3V1KA

Crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
285
structure length
285
Chain Sequence
TALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGQWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of an Acyl-Enzyme Intermediate in a meta-Cleavage Product Hydrolase Reveals the Versatility of the Catalytic Triad.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 104
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v1kA00
4X6XA 2C5FA 1VXRA 4MYSA 5EHXA 2XB6A 1TKRA 3FOBA 5C8ZA 3C8DA 1LGYA 3HACA 5AHXA 5AK3A 5IVKA 1X2BA 4RNCA 4QDZA 2XDWA 4F21A 2HL6A 4GEGA 2B4KA 5CH5A 1YR2A 1XZKA 3GBSA 1A8SA 4RE5A 4LYEA 2VTVA 4OSEA 1SC9A 1QJ4A 4HXEB 3QPCA 5ALRA 1YS1X 4XIIA 3V9AA 4KYVA 5DYYA 1CLEA 2IITA 5JYCA 3R41A 5A7FA 1YAHA 3FYTA 1W52X 4J0JA 1PJAA 2B9VA 2VJBA 3ZLTA 4PV7A 2HA0A 4MEAA 2ZYIA 1MX1A 2RONA 2CUTA 4FKBA 5K3CA 5HCUA 3WJ2A 1IUOA 4WJLA 3D5EA 2H9YA 2FJPA 1YAJA 5EFZA 2OAGA 2FUKA 1BN7A 2PSJA 4LXIA 1YB7A 5D7BA 5J3JA 1P0MA 1DT3A 2WTNA 2X5XA 1ZD5A 1EVEA 3HC7A 3IB3A 5FV4A 4OYLA 4X6YA 1BEZA 4AN1A 2Z3WA 2RGUA 2OCLA 3VJLA 4UFOA 3LLCA 2ORYA 1K8QA 1JU3A 3G7NA 5DNVA 1FFDA 1CUYA 1XZMA 3O9MA 3STYA 1USWA 3IUNA 3GUUA 3PDCA 2PBLA 1HKHA 1J2EA 5LP1A 5JANA 4Z49A 2V9ZA 2ECFA 2XUFA 1F0PA 3WK4A 1ZD2P 3I2KA 1JT2A 1FFEA 1LZLA 2WG1A 1WHTA 5JATA 1P0IA 3TRDA 2OCKA 5BWBA 5D3KA 1ISPA 3E0XA 5KBYA 3W9BA 2AJDA 4BDTA 4WCVA 3WYDA 1EI9A 4JYMA 5KWJA 5HF5A 2R11A 2WLSA 4FTWA 1HDEA 2BUAA 4GW3A 2VQ6A 5K3EA 4WDRA 4ZV7A 2ACKA 4E11A 5AKEA 3H2GA 3KSRA 2BGNA 2O7VA 1CUSA 2XLBA 4B6GA 2IIVA 3C6XA 3DLTA 2WHPB 4H7IA 2HU5A 4FLMA 4BCBA 1J07A 2E3JA 5LZ7A 4G4IA 1OILA 4A23A 4AMZA 5AKYA 2Y6VA 2WHRA 4N5IX 4DMFA 3AZOA 3OC0A 4TVKA 4YK7A 1P0QA 4EY7A 4K6KA 5A2GA 3ZV7A 1JKMA 3QPAA 4J3JA 1RP1A 5CTAA 4X90A 5CT5A 2VEOA 3FNBA 2ZJ7A 5AM3A 4PSCA 4N5HX 3M3DA 4X00A 3ICVA 3V1NA 1J06A 2JGFA 4M0MA 3W06A 2BAGA 4QNNA 2JF0A 3O95A 3LCRA 5BOVA 1GQSA 5E2IA 3C6BA 1HQDA 3WK5A 1C7IA 4XX1A 5ALHA 5BV7A 1DTEA 2XMSA 2WG0A 2VSQA 1XRMA 1R9NA 2H7YA 2K2QB 1CVLA 3D0KA 2ZSIA 1GKLA 3O4JA 1LPSA 3FLBA 1R1DA 1QFMA 3ICWA 2QUAA 4UHDA 1EDBA 4FDMA 3K6KA 2BUCA 5E4JA 1QTIA 3C43A 3HRHA 1SCIA 5HF6A 4UHBA 4FBMA 2PSDA 3PE6A 3VDXA 5C8VA 2WQZA 2O2HA 5K3FB 3KDAA 3WKBA 1EA5A 1LPOA 3DJYA 3BJRA 1XZLA 4LIPD 3VVMA 5AM5A 3V1LA 2CEKA 3KD2A 1E8MA 2AJCA 3M82A 4CCYB 4CG2A 5AO9A 4G4JA 3STWA 4F5ZA 1R9MA 5EHQA 1ODCA 3O4IA 5IH7A 5ALGA 5AM1A 2ZJFA 4IH4A 3VXKA 1L7AA 3R40A 4AN0A 5AOCA 4M0FA 2OQIA 2G5PA 1UXOA 3D7RA 4B9EA 1DWQA 4I3FA 4G4GA 2DHCA 2XMBA 2V98A 3FVRA 1CUCA 5IVDA 1B6GA 3U0VA 4BTVA 3M81A 3KWFA 2QMQA 5E4YA 5LZ8A 5AI9A 1UZAA 2PKYX 3O9VA 5AICA 4C88A 4AQDA 5DYTA 4XVCA 3H2KA 4C4YA 4FBLA 1H2XA 1QIEA 2RHWA 1CUFA 5AIBA 1XRRA 5ALOA 4FLEA 4OU5A 1G5FA 1T2NA 1RYYA 4H7DA 4JH0A 4X3CA 4AO6A 2V96A 2CZQA 4EB0A 5ALIA 3C8HA 1CEXA 1ODSA 4X92A 1CUAA 4B85A 4Q3OA 2XQJA 4G5XA 5ALSA 3LP5A 4D9JA 3PFCA 4ZWNA 1ZI9A 3ESCA 5AKXA 2WFLA 5D3ZA 5ALPA 1PV1A 2OCIA 5EHNA 2BFNA 2WIFA 2XUGA 2C58A 5AM4A 4E15A 3VVLA 2G5TA 3TJMA 5JIBA 2GBIA 1JMKC 4NMWA 1E66A 3F98A 1UOPA 4UBOA 5CXUA 1XQYA 2FJ0A 1G42A 3WWEA 1JU4A 5D6OA 1FFCA 2BGRA 1DU4A 2GZRA 5AKIA 4L9AA 5AKJA 2V97A 5JZSA 2XUPA 1CUZA 3FLEA 4NZZA 2AJBA 4Q3KA 2Y2UA 1Q84A 4B80A 1ZI8A 2QTBA 3G02A 4P92A 5A6VA 1K5PA 5ALQA 3WK7A 3I28A 2JBWA 4UFNA 3E4DA 4B81A 5CH8A 4G8BA 3STUA 3DL7A 1YA8A 4W9RA 3NGMA 1SOMA 3TGLA 1THTA 2HA5A 2VA9A 2C5GA 2JGKA 5FPQA 1EB8A 1DQYA 3IVMA 4UHCA 1E89A 1CUGA 1XZCA 4PNZA 3AILA 1LPPA 4KE9A 3D2AA 3QMVA 1AGYA 1UKBA 2PPLA 3C87A 2DQZA 4PF1A 3C45A 5ALEA 1Q0ZA 4MJ3A 5FPPA 4BZWA 2OQVA 4QDTA 1QIHA 1LZKA 2XMCA 4GECA 2OLEA 3X3HA 3B3QA 3QITA 2G4LA 3B12A 5AJHA 3IUJA 3DQZA 4KJXA 4UBLA 1MNQA 3IURA 1XZJA 4X7BA 2VAVA 4OD0A 1ZGCA 3W04A 3UUEA 1QIJA 3GROA 3G0GA 4B83A 5JARA 4W1SA 1QLWA 5ALKA 4U2DA 4W63A 3BDVA 3STXA 3I2FA 3DS8A 3A2MA 5A62A 2OG1A 2P8SA 4EY6A 1CR6A 2DQYA 5ISMA 1AQLA 4KEAA 3B5EA 3BF8A 4G9EA 1LLFA 3ED1A 3G8YA 2XMRA 2I78A 4H0CA 1R3DA 3ANTA 4IH1A 1CQWA 3ESDA 1CFJA 5AI5A 4AZ3A 4Y2XA 5A7GA 1W1IA 1ORWA 1XLVA 4GWLA 4W1RA 2OPHA 3WIBA 1X70A 3DDUA 3NUZA 2J3QA 3AINA 4FFVA 1IUPA 2AJLI 4Q1VA 5AK6A 3PF8A 3IDAA 5I7UA 2H7XA 1GXSA 3DL4A 3L1HA 5ALVA 5JALA 4J0CA 5AI4A 4Y2RA 2HA4A 4J0GA 5LYYA 5IVIA 4AO8A 3I1IA 3A2NA 1GQRA 1UK6A 3DKRA 3DYIA 4F60A 2RAUA 5JZ9A 2VATA 3WJ1A 1Q0RA 1N8SA 2DCMA 3O4GA 4CI9A 4MWSA 3FBWA 1O6GA 3IIIA 3WWPA 2PSHA 2C0QA 1ZICA 4N8EA 4FNGA 3IUQA 1VE6A 3NWOA 2QOEA 3DNMA 4B0OA 1JJFA 2VT6A 1CUEA 3N0TA 2PSFA 1XKTA 1IZ7A 2HA2A 4KE7A 3VISA 3EF3A 1ZD3A 1ZIYA 4BDSA 4CG3A 1YCDA 2XUIA 4HS9A 3STVA 5I9IA 1CUXA 3BXPA 1EH5A 4Q05A 3D2BA 4EY5A 2QR5A 5CT6A 1GPKA 2QXTA 3DOIA 4EA6A 4W1PA 1XZBA 2JGJA 2PM8A 2QZPA 1XRPA 5EIAA 3H0CA 3OPMA 1NU8A 5FRDA 2C4HA 1ZOIA 1L7RA 5IKXA 2QUBA 3D4LA 1RWQA 4A5SA 1GPNA 4DIUA 4RE6A 4ZGBA 5JAUA 3R3VA 1VOTA 3ZLUA 2WIGA 1Q83A 4BAZA 5C8XA 4BE4A 4BYMA 1UKCA 3HZOA 3A6ZA 4HXGA 1MAAA 3I6YA 4LHEA 2VJCA 4ZXFA 2GYUA 1IMJA 3L1JA 3PFBA 2BJHA 1H22A 1T4MA 5FP0A 3DKKA 2HIHA 4NVRA 3H2JA 5JZBA 2JGIA 4HVTA 2HHAA 1MAHA 4BCDA 2HFKA 3DCNA 5KWIA 1UWCA 1XRNA 4B9AA 4FLFA 1TCBA 5ALTA 5F4ZA 3QBJA 1CUBA 3FVTA 1SCQA 3AIKA 4EY8A 4AZ0A 1EX9A 2QRUA 1FSSA 4ROTA 2ACEA 1WPRA 1FFBA 4OYYA 4OU4A 2DHEA 4G9GA 1ZIXA 2ZYRA 1ACJA 5ALLA 1ZD4A 2HRQA 3EQ9A 2VF2A 3T52A 3H04A 1Y7IA 4AO7A 3PICA 3I2HA 3H1AA 2WFMA 5LZ2A 2JGMA 2WKWA 7YASA 1AX9A 3K9BA 3FCXA 1E5TA 1FFAA 2R8BA 5AKHA 1C7JA 2JGLA 1QOZA 1B41A 4U2EA 1DX4A 1CUJA 1TRHA 2JEZA 4BRZA 1VJ5A 1UK9A 5T4BA 1QIMA 2XUOA 6YASA 4XJVA 1GPLA 1IVYA 1MT3A 3G9XA 5HKBA 3QH4A 3D3NA 1CUHA 4YASA 4KAFA 4ARAA 1XZDA 3JYHA 4MWTA 3RKSA 1SCKA 2VT7A 1U4NA 3WI7A 4KACA 1JJBA 5DYWA 3H17A 5ALUA 4C6HA 4GBGA 2PX6A 4PO3X 4CIAA 4CCYA 1P0PA 3HXKA 4BC1A 4DNFA 3AZPA 4G1FA 1HPLA 5LIPA 2EDAA 5JASA 5AI0A 5FKJA 3AFIA 2OAEA 1NU6A 3AIMA 2QT9A 3SWWA 1XZAA 5DTJA 4Y2VA 4WFJA 1QIDA 3I2JA 4RGYA 3KXPA 4Y2TA 2ZYHA 1CV2A 1K6EA 5CURA 1VE7A 4UBIA 5K3BA 1GT6A 3R3YA 1VZ3A 3WL8A 5EI5A 2QVBA 4X71A 4EY4A 2RIPA 2I3ZA 5FUMA 3SK0A 3IUMA 3OM8A 1WOMA 4OB8A 4BB0A 4DM7A 4DNOA 3H2HA 2EEPA 3WKAA 4P93A 2O2GA 3HSSA 3LIIA 1BE0A 4KAJA 1F6WA 1TCAA 4EBBA 4IO0A 2GBCA 4MEBA 4DMKA 2XQGA 3HEAA 4QDOA 4EZIA 5KREA 4BP8A 1SFRA 1F0NA 4IHAA 3AZQA 1TIBA 2Y2VA 1TK3A 1GKKA 3V1KA 1UK7A 1YSCA 4ITVA 3WL7A 3ANSA 2BKLA 3WYNA 3ILSA 2H7CA 1LBSA 1CUDA 4B82A 3IBTA 3WK9A 1MPXA 3MUOA 1ETHA 4B84A 1AMNA 1C4XA 5K3DA 2DFPA 3EIOA 3RLIA 1YA4A 1H2WA 4GLBA 4N8DA 2PVSA 4CG1A 4QDUA 4YX9A 1THGA 2XUJA 4J0HA 5K3FA 1XQXA 2XQKA 4Y2JA 1MNAA 4BVLA 1ZJ5A 4HZGA 3I6MA 3R3ZA 3BF7A 3WIOA 4WFKA 4UFPA 4KE8A 4PSUA 1WB5A 3G0CA 2CKMA 5A71A 1QGED 5A7HA 5HQ3A 4BVKA 4PSDA 1JJIA 2GYWA 1A8QA 2XMQA 2WIJA 1YS2X 3HLKA 1BRTA 5ALNA 4ZREA 1XFDA 3MGAA 4LKOA 1G66A 3WA7A 5EGNA 5HKAA 5DNUA 3E3AA 1H23A 5HFAA 1YB6A 4WDQA 3RK4A 2XQIA 4GI1A 4C4XA 1LPAB 3G0BA 4H7KA 2OGZA 4BZZA 4FOLA 4AMYA 2O7RA 3QMMA 4H7HA 4OCZA 4TPKA 3C5WP 5LZ5A 4UBJA 4UBNA 4DTCA 1DWOA 5DWDA 2BCEA 4U2CA 2XLCA 4DMCA 4G8DA 1JFRA 2CMFA 3H1BA 5CT9A 1GZ7A 1BN6A 3W2TA 3H18A 1CIJA 1ZI6A 2QM0A 4H77A 1HBJA 2HA6A 2WHPA 4DMHA 1JI3A 1EK1A 2X8BA 3VKFA 1MO2A 3HI4A 4WFIA 4C4ZA 4WY5A 1I6WA 1WB4A 4P9NA 3BE8A 5K5EA 1EXWA 1EDDA 1AC5A 4ZV9A 5ALMA 2Z8ZA 3DD5A 3BIWA 3JW8A 4DNQA 4L3WA 5AK5A 4JNCA 4MYDA 1UKAA 3OG9A 3WLAA 1KU0A 3CXUA 4DLNA 5ALJA 2PL5A 1E8DA 3OTQA 5JD4A 4I19A 1XLUA 2WIDA 4BAGA 4N8SA 1WPXA 1KEZA 1IZ8A 3CN7A 1MTZA 4PW0A 3ESBA 1QONA 1CPYA 4J03A 1CUVA 2J3DA 1Z68A 4BP9A 1EK2A 5DJ5A 2H1IA 4CCWA 3WKDA 1QIIA 3G0IA 2WFLB 1VZ2A 4GXNA 1HL7A 1U65A 3WZLA 4MQLA 5ALYA 3RARA 2WUFA 3QVMA 2CB9A 2Y6UA 2Z8XA 3BJMA 5JAOA 3ZWQA 1FJ2A 2YYSA 2GYVA 2QJWA 3PUHA 3FSGA 4H7FA 2HU8A 4L72A 4DNPA 3H2IA 1R88A 1KU6A 2JIDA 4QE3A 3BIXA 1MN6A 4XWGA 2FX5A 3F96A 2JEYA 2QXUA 2WJ6A 3ZI7A 3G0DA 2AJ8A 2IX9A 2HA7A 2O2IA 3C5VA 1XZGA 1ORVA 5AKKA 3P2MA 5BWCA 1W6RA 2WSLA 3H19A 3WWDA 1E8NA 2JGEA 1HLGA 4FNMA 5AP9A 4UPDA 2XT0A 3C70A 2OGSA 3M83A 2XMZA 5SYNA 5AKLA 1UK8A 2XQFA 2I3DA 4X91A 3VJKA 3K2IA 1R50A 3F9CA 4AX4A 3FWHA 4Y2SA 3WK8A 2HRRA 3EQ7A 1XROA 2ROQA 4OPMA 5CBKA 4BATA 1N1MA 3IA2A 4A16A 1DQZA 4LXGA 4ZRDA 2YASA 4UBKA 3QPDA 5JAPA 2C7BA 2OGTA 3C6ZA 3MUNA 2CBGA 4YPVA 4G8CA 5HZGA 4FHZA 3S8YA 2XUDA 3PI6A 2XUKA 1BU8A 1VXOA 3WWCA 5T4HA 1MJ5A 1EVQA 1JMYA 3RM3A 2Z5GA 5AKGA 2W22A 2GBGA 1E3QA 5AM2A 3QMWA 1L7QA 4E14A 4Q82A 4BVJA 2XUAA 4HAIA 4S0XA 3QM1A 2QJRA 5FXMA 3ZPXA 3UMJA 3BWXA 2PU7A 2PSEA 5FOQA 4Y2PA 5IVHA 4QWWA 4K5QA 2YH2A 3D59A 4DGQA 1ZJ4A 1W75A 4C89A 1VA4A 4V2IA 5LKRA 5DTIA 5LLSA 2HA3A 5AIAA 4BAUA 1WCYA 3UUFA 4H35A 3GA7A 1D07A 4IQ4A 3R3WA 3Q0TA 4PQEA 1XKLA 2EDCA 2D5LA 5CW2A 4Y2UA 1TQHA 5HK9A 3V1MA 1U8EA 4J0DA 4GHWA 2HFJA 4KRXA 1BROA 1WM1A 4UHHA 3I1YA 1F8UA 4BC0A 4UHEA 4UBMA 2WFZA 1GGVA 4U2FA 3F97A 4EHBA 2GZSA 2WUEA 4AB1A 3GFFA 4HRXA 5ALDA 3DOHA 2I03A 1BCSA 1UFOA 5CRIA 1XQVA 2DHDA 3CN9A 2B61A 3LIPA 5E4TA 1XZIA 1WHSA 4QWMA 2G63A 2J4CA 1K63A 4J0KA 2ZVDA 1LNSA 4QA9A 3O4HA 4K6GA 4UUQA 2XMGA 1TAHA 2J4FA 3GZJA 4K6HA 4KAAA 5EIEA 5T4FA 3F8SA 4RPCA 5FDFA 3BDIA 2CJPA 4C87A 3A2LA 5EHZA 1CUWA 1XZEA 2DR0A 5HF9A 1A88A 5AOBA 2ZYSA 2WILA 2ZSHA 1ZGBA 2WTMA 2QKYA 2C0PA 4X97A 5DNWA 5C81A 4H18A 1J1IA 4KRYA 5AM0A 5ALWA 4Y2YA 3FAKA 1WB6A 1UOQA 4Y2QA 3QYJA 3DEAA 1XLWA 4OB7A 2X76A 4JUIA 1XQWA 3R0VA 5SYMA 3G9ZA 5JD6A 3ESAA 3WA6A 3OOSA 4B7ZA 5FLKA 4Y7DA 5I8PA 1XRQA 1U2EA 2HU7A 2B20A 5JAHA 4J0IA 1QTRA 4K2AA 4F0JA 4GDMA 3FYUC 5H3HA 2Q0XA 5LZ9A 2VAXA 3L1IA 2WU3A 3C6YA 1XZFA 1DWPA 1M33A 3DYVA 1XZHA 3WWOA 1CUIA 4HRYA 5YASA 5ALFA 3E1GA 4X94A 5AI6A 2NW6A 2WUDA 3F67A 3EBLA 4OUKX 2PU5A 2AXEA 3NOXA 5CH3A 1H2YA 1H2ZA 1UT6A 3A70A 2XUHA 2OXEA 4TGLA 4O08A 3WKCA 4W1QA 3HABA 4DYHA 1W4LA 4LYDA 4I4CA 5LKAA 1QFSA 1BS9A 1DT5A 1VLQA 3PUIA 4WY8A 1QZ3A 1CQZA 3FSGD 5ALZA 3WK6A 4KR0A 4J7AA 3KOOA 4DSZA 1S8OA 4QZVA 1AZWA 3Q8WA 4Q34A 4BTLA 2ES4A 3JWEA 3WZMA 1MX5A 3S2ZA 1OCEA 4NS4A 1DX6A 1QIKA 3R3UA 2ZJ6A 2WHQA 5HQ3B 4X85A 1UOOA 3HJUA 4L0CA 1TCCA 2LIPA 3ZLVA 3U1TA 4INZA 4BE9A 3D2CA 4QDXA 4H7JA 5ESRA 1A8UA 3STTA 4FMPA 3W9UA 3I6ZA 4JEIA 1CRLA 5AKZA 2HADA 3AJAA 1N5RA 2ONCA 4ZI5A 4EUSA 1W76A 4AXBA 2VJDA 1QO9A 5HK8A 1DINA 1X2EA 3AUKA 1LPMA 5HFNA 3LS2A 1Y37A 1PFQA 5K3AA 1R4ZA 1YASA 1ACLA 3YASA 3MVEA 3FLAA 2WUGA 3WMRA 3OURA 4QEKA 5T4EA 2Z3ZA 1BEEA 2VJAA 3I2GA 3O0DA 4U2BA 4CFSA 1EINA 3T4UA 3KWJA 1AUOA 3IULA 5JADA 1EDEA 3WKEA 3PF9A 4BBZA 3WL6A 1MX9A 4BRSA 5CT4A 4QLAA 3FYUA 2PUJA 3R3XA 3HYSA 3V48A 5CXXA 1Y7HA 1EHYA 4DSAA 5EIHA 4KE6A 4U2GA 5CT8A 1AKNA 1OXMA 1EB9A 3N2ZB 1CUUA 2DSNA 3CCBA 3G9TA 5LZ4A 1ODTC 4P08A 3SC2A 2XUQA 2PUHA 2W6CX 4HXFB 5CMLA 4M0EA 3AIOA 4IH9A 4H7EA 4HTAA 2WJ3A 1A7UA 5HF8A 2GBFA 2WU4A 4MQMA 4UHFA 4OB6A 1G4HA 5AH0A 4B0PA 3I2IA 5JD5A 3GELA 4LXHA 3WQHA 5ALXA 4MXDA 1N5MA 1QO7A 2XI4A 3WL5A 2UZ0A 1MU0A 5AOAA 1AURA 4BCCA 4FWBA 2RHTA 4C01A 2WJ4A 1LPNA 2HDWA 3TEJA 3EQ8A 1VKHA 2BUBA 3FYUB 2OCGA 5AI8A 2XMDA 5C7YA 2RI6A 5AK4A 3FCYA 3W05A 1LPBB 4QLOA 1LBTA 4Y9SA 4X93A 3SX4A 3CCCA 3BL8A 2HM7A 2XE4A 4Q3LA 2QS9A 2YXPX 4X95A 4CIBA 2Y1KA 4X6UA 3G9UA 3VJMA 4ETWA 1XRLA 1QIFA 2WM2A 2D0DA 1BCRA 1NX9A 1O6FA 4E46A 1K4YA 1QE3A 1IUNA 2WG2A 4FFWA 1QIGA 4JYPA 2WIKA 3QZUA 1VA5A 4ARBA 5DLPA
chains in the Genus database with same CATH superfamily
1KSHA 4N9WA 4EEZA 1NMYA 1B7GO 4X6XA 5IX8A 3OTIA 3X1JA 3DBIA 5FUQA 1OIVA 4CL0A 3EH1A 1HSZA 1C3LA 4YP1A 2DPHA 2CXHA 5KOYA 4DWOA 4JDUA 4E07A 3HEMA 1EMDA 2BMJA 3BQMB 5IG2A 5C8ZA 1GG9A 2QP3A 2XY4A 2UXDB 2BLNA 5AHXA 3RUIA 1E1QD 4KO2S 3GJSA 4IAOA 3T1QA 3ZDCA 4PWYA 3ORYA 3N75A 3U3RA 4XWWA 2O5CA 2V7WA 2ID4A 3G2LA 2XDWA 2XWSA 4BKMA 3KQQA 1FOEB 2HL6A 2P1ZA 5KNBH 4WESB 5EIOA 1H66A 4WADA 4CKYA 5JCPA 1U6JA 3I4CA 1BWQA 3IJPA 4IUCS 4M0LA 2PH7A 4HN4B 5CH5A 4ZRNA 3MBOA 2B1GA 1THMA 3C14C 3RR2A 3G6WA 3W1EA 2R25B 3KPVA 1XZKA 5TGDA 2VQEB 4JBYA 1LQ2A 4LYEA 1L7MA 3G7UA 1DIBA 4L2IB 5U9CA 4D80A 1ND5A 4OIFA 1NW8A 2F43B 3V9AA 3OZXA 2B25A 3FGNA 1G2QA 2EL7A 4MQBA 3C3XA 2QY6A 4WW0A 4GZ5A 5E6UA 4LZZA 3OEWA 5KNDA 1F60A 4U7DA 3ORFA 1Z6YA 4JGGA 4L5YA 3L7DA 4YAEA 3AFNA 3VHXA 4COKA 3X1ZA 5F5LA 4M9UA 2H1FA 3H5TA 3PDHA 4DPMA 3AM4A 4HMQA 1PJAA 3ZLTA 4V0NA 4HPWA 3TL6A 1BEUB 1RPAA 3D1LA 3PCRB 3A3YA 3QWHA 4HWRA 5EL0A 1FTQA 1FUYB 5IP5A 4B4DA 1SWVA 3A4VA 1RWXA 3O7WA 4Z0TA 4G5HA 1MX1A 3N2NA 1DDGA 2Q27A 4HX2A 4Z8XA 1GJRA 4O1IA 3DL2A 5NULA 5DHAA 2PUFA 1ISGA 2ZIVB 2EBFX 3TBKA 3VJRA 1F4PA 2A67A 4JJGA 4NG4A 3WQRA 3U7HB 2QZ9A 2HF7A 3OD1A 2AJTA 4AY5A 1E9DA 4PHGA 1X1SA 4MAFA 4GGOA 3MTEA 3D5EA 4KXVA 4RVSA 4WJLA 5B30A 1U9ZA 5JVDA 1SMKA 2J33A 4E3ZA 2OAGA 3GDOA 2FKAA 2FUKA 2XWPA 3I04M 5SZIA 2X9VA 3ZK9A 4DEVA 4Z4IA 2PYZA 4CLXA 3U9LA 3DFKA 3MJHA 4CM8A 3HEBA 3P97A 1M8GA 1NV8A 3DZFA 3PR1A 4A0HA 5EC8A 5L4LA 4ASUA 4KPEC 3COWA 5BW8A 2AE1A 4AN1A 2Z3WA 5CYOA 3IKJA 3BN3A 4ZHQB 3QBVA 4DQUA 2O54A 2OCLA 1MX3A 5LU9A 1D6SA 2WT9A 1XNQB 2B7BA 2IUEA 1JIKA 4HOYA 3K9GA 3C7AA 1QP8A 1F8XA 2NV0A 4DRXB 3DUFB 2FNAA 3VM6A 2FW6A 4YPFA 4QKQA 2FEKA 4HATA 3LQKA 4QTTB 3B2EA 4GUDA 4KFUA 3MQ4A 4OLJA 1BDBA 4S3MA 1ARZA 1CUYA 4IGFA 5FOUA 4JJEA 1J23A 5LQJA 2SCUA 1SKAA 4J8PA 1FMCA 1OWPA 3R3SA 4EGAA 2APJA 3PJDA 2HIAA 2WMYA 4IWXA 2R2AA 2PUVA 3DEJA 2PBLA 3GEIA 1U3DA 4OJMX 3UHPA 4DBVO 1A9TA 3PNYA 4Q37A 1HKHA 5AW7A 1SRQA 3DTTA 3E22B 2HGZA 2YL2A 5LP1A 3ZBQA 1VPWA 4JN6B 1AHIA 4E30A 1L5LA 1U7XA 1PJBA 3WRXA 4Z49A 3BOSA 2Z08A 2XUFA 3FDZA 1HMYA 2W6OA 2QM8A 1CQXA 3FPKA 2CBXA 1C8KA 2AWNA 2O3TA 3LUKA 4QHYA 2IUSA 2X19A 3I2KA 3P9ZA 2O20A 5BYAA 1I94B 1RWVA 3HY4A 1GZ3A 1PGPA 1LZLA 2WG1A 1GN9A 1T3LA 2NQ8A 5KSPA 4DDUA 2F4VB 1OW3B 3SF0A 4V38A 3IUPA 1P0IA 3NCHA 4HGOA 4V02A 3TRDA 4DM3A 3DMTC 1L7EA 5FPKA 2UV8A 4CM4B 2XRZA 3ER9A 1IMOA 4IVPA 1PWYE 1PNVA 1K5GA 2I7CA 1V37A 3QELA 3VOBA 2A1TR 5SZKB 3USCS 4KPUB 4BDTA 1KE2A 1YU9A 1IK4A 4M99A 4FHGA 1RBYA 4AU1A 4IDEA 1PZXA 4TSFD 5J63A 5KWJA 2M1ZA 1GHTA 2R7KA 3CZ5A 4O4HB 4YDSA 3GLUA 4CIXA 1U2DC 1DTWB 4IIXA 5BWOA 4KI0A 4UOEA 4MUAA 4GW3A 4DIBA 1JQBA 4IDQA 2G82A 5FWAA 4I99A 3TM5A 5BN5A 4EG4A 1K0UA 1SBTA 2B4AA 4CMHA 3LP8A 5AKEA 3OF3A 1BCSB 1W96A 2LTAA 4EAQA 1U90A 1JEJA 1X42A 2IKSA 1JDZA 2W2MA 3KSRA 3I0ZA 4KVZA 5KC8A 5TQ2A 1PT8A 1M2OA 1CUSA 4G0QA 4OBEA 5IAJA 5AJZA 1KDPA 1H5NA 2QN3A 4BJ3A 3OEEA 2EZ8A 4R7ZA 1EWQA 4P3OA 2HU5A 2O6HA 5H8WA 4ER5A 2Y77A 1TAQA 3GLFA 3U81A 1ESCA 4JVMA 1PWXA 3I5YA 2PKQO 1H0HA 1XTUA 4A23A 3ZGXA 2WSIA 3C8UA 1E2HA 1XAJA 3I0MA 5F9HA 2L17A 5IUKC 5TR9A 4TVKA 1WZEA 4KQ6A 3HFSA 1P72A 2LNDA 4LNAA 4IHJB 2YN0A 1G9SA 1OF1A 5EP3A 1MD9A 1AKWA 2AFVA 1TU0A 2JFHA 4C0BA 5KU7A 4H3KB 1NVKA 1Z4NA 5BRNA 3T0IA 5AXAA 1P1IA 4HXYA 1J1UA 2JEOA 2OO7A 3D5TA 1QHYA 2H6EA 3FYCA 2C20A 4EPWA 2AFHB 5DCUA 5EKUA 1LC0A 1U3CA 2SKCA 4HVLA 1HE1C 5J2UB 1T8PA 3JD4A 2BFPA 5AM3A 1NBMA 4MYTA 2JAQA 1VLZA 3OCWA 4TM7A 2WHYA 2C00A 5LCXA 4ACBA 1MF7A 5BY2A 4GX2A 4DCCA 1E6MA 1V11A 3K0BA 4X00A 2EKPA 3WHLA 2VQ3A 2HK9A 3V1NA 5FLYA 3TUIC 4MTLA 4CN9A 2JGFA 2O52A 3ZHXA 4M0MA 4H1WA 2N9UA 3TIIA 3V7YA 3W06A 3WADA 1H9CA 1DCTA 1QFYA 2Y4NA 1MCZA 1RDFA 4JT9A 4MQEA 5IWCA 2Q4TA 1NVUQ 3G68A 1SGWA 4CCAA 2O8EA 2P3QA 2PRJA 4KH1A 4LDQA 5IYZF 4GBED 5A4MS 1E2UA 3LYAA 3LCRA 3T94A 1GCGA 1E32A 4OHWA 5DGCA 4DUYB 1KXZA 4HY3A 1GQSA 4XUDA 4GKAA 4PO8A 5E2IA 5DNEA 4BP9A 3NHYA 3NP7A 5FL3A 1O5IA 4I36A 1HQDA 4K1XA 4JI5B 1C7IA 2WZDA 1ZK4A 4RMJA 1NY5A 5BN3B 1DJLA 1CJTC 1M2GA 4O59O 1YB2A 1TLFA 2VSQA 2XQVA 2O4UX 2N46A 2OHHA 2YOGA 4R1QA 3UY4A 4EGCB 3AY6A 3EVNA 1T8TA 4F9FA 2FEWB 3JQBC 2FN8A 4YAJA 5L53A 1ZNWA 3O3OB 1MJHA 1HDCA 2XCLA 3DHEA 3HJNA 4PQRA 3OUUA 4XLTA 5HVNA 2BF7A 3TRKA 4KYIB 2L42A 5AW5A 2IP4A 3CNLA 4YREA 4XLLA 2X0EA 3UCEA 2X5OA 4ZKEA 1RLMA 4IIDA 1WP4A 2YHIB 3FLBA 4JENA 1RC8A 4ZJZA 1QFMA 4EI7A 1L8OA 2QUAA 1QFXA 1XF9A 2V7TA 2PZKA 5TARA 4D6XA 2ZBDA 2ZUWA 3HUFA 2BUCA 2VKTA 3C43A 2IKQA 4E6EA 4RELA 1WETA 3A1TA 4UHBA 4RQTA 4FBMA 1YULA 3H1PA 4OQEA 1BHO1 4F91B 1TDJA 1AF4A 3PE6A 5LYJA 3I76A 1LK7A 3VDXA 4BNDA 2Q28A 1RRGA 3WGYA 4AG6A 1G8MA 3NAQA 3HH8A 5BSVA 5CX4A 1P77A 2OCXA 1U28A 1BXGB 2ZB8A 3INGA 2FW8A 3T41A 4M0UA 4E4YA 3C16C 1GU0A 1NDUA 4H27A 5C4GB 4KBGA 2QRMA 3RVRA 4F2WA 5DM70 3ELUA 4R8LA 3WGGA 4M22A 1JHXA 3VDRA 3E9CA 4IV5A 1HORA 1I7DA 3V1LA 4MNTA 2BFMA 3T54A 5IF9A 3WLSA 5B1HA 2YJ5A 3KD2A 5AFSA 4G1VA 2WB2A 1FTYA 4H6PA 5JMPA 2G0AA 2AJCA 4WOBA 4ZEWA 1BFUA 2A5YB 3E7XA 4IV8A 1AGNA 1E1NA 3KVYA 4O1HA 3NOOA 4OFZA 4TMXA 5FA8A 4HSEA 4FSXA 1PEKE 3CVYA 2I76A 1ODCA 4QGHA 2FA9A 1G16A 3O4IA 2ZBEA 2HK8A 1ORTA 3MUEA 3KEOA 1MC1A 3OZCA 5CLFA 4TWJA 4CE6A 1AH2A 5DNDA 1CP2A 4LE1A 5AM1A 3HDYA 1H9BA 4B4UA 1D9ZA 4DB4A 3IDZA 4ZCPA 4MQ4A 3R40A 2PR7A 3GJ3A 1NHGA 3NONA 2QN7A 4PR3A 5BVGB 2IH2A 4RC9A 5IZCA 3IEKA 1I51A 1DJPA 2W6JA 2ZJYA 1SHKA 2QTCA 4DCPA 3RBXA 1KIAA 3T3GA 2IOHA 4DR5B 3IAM6 5KKAA 1F3OA 3VNVA 1LK5A 2G4VA 4QXAA 1O5TA 4M1EA 5F3RA 1UXOA 2ADFA 2Z9BA 2FZ4A 3C6MA 3D7RA 4FW8A 4KYUA 1KZHA 4BJ6A 3RADC 3FMIA 2C95A 1IIBA 4G4GA 1OPXA 1ECBA 1N6NA 3IP7A 2DHCA 2XMBA 3K3PA 4BO6A 2CFOA 2DRIA 1C3XA 3DEZA 3Q1KA 4W5TA 3QJ5A 1Z8HA 2F3RA 1M74A 3PQ4A 4ZJYA 2C7RA 3K2BA 3F6YA 4QD3A 2VHQA 4MI9A 1BKDR 1PVOA 2H51A 3OZFA 1W9HA 3BTUA 4DJFC 1X1RA 3QFCA 3KR9A 4WK6A 4PAOA 4BMXA 3LPLA 1PEYA 5JMTA 4EJMA 4MHTA 2IP2A 4FNOA 4EW6A 1LVGA 4IHQA 2OQ2A 3U0VA 5A3JA 4BTVA 2B78A 3ETHA 4CTMA 2A9PA 1KTIA 4Z7JA 4U7GA 1SQSA 1NNI1 9MHTA 1RLJA 1LBEA 2VDJA 3OJFA 2IEZA 5E1MA 5LZ8A 1AO3A 1SUIA 3W3ZB 4L8VA 4RZ3A 3MC1A 3V5NA 3RVDA 1K4MA 3IOMA 1EX6A 3JWHA 5AICA 1ZBQA 5I4KA 5CD1A 3P4XA 1Z7GA 3HDQA 5EFOA 3RS5A 1LRJA 4GL2A 4EGQA 4C4YA 1CETA 3ZWOA 4FBLA 4BX2A 3V2UA 2FMKA 2Q7DA 3CBQA 5K09A 2ACVA 1VJ1A 2DBRA 2YMPA 4C0JA 2OP0A 4C2TA 4YB8A 5AIBA 3LXRA 4ZOEA 1KL7A 5K51A 3VTFA 3LYHA 1N2ZA 4IS3A 3PUXA 4KNYA 1JG4A 1H9AA 1G5FA 2QTMA 1T2NA 5FTLA 4PNEA 1G63A 1I7PA 2X1LA 3ZWXA 1E1YA 3OQJA 4LPSA 3SXUA 3UEOA 4CT5A 1W5FA 4QGFA 1NYRA 4B40A 3HM9A 1NIPA 2Q8NA 2X2FA 3OCYA 3ZCSA 3VR2D 3A9WA 5E6SB 1RZVA 2V96A 1IQRA 2ALJA 1E6KA 4FDUA 4YS6A 3UJNA 1HFJA 5C31A 3FFXA 2XE8A 3OSUA 2RHHA 2VT2A 5EY5B 4DV0B 1ODSA 3TGPA 2PUGA 5LNK1 1ODJA 1KY5A 2HR1A 1L5YA 5EPUA 4J6FA 3ZGOA 4QHSA 3I53A 3LDHA 2XEXA 3S40A 3IS3A 1CUAA 4KUGA 2AF3C 1D5WA 4Q21A 3H5RA 4P5DA 4G5XA 5ALSA 3ROFA 3RUAA 3TMKA 4ARZB 4D9JA 1FE8A 1ULZA 3I05A 3E9RA 4J29A 2VK2A 1P33A 3OSZA 1GY8A 3KKEA 3RF7A 5EHNA 1OFTA 2R0QC 3E5MA 4LC9A 2EHJA 2MYTA 2VDWB 2XYVA 4DM4A 3ZJVA 1SC4A 4O2BF 4Y8VA 3Q72A 1QP7A 1ULBA 4MVJE 2G5TA 1AY0A 3KZ1E 1NLMA 4MA4A 2FR1A 3M1IA 4LZLA 1JMKC 4NMWA 1G8KA 2IZ7A 1P1HA 3KALA 1PO7A 1X86B 3OLVA 2OZLA 4YFVA 3FMFA 4MW9A 3T0GA 3WRWA 5CXUA 1XQYA 1K27A 2XTZA 3EZLA 3HKEB 5KVCA 2QX6A 1V5EA 3NHRA 3RD5A 4UVHA 4CEHA 2PNFA 1B43A 1P61B 2BGRA 5IUJC 1J5XA 4QNMA 5CG2A 1RXYA 1QOQB 2H3EA 5FNZA 4QICA 1ODKA 1Q1BA 3KSAC 3PG5A 4O2AB 4PYQA 4RPHA 4CLRB 1CUZA 2PGOA 5G0SA 3QVGA 3AUTA 2FR0A 2XYPA 2ZJBA 4I14A 3O6VA 3HCBA 2AJBA 1PDWA 2B1IA 3GJ6A 2BI8A 1R6AA 2EW1A 3IJRA 3C3JA 3JQGB 1Z22A 2VDVE 4P82A 1P4RA 1U1DA 4Q1AA 4AJLA 1B6RA 1XMVA 1Q84A 3PFHA 4C0QC 3AFGA 4N5MA 1U1CA 3X1XA 2UVDA 5TPWB 2ZKIA 1UPBA 3BCRA 3G02A 4YROA 1ULSA 1UBJS 4BX9A 1JKIA 1K5PA 2ZFUA 2CNWD 3WK7A 2JBWA 2JGRA 1MQ8B 1VB3A 4LYJA 1SKUA 5EQTA 3AYXB 2JFZA 3IHWA 1W2GA 1XL0A 2BP7A 2VHUA 3R7LA 4LY9A 4F6CA 3GGJA 1Z74A 1YA8A 3DMPA 2ZBFA 3KTOA 2PFGA 3NGMA 4B75A 4RIIA 3ZDFA 1IB6A 5EESA 4L8LA 4KDRA 1QF9A 1XZPA 2FUNB 2HA5A 3IKVA 3UT5A 4B6QA 2JGKA 1H1LA 3RRYA 2IH4A 1MZPA 5BN1A 3GNSA 3ZK7A 1K7FB 2CL0X 1NFFA 3L7OA 3REQA 1VBNA 1HFEL 1PKXA 3ZXUB 2XZDA 1NL3A 3AVVA 1WW2A 2PDAA 3DD1A 3F2VA 2GFHA 1ZCFA 3FJ1A 4PNZA 5K0NA 3RROA 4GZ3A 2R48A 4Z7QB 2Q3CA 2Y68A 3HGTA 1LPPA 1QXSA 1YBAA 2FFBA 3CSDA 5DGXA 3V80A 4OQZA 4TT3A 3D2AA 1I3CA 3QV2A 1UIRA 2W00A 3S0JA 3WAGA 2G4CA 3V9PA 5KOHA 3N2YA 2D8MA 2ZT7A 1ZLXA 2X8WA 1TCVA 4R9NA 1F9EA 4ENRA 1FJXA 2PLWA 3WYBA 4CEIB 1WV0A 4GZLA 4L0QA 5FPPA 2DWOA 3EUEA 5JXIA 1KE1A 1IYZA 3I4FA 4XYEA 4PG5A 4FDVA 4TV9B 1U1EA 2C29D 3GWGA 3VV2A 2XMCA 2BI4A 5F1OA 5DRTA 3L7JA 2OWEA 1XMQB 2D1YA 1T8RA 1KDTA 3WX0A 3JQFA 4PYNA 3CX7A 1NOIA 3FHLA 5D8DA 4GX5A 4OJNA 4BMZA 1UEJA 2XCIA 2FOLA 3EDOA 5KVSA 2YRWA 1GR1A 3ZS8A 4C2AA 2QF7A 4CDMA 1Y8AA 2NV2B 3SR0A 3VR5H 4G63A 3OAAA 4QUEA 4IGKA 3UFBA 4HB3A 1XWWA 3IUJA 3HWWA 1K1EA 1HG0A 2O1XA 1OI4A 2F3PA 2FKNA 3BMOA 1C9NA 4HH1A 4ZVPA 3V7UA 3M4YA 2DFNA 4EG0A 4ES6A 1OGJA 4NX2A 1XZJA 1Z7EA 4TTJA 3CVWA 4JUCA 1TKCA 5DNAA 1GG8A 4MZXA 4C76A 2I7XA 4EMSA 2Q4RA 3GROA 4MRNA 5B6PA 3G0GA 4UNIA 1Y89A 2VNIA 4B83A 2PZ8A 4S0ZA 3M2TA 2HLPA 4FDAA 3LLMA 3KEGA 1X80A 4MP8A 1UR5A 1MC5A 2FG6C 5BNZA 1O95C 1T4GA 2VSOA 2QVGA 4W63A 3B82A 3BDVA 5ITZA 2G83A 5M29A 1OLUB 2CL5A 2FXVA 4DPKA 1L4UA 3RFTA 4F4CA 5A62A 2AEMA 5KYWA 1P74A 2JA1A 1YVPA 3FCUB 3TUJC 4YLGA 1RYHA 4IIUA 4QDKA 5DRYA 3VV3A 2I7VA 1CR6A 3FPBA 3VYTB 4TKUB 1KF0A 2QTHA 1RLUA 3CE9A 3CU5A 3N28A 3NHMA 4PZ0A 1UC9A 1W93A 4IDPA 3ED1A 3G8YA 1EGVB 1DXYA 4UJ5A 3SC2B 3WNVA 1ZU4A 3S2IA 5I7VA 1FDRA 5C35A 1A5ZA 1PBTA 4IXWA 1DFIA 2YY6A 3SJZA 1UT8A 3GUZA 3KK0A 1DAPA 5LC1A 4DV1B 1HTTA 3H5OA 3UV3A 5KZMB 4H31A 1PK7A 1YIOA 4IH1A 3UK2A 2VJPA 1E79A 4I5DA 4R6XA 5EZ5A 2BFOA 2RKOA 2A59A 3SLKA 2GNPA 3TNJA 2IUTA 1I6KA 4AZ3A 1WZ2A 1NRIA 4L50A 4PPGA 1H4QA 2GAJA 4Y2XA 1DOHA 3UG7A 1XLVA 2AFIB 4D5GA 3LRXA 4RHTA 4GWLA 2XVZA 1W87A 4JL8A 4PCAA 4Q19A 4WXYB 2G9NA 5K0TA 4FP9A 4BQEA 2NUAA 3DDUA 3AEUA 1QQ6A 3G5UA 3P32A 3H9EO 1CQJA 1XU9A 4RY0A 1A5TA 3KPYA 1O94A 4WXPA 3DHVA 3DZ8A 4QYWA 4WHMA 1ZGAA 2R68A 3H2ZA 1NLUA 4FFVA 2DEUA 2O19A 3I23A 1W5BA 3QOFA 1IUPA 3P9YA 3FI0A 5KC9A 1GQYA 2JKYA 3CRVA 2PH1A 5JSYA 1WCWA 1HOXA 2HCFA 1MQAA 2CDNA 3PGKA 4OV6B 4MIOA 4ZYTA 3L1HA 5ALVA 4N3BA 1EFUA 3WDKA 2G9UA 3D8UA 3BRCA 2JATA 4IG4A 3FM9A 4TVSA 3LZDA 1V16A 4HMOA 1T9ZA 4ALJA 4CM1A 4D0NA 5C1BA 5AI4A 5ICCA 1ZFNA 5KX5F 5IVIA 1N6HA 4N0DA 3GMTA 2FSVA 4PX2A 3RV3A 1KBZA 4IDNA 3IE2A 3ZYCA 1SKBA 5ITZB 4JJFA 4LOKA 3USZA 1STOA 5CX1A 3V4SA 1GTMA 4QUKA 2R1VB 3U2QA 4LY3A 3IE1A 3HBJA 4X24A 3NR2A 3KNZA 3TNLA 1WTAA 5EWJA 4OLBA 1Q0RA 1KSGA 1RQLA 2I5PO 1N8SA 2FPXA 3O4GA 4XQGA 3V2IA 4B3FX 3U5TA 4NCAA 3AVUA 2DUWA 4AKTA 1GRVA 1R2QA 2G07A 2PANA 2NQTA 4L51A 2JI4A 3SCZA 2PXAA 3BMOB 1W5SA 5CU7A 3RE1A 4QVGA 1L5GB 1RKXA 3QBDA 3EGWA 2PSHA 4HT3B 3OLQA 2C0QA 3DOUA 3SAJA 4DMLA 1Q77A 1QVVA 3RC9A 5HMLA 2V7BA 4FNGA 5CDHA 3DNMA 5GP1A 1O0CA 1PTJA 2OZEA 5JSUA 2SICE 2QLFA 1RQRA 5DPMA 3N0TA 4POAA 4MLZA 1WZCA 2DTDA 4P7KA 2PSFA 2O8DB 1NXTA 4HLUC 2YJNA 1IZ7A 5H4HA 1E2JA 3TPCA 1HY3A 3THOA 3VISA 1ZD3A 4CG3A 4QJ3A 3A27A 1ZM2A 1Y34E 3AYZB 4HS9A 3ONDA 1J9EA 1XEFA 4BVEA 2P41A 3NATA 1CUXA 4Q05A 1MB4A 1OXTA 1XAIA 3ISJA 2YC4C 4HDSB 4TYQA 3SYTA 1A4UA 3D2BA 1I1HA 1MMFB 1BO6A 4IZOA 2QR5A 2VTEA 4LAFA 1IU9A 4BNJA 2MSCB 4R2HA 4IGAA 1GPKA 4KKXB 1SK9A 1TUBA 4K9MA 4ZIRB 5K99A 2VP2A 2HMSA 3PYXA 3PXCX 3H0CA 4KO3S 4UMFA 4YRDA 5A5EA 4D25A 2CXRA 2W6QA 3NGLA 1QH0A 2Q5IA 5D3QA 2F7SA 1YHYA 1HLDA 1PJSA 1LI7A 1A5BB 3N70A 3O2QB 4RJKA 4UC0A 4KHPB 2IZ0A 5IKXA 5CFQA 2BBOA 4WLEA 2ATXA 3C5HA 2P62A 3D4LA 4IJKA 5EJEA 3HUUA 3NP9A 4DC1A 1DRJA 1J56A 1CQIB 1DTSA 1VYTA 1FRVA 4RE6A 4ZGBA 1U3WA 4UOQA 1W46A 2H8KA 2D1TA 3T1OA 3IPRA 4MUNA 4NBNA 1MQSA 1BQ3A 4FVTA 1YBHA 3IUSA 4OBXA 2IUUA 3E8XA 5DM60 4D45A 1R0WA 1XTIA 2DT5A 1PW7A 2XOKD 1Q1ZA 3ZLUA 3EGCA 3WLOA 1XCJA 1Q1GA 1TO2E 4BAZA 5C8XA 3HBAA 4BYMA 5B2ZA 5IBCA 1YJBA 1PUXA 3W6PA 1FNNA 1U3FA 1P75A 2P0AA 3FTEA 3MGBA 4NY1A 1CY2A 4UEWA 5EUBA 3H6GA 2B4YA 2FXIA 3L6BA 3A6ZA 2WHEA 3A1EA 3E84A 3O4FA 5ILGA 2OA0A 2QD1A 4RULA 3MD9A 4CEHB 3UENA 3I6YA 1WNFA 4PYKA 3I5AA 2B6NA 1SZCA 1KJNA 3I3SR 3E7DA 3I0NA 5AD1A 1D6JA 1ULTA 1JFTA 2FDCA 4JBGA 1HDGO 2JLXA 2WD9A 3L1JA 3CLVA 2J4DA 3U7RA 4DUPA 1WEHA 2BJHA 1Y3IA 1YKSA 3H2YA 3KLMX 3VNRA 1E7QA 1X87A 3KAKA 1W29A 3GHYA 4JI1B 5EQJB 4KPGA 1EQAA 3U44A 4ITUA 3TDNA 3EGIA 1I4DD 2Y0CA 3H2JA 1BGWA 2COEA 1A2OA 1Q1QA 3H75A 2ZE5A 3JALB 2Y05A 3EXHA 5TJ9A 5IN4A 5KNDH 2ZVQX 3HXPA 5AVZA 4L5BA 4ZPXA 5I9SA 3Q0EA 4D3DA 5CBPA 1FDTA 1YE5A 5TQJA 1Z82A 3UK0A 1HURA 1K9VF 1ZM3A 3UMCA 4B3MB 2C2BA 4LRWA 3AEKA 3G79A 3S44A 1UWCA 1CFZA 5KWIA 5CCBA 3W1WA 5JTUA 5F4ZA 1TD9A 5CVUA 3BZWA 3UPTA 5FL7A 4L78A 4YLEA 1OVGA 5JS6A 3BMQA 2OZPA 3GJRA 3KUCA 4ACAA 5JAIA 3NYRA 3GFBA 2C4UA 4FS3A 4FYVA 1V39A 4YP6A 4RX1A 2D3TA 5F78A 4HZUA 3ZW8A 3QQPA 2XKKA 3C1OA 2HEIA 1GCUA 2JJ1D 5JH7B 2Z1MA 1AK9A 1E2EA 2RSLA 3JZFA 4OHOA 2B1JA 5U4XA 2QG6A 3CW2A 2YCBA 1FYXA 5LP6A 1HR0B 2PZGA 2WOJA 2IHBA 5ALLA 1DRUA 2P6OA 3IOCA 2ZS8A 3KOYA 4QXOA 1KI6B 3MTJA 4BUJA 4DABA 5CVTA 2X4GA 3FE2A 3OO0A 5TIIA 3ZX4A 3U7GA 3T4PA 1YFJA 2GA9A 1TO6A 3CRMA 3BJIC 2PQ0A 3H04A 3PICA 3I2HA 1RCUA 2WYHA 3CURA 2I6GA 1Y3FE 5B1IA 1A82A 5TMDA 5I7EA 2OXIA 4NFHA 3ZDAA 5AW0A 4I1YA 5TQVA 2B69A 4M46A 5T5QA 2X14A 4B7CA 3FCXA 1X8JA 5CDYA 1S1MA 3DXYA 3AKEA 3PDWA 4X64B 1U9YA 5JVDF 3D64A 5AVVA 4OAPA 4WKBA 5ICGA 3KT8A 3PV0A 2JGLA 5DASA 1QOZA 5I9LA 4U2EA 3L82B 1RM0A 4FCWA 2ZAIA 2D7JA 1Q17A 1QHGA 1EESA 1JALA 2F9MA 3PCTA 2JEZA 1PZHA 5DLDA 4BNGA 3OFSA 3OPYB 4D8TA 4MDHA 4DWVA 5I4IA 5DULA 3EEIA 2F55A 2PH5A 1HE2A 4HFRA 4D8VA 6YASA 5IUNC 2FSGA 2J9FB 5DSZA 1N6PA 2C5HA 1JKJB 1COWA 3RUEA 1EP2B 5FAKA 1FDOA 2BT4A 4M9XA 3KS9A 1RW4A 2AEFA 1O4WA 3KJEA 4PSVA 3LECA 5K8VA 1AUVA 2YIMA 4G81A 4IIEA 4YCAA 3RWMB 4B7XA 4MOWA 4I6JA 4XCXA 3ENVA 3ORSA 1SPXA 3PHLA 4FFNA 4JP5A 4P6VF 2FWMX 1GA4A 2YXLA 4BV2A 1LDNA 3IB6A 1GUZA 4HNQA 5HR5A 3HYLA 3IGFA 1SCKA 1E94E 3EDRA 3JD2A 5AVKA 3ULKA 2GF2A 5FL7D 5M3BA 4YV2A 3GLFE 3L92A 1KK3A 2C77A 4GYYA 3KYDB 3ESQA 3KC2A 1U4NA 4KACA 2SECE 4X9XA 3LBFA 3DULA 5ALUA 4HDRB 4I5IA 1PSDA 4QJ4A 4Z0PA 6AT1A 4GBGA 2ANCA 3BORA 2BFFA 3TOXA 4NNPA 2CV2A 1J20A 3G2MA 4B71A 2WKRA 2KJQA 4RTSA 4OX9Y 3QJYA 4HB4A 3ILVA 1KYYA 3QUSA 1RRKA 3C4JA 2R86A 4U00A 4X54A 2VWQA 1VI2A 3H83A 4B5LA 3KZCA 4TWIA 3GN2A 4JC4A 3WGIA 3JQDA 1HDXA 1U3UA 3N0WA 2J6CA 3ANYB 2CLHB 4G1BA 5FOSA 3TLAA 4HUJA 4R2JA 1Z0KA 5HS6A 3NBQA 4EB6B 2FWPA 3R09A 3CEHA 1HPLA 1N3YA 4UHJA 4DHWA 2AOUA 1JTFA 2XCSB 4HG2A 3PNSA 1IBLB 1B16A 1XJCA 5E9QA 3M5CA 2BCGY 2GN1A 4JUDX 2WTUA 4AKEA 2HWUA 2WD7A 3SF8B 1QDLB 2PNJA 3WHKA 2JH3A 2E4WA 2BEUA 2QLJA 2ZI4A 1OR8A 2ONJA 3AIMA 3OEHD 2QT9A 4C3OB 5G0WA 1O87A 3BGVA 1UH5A 1V2HE 3W8FA 4RXMA 4FT4A 5BQOA 2QB5A 1C1DA 1QIDA 2CLMB 2QAJA 4ZVKA 1N5JA 1EAMA 3OCVA 4LQDA 2FFJA 5CB8A 4A6EA 5H68A 2NAFA 4FMDB 5FQOA 3R7DA 2JI7A 3TKAA 4DSNA 1NC3A 3NTQA 3PB3A 4L0MA 4M38A 3SZGA 1S5PA 4HAOA 1ZH8A 5DHQA 2B34A 2C1EA 2VDKB 3DVQX 4AS1A 5TF0A 1B2RA 1B76A 3JVIA 1XCGB 3QLUC 2WZBA 1GT6A 1F06A 3QIAA 2VHVA 4C14A 2ZRPA 4F4FA 4EA9A 3KQOA 4HH0A 1VZ3A 2Z83A 3ZHBA 2NUTB 1IXYA 5EHGA 2ZB4A 4D98A 5DW3A 4P7BA 2B37A 1NA5A 3Q0IA 5EZYA 2R8PA 1FFXB 4EY4A 4TYWA 3SJUA 2I3ZA 3AF0A 3PIRA 2QVCA 1GVNB 4IQFA 3C85A 5FH9A 1OV4A 3NNNA 5EIXA 1WOMA 3L4BA 3NHBA 4OB8A 4XR4A 3K20A 4M89A 4DM7A 1M72A 5JU6A 1NN0A 2R2GA 4L9RA 3DT8A 2OBBA 1OJLA 2PMCA 2XNDA 3LHSA 4JFAA 4ZYLA 1W8DA 1XZ8A 5JNLA 1R0RE 2O2GA 1G41A 3HSSA 2XF2A 1Y9ZA 4HQFA 1OWOA 4M7OA 3RFFA 4QBGB 2RKWA 3T5BA 2Y4OA 1C50A 2JGDB 1E9FA 3ZN2A 4ESVA 2EGGA 2IPLA 2GBCA 2GPWA 2Y92A 4TS9A 3KB2A 1G5QA 1M7HA 3HEAA 4A92A 2VDUE 3FMOB 2JFBA 2LKCA 2PZFA 5JAZA 5KREA 2H7VA 1KH1A 5D1HA 3T7DA 5E3JA 4WPGA 1ADCA 4ZEXA 3MMXA 4P84A 1X7DA 1Y6JA 1J49A 1L7OA 3LK6A 3JQ9C 3E5HA 1OAAA 3MF4A 4JVNA 4X41A 1SQFA 1JLRA 1G60A 1T5SA 2XB8A 1UK7A 1W94A 5PNTA 3GLQA 3RI3A 1AHPA 1U2QA 2VYFA 1DBRA 2BY4A 1E3LA 1NG1A 1XVTA 2QM7A 3WL7A 1H05A 4QAJA 3ANSA 4A0SA 2BKLA 2YMLA 3M9WA 1J9GA 2H7CA 1JHOA 1LDBA 3R0XA 1MENA 1BU5A 4IHJF 5CAEB 3ZQKA 4DC9A 3C3MA 3B1YA 3JAKB 4GIBA 5EIFA 4O1MA 3MUOA 5COQA 3K6SB 4RW0A 3CPHA 4JQSA 2BHTA 2R6JA 4V2UA 1HT3A 3M1YA 2PGXA 5BSMA 5I45A 1X1AA 2B92A 1VE5A 1Z12A 4OJTA 1G6Q1 1XQ9A 1V47A 2BMAA 2HLDD 3NKVA 3HZHA 2GRJA 5HUHA 3N39C 4EUEA 4XOIA 4L4ZA 2VWHA 1D2EA 3EIEA 1KVUA 1ABEA 4BO1A 3ANNA 1R6BX 3O84A 4N8DA 2DWUA 3OPVA 4A2PA 4CU2A 4W5OA 4CG1A 4D9CA 4GBJA 1CR0A 2A1TS 4KIJA 4PO1A 4QDUA 4QQRA 4R2MA 2QHXA 2XE7A 2QUIA 1THGA 2ZRDA 3DYBA 4QATA 4B4VA 3WBKA 4OUDB 4MVJD 4U02A 5K3FA 3ZD9A 3O74A 1RWBA 4XB1A 4ZPJA 2VUSA 3O3CA 3JR7A 1DI0A 1MNAA 3C3KA 1ZJ5A 1CHDA 2ZWVA 4NEGA 2NG1A 1E63A 4B3RB 1S1CA 1HF3A 2BFEB 2IF2A 3R3ZA 4E1AA 4LGMA 3PT9A 3VHQA 2FCRA 1KK2A 1EXNA 1GWNA 4WFKA 2CFRA 4CRWB 1CDEA 1M0EA 3DFFA 4R1TA 4WLNA 3REFA 2GCGA 1T26A 3B8EA 2RB5A 3W7AA 5JMOA 1WB5A 5B36A 3ES9A 4GRDA 4MW6A 4OJKA 1E6LA 1Q7BA 4BVKA 1O57A 4QYTA 3WNDA 1IHDA 1GSAA 1EK5A 2Y1XA 1JJIA 3B78A 4KVGA 5D3MA 4LF6B 4YA6A 2GYWA 4UVGA 2N47A 1EBUA 2XMQA 3EFBA 1N6LA 5B4VA 4LX8A 4MUFA 3C3BA 1FTNA 4MRMA 1YS2X 3OT1A 521PA 5LDGA 3WQQA 4N6NA 3HLYA 1GQFA 2ZOSA 3HLKA 2BEJA 4MKRA 4RHXA 4C03A 1BRTA 4WZBB 5ALNA 1GU7A 4Q9KA 3A3KA 3NAZA 4A82A 1XNHA 2N3ZA 2QMUA 2C5SA 2JDID 4JUFA 4PLWA 4LKOA 1RU3A 4BN4A 3AI3A 2C7GA 4JWTA 2CXOA 4YHBA 5KPJA 1Z38A 2O7NA 3BCHA 2NX2A 2AZTA 2WJGA 2P79A 2ZAYA 1XEAA 4QSHA 1F8YA 1T2DA 3FMVA 3BWVA 3CONA 4BO7A 1A50B 1FSFA 3HCFA 5IDQA 1RHKA 3QUBA 3Q87B 1YB6A 2WJPA 1ZN8A 1CS4C 5KNBD 5JSFA 4OFXA 4QPJC 4GI1A 1KS9A 4PZZA 3G0BA 5FNVA 4D26A 4H7KA 4TS3A 2QRVB 3Q1LA 2GX6A 2I71A 4IHKA 4NL4H 4BEJA 5C9ZA 1NUHA 3C3CA 3IAAA 3MXTA 4RVCA 4D9KA 3KV1A 3FTFA 3O2SB 1FZTA 4IMPA 4X0EA 1ENZA 2AOVA 3BE5A 1KZ1A 1IJEA 1L8XA 1NSFA 1QK3A 2Y1FA 3CO0S 3LUHA 3PRHA 3QRWA 4H9GA 4YBRA 5EVJA 1L5HA 4B3JA 5AW2A 3CKKA 4GWGA 4EVIA 1YQQA 4YRIA 3MRVA 4U2CA 4JYCA 3FOFC 8GPBA 1V7PC 5J4HA 1L4YA 1V8ZA 3N6XA 1JFRA 1D5CA 2ID7A 4DA6A 4HX5A 4EJSC 5FX2A 1FDUA 3UJ8A 3ZWKA 5J9FA 3CUTA 3K6SA 4A26A 1LTQA 2LDBA 5JNTA 3DLBA 3HJTA 4XM1A 4EW3A 2I1WA 4OK6A 4RZIA 4AJOA 4FN4A 4Q02A 3MHTA 3VU9A 3W2TA 4H17A 5AHOA 1VSTA 1H1LB 2X3FA 4R8MA 4JI3B 2CUKA 1B3BA 1DSSG 2W83A 4I6EA 1KO1A 5AVXA 1MA3A 4DIMA 1OA0A 5AXBA 1J70A 2EFCB 3P4UA 4IF4A 1IHOA 1VCNA 2FPSA 3KSMA 3OCCA 3IRUA 4V0SA 1JI3A 3SFVA 3TOVA 5LD2B 3O9ZA 2FI1A 4MP6A 4HSGA 1NURA 3IEPA 5JJIA 4Y6GB 3IAS6 4YJHA 3KFVA 2B8JA 2A1IA 4WNAB 1NP7A 2YZ2A 3ZDBA 4WFIA 1DAKA 3NH9A 1AQ6A 1PQ4A 4JJKA 4Y0NA 3QPBA 3U7IA 1QR6A 5H9WA 5LQRA 2AZ4A 1LW6E 1AKYA 2UZIR 3BE8A 3T15A 2PJUA 2ZG6A 1YRQA 3EUAA 4O4HF 4M98A 3AKCA 4H6VA 2OD9A 3OHPA 2KE5A 4UM5A 3G82C 5D1NA 1R6TA 5KSYA 3T7TA 4FONA 4I81A 2AN4A 1N5DA 4JR0A 4Z9XA 2O3SA 1D4FA 1JFFB 2UVPB 4DIFA 3CH5A 2RGYA 3MSXA 1J99A 4MV4A 1K6XA 3A1VA 2QP9X 3V6LA 5C4MA 2G17A 5E7QA 1N2CA 4GLJA 4YRGA 1SVNA 1A9YA 3TZKA 3VAYA 3UGJA 3RT1A 1U2GA 2OBMA 4MGZR 1UKAA 1Q21A 1G2OA 3L0DA 4DV3B 4OEHA 2RI1A 4MS3B 1Z26A 4IKEA 1JLHA 4G2TA 1DAFA 5K0ZA 5LMNB 3UW3A 5CEFA 4JV5B 5FPYA 4GOMD 2DQKA 1RXUA 2LBPA 2YJ3A 4L28A 3A9RA 3IX7A 4JQZA 5DCLA 2QNBA 5ALJA 5G3YA 4AWXA 1VHLA 3OTQA 4ZT7A 1P0CA 3KXKA 5KHAA 2G7ZA 3M49A 1C1XA 4W8OA 3OIVA 2PRIA 1C0LA 2J9RA 1F3LA 2AG8A 1RT9A 3VR3A 5KEIA 1Z0AA 1N2BA 1OQAA 4TLDA 5DYIA 1I80A 4UVIA 1JAZA 2WIDA 2GYYA 1LS6A 1A9RA 2OGUA 1U2TA 3GJQA 1NR1A 2QX4A 3DXZA 1Y6ZA 3LBAA 1A8HA 1LRLA 2JFWA 2P5TB 4HN2A 2W5UA 1IQUA 2QJFA 4EHNA 4MDYA 4YJGB 3NIDB 5PGMA 4EHJA 5BMOA 2AW3A 3OQPA 5CLJA 3EHDA 3TEFA 4CHGA 1K2WA 3KJQA 3W9SA 2Q9BA 1BHJA 4KLAA 2P1RA 1FYDA 2VJMB 2W8ZA 4BZXA 4F9EA 1SBNE 2YRFA 5HDBB 3HP1A 3DV0A 4PW0A 4QRHA 4J03A 4AJ9A 1LV7A 3UAZA 1E98A 4XWTA 1I1OA 3MHPA 2WEKA 1D3AA 3OIUA 3ZXXA 4B3GA 2O5EA 1ZIPA 1RZUA 1PG5A 1Z68A 3D0RA 1EK2A 3GX1A 2OORC 1LSUA 2CEAA 4IXMA 5DIFA 1Q7TA 2QMOA 5DP2A 5FOWA 3SM9A 4W7SA 2UZ1A 3TRJA 1QIIA 3K0FA 1ZESA 4F46A 2YFKA 3FH0A 3EF1A 3U7QB 1M5RA 1YDMA 3EXG1 4OSOA 2OOSA 2D2EA 3AV3A 3HCRA 4NBSA 3LQ1A 4RDHA 4BNTA 3I83A 2FUG1 2ZTSA 3TW8B 1T5LA 1W1WA 4EW2A 3QPVA 3QFTA 4KR9A 3ONVA 2HBZA 1GPH1 5B3KA 3ZWMA 3SZLA 1I14A 4KNWA 4MVJP 3UPDA 4XM2A 4JU9A 2IOFA 2I91A 5A02A 1CSEE 4RY9A 3WSTA 1YUMA 3K0CA 2Q62A 2P69A 3H1FA 3TD2A 4AJNA 5F3DA 5DK6A 3F5DA 5I5GA 2QTGA 2FPPB 4K26A 5HJ2A 4TTAA 1Y9EA 1JPNA 2W43A 3CZ9A 4B44A 3AP1A 2YYSA 4X62B 4AULA 3OKFA 2FZGA 1SG6A 5LDDC 3PUHA 3IBCA 1HT1E 1RJ9B 2Q4DA 4FFPA 4LXQA 4PO9A 4YQFA 1O6CA 1BVHA 3ZIAA 1QBGA 5BSUA 4J4BA 4KI7A 4L72A 4DNPA 5C8YF 3RUFA 1R88A 1GXSB 2P7IA 2QTLA 5JXGA 3KAQA 2HPHA 4ZVOA 2D00A 2P67A 2VP3A 3HU5A 3BIXA 4MGHA 4BMNA 1WBJB 4Z4QA 3DDZX 3W4JA 4XD2A 2D5IA 1GSIA 4KSYA 3PHIA 2KYRA 2B5VA 4BNYA 3F96A 4OXXA 1SN7A 1KOLA 4OXKA 4Y7CA 1N2GA 2FFAA 1KQNA 2WJ6A 1W19A 1HTBA 2AJ8A 1EP9A 4JBLA 2IX9A 1AKEA 1E7WA 3BXFA 4RM2A 2JHPA 2P11A 3G17A 4PX3A 1KP2A 3PDIB 3UMGA 1R4AA 4EG7A 4PY2A 1EM6A 5G02A 3UB4A 2E55A 4L9WA 2WSLA 3BXXA 5HTOA 5FBQB 5BVGA 3ZC3A 1G59A 3BXZA 4QGSA 3ICOA 3SIXA 4LSGA 1RLOA 1O9BA 4HGPA 3JVEA 1FX1A 2MU1A 3QVVA 1J39A 2MHCA 2CD7A 3SJCA 3B51X 1QQ7A 5FV7A 5BSWA 4GSYA 1JFLA 3KOUA 3M83A 2D59A 4BIIA 2QPLA 1GGFA 2EYQA 3N1UA 4K9OA 4NG5A 3LWNA 4B43A 2GWRA 4CJXA 1VL6A 2J5KA 4NC9A 1J24A 2JIZA 3A0RB 3EZXA 4PLGA 3K2IA 2R6DA 3R9XB 3THRA 4JYBA 1E3DA 2XTNA 1GKUB 1R50A 4ED9A 5FULA 3ASVA 1DEOA 3FYHA 3CVUA 4Z3OA 1JFVA 4TV8F 3ITKA 3MWYW 3EQ7A 1L1QA 1PS8A 3QXHA 1X94A 4NBTA 3NT4A 1ECPA 1Z0ZA 2ROQA 4OPMA 2AVDA 4JC8A 5CBKA 3MM4A 2V0NA 4BATA 1P7CA 1E7SA 2LPMA 3MINB 1R0KA 1XK7A 3ZHZA 4EG5A 1N1MA 3IA2A 3QEAZ 2JHCA 1RMQA 4A16A 1TU4A 3SYRA 5HFJA 5BRAA 1U2SA 2EFYA 4RMHA 4F1KA 2ZS7A 4UBKA 5DBFA 4HZUB 4TMVA 3VR6A 4LE0A 1P4SA 5C53B 2AUTA 3QU7A 3LOPA 4RYDA 5JAPA 2VN8A 4JMPA 2OGTA 4I4NA 3RUHA 4W9NA 4W5NA 2ZAGA 1R66A 4HDMA 1DVRA 1LVHA 1XDDA 1CIPA 3MUNA 3BSYA 4X8OA 3UWDA 1SHJA 1YOVB 3R20A 4D4LA 2NU7A 3GRRA 5TGTA 5HZGA 4F2PA 4BX3A 3RYIB 2ZKLA 3ZWVA 4MAMA 4EENA 1JPVA 1BOOA 3PNBA 5TMBA 1TM2A 1Y5LA 4M1SA 4PYJA 4I9HA 1EVQA 3WBBA 4D82A 3C3AA 4N7MA 3EDQA 1DPFA 2YYYA 2Z5GA 5E2AA 1VFNA 2NVOA 2ODTX 1U3VA 3EFOA 4HMPA 4YJ3B 5EG5A 3OQ6A 3FDFA 4MA5A 4CI0B 4Q9NA 1MDBA 3RTAA 1G0OA 5LBTA 5TLSA 3BSWA 2EEZA 1SEPA 2HUNA 2V9PA 2OORA 3QMWA 1ZUNA 4MDEA 1L7QA 4E14A 4INJA 3GEEA 4D41A 5A5FA 2QI9C 1YRHA 3DH0A 1SBCA 2DSTA 2IEYA 4WOKA 2H5LA 1DQNA 2NZYA 5C18A 1KJWA 4Q9HA 1QKKA 2V7PA 3ZPXA 3IMFA 2OB1A 3CNNA 3WMGA 2OE2A 4KL8S 3UMJA 4BNHA 4BV3A 3BXOA 1EQ2A 1SC6A 1JR2A 4WNCA 1BQEA 1VG0B 4Y2PA 2B94A 5FOQA 3TLZA 2CCKA 4HQKA 5IVHA 3FI9A 2MYNA 1II8A 3KOXA 2VYVD 4K5QA 2HSJA 3D59A 3OWXA 3KQNA 5LD2C 1KRXA 4C89A 4S1OA 5L3QB 2R6ZA 3NDBB 3O82A 1ZRNA 4FHDA 2YWDA 1IPEA 5CITA 4JHXA 1VP3A 2ZROA 1UDWA 4Y0VA 2Y66A 3NALA 3UUFA 1V26A 3X2EA 3GA7A 1Y3BE 1U6IA 2ESRA 3DLPX 3FETA 5BQ5A 4ETMA 4IQ4A 2WU0A 4WI1A 3PPXA 4WACA 1DG1G 4NDAA 3AB3A 5KOJB 1ADFA 3Q0TA 3SKVA 4G1EB 3ZDZB 4K0RA 1SUBA 2QENA 2ZU6A 3Q85A 4OKSA 3VMMA 4JLUA 2WOOA 5F9FA 4BFYA 3J81A 1ONOA 3D8NA 5GJBA 3MS7A 2PS0A 4Q16A 1VKJA 5DMXA 2XTAA 5HK9A 5CA1A 1XELA 5AW1A 1OY1A 4HGRA 3AMVA 1U8EA 5BSFA 1B42A 2G9QA 3ZOKA 2Z56A 3BRSA 3ELWA 4FGSA 4F4IA 2WZQA 2GDZA 2R4UA 4G56A 4DREA 1LBHA 2GEKA 1TGVA 1BQ4A 5E7MA 3H3XA 4LTMA 4KV9A 4EFMA 3CF4A 1MOPA 1BROA 2GPSA 2Q6LA 3PDIA 4NONA 2GXAA 1FP4B 1RPZA 4PXAA 5ESXA 2WUVA 4QSMA 2OUIA 2HC9A 5DWQA 2XZTA 1F8UA 1ZY2A 2V4ZA 1VMAA 3D7LA 5MHTA 4JUAA 1N7JA 4CL3A 4NH0A 1JDUA 3LKVA 3TZLA 1IL0A 1B2LA 3OH8A 2B35A 1GGVA 4IDCA 2W6ID 1JX6A 5GTDA 3M6FA 3PYMA 4Q9DA 4F7WA 1HFWA 3F97A 3RYHB 2N1MA 2GZSA 2VCEA 2D0OB 2FPLA 1ZCBA 1LEHA 1GNLA 1TJ5A 3L5OA 5MDHA 3IJ5A 5CXQA 3ZQUA 3AR5A 4HRXA 2GHRA 1ABBA 5JNVA 3A6HA 4FT2A 3UA3A 1QMPA 5A04A 5HKKA 4PTYA 2J0UA 4TUYA 2BMWA 3VOAA 2EV9A 1T13A 3QGMA 4FGWA 4OOEA 5KNBA 2CXUA 1XE3A 4EITA 2WJYA 2GN4A 2PBZA 5E6RB 1G8HA 4OXNA 1N2JA 5G1NA 4AM8A 3H0EA 8ATCA 3NM5A 4XEUA 3CM0A 4V3CA 3D2LA 3CF6R 5EIWA 4M7WA 3T12A 5K8LA 2P9GA 2AMLA 3EQ2A 1QRSA 4JLSA 5KCZA 1JHDA 2A4KA 2IVZA 3ACDA 3CN9A 4Q66C 2W4QA 3WRYA 4E0BA 3T3NA 1EU1A 1XZIA 2HF9A 5C52B 3S2YA 1HE3A 2IP1A 3FTNA 5HMMA 5EJ6A 3EA4A 3CUWA 4I8DA 1VBFA 1Q2XA 4KXUA 2NTYC 3VPFA 1ETUA 1Z39A 2RK3A 5ES3A 3FDZB 1ZO8A 4P54A 4R5HA 3GFVA 1K63A 2VG8A 3OQBA 4E08A 3FXAA 1E62A 2EFEB 1LBQA 4GMDA 3UCFA 5HIKA 3JASA 4TTTS 3I5XA 4BO4A 2EX0A 1Z6AA 1HRDA 3O4HA 1U5BB 1Z73A 3HK2A 4AICA 3AUXA 4LHXA 5DOVA 2AXQA 4WL0A 3ZGZA 3SN6A 3U4DA 1U0JA 3DV0B 1GZUA 1SVMA 2P6PA 3OCXA 3ABOB 3E9DA 3GO4A 4KAAA 5KNLA 1D1TA 2JFFA 3OJOA 1XWFA 1IN6A 2OG2A 2I33A 4D3SA 3QF4A 1KI3A 2ZR0A 4YJGA 2GTIA 3MAGA 4YMGA 4QOGA 3A6KA 1F4LA 2QE7D 3HVRA 1N34B 2ECPA 4YTEA 4DLLA 1A9XB 1M2WA 1A7KA 2R84A 2H5IA 4B87A 2JVJA 3D6TB 5KTMA 5JQGA 1XZEA 2DR0A 3ETDA 3G2KA 1GCAA 1USVA 1A88A 3EWNA 4IIJB 4NAUA 1FSZA 2ZYSA 4M86A 4ZHQA 2PS3A 4WT7A 4QPCA 3GVXA 3R75A 2ANBA 1MO4A 2G76A 5EYPB 2QU8A 3THYB 3CR8A 4IJQA 1HNXB 4X97A 3GYGA 1ZVJA 1P80A 3DUWA 3JVDA 4FHFA 2BHNA 1NF2A 2K4MA 4H18A 2ZJ2A 5ALWA 4LYAA 1TF7A 2ONZA 3RIYA 2GEUA 2NVUA 4G36A 6REQB 1NUSA 1NZJA 2ZTHA 1U0TA 4A4DA 1UOQA 1GRQA 2IHZA 2M98A 3ZVRA 5CFNA 1V9SA 1XLWA 4TKUA 3SHTA 4OHMA 4DCVA 2BTQB 3PC2A 5DGDA 4ERXA 2RGXA 3I9NA 1N33B 3G2HA 4URHA 3WNQA 4I1SA 4NK5A 3AF1A 4TV8B 2ZW9A 1K97A 3CLSC 1K2VN 1QK5A 1KARA 4W7HA 5JD6A 2MSEB 2JIBA 4ZTUB 4EX7A 1K4KA 2RC6A 2QZJA 3O31A 4H1TA 5KSZA 3ZY2A 1C9EA 1VIAA 1A8IA 2X0NA 2HPVA 3MCZA 1COZA 1HUQA 3OQ1A 4B7ZA 5LBUA 1NBIA 4UCXA 4Y7DA 3CUYA 1LV8A 2B20A 3L8DA 4YJHB 3ZV6A 2QRLA 4C7XA 4LV5B 4YDHB 2Q0XA 4RWEA 4AZTA 1BFKA 2GZDA 3JAWA 3L1IA 4QYSA 3T9AA 3C6YA 4BRWA 2MR5A 1FVXA 4B47A 4BE7B 4UTPA 1V1JA 4HAUA 1IH8A 1T0PA 3H11B 2PKQP 4G09A 1MJFA 2P6NA 2ZRGA 3TG2A 1M33A 3DYVA 3P9NA 2ZM5A 1Q57A 5CLGA 3MWDA 4Z9AA 2PUTA 1KJYA 5DTRA 1AKRA 3N7TA 2YWXA 4O8ZA 4QFMA 5BXYA 721PA 1RRPA 2RGGA 4KX3A 3WRXC 3ZKWB 5AI6A 4JCOA 3I4LA 4NENA 3WE7A 1RMYA 3DDNA 4F3TA 3Q3CA 1IULA 3LDFA 2X8JB 4BQRA 1ZHHA 1MDFA 1NXWA 1ZVMA 2GBLA 2JJ8A 2WUDA 4RBNA 1NPTO 3GPBA 3IAEA 1Y7LA 4TV9A 3OJLA 4ZAFA 5G1OA 9ATCA 3K8OE 2YUTA 2OT3B 3A70A 3NCTA 4RV4A 4UUAA 3VSBA 1J8VA 2XUHA 2DBZA 2FSHA 3B6KA 1FW8A 4FIZA 4DRYA 4F12A 5FWYA 1NW5A 2NPOA 2DJ5A 2ZT6A 3DSRA 4OQFA 4UQPA 3SMVA 2OFFA 2VP6A 4TGLA 1EGAA 5KOHB 4O08A 1GPYA 2XD9A 5KQGA 1UKZA 1X9GA 4HBZA 1N5IA 2HK6A 2I2DA 5GAJA 4EQ6B 2ECKA 3B1KA 2ZE8A 4Z2YA 4DYHA 1W4LA 2G36A 4PXYA 1M1YA 1DIAA 3CGWA 4LWPA 3SHFA 1IWOA 3V4FA 1A2BA 5JYEA 3CVJA 3L8HA 2CVZA 3AHEA 4PGAA 2OHJA 3AHFA 3QNUA 1JQEA 1R0CA 1GLNA 2XYGA 2DR2A 1HE8B 1QZ3A 1ZVQA 1KI7A 3UKOA 2VUIB 1Y8QB 1ONSA 4XWYA 4BPRA 4LC1A 3H11A 5ALZA 4KR2A 3H16A 3H9BA 3BRWA 1KXJA 4V39A 4DSZA 4FZVA 4QT4A 3IQXA 1AZWA 3ZDRA 4Q34A 3PDUA 5TPZD 1L5KA 1NBME 3AR8A 2LRHA 4WZBA 2FFRA 4KXMA 2DY1A 1JLSA 1XEXB 2QTVA 2IYRA 1B4DA 1QBKC 5LM3A 5M34A 2YV5A 4AKIA 4OXQA 2P9ZA 5DZSA 4YAWA 2W6PA 4R40A 2IYSA 1UBMS 4B3IA 3SVTA 2Z2IA 4U39A 2IPAB 3OE5A 1TUIA 1DX6A 3ZV4A 2E4YA 1D8TA 4OFWA 1XO1A 3T9BA 3JQGA 1BC5A 4EQZA 4O33A 1NFRA 4L0CA 3RKUA 2LIPA 3MWFA 2WTXA 4M1YA 3O3NB 2CVHA 1VSUA 3CX6A 3D7SA 5DM2A 4CQMB 4E6PA 2H2DA 4M9SA 3P27A 4MKIA 5FYQA 2IE0A 2BTQA 1Z33A 3UAYA 1I2BA 5DXJA 4QDXA 2XCUA 3TL2A 2QLLA 1UFQA 1CW2B 4FMPA 2WK1A 4KXLA 4NE9A 3I6ZA 1NXQA 1I9GA 4D4GA 3JQAA 5B2FA 4QOEA 4IDOA 2HWKA 4RSGA 2I7TA 1P44A 3WLEA 1DIHA 1Z7BA 3WYAA 4CQJA 4ZI5A 4UMEA 1LI4A 4CFYA 2FQQA 3PZBA 1IY9A 2FWRA 4AXBA 1GUAA 1CY0A 5TF4A 3RJTA 4EHIA 1Z0SA 5DHSA 3VR6H 1P8AA 3GMIA 4ZCIA 4W5JA 2CVPA 1DINA 2C2YA 4MV3A 1JR4A 4RV5A 5K8UA 1Y37A 1PFQA 1QNLA 2GAAA 5K3AA 4CM3A 5JQGB 4D79A 2HXGA 5TT1A 1NC1A 4X44A 4PGFA 4GPBA 1P9WA 3LL4A 1ACLA 2O8BA 2HDHA 2GPBA 3PR3A 5AW6A 2C9BA 2C2WA 2RAVA 4Q4AB 1G19A 4D3XA 5IJWA 3DXFA 3RHSA 3RT9A 2W42A 3KOMA 1IHUA 2R1UA 3KFLA 1YH3A 5CDSA 2WUGA 4BUZA 3GVIA 2VXCA 5LWHA 3B13B 4DQXA 2VSXA 1RQ7A 3GLIB 2WE8A 5T4EA 5HM8A 2CK3A 2C31A 4Z6KA 2ZJ5A 1MRZA 3U40A 3LUGA 3ETJA 3ZE9A 2UUBB 3O92A 3SSAA 5CNKA 1JR3E 1U9IC 1ZBDA 3A7EA 4U2BA 4MVJM 3SXUB 2Q1SA 4GMGA 3K09C 4CFSA 3HA3A 1SOAA 1P18A 1Z6XA 1S3FA 1U0FA 1N9GB 1T3TA 1JYEA 1ZRSA 3RRZA 4YCCA 5K4HA 1AUOA 1RXEA 1TLTA 1P7YA 3IULA 1PR6A 2EJWA 2I65A 1R0XA 3EGEA 3HKBA 3OFND 4RLFA 4TMYA 3UOAB 1EDEA 2CVOA 4GE0A 1Y4ZA 3VSAA 2P5SA 1EFDN 2QTZA 1S4MA 2H2GA 2VHXA 5J40A 3U3XA 2FQXA 3W5IA 2GILA 2WVJA 5HWSA 3PR2B 3H86A 2WKQA 5EJ7A 3ZNNA 3KT0A 1PZFA 3ENNA 5ILQA 2IS2A 1WG8A 4E09A 1CB7A 4JA2A 4QGGA 3I45A 3MIZA 3N2IA 4YDQA 3ZTTA 1F1JA 2PUEA 4IWYA 3FYUA 3ZCRA 1EE9A 1KJIA 3LXXA 2YZMA 3W7VA 5CPBA 5CXXA 1TJYA 4KQFA 1O58A 4N0MA 2YHSA 5K2MA 3L1VA 1WSDA 2Y0DA 4L4SA 3S2SA 1KY4A 5JV5A 4JT2A 5EIHA 2FU5C 3AVWA 1GNRA 2NVWA 4ARCA 3LGSA 4MMYB 2EZ4A 1NE2A 1FPMA 2H1LA 3RVBA 4KFRA 4TVOA 1K6MA 4X1YA 4ZOBA 1C1HA 5HGXA 5DF1A 3RSSA 4AURA 4D1YA 3T3DA 5BQXA 1ITZA 1GCIA 2DSNA 2Y1DA 3V8RA 4DTIA 1AMOA 2RGEA 4WLUA 2I2CA 3WJ7A 4AI6A 3IMGA 1WMDA 4QUHA 4G25A 2GRUA 3U6BA 2JLSA 1X19A 5LZ4A 3AESB 2VTBB 4QYIB 4KR3A 1Y8CA 3AR4A 2ZB2A 1VG9B 2PUHA 4KB5A 1JXMA 1YC5A 4HXFB 4Z0HO 3AIOA 1GTSA 4I08A 1BWRA 3FUXA 3HCNA 2XOKA 3I6QA 1NN1A 1L8QA 1OH5A 1LH0A 4EK9A 1XDUA 3RFUA 3EFEA 2WYVA 4QQFA 1RXIA 4R1OA 4BLVA 5HM6A 5HF8A 2IU4A 4U8GA 4ZARA 2AN9A 5HKOA 1XCOA 3T5AA 1VHJA 1UBKS 5FWNA 1MC4A 3HMKA 4QL3A 5AH0A 2E85A 3CWZA 3PUJA 4IILA 1YRBA 1Y4DE 2TECE 2YIDA 2C94A 1Q0HA 4LXHA 1XQ6A 2FY8A 3F6EX 3OQHA 5JW6A 3HCEA 4AMUA 1OFIA 3KX2A 4RXUA 2UUAB 3R8FA 2Z2KA 4GP6A 2UZ0A 4E21A 1I4LD 3QE0A 4MROA 1AURA 4YN3A 4D9MA 3FHCB 1Q44A 2WJIA 1ZQ9A 1FEZA 1XPOA 4K28A 1KMCA 2Z5FA 3ELDA 1C2TA 2WT8A 3OOWA 3VH4A 1PD1A 2BKXA 3WMEA 4BNUA 4CIDA 4FB5A 2HDWA 4KGXA 1PQWA 2ZK7A 1VKHA 2OYSA 2G09A 5JCJA 2N75A 3INRA 4ALLA 3WTBA 3E05A 4EZBA 3K05A 3OOHA 3P2YA 4JGBA 4NMHA 5AI8A 1D4ZA 3IPAA 3M8KA 5H59A 5TS2A 1GA1A 1K92A 1OE0A 2IEBA 1VKZA 2SKDA 4HDRA 4QRIA 1LPBB 1WY5A 2FW1A 4C0XA 3PKJA 5BSGA 4QLOA 2CMKA 1B23P 2WAMA 1LBTA 3G59A 3KYDA 3V7FA 3KJXA 2C4TA 4EPYA 2FZCA 4NCHA 3VC7A 2Z1DA 2HH9A 3CCCA 2DLNA 2H8GA 3NT5A 3A2KA 2Q8PA 5CIQA 1K6JA 1R8XA 2C07A 1ZOLA 4D02A 1WVMA 4EGFA 3E58A 4MYUA 4HVCA 4U7JA 4X8HA 2XDAA 1Y33E 4HRAA 2XAUA