3V18A

Structure of the phosphatidylinositol-specific phospholipase c from staphylococcus aureus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
304
structure length
304
Chain Sequence
DSLSKSPENWMSKLDDGKHLTEINIPGSHDSGSFTLKDPVKSVWAKTQDKDYLTQMKSGVRFFDIRGRASADNMISVHHGMVYLHHELGKFLDDAKYYLSAYPNETIVMSMKKDYDSDSKVTKTFEEIFREYYYNNPQYQNLFYTGSNANPTLKETKGKIVLFNRMGGTYIKSGYGADTSGIQWADNATFETKINNGSLNLKVQDEYKDYYDKKVEAVKNLLAKAKTDSNKDNVYVNFLSVASGGSAFNSTYNYASHINPEIAKTIKANGKARTGWLIVDYAGYTWPGYDDIVSEIIDSNKLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-phosphatidylinositol phosphodiesterase
publication title Structure of the S. aureus PI-Specific Phospholipase C Reveals Modulation of Active Site Access by a Titratable PI-Cation Latched Loop
pubmed doi rcsb
molecule tags Lyase
total genus 113
structure length 304
sequence length 304
ec nomenclature ec 4.6.1.13: Phosphatidylinositol diacylglycerol-lyase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00388 PI-PLC-X Phosphatidylinositol-specific phospholipase C, X domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3v18A00
4F2UA 1QATA 4GNKB 4Q6XA 1DJYA 1T6MA 2P76A 2FJUB 3KS5A 2PZ0A 1DJWA 2F9RA 1O1ZA 4I90A 4QJ4B 4R7OA 2O55A 4I9MA 3NO3A 3KS6A 4F2TA 2ISDA 4F2BA 2PTDA 1YDYA 1XX1A 4I9JA 4RW5A 1DJXA 4PTDA 3QR1A 2PLCA 3EA2A 4RV3A 5T9CE 4OECA 1DJZA 7PTDA 4S3GA 2OOGA 2OTDA 3H4WA 1PTDA 2OR2A 3I10A 3V18A 1VD6A 2ZKMX 3V1HA 1V8EA 4QJ5B 1PTGA 3MZ2A 5T91A 3EA1A 3L12A 1AODA 5T9BG 3CH0A 1DJIA 1QASA 6PTDA 3H4XA 3OHMB 3RLHA 3QR0A 1T8QA 3V16A 1ZCCA 3QVQA 4I9TA 4QJ3B 4RW3A 1GYMA 1DJHA 5PTDA 4I8YA 3PTDA 1DJGA 3EA3A 3RLGA
chains in the Genus database with same CATH superfamily
5LIKX 4LVBA 1D9EA 3IJQA 2G96A 4BY3A 3EOEA 3S5NA 3QY6A 1BVZA 3QZ6A 5CZ0A 1C3FA 3WH7A 3R1ZA 2O9RA 1B3VA 4K1WA 4LWWA 2OCZA 3DFHA 3E2RA 1BPLB 2YXXA 2B0MA 2J25A 5CSSA 1TFVA 3AS3A 2XYLA 3SDOA 2B7NA 3TW6A 4ENLA 3WLJA 2VFHA 1MEWA 4MJ4A 3T8LA 5A69A 3W29A 2ZUMA 3AOFA 1UB3A 4ERIA 1GKPA 4TQTA 1DJXA 2VC6A 2BX7A 4GZ7A 3KCJA 4PRTA 1NELA 5DX7A 3CZGA 1EP3A 3A21A 3B9DA 5I09A 3R5EA 2BXYA 3W1TA 3PBVA 1E71M 4OGZA 4NRRA 2DT1A 1TB3A 1F6KA 3QPEA 5A2CA 1CGXA 2HS8A 1FTXA 2BY1A 2R14A 3JZEA 1DXIA 3ARYA 3G0XA 1GVIA 2IQDA 1ADOA 2ZRYA 3W7DA 3ZR6A 3D0CA 3SGGA 1PIIA 2VR5A 4D2JA 4RNHA 4BEUA 2Z4GA 3OGRA 4I6VA 5CKSA 3W2UA 4J3XA 5HPOA 3FS2A 1BWLA 5G1YA 5ENLA 1UIOA 2XSAA 4IGNA 3H4GA 3EWBX 3A12A 4CQDA 1XI3A 4IMFA 2CZFA 3MUIA 2X16A 1CB7B 4W85A 3IK4A 4RE3A 3KS5A 1E9LA 1OGGA 4WUIA 5BU9A 2ACSA 2YYUA 2X1UA 1IEXA 3BQ5A 3GAKA 1JXJA 1TJ0A 3A4JA 1ESWA 3UG8A 2MNRA 3NYDA 4B3ZA 3DERA 2VURA 3G1VA 3WLOA 3W2KA 3KUMA 4EVZA 3DFNA 3ITLA 3VOGA 1I2OA 4Y9AA 1UZHA 2VZUA 2EXOA 2O9TA 1KR0A 3GFYA 4BWLC 2YGYA 3RCMA 2QZRA 4ALDA 1KFKA 1EH9A 5K4ZA 4ZQPA 2Y70A 3RX4A 4N4PA 1KTNA 4L4OA 1YE4A 4W9TA 3NSNA 4TTUA 1KFWA 2P0OA 1BWVA 4LYKA 1A3XA 2VDGA 2P88A 3IUHA 2GQ3A 1REQA 3EWWA 3SCSA 1E70M 3MJMA 3SUUA 2AQVA 4R9OA 3QVQA 1QNOA 2Z2BA 4L65A 1MFUA 1EXBA 1QPQA 1EZWA 3A5FA 3RFAA 4DPPA 3T4WA 4UQCA 2I1OA 1N8FA 2ZZ4A 3GR8A 3HU7A 3KOWA 3Q2DA 4CU6A 3IUDA 3W2MA 2ZUUA 4HHLA 2WC7A 4XUYA 3FY1A 2VR2A 4LUSA 4IJBA 4UZSA 1SJBA 4QNWA 2CXGA 1F61A 3LSCA 1UR3M 3MWAA 1SZFA 1Q66A 5BCAA 3P84A 4JR5A 2C13A 4E8GA 3W7QA 1E4NA 4MJMA 3L4VA 3VGGA 1D8WA 3L23A 1DHKA 2EPMX 4GZIA 3SIMA 4JNMA 3HFTA 5A1AA 4GBDA 3CUIA 3CV1A 2X1RA 3KRBA 1UD8A 4X63A 5BXPA 4B91A 4DIAA 2QV4A 1T40A 1P0EA 1KGUA 1KCXA 1PO9A 3LOTA 3H53A 5EMLA 3WF4A 2BXZA 1V0KA 4GZEA 1FX6A 2EG8A 4DXXA 6REQB 2DZUA 3AMCA 1XCXA 1NVMA 1XG4A 3TIMA 2BV9A 1K9DA 3OGSA 4C6NA 2I5GA 4Q8MA 1HX0A 1A3HA 1JUKA 1YDOA 2DV0A 3ARSA 2VEMA 3KBWA 1Q13A 1J18A 3MHFA 2A7NA 1W56A 2HEJA 2EPKX 3LPOA 2J8FA 4MDOA 3T0CA 1PCWA 1K6AA 2Z26A 4KW2A 5ABHA 3GVRA 4GY0A 4IIFA 3C6CA 4W84A 4HTBA 3ME3A 2F6UA 1H5VA 3GU2A 1C8XA 4IT1A 1BF6A 4WY0A 4PMUA 5D4YA 3LGEA 4UFMA 3BE7A 4M1RA 5CC7A 3L66A 1IXNA 1VH7A 4Q8WA 3HA1A 3WLRA 4GO9A 2AAAA 3PANA 4P8UA 1DPMA 1ZRQA 3S42A 4LGXA 3OVQA 3CBWA 5DF0A 1XQLA 2BMBA 3WJYA 1QFEA 2O9PA 1B90A 4KGLA 1Q6GA 4JD4A 4RCXA 1D8CA 3DBNA 2CERA 4O4VA 4MB3A 1H11A 1KXTA 1MNSA 3CHEA 3O0KA 3TTYA 3ITCA 4HNVA 2CLEA 4GI8A 3NOEA 4GH3A 4JQ4A 3H24A 2NVDA 4H9XA 2YCJA 5HMDA 3UVAA 4DY1A 2JQXA 5DLCA 5HANA 2HK0A 5FOOA 3T08A 3AJXA 2D20A 1F7BA 3IJ8A 2YXOA 2RFGA 4ZODA 4NY2A 1C7TA 2OGYA 1S39A 3TQKA 3OPSA 3WLSA 4GXPA 1UHVA 1ME9A 3BMVA 3SIZA 3EA3A 4PTNA 1HGYA 2GFTA 3AWNA 3LGDA 3AXKA 1KNWA 1W1TA 3PUEA 3WO8A 1LG1A 4UC5A 1XL9A 2A3EA 4AD4A 1E6QM 1MRQA 3DHDA 1BYBA 2WJDA 2WV8A 2WNQA 5FACA 3T6CA 3M43A 4N2YA 3PJXA 4HBKA 2ZXBA 4LCSA 1ALDA 3VKKA 7A3HA 1RY8A 4NF7A 3W7OA 1CTNA 5A6SA 2WC4A 3UU0A 2ZFAA 5HATA 4DWSD 4H2HA 3VOIA 2XFRA 3QMTA 2BY3A 1EQPA 4EPBC 1ZQ5A 4N42A 2ZUNA 1CGVA 4G5DA 3CU2A 3NYZA 1JZ3A 1POJA 4U28A 3WELA 4B5WA 1H7WA 1VYRA 1PTDA 1EC9A 3NQ7A 2OLHA 1VD6A 4Q8PA 2HRWA 2H6RA 3BGGA 3SY8A 3MZ2A 4JTQA 2G41A 1SGJA 5F1UA 2O9OA 1OG6A 4XVEA 1W1A1 2V8ZA 3GRIA 1E72M 1W5MA 1GNXA 2WSRA 4QBXA 2W63A 5AHIA 2CCRA 4ZVJA 3WQPA 4LXFA 1TMHA 4MY8A 3NSXA 1VGAA 4PUNA 2FPTA 4TIMA 1QI2A 1WE5A 4FALA 1RQEA 4IJRA 1RR2A 5BRQA 3MQTA 2GVLA 3PZIA 3QV8A 1OG0A 1BVNP 1NDVA 3KOFA 4GVGA 1O1HA 4JN8A 3MMUA 2D1ZA 5DY2A 3PZOA 4S23A 1GVRA 1VBJA 3ARWA 4BF7A 1A0DA 1RCOB 1EWDA 4FPSA 1BRLA 4JX6A 3RMJA 5I3KA 4X60A 4AEOA 2TMDA 1KTCA 2ASHA 3CM4A 4L5ZA 3SJNA 1V6TA 5DN1A 4GACA 4O54A 1F6YA 2FVLA 4KMQA 3R7MA 2VYOA 2X05A 2I56A 1FWEC 5GJPA 3MUZ1 3DOPA 3WNNA 1TTJA 3IK2A 5M1TA 4Y7EA 3D6NA 3TAKA 3VMPA 1UR1A 2GUYA 3IVSA 3TOYA 1J2BA 1GHSA 2IS7A 1VRXA 1SFSA 3VNLA 1S3HA 4UTUA 3LN3A 2WVVA 3ITYA 5CAKA 3MHGA 4C6JA 5HA7A 2C16A 1RUSA 1YNQA 4L6OA 1YPIA 1OABA 3OGVA 4PTWA 4Q32A 2Q8XA 3T2QA 3BWWA 2OO0A 2ZXDA 4NNCA 2OEMA 4ZR8A 3CZLA 3QHNA 1OGBA 2YFOA 3V75A 1DWHM 5MKGB 3LNMA 2J9ZA 2QCDB 1YXDA 2C1GA 3SFKA 3KCLA 2OWWA 3L9CA 3W22A 1TV7A 3W2JA 1JCNA 2VX7A 3AU6A 4HZ7A 4LBUA 5D37A 1FCVA 5FF2A 1CDGA 4AZ6A 5AY7A 1ONXA 3W2LA 2DZXA 3CAKA 4XAGA 3TW9A 2HISA 9XIMA 3YPIA 3BC9A 1JPIA 4HJFA 3VIFA 3CUJA 3LD5A 1PTAA 3CL7A 2RGMA 3TLLA 1LT8A 1CGTA 3E3HA 2X40A 1H1YA 2WHKA 2ZRUA 1US0A 3N4FA 2CKRA 3ATZA 2A6NA 3RM9A 3ZM8A 3K5XA 1ZPTA 4QS6A 3MSGA 3RUBL 1KR1A 3QMRA 1X8FA 2BXVA 2BGNE 5MF5A 2Q02A 1WB0A 1H51A 2Y5SA 4IX0A 2VCAA 4L6DA 2WVTA 1MVYA 1KD0A 3JUGA 4FNTA 4ZOEA 3NNTA 4B3KA 4MM1A 1TWIA 1F76A 3WLPA 4OUIA 3NQGA 1JYWA 5D04C 1DWIM 5CPNA 5C55A 1AODA 3W6YA 5A3HA 1PJ9A 2ZA2A 5E93A 1M53A 3TK7A 1WKEA 1EOKA 3EPNA 1AMYA 2ZDSA 3CPUA 3S1UA 1FVPA 3EDFA 2ZX7A 5I78A 3P0WA 3APYA 2OZ0A 3AU2A 5I03A 4DJFA 4EAMA 2OX4A 3CH9A 3FAXA 1MO0A 1B9BA 1CB2A 2C71A 3PZ9A 2PB1A 1IEIA 1WDSA 1SSDA 1WAUA 1V02A 5F4XA 3KOZA 4E2DA 1B31A 3OO2A 3UR5A 2DW6A 3KL0A 4XSMA 3CQ0A 3VC5A 2GDVA 2ZZ7A 3LS9A 3RGTA 1WZLA 4TR9A 2YBTA 3BSGA 2FHBA 2XGZA 4KWVA 3VCNA 4CKQA 4E3TA 4WIWA 4FSAA 1TELA 3E49A 2Q01A 2VQUA 3FHQA 1JPHA 1EP1A 3P82A 3APGA 5T8GA 2FVMA 3TFCA 1N2VA 3PVFA 2Z1KA 3WJWA 2X2YA 4IPNB 1TMLA 2QIIA 3SY1A 2W91A 1MDLA 3M46A 4M19A 5T9CE 3IIPA 3DFQA 1E9YB 3KWXA 1DJQA 2ZUVA 4ZOCA 4MNJA 3IV3A 3K46A 3BG9A 2A6LA 1US3A 1DEDA 2RAGA 3UY7A 1QPRA 5AOUA 4AVFA 2X09A 1UBPC 2YCEA 3CHFA 3P5ZA 4Q4SA 2ZRWA 3PAOA 3ITGA 1HP4A 4PMVA 4ZEPA 3AXHA 4F79A 4NKCA 3FOKA 3N9SA 1K6WA 1GONA 4CVWA 1K03A 4OVXA 3ZVHA 2Z25A 4R3UA 3OLDA 3T44A 3LI1A 4BI6A 2FFIA 2J66A 1FWBC 1H0IA 1O5QA 4F0HA 1CEOA 1MUCA 2BWGA 2Y7DA 5I77A 4C6FA 3PTQA 3IAPA 2DVUA 1QI3A 1FWGC 3U8GA 3AZTA 3CMJA 1R86A 1AW2A 1WX0A 3QQ0A 3IJ7A 3LTYA 3EKGA 1DQXA 3WD2A 3NQBA 3P67A 4JOMA 5HMFA 1KTBA 1EOMA 1EPXA 4LH8A 1B3XA 4MYXA 2JIEA 3RNDA 4FXJA 1NWRA 1XPYA 1GHRA 3MCNA 2GQ9A 4F2BA 9RUBA 4X3ZA 3THCA 2YSWA 2QCNA 3CUFA 1X6UA 3WLIA 1I75A 1A5NC 4H83A 3R4IA 5CC3A 1R3RA 2QJNA 1YE6A 3S6OA 4K1GA 2DIJA 1H63A 4DJFC 1PE1A 3WBEA 2JFEX 3HV8A 4YMZA 2DZWA 2NLYA 1E73M 2E40A 3RX2A 2WMHA 3OOQA 4OZOA 5A8GA 1G4PA 4UXDA 2NW0A 1GZJA 1J0HA 4UTTA 4Q3MA 4MVAA 2BZNA 1PAMA 4FIQA 4DZAA 3AHVA 5FJJA 3EXSA 4AD0A 1OIFA 3HTWA 3GVQA 1EDGA 4FAMA 2CLLA 5JVLA 3BLLA 2FVKA 2QJHA 2PWEA 3ITXA 2WCAA 5I23A 3LV5A 2ATSA 4ADUA 3FVMA 3LQGA 1S2TA 4EXQA 1UD4A 5BRBA 4NIRA 4DPQA 3SCWA 1GOXA 3WH6A 4NNAA 2VL4A 3T07A 2Y8VA 2R24A 3VZZA 1O94A 2V2DA 3TYZA 4I9MA 1OVDA 3TWAA 4HZMA 4QX4A 1OC6A 1L2UA 4ZOAA 2BGQA 3P0XA 2AL2A 3QMSA 2NV1A 5FEXA 4MFDA 3PZUA 2PWVA 5JH1A 2FZNA 4LV4A 1U2YA 4ERGA 5FJRA 5A6TC 5ECUA 2RDWA 6ALDA 1WKDA 4OECA 3KZPA 3PFMA 1R7OA 1P6BA 1SU5A 3THQA 1VB9A 5D9MA 2IPGA 2QAPA 2ZKMX 4KRZA 3HGRA 1UUQA 2OQHA 4AXKA 1V8EA 2Y62A 5AYYA 4DLFA 1W9DM 4IP4A 2DZAA 3RX3A 4HOWA 4WOZA 4R27A 1A5AA 7CGTA 2A85A 4DUXA 4DB7A 1KWGA 2XH0A 3G1DA 4DBDA 1R87A 3KDOA 1W3LA 1UZ1A 4QIUA 4DO7A 2WBKA 2QXWA 4QISA 2JKPA 2GSJA 2PD9A 1Q6OA 3GSMA 5GJMA 3C61A 4LY4A 4W88A 4C1LA 3GC2A 3JR2A 5FAGA 4Q8NA 5BMWA 1F73A 4QXIA 3SUSA 1WDQA 4A2SA 4ZQOA 3HM7A 3REQA 1LWIA 1DJYA 2V69A 4LAKA 3QHMA 2WPGA 2HPMA 4E38A 4BQ2A 1I0DA 4ZSTA 4LNCA 4V33A 1M1BA 3A13A 4FLOA 5E0KA 4M56A 3G3MA 3OIHA 1SFJA 3QYQA 1K8YA 1E51A 2QMJA 3GIQA 1X96A 4HN4A 4BS0A 2NLIA 2E77A 4KCTA 3WFAA 4AD2A 4ATDA 4XO6A 3C56A 1EF2A 2GZXA 3W0KA 3NQAA 5E09A 3BLFA 1HKVA 1E9ZB 4B5TA 5K9XA 4ZQNA 3CPRA 4US5A 3VOCA 3WDPP 1VQTA 1QR7A 3QLLA 2W4XA 1XRFA 4MYAA 3EEZA 3ABQA 4LUJA 1A0EA 5LYRA 5AHLA 2YBUA 4RPQA 3Q37A 4A6GA 5EBUA 1LYXA 3K4AA 1HN1A 3RF9A 4B4FA 2A7RA 1PDZA 1WOBA 1FH9A 3PUDA 4AIBA 2VX4A 3U0HA 5K7JA 1HF6A 2ZTKA 3QR0A 2JE8A 4JTAA 1S38A 1ISYA 1A47A 1V7YA 1TA3A 1JGIA 4UQAA 1HIZA 4U10A 1XBXA 4ZFCA 2RJHA 1XS2A 2FZDA 1A80A 2V5DA 4WDTA 3UPWA 1X6NA 4HP5A 5CAHA 1PX4A 4TX6A 2R1PA 4HYWA 4X2PA 4F0MA 3S5SA 1YPXA 5G2WA 3OW1A 3S2JA 3APTA 4CCDA 3N17A 3M5XA 3EB3A 3UWYA 3JS3A 3N9RA 1GJUA 3T0TA 2WKLA 1TR9A 1KLZA 1R85A 1LT7A 1EQCA 3GH4A 1VHNA 5D8ZA 1ZAJA 3LM7A 3E0IA 1CNVA 1ZY9A 3BO9A 3HO8A 3WF2A 1E6RA 4CLMA 1HVXA 1Y65A 1U5JA 3G6LA 3GNNA 1LP6A 5HUOA 5AN7A 3E2VA 1GK8A 5A6MA 3FV9A 3QY8A 3PPHA 5IBXC 1BG9A 3SEPA 3WLKX 2X7VA 3TC6A 5K2ZA 3N19B 1DQUA 1MUMA 5CPLA 1ZP4A 3CQKA 2NQJA 3WQGA 3B40A 3NFUA 3AS2A 2VQTA 3HG5A 2DGAA 4QTGA 4Y9NA 1CXKA 3KTSA 4N6EA 3I7SA 1P1XA 3S47A 3L12A 5CZJA 3G18A 2X42A 2ODOA 1KCZA 4HA4A 1P0NA 4H1ZA 1P0KA 2PTYA 4FO4A 3JW7A 4OV9A 2HSAA 2QPUA 3B8SA 1SZGA 4JL1A 5E70A 4MADA 3ORWA 4UTMA 1AD4A 2QT3A 4S3AA 4IFRA 3AIQA 3E2SA 2OPJA 4Z2IA 2WMIA 4GLEA 2YW4A 4PODA 4DJDA 4AAJA 3WEMA 3W6MA 3G1RA 1W2VA 4B15A 3TYAA 4GIEA 3WNPA 4WKHA 3SM0A 4O12A 2AQWA 4MFEA 1XSJA 1HW6A 2WYSA 4E2BA 2PFHA 1PIFA 1WXZA 3WLNA 1OYBA 4XKMA 1CXHA 1BGAA 2RHGA 4XD4A 4H3DA 3VDGA 1UR4A 3OTRA 1KGWA 3BXWA 3G1AA 2J24A 5FF4A 1EC8A 5E6ZA 3RN6A 3E0VA 3OBKA 2FZ8A 4TMCA 4O1DA 4K68A 4RV3A 3HB9A 2A3BA 1M7XA 1KRCC 1I2PA 4TOQA 5EY5A 4YPJA 3IIVA 5M2FX 2DT0A 3ALGA 1XYBA 4IG2A 4LBSA 5AKQA 2ZVRA 1OX4A 3AAMA 3GNPA 2XFFA 3FGCB 1XFBA 2I7GA 2QCGA 4WLCA 3SR7A 1DIKA 4RV8A 3M4HA 5AHNA 1XQKA 3E96A 2J47A 3U57A 1V6UA 3DENA 1E6SM 3S1GA 1HKWA 1QHOA 3GDRA 1AG1O 3DN5A 3NM3A 6A3HA 5ABFA 1W54A 3MHUA 1XSKA 2W79A 4I5XA 2XPKA 4JS3A 4BZYA 3BZGA 1EJUC 3CXOA 3SADA 4WJEA 1BG4A 3I3DA 4K2SA 4IISA 2QJMA 3KOXA 2J4GA 4QLLA 3VILA 3K4WA 2BFGA 1HO1A 3GG1A 4BF5A 2VEPA 1LJYA 3ATYA 1ICPA 4PH6A 5K9DA 3PF3A 2P3EA 3PULA 5ABEA 4R33A 1UZDA 1KXQA 1FHDA 1O12A 3W3OA 4L4PA 3CB3A 3JRKA 1TPWA 3GB6A 3CWOX 3K8KA 3L2IA 4DJFD 3WD0A 4NSBA 2PAJA 1KW1A 1FDJA 3COTA 4R7JA 4EXBA 3CJPA 2OZTA 1PKNA 2HCVA 3WLHA 1NP2A 2FB2A 3AJ7A 1OFRA 4DJDC 3H8AA 1HT6A 2OX1A 3AYTA 4JHMA 3VE9A 3UZYA 2NXHA 3UVIA 2ZZ5A 3HJEA 4HGXA 3NDYA 5I3FA 3R0KA 3P74A 1CWYA 3MMDA 1RALA 4NU7A 2WMGA 1RCXB 3CNYA 4QG6A 1JDEA 3ANUA 4KERA 2Y7FA 4DLMA 2YCKX 3MV01 1JAKA 2AQOA 4LY8A 2VRKA 1B54A 2ZWYA 1MYRA 2D24A 3TP4A 4P2VA 3ARVA 4ZZ9A 5KINA 1TMQA 2H3BA 3H7UA 1UD5A 3W25A 1TPB1 5DXYA 3R94A 4UQDA 4LW7A 4FNSA 4HU3A 4OWGA 2P76A 1IWAA 2NX9A 3OZPA 4J40A 3LUTA 4QE5A 1AQFA 1NDWA 1TRIA 4KESA 2D3NA 3OHIA 3TYBA 4EACA 3LZ5A 1YYAA 4GJJA 3DFPA 3EWUA 4JHOA 2QJGA 2PTZA 5LNRA 5FJOA 4PA8A 4JZ5A 3BCDA 4BI5A 5BXSA 5C9ZA 1I6NA 4GQQA 1C29A 4DUWA 1SM9A 4BEQA 3N2XA 1XD1A 3WYZA 3M7WA 1JEZA 2C0HA 4OOUA 3EOLA 2A1YA 3QHOA 3QN3A 1GGOA 1PHWA 3U2EA 4QHRA 4XD6A 2YL9A 2VXNA 3T2OA 5HWMA 3Q58A 4EPDC 2E1DA 4W86A 1UWQA 3QSTA 2X1TA 3BLOA 5HAOA 4JIHA 4JAWA 1GVEA 3K30A 5T91A 1JPKA 1H41A 4JYEA 3F5LA 3WK0A 1VBHA 4WKAA 1QPNA 3R79A 1U5HA 1R9ZA 4ERAA 1E6PA 4HPXA 4QNEA 1QCWA 2GJLA 5G2HA 1EA9C 2PMQA 3QGVA 1NFPA 3VDHA 3BW3A 4MZ1A 5G4HC 1Q7QA 4MPKA 1EEPA 1Z42A 2F7FA 4W8AA 3W87A 3RLVA 3N29A 2OYKA 4LAZA 1Z44A 4IL0A 2FZ9A 4NJIA 5A8QA 1DWJM 1T6MA 3NR0A 2YB1A 1RQBA 2WO5A 4UWMA 1ZU8A 3UYCA 3B03A 1M7JA 4QJ4B 2ZX8A 3UWVA 2J8TA 4LVFA 5CZSA 1SFLA 1OB0A 4LF1A 3W70A 3FYOA 2ALDA 4P7OA 1MSSA 3S9ZA 1KC7A 1XGDA 4KWOA 4JHZA 1XISA 2J7BA 1Y5WA 2F38A 1XBZA 1W3NA 1XLDA 3W7NA 1VPQA 2VVSA 4D6JA 1UWTA 3PBWA 3HMCA 4IIDA 3GUGA 1R3SA 4EF8A 5G1TA 2DH3A 1C92A 1ADSA 3JVAA 3GR7A 3BSHA 3HZ3A 4E2VA 2VOMA 2Y5JA 3UF9A 1B0IA 5RUBA 5AVHA 3VD5A 1TPDA 1TZ9A 2ZCGA 1TPVA 4CNSA 3EOSA 4N0RA 4V1XA 1OINA 1EJXC 2CKSA 4PBEA 4GFIA 1TCDA 3QFEA 4BHYA 5C9XA 2CEQA 1H1ZA 1BYAA 2HXUA 5AHFA 1H7XA 4L4LA 2QDGA 4M51A 2CBIA 4ZTXA 3LK6A 3CEUA 1EX5A 3BJSA 3NURA 3G1HA 4YVVA 3LTSA 1O1ZA 1V08A 4WGHA 3REQB 9XIAA 1HXJA 1E4IA 4MLRA 2OWCA 8CGTA 4HNNA 1R2RA 4CD5A 2DSUA 4K36A 2WB5A 3U5YA 4F2TA 4A22A 3D5HA 1PS9A 4V27A 1P4CA 4FP1A 3G24A 3KW3A 3QKZA 2PP3A 5KEZA 4XBJA 4H9UA 3UZZA 1VCGA 2EHHA 2GGEA 3LRKA 1FOBA 1K4GA 3GY1A 1TQXA 4ICMA 4GY1A 1D2KA 2QR6A 5DRCA 4JFSA 1QAPA 4R53A 4B2DA 1TZ7A 4YNGA 3OYXA 3W85A 2VOTA 3I6TA 4H7ZA 5GNZA 4Q22A 1KM5A 3AHZA 3GTXA 4F3HA 3WQDA 2G4FA 2VRQA 2NXGA 4MGGA 1TYGA 1KM3A 2PLKA 3H4XA 2XG9A 4I3GA 3DHPA 4DYKA 2XU2A 5CXPA 4D6FA 1RD6A 3ZVIA 4HMCA 4IJCA 4HPJA 5HQMA 3M0XA 3BH4A 5EB8A 4JTRA 1QO5A 5D38A 3ANYA 5D8WA 1O68A 3LCIA 4US5D 1KXHA 1TV2A 2F2KA 4UR8A 3HBLA 3IIOA 2A4AA 3GX9A 1XDMA 4A35A 2WKGA 2HVNA 2MUCA 1DJWA 4AVOA 2X1IA 2VFFA 4F0SA 3GVVA 4LF2A 4DX3A 4M1BA 3AXIA 7REQA 3WF1A 2QDHA 2KX9A 2PF0A 1LWJA 4O14A 4PCFA 4LX4A 1SR9A 3V35A 1G7UA 5TF0A 1E40A 3IGUA 3CAQA 2ZX9A 3R58A 4AWSA 4XBKA 4C1NA 2V81A 3WUFA 4LUYA 2G50A 3CQJA 1RLDA 1V7AA 3UJEA 1GTHA 4GE8A 4HA0A 4D1JA 1XYFA 1Z32X 2XGIA 4JIRA 3VIMA 1Q5MA 1WPCA 3AWOA 1N7KA 3OLGA 4KWWA 1JJKA 5DT7A 2REQA 1IIGA 1Q7MA 2VFIA 3GHUA 5F4WA 1CLXA 4C6DA 4TV5A 1OHLA 5I5RA 4H8VA 1LG2A 4DJEA 1P6WA 4DM2A 4MWAC 1JZ2A 3STPA 3VFLA 1AK5A 3O07A 2OT0A 1DVJA 3CT7A 4UFHA 1E5JA 3SAZA 1J6PA 3BLKA 5FJPA 1XWYA 3C0LA 1VP5A 1WNOA 3K4DA 2WWDA 3LLXA 8TIMA 2OYMA 5I3JA 4F8XA 3W7CA 4L80A 4HSNA 3FA5A 3EBVA 1T99A 2VM8A 1EBHA 4DBSA 1XHGA 5LNUA 3MKVA 3OBEA 2ZA3A 3E5BA 1R3WA 4W93A 1NWUA 3ARZA 1W9XA 4I7VA 2BBFA 3QXBA 3SECA 2PZNA 5AB3A 1LL4A 2UY4A 5EKYA 4FZIA 4Q8OA 4TX8A 1IXPA 1EO7A 2WK2A 1G4TA 3N6QA 1UP2A 2PDMA 3WQFA 4AIEA 2Y24A 3WDRA 5FF3A 1XV8A 3V5CA 2JGQA 1E55A 1I4NA 3WH9A 1UMLA 1LM1A 2OEJA 4HOZA 4ILSA 3LMZA 3L4ZA 1W5QA 3C8NA 3A6OA 3GXIA 3BK0A 1D7FA 4GY7A 3A4WA 3NL2A 1T5AA 3UFYA 4IG2B 4PUMA 3CL6A 1EPVA 2NQ9A 4RL3A 3DHUA 2P53A 4IGSA 3UZJA 4AU0A 2CHRA 2A0NA 4EP8C 4ORIA 4RLIA 2CHNA 2ZZ6A 1XRVA 3W72A 1F4HA 2XSBA 4C6CA 3WMBA 1KFLA 2ANUA 1QNSA 1LRTA 4I9TA 3BDKA 3B9AA 2VCBA 3W38A 2WOQA 2BTMA 5ABFB 1JUEA 5EFFA 1QATA 2EKCA 3GK0A 2NSOA 4JQ1A 5HUPA 4CQBA 4MKSA 1IEWA 2WWCA 2P50A 2D0GA 4I90A 3WH5A 3TFXA 1P1MA 2FGBA 4H9ZA 3SCNA 1XYLA 2NQHA 1JPDX 1PKLA 4LPCA 1LLOA 3V3WA 1OYCA 5AYBA 3RAOA 1OQFA 3VKJA 1OD0A 4HOXA 2PTDA 3NPXA 4O8AA 4B5NA 2BSLA 1V5XA 1SJAA 3QC3A 2P10A 4DO5A 2YDAA 3O7UA 2WC3A 4L61A 2G3MA 2OOGA 3NGJA 3NL5A 4YIWA 4YCPA 4ZGYA 2Y7EA 3WNLA 1L6SA 1K70A 3GDLA 3QZAA 1T0OA 4Z1BA 4AC1X 1B4EA 5IHSA 2OKOA 2OEKA 4K39A 2JBMA 4ZB2A 1D3HA 3ES8A 3C0QA 3VIIA 1PYFA 3KTCA 1NSJA 4DZ5A 2XFWA 3WUGA 2Q6ZA 2SFPA 3UZXA 1VCFA 4UFLA 1OZQA 3H2NA 4KIRA 4YXGA 1W1YA 2OLAA 1U30A 4KCWA 1Q6QA 1C9WA 1DV7A 4IUGA 3W88A 2EJAA 1FWTA 1M3UA 2P8BA 1VENA 2FPYA 3U2CA 1JPMA 2JALA 2ZUWA 3TMLA 5A6BA 3CK5A 2QDDA 1XYZA 4IP5A 1D3CA 1SMDA 2ISDA 3QOKA 1OD8A 4INFA 3WJXA 2E6YA 1KM4A 4AF0B 1XXXA 3M0KA 4LUTB 3O1NA 3RXZA 1ZBKA 1AFSA 2VC7A 4Y8EA 1GJPA 4GUIA 4IIHA 3MBDA 4PRWA 5LIWX 4G9PA 2ZUTA 2PBOA 4LT9A 4RUBA 2HTMA 2VZOA 1C7SA 4Y9MA 3FX4A 1SR0A 3MI6A 2J8GA 4RPPA 3LHZA 3OBAA 3GXMA 3PPCA 3PBGA 4CNTA 4QSFA 2ATMA 1KBJA 4D6IA 4MTVA 1OFQA 1K9TA 4EKJA 3DFYA 3WUEA 3PR2A 2EKGA 1WBHA 4O18A 1H5YA 5IM51 4WGXA 1FWDC 3GU9A 2WPBA 3MP5A 2D2HA 1XGZA 1W5PA 3TTOA 1PKMA 3AMKA 5I6SA 3W83A 4Z2KA 4B9YA 3LPFA 3C0SA 4OFCA 4BF9A 3WDQA 1IWBA 3UXAA 2VEGA 3WF3A 1DXFA 3PZNA 4J3WA 2KZHA 2VDHA 3RU8X 3K8MA 1VFOA 3W37A 2YFNA 1CXIA 5U4NA 1LZOA 3PY2A 4Z0SA 5A6AA 4GO8A 5DRIA 1EGMA 4V15A 2GGGA 3RPTA 3PZMA 3M1ZA 2YBVA 3VZXA 3TA6A 4HNUA 1WDPA 4LUIA 4TVCA 5LA1A 2DJLA 3SSJA 1DKWA 4PCTA 4ZSUA 1UPMB 1VRDA 4NI8A 3MWCA 3V18A 4DQWA 4AZCA 4CCZA 4JX4A 3SN1A 2POTA 2XIJA 2WHLA 4QJ5B 1G4EA 3W75A 3EX6A 1N82A 1V3KA 2OQLA 3CQHA 3S5ZA 2IPJA 5C2XA 1H1NA 1VFSA 4FX6M 4JDYA 4PB5A 1Q45A 4JTIA 1A53A 1WCGA 2GK1B 5EGRA 3ZSSA 2WMFA 4YLWA 1WV2A 1F07A 1I60A 3FDKA 4NZ3A 4POCA 1NTHA 1GG1A 4Z2GA 1OBAA 3W82A 1IZKA 1GOMA 3L21A 2O0TA 3FA3A 3FFSA 3TA9A 2DVXA 3BGJA 4OIFA 1XM3A 2PCEA 2A3AA 4JQ2A 3CWNA 1UZ4A 1W3KA 2V5CA 3W1RA 1ZBCA 4AIOA 4KEVA 3UJRA 3F5JA 4DBEA 3M0HA 1BF2A 3W2NA 4IGHA 3N2TA 4MMWA 3G1FA 4WOQA 4P7RA 2D2OA 3C3NA 3URQA 4KQNA 4S39A 3IGXA 1A49A 1GVFA 2EGZA 4NG3A 3GHSA 1EFZA 1W9UA 1K7EA 4RNFA 5HR7A 3VVGA 1ZBVA 2OXNA 4D71A 3H2CA 4R7WA 4C60A 3TWBA 1YW1A 3N73A 1VJSA 1E6XM 1ISVA 4GGHA 2FGLA 2Z1VA 1B3YA 1X6LA 1UPPA 1GEHA 2VZSA 3KBVA 4N6FA 1E9IA 2YCLA 1RVKA 3NQ2A 4GZJA 3C8FA 3QV9A 2YL5A 5EU9A 5BW6A 4NXKA 3LDVA 4H00A 4EK7A 3UG4A 4A21A 1V02E 3I6RA 3T7VA 4G7EA 1JIBA 1XCWA 2HVOA 3UG5A 5FAJA 4BR1A 1GJWA 1XIHA 3PJTA 1S5VA 3U2OA 3S6TA 3RIKA 1F74A 3IEBA 3SBFA 4OTKA 3UWUA 1IEVA 3G1SA 3UGRA 3H2FA 1GW9A 3MPGA 4GISA 4AX7A 2QEZA 2FHFA 4B2DD 3NO5A 2QGYA 4GK8A 1BVWA 4E6MA 5XIAA 3OVGA 3B9NA 5FIPA 4O15A 1W3IA 1A50A 4GI4A 2AMGA 5D05A 4D6CA 1PX8A 1UR9A 5H91A 4LU0A 7REQB 2Y61A 4O1CA 1W1B1 3VMOA 4O1AA 3L68A 3W1LA 4XD5A 1EJVC 3LA4A 5TNVA 3WBXA 5LNVA 4MJ2A 1YTKA 3TONA 3D3FA 3ZWTA 1PVNA 1KM1A 3PG8A 3R8GA 2CZEA 4UNLA 1LROA 3UXDA 1I45A 3IIZA 4ACZA 5MHBA 1F5ZA 4KKXA 1V93A 1VJZA 3VCCA 1HJVA 3MV11 3M0LA 5LIUX 2WMKA 3CLMA 3VDAA 4FNPA 3ARQA 3CIVA 4S2CA 4HMDA 1NFGA 3NGFA 1UKOA 1E4LA 4MUPA 5C7HA 4JTLA 2ACRA 2DDXA 3DHFA 1G6CA 5JMUA 1JDFA 4BCEA 1HQTA 4IFOA 3IV8A 1GZGA 2DSZA 1PIGA 4XKYB 1JXKA 4ADSA 4QAIA 4H6QA 4JNYA 1PYMA 2J7CA 3ES7A 3U6WA 2E6FA 2NZLA 3WFLA 1AVAA 3FCPA 3UXKA 3Q45A 5A8OA 2IPWA 1IGSA 4DJED 1JG9A 3OA3A 3K8LA 4IGMA 4F66A 2Y4SA 2E5BA 3WQEA 1O7AA 2W3ZA 4EPEC 1UROA 1JCXA 1S2UA 3AS0A 1DJNA 4WF7A 5F7UA 2INEA 1KRAC 3CHDA 2XN2A 1S2AA 3QF0A 1UH3A 1HJUA 1R30A 4YCOA 4H7CA 4GRSA 4XTDA 2DU2A 1EHNA 1ZTVA 3KFTA 3V1HA 2FH6A 3M0MA 1LLWA 1WOAA 4BI7A 1F6PA 3O9NA 3PHAA 3UESA 5I2UA 2AGKA 3EGJA 1OJXA 2GPTA 3LRLA 2Z7KA 3P5YA 3W7IA 2VRJA 3P81A 3QTGA 2TODA 5M17A 1W9PA 2P8CA 3HGOA 2UZ9A 1KRBC 1RK5A 4U5IA 1GYNA 3O05A 2AOSA 4GUGA 4PMOA 3T9PA 5AC6A 3VM7A 3AMLA 2Z1XA 4GI6A 4Z2HA 3SUWA 4O1EA 2AKMA 1QPKA 1X38A 1FWAC 1S2VA 1EZ2A 4H6RA 3QR3A 2J9XA 1SPQA 2IKHA 1YBQA 4CNUA 4LAMA 4IIGA 1JZ5A 2GJPA 1IXOA 3QC0A 4ORMA 1BFNA 4R85A 4B3LA 4XTIA 2E25A 4QE1A 2BOGX 4TX9A 2NUWA 4CUCA 2PGWA 5J8LA 2VGGA 4GIAA 3NDOA 2VO5A 3TYUA 4PMYA 3FXGA 1W1VA 1BWKA 2YZ5A 4RZBA 3AICA 4YWIA 3NPUA 4GMEA 2G95A 3SCTA 2WJZA 3GVWA 4FOUA 3TTEA 3INPA 4MHBA 2ZZ2A 2VVNA 4GUJA 4C65A 1GOKA 4AWUA 1JUBA 3A23A 4KEMA 3M6YA 1QI5A 4QJ1A 1VYPX 8A3HA 5H2ZA 4DVOA 3ZZ1A 2RKXA 1BXBA 4GBUA 4YTQA 4DN1A 1Q7ZA 2VD9A 1RPKA 4IPJA 1XIMA 3RCYA 1XLHA 1MEIA 4NAEA 1IWPA 1V4YA 3UA4A 1PBGA 3RDKA 4GH1A 1HKKA 3WNMA 5ABGA 4J5NA 1PV8A 1TPEA 1MQQA 3THAA 1VFLA 1KBLA 4RE2A 1M7PA 5JIPA 4WZHA 2YA2A 1NIUA 4CN6A 4UTWA 1R9YA 1F4AA 2QGHA 3LHYA 1KFCA 1KKOA 1TV5A 4HMNA 1IE7C 4H04A 1UCWA 3ZOAA 4PUJA 2Y63A 5HWJA 3PSWA 5I00A 4NX0A 3GHTA 1E3XA 3L67A 1AMKA 3N14A 1DE5A 3BW2A 4JKMA 2BHZA 3WQVA 1JI1A 3MP4A 3PB2A 3DCPA 4O0QA 2GJXB 4W5ZA 6TIMA 3ARRA 2PP0A 4NX5A 4FK9A 4A2RA 4HK7A 2FIQA 4BWLA 3L4WA 3W7KA 3IGSA 4A3UA 3VKDA 3VD9A 3UY8A 4B5XA 3OVRA 2CWXA 2VGFA 3H7VA 3VA8A 1WKFA 3ZJ7A 2VDIA 1HL2A 5DCEA 3UCDA 1WQ5A 3G22A 4N9EA 3BANA 3GM8A 4ADTA 5F2MA 4NRSA 3W00A 3MVTA 1CW2A 1YQ2A 3MKCA 1OSEA 1UR0A 3VIJA 1Z6KA 1KQYA 4JQAA 4IMDA 4Q7BA 3W24A 4U3CA 1GKQA 1Q6LA 4LS2A 4JTCA 1JD7A 4HN8A 1P7TB 3LZ3A 5J5RA 2QJIA 3H2EA 4YWSA 5D9PA 4O16A 2Z2UA 1TX0A 1ZFJA 3R0UA 4B4HA 1S3TC 3ZWSA 2XDFA 4PEEA 5AFDA 4IF2A 3FYPA 4M82A 3UP8A 4DAIA 2V63A 1TKKA 4H2CA 4NZFA 3G1YA 2IW0A 3WJZA 4OBRA 4Q6XA 2YPIA 4M6UA 2OGJA 3R8RA 4A29A 3RCNA 3MJYA 1TJ1A 3MDUA 4PFMA 3CUZA 1P0BA 4K8HA 4KFNA 4C5ZA 1XIJA 2VEFA 2D23A 1R47A 4B5VA 3G5EA 4JCMA 4I7WA 5F2GA 2CLKA 1UKTA 2H8XA 4BA0A 3GLCA 3O8AA 1FCQA 5LXEA 2V5BA 4H4IA 1CLVA 4QEEA 3U7VA 1A5SA 3NL3A 4JYFA 1FCUA 3WSUA 4YTUA 3NWRA 5HPCA 3NQMA 3W6LA 3SCPA 5REQA 4Z1YA 4GFSA 4HNOA 4GOAA 5C9RA 1QW7A 1MXSA 4PUKA 1XP3A 2PTXA 2FYMA 1A5BA 1LDCA 1JRBA 3W07A 4UTWC 3EOOA 2Z7GA 2HK1A 4YS1A 3EMQA 1Z3NA 3W4RA 4TVUA 3TR2A 3TMQA 3PFRA 4R88A 4GYKA 3FAWA 4FI4A 1XC4A 5CJNA 5CZTA 4O57A 4RNJA 2QPXA 1NOUA 1XINA 2GDUA 1E1CA 1ZUAX 3WLQA 4LAUA 4PYSA 1Q65A 4XD3A 2A2IA 4K8EA 3C2VA 4LV9A 1YHTA 4JIQA 4LYPA 2WW5A 1W0MA 4KFOA 2R82A 2WZTA 2VR4A 1GOQA 1PB0A 3W23A 1FH8A 2ISWA 3VNIA 1T7LA 6CGTA 3IWPA 3H2OA 1AW1A 1YX1A 2Z29A 5EMKA 5CG0A 4AY1A 1YDYA 2OLSA 1KV8A 5EMJA 3PPFA 5DEZA 3PZQA 1NH6A 3F7JA 1RPXA 4RZ4A 2VX5A 4JKLA 2NUXA 4FHAA 4UOZA 2QJJA 4ZB5A 4XUGA 1JD9A 5BOFA 3D47A 3L5LA 2DSKA 2ESCA 4MOZA 4QDWA 1H49A 1SZRA 3AUJA 1OK6A 1OX5A 1ODZA 2FHCA 1TV3A 1OFAA 4IMAA 5IHRA 1O5XA 3B8UA 3A3HA 3VGBA 2HV5A 4IFKA 3NQVA 4IHCA 3MI2A 3WMSA 4RJEA 1VBGA 3SB0A 4IPLA 4PUUA 1DTNA 1SZEA 3PK7A 3M0IA 2OMAA 4UTLA 3UR2A 3E5PA 3QM3A 3IIXA 4J35A 2YCLB 4RW3A 1H62A 3NEVA 4H7VA 3PG9A 2NQ5A 3GU1A 3GUWA 4F40A 3L0NA 3CT2A 2IPFA 4MLJA 1UC4A 4PRRA 2E09A 4G7EB 4HTYA 4H8UA 1B3ZA 3VDBA 4ZQMA 1VIWA 3KXQA 4OUEA 5E6YA 1KQZA 4CEXC 4PBFA 3C5QA 4Z17A 3MANA 1BHGA 4IQDA 3B0PA 2DP3A 2B4GA 3L5AA 1M01A 3UWQA 4DEFA 1B1YA 2ACQA 3PUGA 1XICA 2FFCA 1QNRA 1UKPA 1HJXA 3PUOA 3GZAA 3ECQA 3TXZA 1V3JA 3LLDA 4O13A 1QNPA 1E43A 3KRZA 4MDPA 2ISSA 4HHMA 4AUBA 1VEOA 1LBMA 4HU4A 4PE8A 5KSWA 1VBUA 1TV4A 5FJUA 2CBJA 2Q3RA 1IIHA 1XF0A 3T0DA 4C91A 5BU6A 3L4TA 2H9AB 4Q7IA 3OG2A 4DYEA 5GNXA 4XZMX 1SO3A 3GW3A 1EUAA 2BHYA 3GFXA 4PZVA 3IARA 3VO0A 1TR1A 2PDFA 3HQOA 4LALA 2RGLA 3BLEA 1EDQA 4IZGA 1X1ZA 3BLIA 3T1GA 3EX2A 3SRDA 1EA0A 2VZTA 1X97A 3CASA 3POCA 5G4WA 3B3DA 1IHIA 1OK4A 5BXTA 1V51A 3AXMA 1FBAA 2RH9A 4PSPA 2ZA1A 1RQHA 3QGKC 4REQA 3VABA 3BAJA 1FHUA 1MQPA 5BROA 4ONVA 3LMYA 5KZMA 1ONEA 3RK8A 2ADAA 4HYVA 2W61A 3AYSA 1TUFA 3SSZA 5JXQA 2BVDA 4YL2A 2HE8A 3BAYA 1OZMA 5H6HA 3M0VA 1XX1A 2WBGA 4FXRA 3VUSA 2QUVA 3WDHA 3HIJA 1L6FA 2PDQA 4M24A 4JY9A 4ICCX 1YXYA 3VNDA 2G8ZA 4AY7A 3N1AA 1ZNNA 3VIOA 2I57A 4GC4A 1L6YA 3DZ1A 3C0JA 1JRCA 5LA0A 5BYWA 1MNZA 2PU0A 3OZMA 1VLIA 4QM1A 3VYLA 5A6LA 3N11A 1IT8A 5IDZA 4DELA 4M7SA 2CLOA 2JKAA 4DWSB 1P48A 2FTPA 2V3DA 4B90A 1QWKA 2Z00A 5T9BG 1WDDA 4LS1A 1A5CA 4B9ZA 3VD4A 1P5BA 4DO6A 2YR1A 3KBNA 3B06A 3CAVA 4Q7NA 2ZZ1A 4CN1A 4ZBCA 3ZR5A 1FRBA 5D2XA 2RJGA 4PB3A 3QV7A 2HJPA 3UJSA 1MW1A 4AD3A 1LBFA 3WEOA 3NOYA 3A4AA 2V2HA 2QV5A 2CW6A 5I7GA 5EYWA 2C18A 1GG0A 2A21A 3KHDA 3ABXA 1J12A 3HG3A 1FWIC 1FA2A 3M5YA 4QFUA 1HJSA 2TSYA 4XAYA 3TYCA 2NWSA 4EWND 3EXTA 1AJZA 3U4FA 2Z6JA 3VD3A 1UJPA 1K7XA 4PMQA 1YBQB 2PPGA 1QOXA 4L7ZA 3BCJA 4AQLA 1ADDA 4Z2JA 2HBXA 2QMKA 4Z1AA 1OY0A 2PDGA 3BURA 1NY1A 4PTDA 1UOZA 3DG3A 3QR1A 1NOFA 4Q4OA 1MXGA 2FKPA 3HOJA 2DY3A 1OEPA 3AIRA 2IXVA 3OA5A 3CZ8A 1TJ2A 1W31A 4FF5A 3M07A 3S8HA 1GWJA 3RITA 2CPUA 4L1WA 3DECA 2I9EA 3FJNA 4IPIA 1IEQA 3DDMA 5TAOA 3OLIA 3PZTA 3DYPA 4JEJA 3AHTA 3T4CA 1TX2A 2OSWA 3VUPA 3VIGA 3RHGA 4S3FA 3SN4A 2A3CA 4FOKA 1TUXA 1D7KA 5HJYA 2JEQA 3NIYA 2HMCA 1R3YA 4GIYA 1V3HA 1Y5VA 3TJ4A 4YTSA 3VKBA 1FFRA 2PURA 1DJHA 1UOKA 4JPGA 4AYGA 2V3GA 2PC8A 4M3PA 2ZOXA 5BXRA 5LNWA 3RG6A 1H7PA 1XDJA 1GPFA 3F5KA 3PC0A 4GCAA 4GKTA 1Z48A 4O4WA 4TU1A 2DZVA 2GSEA 1ECQA 1JCTA 1MEHA 3NVDA 3C4UA 4S38A 4NUWA 4HA3A 4K3ZA 1I1XA 1TE6A 3OP2A 2RDTA 1I2NA 4YTRA 3RRXA 1M03A 2JEPA 1JYVA 2VNCA 4ZXOA 2ABBA 3ID7A 4LEQA 4XX6A 1EJTC 3WDJA 3EDKA 5CLTA 4FA3A 4NAFB 3GC5A 3LXCA 2A3LA 1KBIA 3FDGA 3DG6A 1Y0EA 3QZEA 1XUUA 1E0WA 3LNPA 2WQDA 3ZLFA 3B0UX 5IXEA 3DX5A 1T8XA 4M6PA 3O6AA 1RJQA 3TQ0A 2ISFA 1J11A 1K77A 2QCMA 3KL3A 2E9BA 5JBDA 1VZWA 1G69A 1XLEA 4LYRA 4LOCA 1ZCCA 3B8DA 4NYUA 2DQXA 1DOSA 4YVPA 3GG0A 4BFAA 3ALFA 3LCHA 4OQVA 2QCLA 3FEQA 4BQ4A 4K7YA 4NXSA 4IOTA 4GG9A 2CITA 1JDAA 3BAKA 2Z27A 3OU8A 4E2OA 3AZRA 4JICA 5CSYA 1UWRA 3LPGA 3N2OA 2F2HA 2IXUA 1VFTA 3VZYA 4HA1A 1VJIA 2FJUB 4CNOA 3B05A 5CQ1A 1XLGA 2VFEA 2TAAA 3SQMA 4FOJA 4UTIA 1OF6A 3PTMA 4GVHA 5C70A 5JBFA 4J3UA 4C6BA 2EG6A 1TWDA 4JY8A 1M5WA 3LB0A 4CQ9A 3MY9A 4S3CA 5AVNA 2QF8A 3W86A 4HT3A 4QLKA 4PULA 1TIMA 5H8PA 3FEMA 3N04A 3GHRA 5A8PA 3ONCA 3R11A 2YX0A 5FESA 3OYZA 1UUMA 2Q09A 4Y96A 2IKGA 3TUUA 3NZ1A 1W1PA 2D3LA 2QUUA 3VOFA 7PTDA 3MSRA 3SW6A 3S2NA 3RRAA 1EP2A 1J4EA 3L7RA 2V0TA 1S5MA 4KF1A 4PMJA 3CL8A 2QUTA 3RU6A 1X39A 3L0GA 2YZRA 4C6LA 1NFBA 5BWFA 4P8VA 3HQ1A 3MC5A 4MF4A 4OBTA 3STEA 1O6IA 3F2CA 6REQA 3G8EA 2WXDM 1WAWA 1ZALA 2YOCA 5DXXA 1PX3A 1TJRA 3URBA 2OOFA 3EWXA 4GCXA 1L8NA 5B7ZA 1EGVA 3PNZA 1PZ2A 4HHHA 1TIWA 2D22A 1BYCA 4AMAA 1FWRA 3CB8A 3LTPA 1XKJA 1O95A 1PUDA 3W7JA 3W1QA 4DHGA 4CGTA 3JZUA 4ZCWA 3UJ2A 4D8ZA 2WAGA 2XTKA 1J2WA 1ZAHA 4AEFA 4JTJA 1Z69A 3TR9A 1A5OC 3NDZA 4L1XA 4QR6A 4XZWA 4MB1A 5CPOA 3B8TA 3Q94A 3S2LA 3LENA 4HU0A 1TWZA 2V38A 2OODA 1BKHA 3RJXA 4RNIA 2ALRA 4Q4MA 3SCRA 2WHJA 1VKFA 1YLVA 1REQB 3XISA 5FCZA 4UTJA 1MMFA 5M3WA 2J75A 3MTWA 3DGRA 5I3DA 4X0VA 1OCBA 2PWGA 4S3JA 1O4UA 1RP8A 5EBAA 4IIEA 4IFKB 3GXNA 4D6GA 6TAAA 2V2CA 4X0NA 4NZJA 1IF2A 3EDDA 3DUGA 3VGDA 2G3IA 1GPWA 3IUIA 1TZZA 4XISA 5EA9A 1E3ZA 4LUSB 4A3RA 1G0CA 1R6WA 4HPGA 3RO6A 1OFEA 3V0TA 3W7LA 1NQKA 2GOKA 1O5RA 1YEYA 2QPSA 4ES4A 2PDWA 1ZBWA 4GQGA 4XZNX 3DI0A 1VFHA 3A64A 3PBMA 4I8DA 1FQ0A 1POKA 3N15A 3GDBA 1ITUA 3DFOA 4QITA 3UBPC 2EPNA 4FEZA 2PRMA 5CG7A 1EJ7L 3PJWA 3NZQA 3WNKA 4KRUA 2YIHA 3HURA 4RW5A 4EF9A 3WMLA 4O0KA 4X9YA 3MA8A 1Q3NA 2VC5A 3ITTA 4QDPA 3W1NA 3KLKA 3H54A 4AWTA 3EZ4A 2QCFA 3LCFA 3HPZA 3S4TA 5GPRA 4Q4QA 2VFDA 4RE4A 4IL2A 3GXPA 1ME7A 5BWAA 4A8RA 2IMRA 4YU1A 3BAXA 5AC7A 1LOQA 2FH8A 3S5YA 2IQ0A 3IRSA 4MAVA 8RUCA 3NQEA 4E5TA 3S9IA 2C3ZA 3SCOA 2UWFA 4WK9A 3M47A 3IJ6A 3HG2A 3QBUA 3W74A 4XG1A 3DC0A 2PCQA 3EB2A 1BKSA 4AW7A 4HKPA 3PB0A 1ODUA 1OYAA 4YVXA 5BOEA 4WY0B 2QW5A 1Q8JA 1E1EA 2WCSA 1XUZA 1FFQA 1E0TA 2INZA 4AFYA 3FSUA 5H8UA 3T81A 2BS9A 3RO8A 2PODA 2VEKA 3SQSA 4FMVA 2DZTA 4AISA 4JEQA 4Y8FA 1TJPA 3GXDA 4H6EA 3ZT7A 1HFBA 2DIEA 4C1KA 2O55A 4CD7A 1SO6A 2XN0A 3GC4A 3GR4A 4IP7A 3BJTA 2OELA 1J5SA 1XYMA 1FWSA 5KZEA 4LCRA 2EAWA 1GOWA 5D33A 2PLCA 1TREA 3PPGA 4QE4A 3VINA 3EA2A 2J88A 1OF8A 3TX9A 4A05A 4G2DA 5IBXA 1EIXA 1U33A 1DJZA 2QVHA 3A4XA 3KLLA 2V82A 4NILA 5JQ9A 2E9LA 3JU2A 3C3UA 8XIAA 1NF0A 4Z08A 5BNKA 3VCRA 3BOXA 4E4UA 3RPDA 2WSYA 3WZ0E 3S46A 3TJXA 2R1NA 2PWFA 3VX0A 1OC7A 3AUOA 4DWSC 1EO5A 1YTDA 2GGJA 3THDA 3TCEA 1K8CA 2VHLA 3S1VA 1GQNA 4A8NA 4GI9A 3KRSA 3MT1A 2FDMA 3RR1A 1U22A 1T8QA 1TVLA 4M5PA 3ZR4A 4HMEA 1NEYA 1PXGA 5MKGA 3T40A 3RMEA 2WNZA 4AYSA 1AZ2A 2ZZ3A 3V0UA 3P14A 2I5IA 3EPOA 2XJ7A 3ABZA 3ZLHA 4HHPA 3V4BA 3IVUA 1LF1A 1UWUA 1LRNA 1QPOA 3E02A 3N25A 1RSCA 2CLFA 1R46A 2YA0A 5D2VA 4JGDA 4J3SA 1W32A 1EDTA 2Y8UA 1OX6A 4KH2A 4QGCA 1I8JA 1S5WA 1MW3A 4M0XA 1WKYA 3TQVA 2YYTA 5BMXA 3BL3A 1ZJIA 4HU8A 4J4KA 3GYEA 4IIBA 5AYZA 1TQJA 1AZ1A 4NNBA 3B8VA 1WUFA 1UH4A 4AZGA 3BQ6A 3TJLA 4S3GA 3SGZA 3WK2A 5IRPA 3NZRA 1XIEA 3S2MA 1KM2A 1XH0A 1IT7A 4V28A 3A9IA 3BAIA 1VEPA 1Z8AA 2FB3A 4PMRA 1ONWA 3BUVA 2XZ7A 2XWDA 3CUXA 1QASA 5HJXA 3NSMA 3RLHA 3O6YX 2QKFA 4O10A 4V2XA 1AQHA 4GIRA 2HE5A 5I3GA 1F3EA 1JVNA 4JTSA 3CTLA 1ZS2A 4GNVA 3VC6A 2GOUA 2Z1SA 1ELSA 3AIEA 1GORA 2DEPA 4N02A 4MJZA 1ISXA 1BRLB 5FSEC 4HCDA 4RX0A 1TE1A 5AZ0A 3S9YA 1OFPA 1W1ZA 1XLLA 2XWEA 3F4NA 1TVNA 3RM8A 4RXFA 3IANA 2HNHA 3BMWA 2RDXA 3RJYA 2WLYA 3VIKA 5I06A 4KPLA 2ONEA 3PN8A 3BOLA 5DCDA 1FHVA 1QO2A 2CC0A 1IXQA 2CBVA 4Y2WA 3T78A 1IGWA 3W7PA 1JCJA 3E0WA 4WJXA 2E6DA 3HPAA 4MPQA 4Y9OA 3EYPA 4JL2A 2NXIA 5DCBA 2WVVB 3MMWA 1TSIA 2Z28A 5A8NA 4J3ZA 2DUXA 2UY2A 2DFAA 1RP9A 4GABA 1GVOA 1J79A 1KCKA 2Y8KA 3DYOA 3T42A 1UW9A 1GUVA 3MP3A 3KL5A 3TE9A 5H8MA 2XISA 3AIVA 3L65A 1E15A 1OIMA 3EWDA 3GBDA 1DXEA 4JN6A 1UJQA 2DZBA 3QRHA 2FJKA 4F0KA 1NJJA 5B80A 4PUDA 3GDMA 4Y9PA 4Q4KA 3FJ6A 2VD8A 3WENA 1W2PA 3AS1A 1CBGA 2D2GA 2C0AA 5KITA 3ARUA 1F3XA 4ROPA 1DE6A 3TN3A 3RYSA 3TC3A 1V0MA 4J7RA 4S3EA 5LXXA 4QCFA 4NJKA 3PJUA 3PTDA 3T8QA 2F6XA 3EXRA 3PZVA 2E67A 4AG0A 5HXMA 4H9VA 1Q4WA 4AB4A 1ISZA 5C6MA 1RXOB 4ZENA 3IJDA 4WX2A 4UTHA 4NHVA 1LQAA 5J04A 1UR8A 3WY1A 3WG6A 1M65A 2CLHA 4FS9A 4HNCA 2ZIDA 3EDJA 5EPDA 4I5UA 1E1FA 1H2JA 4US6A 1PEZA 4PFHA 1XLCA 1RBAA 3MBFA 1UQZA 1J01A 3HPXA 1PWMA 2GUUA 2XM2A 2PF8A 1B30A 5EMUA 4WD0A 3B0YA 1SZNA 5E0CA 1AJ2A 1KFJA 4MY9A 4MNKA 3VOHA 5B7YA 3UQNA 1SO4A 4WXYA 2XH4A 1Q6DA 2I14A 1Q6CA 2VJXA 3KHJA 4BQ5A 4AZ5A 3S2CA 3C2EA 3URAA 1V6YA 1EYEA 3SURA 1V3MA 2VX6A 1TPH1 3BZJA 3CIXA 3CWHA 4L9ZA 1SO5A 2XGBA 3GXFA 3KOYA 1W37A 1EB3A 3UWWA 4WR3A 3EX4A 2JGYA 1CX9A 4H9YA 2QUMA 1VAHA 4MNLA 2CWNA 2JF7A 1GW1A 1DJGA 3RLGA 3HV9A 3SGUA 3EX1A 1H7NA 2ISVA 4GGBA 4HD5A 4K8GA 1GQKA 1DIEA 3UXIA 1T96A 1H60A 1TTIA 2WANA 4R7OA 1SJCA 1VR6A 3W84A 1XIGA 2XVNA 3VNZA 4JKKA 4WDXA 2WSPA 4UUIA 2F84A 2DZPA 3FLUA 6ENLA 3WBYA 5FEWA 3DIPA 4OT7A 5CPQA 1OADA 4D6DA 3RM4A 3UR8A 3GTIA 5D9NA 1EEXA 1UC5A 1PKYA 2OSXA 1US2A 1FWNA 2WSKA 1BAGA 2C15A 1PHQA 3WFZA 1FWWA 1LQ2A 2QYGA 4HVXA 3U2ZA 1VIZA 1QI4A 1PZ1A 4RE0A 3P8JA 3WQOA 2G97A 3VNMA 1VPXA 3K13A 5C54A 7ODCA 4IH3A 3GG8A 2PP1A 2VFGA 1PL9A 2NQLA 3PM6A 1QUMA 1C8QA 1JI2A 5AC5A 2NWRA 4GA8A 3ZVHB 1A3WA 3WMCA 1Z41A 2J62A 4DXKA 2DUZA 3Q65A 3LV6A 2AMXA 4RZ5A 3L2MA 4Q4RA 4QEHA 1GYMA 4R5EA 2XIIA 4BJHA 1QRQA 1OFBA 3KTXA 3Q67A 2YLLA 1EBGA 3II1A 1GVSA 3HF3A 3Q4DA 2PDYA 2ZXQA 1RY0A 4QDMA 4P7QA 4D9PA 4NJHA 3T05A 3T09A 1O60A 3P61A 5HINA 2J7HA 2HS6A 1PSCA 3NUKA 4JTDA 2ZRVA 1MWOA 3LBCA 2JIWA 3IJ9A 4HZ6A 1UMYA 2J77A 5FEPA 3KBMA 1YPFA 3GQYA 2V5JA 3N6JA 1QDSA 4QS5A 2WCGA 1HL8A 4AWEA 1SYTA 3H4WA 2CBUA 1CT5A 3GDTA 3HGSA 1WZKA 5HR6A 3WL1A 3VGEA 1TPUA 4H19A 3O16A 2VMFA 3VPLA 3BG3A 4NJGA 3SRKA 2YKKA 3P60A 1ITXA 3OJGA 1UA7A 3NPWA 3U4AA 2W6RA 3ARPA 1FHLA 1GQJA 1PCKA 1FH7A 3ZT5A 5GVJA 3LCWA 3OZYA 3FIGA 4Q33A 3QJAA 3B4YA 3SN0A 5IDIA 4UTKA 2WM1A 4F2UA 2O4QA 1B3OA 2OQYA 5XINA 5AZ1A 5A8MA 1J6OA 3TTQA 1HJWA 3FSTA 1SW0A 5JBEA 3LRMA 2UV8G 2YDSA 2WVSA 4G56A 2AL2B 5E9AA 2BLEA 1OGSA 3WD4A 4NZCA 3QQWA 3LBMA 3DKJA 1IR2A 5TQLA 3N3MA 2XIQA 2E8ZA 2XIBA 5IFPA 3M5VA 1P6CA 3NQCA 3SY5A 4W7VA 4ZO8A 4DXVA 3QH2A 2J7EA 3WD3A 2Z24A 2E1WA 3AFBA 4CNNA 3PWAA 3W1XA 2D0HA 4Q8UA 1VC4A 3W81A 5BZAA 1KFBA 1BTMA 2E68A 2PRLA 3S1XA 1SSGA 1ITCA 1EIBA 1QT1A 2Y88A 5KTLA 5LKYA 3P8IA 3MSYA 4OJYA 4FXFA 2CYGA 5CBBA 1LTDA 1RBLA 1KLYA 1XIDA 4JTFA 1MFVA 3ARXA 3GAYA 4X22A 1LOSA 2YW3A 4PCNA 4DZHA 4MWAA 1ZENA 5C9WA 4LAOA 4FX8A 3WLLA 4PCPA 1ML1A 2ZUSA 2HZGA 1X1NA 2G3JA 3BVJA 4EAYA 1VLWA 3GNOA 4DWDA 3KVJA 1BTCA 4PTMA 3MW7A 3TVAA 4GINA 3F03K 1MZHA 2PD5A 4C6MA 3M41A 4OHQA 1DWAM 1R38A 4Q8VA 5CPTA 5J5DA 1H61A 3LCXA 2E8YA 4WDUA 1XRSA 1S2WA 4KT2A 2C91A 1YDVA 3UD6A 1R5YA 1WZMA 2G4JA 1JQVA 2DZSA 3WBWA 1EUNA 3GH5A 2GQ8A 1BXNA 5A6KA 4F0LA 1AH4A 5D9OA 2C14A 3QPZA 4J3VA 3H12A 4WQ6A 2V5LA 1SUXA 3FN9A 4MB4A 1HKMA 1WA3A 3N2CA 4PMXA 1XSIA 3ANVA 4FIRA 3BGAA 2IQTA 1WDRA 4DAFA 4O11A 3LHTA 2A5HA 3VKAA 1ICQA 3VXGA 3STGA 2XSXA 2PDCA 3HG4A 5T26A 4GVFA 2WJFA 4F0RA 5CCZA 2NX3A 4UQEA 4S2BA 1XH2A 3DGBA 3WK3A 1TA3B 3K2GA 1V3LA 3CV7A 2QCCA 3ZSTA 3GD6A 5U7SA 2V6AA 3C52A 3FGCA 2J79A 4WJ8A 2VT0A 1EJSC 1JULA 1RA5A 2ON3A 2YB4A 1OC5A 5DANA 1J9YA 4GUFA 3HJZA 4X2RA 3DI1A 1K8XA 3GNRA 3SRHA 1A5LC 1JL8A 4J1OA 3U7BA 3XINA 2ZRXA 1GVYA 2ZRZA 1ZAIA 3D3AA 4H9MA 1JZ7A 4HSHA 4WVXA 2WM0A 3FW6A 1YDNA 4ROQA 4U3AA 2PE4A 3FKRA 5HOSA 4TUFA 1J0YA 4AEEA 4JQ3A 1W5OA 1F8IA 2X0SA 2Y6ZA 3GZ3A 2FZBA 3VI2A 4C6PA 3H6OA 4O0ZA 2ZXAA 1GQIA 2H3DA 4RDZA 3LPPA 4KWSA 1FUYA 1S46A 1LQ0A 1QW9A 5I79A 2J13A 2V5KA 4MSSA 4PMNA 4Z0JA 4KCVA 3N2BA 1XLKA 5DQPA 2G3FA 2CU0A 4LFYA 3E0LA 1XLFA 3SCUA 3GYCA 1KGXA 2P3ZA 3G1XA 2ABAA 2E6AA 4DUOA 2BDQA 1TRDA 3TU9A 4L1GA 2X30A 3U3HA 3F2DA 3LHUA 2RDUA 2E28A 3F4WA 4MG4A 3TTSA 3G2GA 3LCGA 2E7FA 2WMIB 3TNOA 3TEVA 2PDHA 3AO0A 4ATLA 3HPSA 7ENLA 2WVUA 2XVGA 3OVPA 4CQCA 3OZOA 3K1GA 2PDIA 4ZXLA 4ML4A 1YKWA 2O92A 2JK2A 4O53A 1LL7A 1J0JA 2C8NA 3MCMA 4I6KA 3DKLA 4UZUA 3B9EA 3UG3A 3GE7A 3EX3A 4GVIA 2BVYA 4A8LA 1RJPA 3O6CA 4UMCA 4KFPA 4EXAA 1A5UA 1J93A 4RKAA 4DZIA 4NASA 3FJLA 3A3XA 3GIPA 3P6LA 4DJDD 3BOFA 1KBKA 3POHA 1MXDA 5CBIA 4UCFA 3CV6A 5C7VA 4O52A 3AIUA 3MVIA 1E0VA 1XR2A 3W73A 2Y2WA 3IPWA 5HBFA 3EOUA 1FWFC 4J2MA 1OX4B 5ECVA 3W27A 2PUZA 1C93A 2VKZG 4AZ7A 4D72A 1JYNA 2GVEA 3VDCA 2NX1A 1UQYA 4W8LA 1Y5XA 3E6EA 4PTXA 5C8BB 3S1WA 2NV9A 5HWNA 1U83A 4L4MA 4ZO6A 4WSJA 5C0QA 4PGLA 1PDYA 1YXCA 4K38A 3VIHA 1B4KA 3VNYA 3N13A 3ERPA 1YTEA 1JDCA 1AH0A 3WBAA 2FPVA 4LBRA 2PDKA 4UBPC 3NZGA 3UXLA 4GPNA 4PCSA 3OB8A 4PUWA 3AHXA 4MZYA 1L8PA 1KRMA 4MUZA 1UIPA 1EJRC 1CZ1A 2IUZA 1JZ6A 3I4EA 4MAZA 3CHCA 3XIMA 1HKIA 2G3NA 3B8IA 4P7LA 3QW4B 3H2AA 3W28A 4ZMGA 3CS2A 5TIMA 5M03A 2PEVA 2QULA 4AVNA 3FNDA 1O66A 1TO3A 1TTPA 1VF8A 2YA1A 2WZEA 2X41A 2GLKA 3B9OA 3B97A 1VFMA 4A4AA 2F61A 1KV5A 3R8HA 2B7OA 3SFWA 4JNZA 3WD1A 1TV8A 5LHFA 4RXGA 3VOJA 2J6XA 1IR1A 1M41A 4XQ6A 1QWGA 1RCQA 3F1QA 3USZA 3P93A 4FNUA 4LYQA 5DO8A 2DSVA 4HPHA 3VTRA 5G4EA 4I7UA 3QYSA 1K8ZA 4E3VA 4M29A 3IGHX 2J7DA 1G67A 1XYAA 3NG3A 1B3WA 2WHMA 1FY6A 5C2CA 4GHRA 4L64A 4H8HA 2ZTJA 1K1DA 2DT2A 2QLYA 3GG7A 3WQ8A 1LORA 3VFCA 4Z1CA 2XIMA 5H1WA 1L6GA 4FNQA 1JNDA 3OG3A 1M9HA 4W87A 1LCOA 3WIJA 3S6DA 5CH9A 1F9CA 4JTHA 3FJ4A 1R3VA 2QQ6A 3TZFA 2PZ0A 2GWNA 1JCMP 3DU0A 1EKOA 4JXCA 3TCSA 3HQPA 1AQMA 4GX9A 3VU2A 3LGGA 1RLCL 4XO7A 2DPEA 2W9MA 3AYRA 4N9CA 4AD5A 4E0CA 3ZMRA 4UOJA 2WLZA 3N18A 4RZ6A 4NZ1A 4JTGA 4DF2A 3V5OA 2NVCA 4GX8A 2R91A 1QBAA 1V0LA 4WKFA 4B5UA 4NP7A 1H09A 3AYVA 4GYFA 3G0UA 4KGJA 2EPLX 1FP8A 3IS4A 2J7GA 3L0KA 3WLTA 2ZC8A 3M7SA 2R6OA 2XVKA 1NQ6A 1BXCA 1IZCA 3KM8A 4UTTC 3P2VA 4D6EA 2DT3A 3AIWA 4AY8A 1L9WA 1SW7A 3TYDA 1G5AA 4R9XA 4GJ1A 4XZLX 4QSHA 3BV7A 4EANA 3N6HA 4NZ5A 3GWQA 3PNUA 1XIIA 4QJ3B 4N9BA 2GVYA 5DBTA 3ZQ9A 2BGSA 3H22A 4UFIA 2FDSA 5D32A 3LEPA 1RBOB 1JZ8A 5A6JA 2Y89A 4LRSA 1Y7VA 3TSDA 5D2YA 5AYIA 2PRHA 4DM1A 4WEVX 3I68A 5HNTA 3QV6A 3M6DA 4TXEA 4XWUA 1ECEA 3QTPA 3E0FA 2VC9A 4OBSA 4JTUA 4KS0A 1Y8BA 1ENUA 3QY7A 3QKEA 4URIA 5FL0A 5FSDC 4IPPA 4O50A 3E74A 4S3BA 1E6ZA 1MW2A 1XJBA 4ZQRA 2OB3A 3O63A 3LBOA 1FDZA 3W7HA 3UR7A 4Z1DA 3TXVA 1NWTA 1E4MM 2RUSA 1EYWA 3UPMA 4AXNA 1J0IA 4C6QA 1ZJBA 2L5HA 1X7IA 2J9YA 5C9UA 1VYSX 2WNWA 3I7QA 3EWZA 3AIBA 2C19A 1KFEA 3CZEA 1GQLA 1VFUA 3RILA 2C79A 3NPVA 6XIAA 3IJLA 3UETA 1FXPA 1XG3A 4G8TA 1OM0A 4FR6A 5LZLA 1PTGA 1FCBA 3TLQA 3FXYA 4H6KA 3NXFA 2DH2A 4DRSA 2FZMA 2C1IA 2EG7A 3BICA 4PSRA 1WYIA 3K1DA 3QSRA 5L6UA 2PDNA 4AHPA 3CIWA 4DNHA 2I17A 4JTEA 3TKFA 1DQWA 1S5NA 1QJWA 1R7AA 4MWAB 4FNRA 1X1OA 2WZHA 1FXQA 2AGTA 3T2PA 3LG3A 3TAOA 2O7QA 5KZ6A 4XSLA 4O1FA 4U2YA 1ZJHA 1E0XA 3WQ5A 2X0YA 2W92A 1VFFA 2XHYA 5DMYA 4MIMA 4TVDA 5CEWA 3CYJA 1BQGA 4XAPA 1FKWA 4J3TA 4EE9A 1NAL1 3C86A 1HL9A 1XLAA 1VS1A 3SQLA 3OODA 1W8GA 5I3IA 4MWAD 2OZ3A 2QAFA 1Q6FA 4RDWA 2CIPA 4ZB0A 1XDLA 1HKJA 3AHYA 4DUVA 1CIUA 2DJXA 5I24A 3QW3A 3A22A 2DW7A 4EOUA 4TV6A 3LSBA 4DNMA 1WO2A 1EL3A 4AD1A 5BOOA 5HNNA 1XLBA 2CZ5A 1JZ4A 2J74A 2V9DA 2CLMA 3DEQA 3G8RA 3PWGA 4QAWA 4H41A 1FDYA 2TRSA 2VUYA 4K37A 2QS8A 4C6IA 3H55A 4C90A 5DFAA 3KBJA 3MYPA 5I3HA 4N9DA 4HK6A 3FK4A 5TD4A 1LBLA 5DMNA 2WNNA 2CFFA 4IWWA 4TMBA 2HROA 3CEPA 2OYLA 3AXXA 4O8RA 4RR4A 4KCUA 4YJ5A 5HDRA 1MI3A 1E56A 2P0IA 1ZSXA 4WCJA 5AHMA 2PLJA 2WKJA 5F4SA 1YRRA 1NM9A 3TQPA 3NAVA 3WDIA 4C6EA 4GQRA 2Q8LA 3L5MA 3W7RA 4LVGA 2A7PA 1KXVA 1YNYA 3VD7A 3N9KA 1AH3A 3A9BA 4C1NB 3EDEA 3UEQA 3EMCA 1WZAA 3AQUA 1E0UA 3M64A 5CC5A 1D3GA 1NOWA 3GIYA 3I3EA 4Q8TA 2Y7GA 3UWEA 2CHOA 2E5CA 1DHPA 3DBPA 4W5UA 2XINA 2ZE3A 4XK2A 2REQB 1IZJA 4TO8A 4M6QA 5XIMA 5DY3A 4PR4A 4I5RA 4IM4A 1WUEA 5C5YA 1CGYA 3TOPA 1S1PA 3SI9A 3C2FA 2YDRA 2O4MA 3ITVA 3W01A 5C71A 1H7OA 4M8UA 4UQ9A 2AKZA 4JIIX 5D03A 4JDBA 3UPBA 4L6HA 4AMCA 3PP7A 3MKKA 4U31A 3VM5A 1A0CA 2UY3A 1UG6A 3R13A 6PTDA 1L0PA 3F4DA 1XLIA 3TNBA 1CECA 3VIPA 1ZB5A 2VCCA 3J7HA 2JKEA 1U1UA 2W62A 3THUA 3WF0A 4CU8A 5K3VA 1MZRA 3GKFA 1WXYA 4LANA 4OOZA 2PDBA 3ARTA 2DVTA 3NQ6A 4GKLA 4GYJA 2VWTA 2NV2A 4I8YA 1WXJA 2VI0A 4GQBA 4N7QA 4AHQA 4IICA 1XLMA 2OKTA 1O5KA 3WQ6A 3FHAA 1V3IA 4JBRA 1QBBA 3RPMA 3B8WA 2NUYA 1TVPA 1I2RA 1SFTA 3EPMA 4UR7A 3ZIZA 4NZ4A 4AIUA 4CCEA 3WJSA 2GDQA 4LNYA 3TJIA 3CQIA 4A8IA 1Z9AA 4XIMA 3B0XA 3ZJ6A 5AECA 4U4MA 1K9FA 4JTTA 1ICSA 2QDEA 1EHAA 4M6VA 3DAQA 2OTDA 1W9BM 4AF0A 5F1VA 4LUTA 5GQBA 4W4QA 3SRFA 1T41A 5CC6A 4PC8A 1DORA 4LVAA 5EFDA 1DWGM 1QK0A 3STCA 2UBPC 4ZE4A 3MDWA 3BMXA 2GL5A 4BKNA 1TCMA 5HNUA 3F4VA 4C7FA 1PZ3A 3DG7A 3EWCA 4DF0A 2EPOA 3FA4A 4CVUA 3N4AA 1DIOA 4UCGA 4D6HA 3VAVA 3UA3A 3GVGA 5FEZA 4JCLA 1BLIA 1DYSA 1XYCA 1P0DA 4WSKA 4J27A 2Q71A 1RHCA 5AYXA 1DTUA 4PB4A 3V1PA 1LWHA 4A3QA 1JAEA 1M68A 1QMLA 1YIXA 4HNTA 2HQAA 5E9XA 3GNDA 2XZ9A 3T0AA 4F4RA 2OZ8A 3O06A 1UUOA 4CQ8A 3W02A 3C2RA 1Q2SA 3BLDA 3NQDA 1GCYA 2PDLA 4IMCA 5HMSA 4O19A 3AC0A 3SJ3A 1I0BA 4HCLA 1G94A 4Q6JA 5A2AA 1M7OA 4C5YA 2E4TA 4Q8QA 5A94A 1EC7A 1OFDA 4W8BA 3L4XA 3NJ3A 4XVDA 1FWCC 2PA6A 1MUWA 1M04A 2WZMA 4QRNA 4ATWA 1JF6A 1MDRA 4Z42C 5LA2A 1RA0A 1EJWC 3S0CA 4UQBA 1JYXA 2CLPA 2PGRA 4HCHA 4EX4A 4DI9A 5LGZA 1QW8A 1DJIA 1L6WA 2CESA 4J2PA 4H8NA 2PLMA 3VGFA 2GWGA 2V3EA 4Y6GA 2FTYA 4IQJA 3UYIA 5HMEA 1JCLA 3FKKA 2Q8ZA 3KWSA 1UWAA 3GTHA 1MW0A 1IV8A 4A3HA 1QXLA 1ME8A 2X7WA 3HN3A 2TYSA 3SCQA 4X9SA 2GGIA 4ZTYA 3R10A 2GK1A 2IKJA 1TG7A 1FKXA 3WLMA 1XH1A 2ZICA 1JFXA 4PL1A 1B57A 1R2SA 3N34A 1GZ1A 3DC8A 2HDJA 2J6VA 1R2TA 1J8VA 4HYRA 1X7FA 3LXBA 2G5WA 4C6OA 4GWEA 4BQ3A 3MCOA 5A2BA 4DYJA 3ONBA 1XCFA 4I9JA 1XPGA 1M6JA 3UZ5A 1Q63A 3A47A 2GQAA 2OJPA 4UR9A 4YTTA 1UYQA 4PN2A 1DL3A 3QEZA 4PUEA 4J9JA 5A6BD 2GGHA 2WSQA 3S3GA 3QQ1A 1W5NA 1I1WA 2BHUA 1W6TA 3G77A 1R3QA 4S3DA 3H23A 1XFCA 2PI6A 3OQ8A 1H50A 4P8XA 4FLRA 1B9ZA 1UD6A 4AC7C 1QK2A 2O56A 3TN5A 3O2LA 4FLSA 5KMYA 2P1FA 1NARA 5CSUA 4LC8A 1QHPA 1FWJC 3R25A 4FLQA 3KP1A 2PU1A 1H7RA 3USBA 1JF5A 1TWWA 4XZIA 2BOEX 3HGJA 1IQ8A 5FI8A 3P3BA 1SMAA 3PAJA 3N2MA 4CQAA 2CXEA 2YXGA 1WBJA 1OT2A 2VELA 3IACA 3ISIX 3W71A 4PEKA 4S1FA 4L56A 4XAFA 4Q4PA 4HJWA 3G6MA 3TN4A 5FJTA 9CGTA 3E1F1 1G7VA 3CAWA 1ZGDA 5E0FA 1F3WA 1GTEA 3UW6A 2C6QA 4W89A 4AHOA 3TSBA 2GJNA 1BGGA 1OCNA 4HPNA 3ZJ8A 3PS7A 3OIXA 1G4SA 2ZX6A 2WQPA 2Y0FA 4PMZA 3CYVA 3GBEA 4AZCB 3EAUA 5E5CA 3I4KA 5JU6A 5FKYA 1VHCA 2OR2A 1NWSA 4DI8A 1A5MC 1N8IA 2GVJA 1F2JA 2DORA 2G37A 1S1RA 3TH6A 1BYDA 3UJFA 1U5VA 4E4FA 4CN4A 1AJ0A 1BSIA 3EA1A 5C2GA 4CNPA 1W17A 2BY2A 4XZBA 4JFTA 1UP3A 2R9RA 4LQ1A 4OV4A 3RR4A 3OHMB 1TPFA 3KBSA 2AL1A 1DWFM 3S83A 3KZSA 2GJRA 4DBWA 1Q4NX 1VBRA 3TN6A 4UTFA 3WH8A 2YLAA 3GH7A 5CGQA 3R6IA 3VX1A 4KWUA 3HFYA 4XZ9A 3BARA 4ZL1A 4GQ0A 2FGZA 1V6XA 8XIMA 3NO1A 3NQFA 1L2QA 4D8AA 4KIEA 2QUNA 4GYPA 1QTWA 1N55A 2C7FA 2WJEA 2GYIA 1FP9A 3MUY1 1F05A 3V0SA 4XKYA 6XIMA 1V03A 3CC1A 3VGHA 3T55A 4XB3A 4QP0A 1ZP3A 2E3ZA 2E5DA 3B4UA 1K4HA 3TV8A 4EIVA 2TPSA 1CPUA 3VNKA 3LXAA 1UWSA 4IXXA 1EXPA 2PWHA 3ABOA 4CCCA 7XIMA 1H3GA 1UASA 3UNDA 2EQDA 3GKAA 1QNQA 3F4CA 2NT1A 1THFD 4RDYA 3W9ZA 1CCWB 1LRQA 3CLWA 1Q2RA 3AALA 4JN7A 4ACYA 4PMDA 2BY0A 2A79A 3LQLA 4LRTA 4C7GA 2NT0A 1RZMA 2W66A 3EEGA 2PDXA 4ZFMA 4G6CA 5FD0A 3MUXA 5FF7A 2BVWA 2VGBA 2O7SA 2QIWA 1W3TA 5IOBA 3WQ4A 2CZDA 3CMGA 1LUCA 1HG3A 2W5FA 5M5DA 3SO7A 3H26A 2Y5EA 1PPIA 1AL7A 4EWJA 3SUVA 5A95A 1UH2A 1C91A 2FQIA 4C6KA 4CD6A 4L9YA 4X61A 2FTWA 4QG9A 1SVDA 3OEXA 4U33A 2INFA 2VENA 4UFKA 2H90A 4JIEA 3EWYA 2F8QA 2LLEA 3H7RA 3O6DA 4NT0A 4D8LA 1P43A 1S5TA 2ZE0A 1U1HA 5CGTA 1C9DA 2EO7A 1V77A 3VE7A 2A3HA 2I5QA 4JFUA 4E4PA 2GSHA 5CLWA 3W26A 3WEZA 4FX7A 2R1LA 1QU4A 4ACZB 2OT1A 3AMDA 2BP1A 3SZ8A 3LI0A 1KBBA 2HXTA 4ZO9A 3RLUA 1HZYA 5LIXX 3AZSA 1XBVA 1CGWA 4ZA0A 2P5NA 1ZLPA 4DJEC 4GJIA 1E6NA 1XBYA 3U5UA 1NDYA 3PTKA 3V7PA 4XBSA 4M81A 1Q6RA 4GYPC 3WQCA 1GVQA 3A24A 3L2LA 2QHAA 4O1BA 3UT0A 3DH7A 1UR2A 5HQEA 2DQWA 1CENA 5SWUA 1K7FA 1ITQA 3I3BA 2ZYFA 3QGAC 5DBUA 5LNSA 2UY5A 3BCFA 7TAAA 3FYYA 4NVTA 1RD5A 1A4LA 3CUHA 3KVKA 3N4EA 1H0GA 4B16A 2EJ1A 5D30A 2V68A 3KVMA 1LL6A 3DYMA 1W91A 2D69A 1HGWA 5I0DA 2ZX5A 1J96A 1JNEA 2PDJA 1OFOA 5CJMA 1W3JA 3I6EA 3P62A 1QVBA 4QCEA 1QOQA 2Z0IA 4UB9A 1C8VA 4HZ8A 1UBSA 3PBUA 4ZO7A 3MUCA 3TSMA 1UD2A 1CLKA 5I07A 3TDFA 3M44A 3UERA 4ZE5A 3EKLA 4S3KA 4M80A 2R94A 4AZHA 1NP0A 2QVNA 3H70A 4IMGA 1AUSL 3LYEA 1DP0A 2QCHA 5AHEA 3H2MA 2GJXA 4W7WA 2HNEA 4CD8A 1G9HA 4QQ3A 3G0SA 2VP8A 3E2QA 1V79A 1W1IE 4U5KA 1Q85A 3ELFA 2J78A 4L9XA 5E1QA 5AC8A 4FF7A 1QNVA 1VCVA 3LHVA 3BPWA 3KP0A 4UFJA 2ZBTA 1B5TA 2XVPA 1NU5A 3LCLA 4P7NA 4E8DA 2PWDA 1C90A 3PSVA 3W53A 2CZVA 2FLIA 5CPSA 3QOMA 1P7TA 1S2CA 2PDPA 3P80A 3D46A 3W7MA 4K6AA 3NTYA 2ZWZA 3T0BA 5D02A 5FA5A 1JFHA 1ZZMA 4XIAA 3NVTA 2X1SA 1XW8A 4F9JA 2BODX 3KRUA 2CETA 5HJLA 3MSDA 1BQCA 4QG8A 1HTIA 2Y1HA 3GXTA 3MUAA 1I9CB 3OQEA 4LS0A 4JIPA 2OWXA 3CZJA 2ICSA 3AI0A 3W76A 1XRTA 3HMJG 3BAWA 1RAKA 3IVTA 1V6VA 1HNYA 4P8WA 2W0UA 2W67A 3R2GA 3ICJA 2XH7A 5DELA 1RVGA 5CBJA 1XIBA 2Z2AA 1G01A 3QFWA 1AQ0A 3ZT6A 1C8YA 2WMJA 1ZL1A 2EF9A 5JIWA 3CV2A 3CHVA 1XLJA 4IQLA 4KETA 1EX1A 4YHEA 1E5NA 3MI3A 3IJIA 4JYDA 4DF1A 1KKRA 2PGEA 1X8CA 4MWAE 4JFWA 3BG5A 2ZVIA 3O3RA 4NAEB 4I9AA 5TBOA 1R0MA 3U48A 1JGMA 2BG5A 1IYXA 3MS8A 4Y90A 1AW5A 3ZJKA 3V36A 4DO4A 3M0JA 3AMGA 4UIOA 2QNEA 1G1YA 4HK5A 4KBXA 4AH7A 5LHEA 3M5ZA 2B81A 2OU4A 4W7UA 3MMTA 3N3TA 5K4XA 3KDNA 2R8WA 5G5IA