0CA 3PZQA 4ERIA 3B4UA 4DUXA 5FESA 2YCLB 2ZRWA 3VCNA 2O92A 1Q13A 1V79A 2J9XA 3CHCA 3O3RA 4L4PA 3SCTA 3N1AA 1KV8A 4QRNA 2DSKA 3VKJA 2JK2A 3T0CA 3SADA 3AIWA 4HOZA 1Q63A 1TO3A 4BI7A 3S4TA 4GWEA 3MWCA 1XSJA 3VD9A 3TJIA 2HQAA 3WQEA 1L6FA 1FWAC 1DOSA 2LLEA 2ZRZA 3GS6A 3GYCA 4I90A 1LG1A 2X1TA 5BWAA 1ZSXA 3RF9A 1GEHA 1K3UA 1QI2A 1SO4A 3FS2A 7A3HA 3EWCA 3SCWA 4OECA 8XIMA 3GHRA 4M6QA 4B2DA 3MCNA 4E8DA 1VCGA 3RFAA 3OQEA 5AB3A 2HK0A 3EXSA 4AZCA 3PJUA 5TD4A 4JEQA 4AY1A 3STPA 5DANA 4B4HA 1KWKA 4O13A 2CBUA 4XD5A 3ABSA 3TUUA 1B30A 4A6GA 5LSMA 4GQBA 4GMEA 1RSCA 1R86A 3GW3A 3N2XA 3CTLA 4U2YA 4A8IA 3B8UA 1BVNP 3FA4A 2I9EA 5BROA 3SFWA 3W75A 3P84A 3QOKA 3W7MA 1UZDA 1YXDA 4Z2IA 4H9TA 1ZUAX 1MUWA 4ZOCA 3KCOA 2Y70A 3N6QA 4NX5A 4QG9A 3BH4A 1TREA 1U5JA 2OLHA 4I5RA 4NAEB 3NTYA 2RGLA 3KCJA 1OGBA 4CQCA 3CUXA 4J1OA 4JTDA 3TQ0A 5I24A 4HPGA 3QPYA 3L5LA 2R14A 3DGRA 3D0CA 5D37A 2CLMA 3W38A 2JEPA 4FXJA 3WLRA 1KB3A 2PDKA 1TZZA 1R7OA 1A0DA 2VVNA 3FGCB 2CWXA 3MWAA 1J12A 3W1RA 3T07A 1GPFA 4U2ZA 1Z8AA 4ROPA 1ZCOA 4AWEA 5I03A 2PDUA 4J9JA 4H83A 3DHFA 4YJ5A 2BXYA 3W7PA 4FR1A 5C9ZA 1TA3B 1BSIA 3ABZA 1DL3A 2YLLA 2HBXA 4LS0A 4D6FA 2UY3A 3UEQA 3BANA 2PLMA 4NJHA 3IRSA 1W17A 2V3FA 2WWDA 3K8MA 5FACA 3HPSA 3ZXWA 3EYPA 1VPYA 4OKDA 4IF2A 3LQGA 4WSHA 2PLJA 2WLYA 5EFFA 3R8HA 4TX6A 5BOOA 1XLHA 1Z9AA 2HMCA 4U4MA 1MQRA 3B8WA 3DIPA 3W25A 1W1VA 4Z2KA 4Z1YA 1BHGA 1GYMA 4CQDA 2VWTA 5E0FA 3ZT6A 2FZMA 4PCTA 3G0UA 4WX2A 1KO0A 1UR8A 1VHNA 4CCZA 3OEXA 4TOQA 3OVRA 1M7JA 5F1UA 4EXBA 3CV6A 5LGXA 3S9YA 4R53A 1A53A 1POJA 3HO8A 3WH5A 3UXAA 3DFPA 1IT7A 4PB4A 2IXVA 3H2EA 5A8MA 1UQZA 1AG1O 3N4AA 4NJGA 1KRMA 1JULA 4OV4A 3URQA 1CCWB 4IX2A 4RKAA 5AHLA 2NVAA 1MXGA 1V08A 4L6DA 1DHKA 4XG1A 2WNZA 3B8VA 3DG7A 1JCLA 2CWNA 2W63A 3CHVA 4S2CA 3AXMA 2MUCA 5KITA 1X6LA 3P82A 3BV4A 2JF6A 4QQUA 3ZT7A 3TJ4A 5I0DA 3A3WA 3V7PA 3JU2A 3GR4A 1XLEA 1YHTA 4QSHA 3GYEA 4DO6A 5DRIA 1KRCC 3H70A 4AG0A 3EWWA 1OFEA 2VR2A 1XBZA 1JPDX 3KX6A 4GKTA 1QUMA 2VCCA 4QLJA 3LLXA 5D05A 4GNJA 3K8KA 2IQ0A 2PDBA 5LNUA 4UOQA 1U1HA 4BR1A 1PPIA 1WOBA 1P6CA 2WKGA 1YTEA 5LNRA 1H7WA 7TAAA 4K3ZA 3VK5A 4JTQA 1Y0EA 3IS4A 3T1GA 3L12A 1IZCA 1ZBCA 5EY5A 2DJXA 3ZMRA 1JCMP 3EOEA 3NQMA 4QXIA 2D1ZA 2WO5A 1CXLA 5D9OA 1CX9A 3LTYA 1AZ1A 1XLLA 2CZ5A 2EAWA 4AD3A 3IAQA 1H61A 4J3WA 5MKGA 3LV5A 1EXPA 3N3MA 2P5NA 3NNTA 4XVEA 3NWRA 4UWMA 1MNZA 1R9XA 3CBWA 4M5PA 1C3FA 3OZOA 3S83A 4HJFA 1RBOB 3CH0A 4Y9PA 5A95A 4D72A 2YGYA 1A3XA 4KFOA 3T44A 4WXYA 1K9EA 4UCFA 2F61A 5FA5A 4D8ZA 4E4PA 3AMCA 4YMZA 4ALDA 2HDJA 3CS2A 3CUZA 4J2MA 5IM51 3EEGA 4I8DA 1VRXA 1JJKA 2VFIA 3HBLA 3QXBA 1AW5A 3OZPA 1R46A 1SR9A 4OOZA 3RX2A 4Y90A 1UWQA 5CBJA 1JEZA 1LUCA 3OGVA 1PE1A 2E25A 1FWFC 3DCPA 4LUIA 4M1RA 3WNLA 4OT7A 3O05A 4X9YA 4P5UA 5D38A 3VIPA 3IV8A 3TSBA 3SJ3A 1B3VA 3CQKA 2QIWA 1K02A 4LB4A 2OEMA 2J88A 2VEFA 4IX0A 5HOSA 2PDWA 3GH5A 2HISA 3QHNA 2C1GA 4GFIA 5CQ1A 1XYFA 1GVFA 3UERA 2ADAA 3S2LA 3DFTA 1CIUA 1OFPA 3LCLA 1GW1A 2A79A 3PP7A 1A5BA 4PCSA 3RO8A 1GJPA 1GPWA 3GKAA 5EL1A 1ADSA 2ZE0A 3S9IA 5ABEA 4GQ0A 2GQ8A 1XDJA 2I5QA 1HUVA 3SY1A 4QIUA 3DN5A 1D8WA 4JKLA 3TTQA 3S2JA 4S39A 4A29A 5HMDA 4RR4A 2CIPA 3M5YA 1VAHA 1EBGA 1GKRA 3DX5A 3VM5A 4YTQA 3CV2A 1EH9A 3BLDA 3T2QA 1BXNA 4DF0A 3BLOA 1UH4A 1V4YA 4JEJA 3VDCA 2QF7A 1CXEA 1JCJA 3EPNA 4GY7A 2E6YA 4MJMA 1RXOB 1IR2A 1O68A 3R0DA 3WSUA 4O1BA 4J3SA 4OV9A 1J2WA 1DTUA 4PTMA 4B5XA 2BB0A 1NWSA 2YKKA 4Y96A 3KVKA 4MPKA 3LV6A 4LALA 1NAL1 3W4RA 3B9DA 2VEKA 1DVJA 5A94A 3W24A 2P0IA 2I57A 4HZ8A 1WAWA 2J77A 3W1QA 1WUFA 2NT0A 1LRTA 2VC9A 2QCEA 2A3BA 3S6OA 4AZIA 4I9AA 1WCGA 3B9OA 4WLCA 4FLQA 1XKJA 1E0WA 1TTQA 5AECA 5D2WA 4S3BA 3N34A 2OR2A 3MCOA 4X60A 2GUUA 1J0ZA 4LVAA 1BF2A 4MZYA 4DX3A 2NV1A 3QF0A 4DVOA 4EANA 2OQLA 4G7EB 3F5LA 3SY8A 4Q7IA 4ACYA 2BHUA 2ZADA 3CL7A 3QGKC 4PUMA 5H6HA 1ZRQA 4GLEA 3G6LA 4XD6A 5DCBA 1T41A 2G3FA 1RLDA 4XKMA 1VS1A 3RX4A 4YVPA 1A5AA 2DZSA 1LDCA 4Q4KA 2BVDA 4DLMA 4Q8UA 2O7SA 1JF5A 2FYMA 1W3KA 2EPKX 5C9XA 3VIIA 2YXOA 4FS9A 3W53A 1EDTA 4B5UA 2YOCA 1QOPA 3AUJA 5CC7A 2V9DA 4J7RA 3NQDA 5TNVA 3HQPA 1Q6EA 2RDXA 4J3UA 4HTBA 1W5MA 1KBKA 3GR8A 3HGRA 1IYXA 1UD3A 1Q4NX 4C1KA 2CYGA 2GK1B 2PDGA 5C7VA 2YSWA 1K4GA 4X63A 3WH7A 1TELA 1JAKA 3TNOA 3RITA 4LAMA 2NQ5A 2VT0A 3FYPA 1UWSA 2ZUWA 1Q3NA 3APTA 3USBA 3UYIA 4FNUA 2JGYA 1V6UA 3S46A 3NURA 5AC8A 4DEFA 2I5GA 3H2FA 3ZJ6A 5G2HA 5I00A 4UUIA 4XKYA 1XKYA 2CZEA 3VAVA 3ABRA 1NDVA 1EOKA 1WXYA 3WLKX 3DG3A 3O06A 1JGIA 1LQAA 1F9CA 3TTSA 3P7YA 4D1JA 4MYAA 3EOUA 3L7RA 1CB7B 3SEPA 3E0LA 4GXWA 4UFKA 4QQ3A 4NILA 1F73A 1HKMA 4N02A 3G77A 2FGBA 3MMTA 1R2TA 4MY9A 3LZ5A 4L1XA 1N82A 2QV4A 2NSXA 2PMQA 1T40A 3WQGA 1M53A 4DXVA 3RPDA 4MNLA 1QW7A 2L5HA 4LB3A 1OIFA 3QVQA 5CAHA 1DBTA 2QUMA 4MB3A 5IHRA 1FUYA 3ITYA 5HNUA 3ITXA 4GABA 2NX1A 3NOEA 1L2QA 3VNMA 1CGWA 5ABFB 3VIGA 1LYXA 4NZ5A 1VEMA 4DPPA 5H8UA 3AIVA 2F2KA 1QDSA 4LWWA 2OB3A 4H8VA 4MLRA 1QHZA 3I68A 3FHQA 1OYCA 3I3EA 1I1XA 4BY3A 1OCQA 1PSCA 1K6WA 3EB2A 1BKHA 2I17A 2OOGA 2J9ZA 3O0FA 4REQB 3VNKA 3HQ1A 2D0FA 4B5TA 1MDRA 3AMDA 3VGHA 1CDGA 3PANA 4MZ1A 1RCXB 2UY5A 2YCLA 3WNMA 2HZGA 2E9LA 2INEA 4EWND 2ZKMX 3LHWA 1TUXA 9XIMA 1EWDA 1EBHA 2GVEA 3ARYA 3ZS4A 2V2HA 4EPEC 4IIGA 3NL5A 1J93A 1JD9A 1PYMA 4TIMA 1R6WA 4J3VA 4AU0A 2VZVA 2IXUA 3P61A 1MZRA 1IIHA 1TMHA 1ME9A 4H3DA 2XTKA 3KS6A 4XZBA 2UZ9A 1RJPA 1PX4A 1OY0A 2Y1HA 4C6KA 4H9YA 3A9BA 3AMKA 3UZXA 2OU4A 3URNA 1U30A 3AXHA 3ME3A 3WUGA 3PZTA 5K4XA 4GQRA 2ABAA 2PLKA 2UWFA 4KWUA 1R8LA 1OIMA 4B5WA 2J78A 1ZP3A 4ZFMA 4QJ3B 2Z1SA 1TTPA 3NA8A 2V2DA 4IXHA 3LGGA 3SB0A 3NVTA 5BRBA 1T5AA 3VOIA 3SO7A 2O4MA 4ZCWA 1H7XA 4XSMA 3UD6A 4DWSD 3DBNA 3W86A 3BJSA 1BWLA 5A3HA 1F3EA 3E49A 4MZ8A 3QV9A 2DUXA 2BWGA 1AH4A 1GJUA 3BDKA 4DJDC 4E4FA 4XZIA 3LYEA 3LPOA 2B7PA 2C14A 4XV0A 4OBTA 3S2MA 1G1YA 3M9YA 2VWSA 3ZLHA 3SQSA 4DM1A 1FHLA 2TPSA 2UV8G 4QX4A 3SUVA 2H9AA 4ZB0A 5CZ0A 1UBSA 3W3OA 4Q8VA 4JQ4A 3WLPA 5CPNA 4BHYA 2VDIA 4XZHA 1JPHA 2WC3A 3A64A 3FEQA 5I3HA 3B03A 4UMBA 2HBVA 2FZ8A 3L67A 2FGLA 1SFLA 3NZPA 1PS9A 4IMFA 3OLGA 2REQA 4E6MA 3O6CA 3LBMA 4MDOA 3EA1A 3KE0A 2ZZ1A 3UR2A 3AUOA 3SZ8A 5H8MA 4F8XA 4OUEA 1VIZA 3R1ZA 5A5WA 4FIQA 4Z2HA 4AMAA 4CNOA 2E7FA 5D2VA 3DI1A 5A6LA 3G1HA 2CFFA 2NLIA 3CAQA 3RG6A 1BRLB 1GK8A 4EWJA 4RV8A 3VTRA 4M82A 1MO0A 3BLEA 3H21A 4OVXA 1TA3A 1DQXA 3BTNA 1RBAA 2V38A 4B90A 4QS5A 1ME8A 3V0SA 3TA6A 1RBLA 3VABA 3UNDA 2J47A 5AYZA 3IJ7A 2R1PA 3CZEA 2IS7A 1WZLA 3F1QA 3G1AA 3M44A 6REQB 1B31A 2DZBA 2ZRVA 4Z1BA 1KW1A 3SCSA 2E1DA 4K8EA 3QMSA 3BICA 4ZO7A 3NXLA 3A21A 3E9AA 1WKYA 4W5UA 2HEJA 3P74A 3M0KA 5HJXA 4HK7A 1KCZA 4C5ZA 1XRFA 2VNCA 4AISA 4LY8A 5D09A 5A6MA 4FEZA 4F0SA 2JIWA 1W5QA 2Z4GA 3PJTA 1SU5A 4OE7A 3AZTA 4KFNA 4IG2B 1WZKA 1HL2A 1DPMA 3HPFA 5H91A 3V35A 1UWUA 1RV8A 2BGSA 3SBFA 4HN8A 4ZFCA 3VGGA 3CEUA 2F6KA 2OODA 4RV3A 1M41A 2PCQA 1Y5VA 3OTRA 3U5UA 1K8YA