3V1KA

Crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400.
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
285
structure length
285
Chain Sequence
TALTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGQWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of an Acyl-Enzyme Intermediate in a meta-Cleavage Product Hydrolase Reveals the Versatility of the Catalytic Triad.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 104
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v1kA00
4B9AA 5HFAA 1LPBB 1QIMA 1GQSA 4MQLA 4N5HX 1XZGA 3E3AA 4QA9A 1TK3A 1BRTA 4BVJA 5AKZA 4GW3A 5AOAA 3W9BA 3BJRA 3ILSA 1CUUA 1D07A 3D4LA 1UK9A 4C4YA 1FJ2A 1J06A 4ZI5A 4BE4A 5E4YA 1MTZA 3G9TA 4DMHA 4RNCA 1KU0A 5LKAA 3QPDA 3IDAA 4H7JA 4TGLA 5D7BA 3FCYA 3S8YA 4U2EA 4ETWA 2RI6A 3U1TA 1BCSA 2PU7A 3WJ2A 3WWCA 1TAHA 3U0VA 5I7UA 3BF7A 4QDZA 1BROA 5AM1A 4UHEA 1OXMA 5AOCA 3IIIA 1YR2A 1SCKA 3AZPA 5ALLA 1Y7HA 3D2CA 2C0QA 3W9UA 1H2ZA 3IURA 2PKYX 1AURA 2WG1A 4JH0A 4GWLA 1E89A 2Y6UA 5AH0A 3DKKA 1MAAA 2JGJA 1ETHA 4X85A 4XVCA 5AK5A 2O7VA 1IUOA 1FFCA 2K2QB 2WM2A 2XB6A 1UKBA 3D59A 4W1PA 2WUDA 3EF3A 3O4JA 1XZHA 2Y6VA 2H1IA 1R9MA 1P0IA 2XMBA 3K2IA 1EI9A 2PVSA 4CG1A 1PFQA 1CUIA 4N8SA 4FWBA 4X7BA 4X94A 4GEGA 1IVYA 5DLPA 2PSDA 3CXUA 3ZWQA 4ZRDA 1JKMA 1ZGBA 4UBLA 3UUEA 4MYSA 3STYA 5CMLA 3BDVA 4X92A 5YASA 4U2CA 5ESRA 1W6RA 3WK7A 1F8UA 2PUJA 4DSZA 3GA7A 4MWSA 3S2ZA 2JGIA 3OOSA 2CMFA 1MAHA 2WQZA 4WY5A 4J0HA 2WUGA 4AX4A 3D7RA 4UBIA 2QS9A 1E8NA 1CUVA 4H18A 4WDRA 3AILA 1USWA 4Q82A 4LXHA 4KAAA 4BCCA 4RPCA 3R41A 1CUFA 4OSEA 2ZJ6A 5HFNA 5DYYA 2XMQA 1CUYA 1N5MA 1YAHA 3H0CA 3EQ7A 3H04A 2WFLA 3PF9A 1K8QA 2DFPA 4MXDA 2H7XA 4EUSA 1XLUA 4PNZA 3R40A 3FSGA 5AKHA 4HAIA 2AJDA 4OPMA 1P0MA 5ALMA 2WJ3A 3D3NA 3X3HA 1XRMA 3FYTA 4Y2YA 3L1JA 4P9NA 4KRYA 1XZEA 3L1IA 4INZA 3QM1A 5ALIA 1SFRA 5CH5A 2RONA 2ECFA 3WIOA 1WOMA 1LGYA 1EHYA 1TCBA 3OPMA 2C7BA 5A7FA 1VJ5A 3HZOA 5EI5A 1NU6A 2BUCA 4NZZA 2VSQA 5HF9A 5FLKA 2X8BA 2XI4A 1MNQA 2B61A 1EB9A 2QTBA 5AKJA 3WZMA 3BWXA 4BCBA 3NOXA 1ZIYA 2XE4A 1T2NA 4QDUA 1YB6A 2XMSA 4XIIA 3VJMA 3O0DA 4CG2A 4ZV9A 3GFFA 2P8SA 4EA6A 5A7HA 2WFMA 4DMKA 3JWEA 4GI1A 4G8DA 4FLFA 1P0QA 4NS4A 3A6ZA 2OQIA 2WHPA 2QT9A 5AP9A 5LP1A 3K9BA 1GKKA 1QZ3A 2WTNA 3EBLA 1H23A 4QLAA 3AZQA 1VXOA 1CQWA 1MX9A 1FSSA 4I19A 2WHRA 2PUHA 2PSFA 1GXSA 3WA7A 1UKAA 2XT0A 4OD0A 4G8CA 3BIWA 5AIBA 4PSDA 5AIAA 3HYSA 1DTEA 2C0PA 5EIHA 1XROA 3KXPA 4OU4A 2BGRA 1DX4A 2OGTA 3WLAA 1JJIA 2XUKA 2GZSA 1ODTC 3DKRA 3FWHA 4GXNA 2RHTA 1HKHA 3ZPXA 4ROTA 1QIJA 4UHDA 1XFDA 2ES4A 3C87A 3BIXA 3G0CA 5CT9A 2VA9A 3A70A 2CUTA 3G9UA 3PF8A 1VE7A 3STXA 4Y2UA 1EVQA 1LBTA 2C5GA 4LHEA 4H7KA 4DNFA 1F0PA 1CEXA 1VA4A 4QZVA 1R50A 4OYLA 2XUIA 4KAFA 1E66A 1JU3A 1BN6A 2QVBA 3I2IA 1QJ4A 2ZJ7A 3FCXA 2PSJA 2ZYHA 1TKRA 4EBBA 2W6CX 4X6XA 4G4GA 4BAZA 4CI9A 3ED1A 4IO0A 4P08A 4KEAA 1EINA 1CUZA 1DT3A 4MYDA 2XUPA 2GBFA 5HQ3B 1UFOA 5JAOA 2G5PA 1E5TA 3R3ZA 2CB9A 1CV2A 3LLCA 2OAGA 1LZLA 1XQVA 2I3DA 3G9ZA 3DYIA 3WKAA 1H2YA 1A8QA 4DMCA 4MEAA 1CFJA 3E0XA 3H1AA 2HA4A 1LNSA 1UZAA 3KWJA 5ISMA 3WK4A 4ARBA 5FKJA 1Q0ZA 1YA8A 2XMGA 2Z8XA 3ANTA 2WTMA 3TEJA 5I9IA 2CKMA 2D0DA 3STTA 3OM8A 1XQYA 2GYUA 2WIKA 5JAUA 4B7ZA 5JZSA 3HXKA 4FDMA 4KE6A 2VATA 2ZSIA 2LIPA 4J3JA 4G4JA 1T4MA 3CN7A 3VJLA 2BFNA 1VA5A 3E1GA 3FYUB 1ZICA 4TVKA 1CVLA 5SYMA 4XWGA 3VDXA 3OURA 5FRDA 5KBYA 3I2HA 3C6YA 2NW6A 4M0MA 1K63A 4WCVA 2WJ4A 3I1YA 1AUOA 1KEZA 1U2EA 5ALWA 1K5PA 2AJBA 2QMQA 5AICA 5AKGA 2XUJA 4K6KA 3G0GA 3EQ9A 1AC5A 2HRQA 3SX4A 2GYWA 5AI8A 4YX9A 1DQZA 3LIPA 2XMRA 1XZLA 3KWFA 3VVLA 3IUNA 5EHZA 5JANA 2W22A 4OYYA 1TCCA 3QVMA 5DNWA 2JIDA 1JMYA 3LIIA 1EXWA 1R9NA 4DLNA 1RP1A 1ZI9A 1LPNA 4B0PA 3H2HA 3GZJA 1CUWA 3WWDA 4B83A 5E4JA 2IIVA 2HADA 1BS9A 2WJ6A 1E8DA 4I4CA 2HHAA 4OB6A 4X6YA 3I6ZA 2GYVA 3ZLVA 4MJ3A 5AI0A 2H7YA 5JAPA 1CRLA 1CUBA 1UK8A 1XRNA 2OGZA 4WDQA 2XUHA 3R3XA 2BKLA 4WFJA 4ZV7A 1GT6A 5DNUA 1LPAB 1MPXA 2ZVDA 4WJLA 2JGMA 3CCBA 1DT5A 4Y9SA 1QIKA 2XQFA 4U2GA 4AO6A 4B80A 3H2KA 2I03A 2WKWA 3VVMA 1U4NA 1L7RA 4HXFB 3WA6A 3AIOA 1DQYA 2HRRA 5LKRA 4U2DA 3NUZA 4H7FA 2PX6A 5AOBA 3M83A 4DTCA 3G0IA 1F6WA 3QMWA 1QO9A 2XUDA 4QNNA 4BAGA 5ALFA 4X3CA 3IBTA 2VJBA 5A62A 3PFBA 4CCWA 4TPKA 1G5FA 4NMWA 3C6ZA 3HI4A 3I2GA 3C45A 3ESCA 1AMNA 1A7UA 2JF0A 3O9VA 4WFKA 4MWTA 1CLEA 2QR5A 3ICWA 4EY8A 5EGNA 3VXKA 1CUAA 2QM0A 3ESAA 5AM3A 1UK6A 4X90A 1BEZA 1WM1A 1ZIXA 3WK6A 2WLSA 1W1IA 3C8DA 4Q05A 1A8SA 1EH5A 3HC7A 1GZ7A 1UWCA 4KE8A 4BP9A 5BOVA 1L7QA 1XQXA 4KAJA 4BRSA 4Y2VA 1CUJA 3QPCA 2JGLA 3BJMA 4N5IX 5ALTA 2XUGA 1AGYA 1B6GA 1C7IA 2HFJA 4LKOA 4LYEA 4G9GA 4W1SA 1ACJA 5ALGA 5ALVA 2IITA 2QZPA 1XRRA 2C4HA 1WPRA 5CT8A 1EK1A 3KDAA 4HS9A 1YB7A 1FFDA 3V9AA 3SC2A 4Y2PA 2B4KA 1XZMA 2PSHA 4FBLA 1G42A 2HL6A 3A2NA 2WIFA 5CW2A 5DTIA 1TIBA 5ALKA 3DLTA 4L72A 4F5ZA 3DYVA 1FFAA 4B0OA 4OU5A 4H7HA 4B6GA 4X91A 1BCRA 4B84A 2RAUA 3W06A 3BF8A 5JD5A 3IUMA 1YCDA 2WHPB 3C70A 2H7CA 4H7DA 5ALNA 4A16A 3IULA 4QDTA 1X2EA 5LIPA 3ANSA 5A6VA 1THTA 2VJDA 1XZKA 4J0IA 4GHWA 2AJLI 5D3KA 1AKNA 3RK4A 3ZLUA 4PSUA 3ZLTA 4DYHA 1EDDA 3H17A 5HKAA 5AK3A 4YASA 1OCEA 3D2AA 4LYDA 2O2HA 3FLBA 5DNVA 3ZI7A 5LZ7A 1EB8A 2BCEA 4AZ3A 5CBKA 4C4XA 2HA3A 2YYSA 4B9EA 1QGED 1JU4A 5AHXA 5AJHA 2H9YA 5IKXA 3PE6A 3M82A 1JMKC 5LZ2A 1ZI6A 2DQYA 4J0JA 3SK0A 4JYMA 3WWOA 5ALUA 2YH2A 4CIBA 1HPLA 4EY5A 5ALQA 5HF8A 7YASA 2ZYIA 1DINA 1X70A 1ZGCA 5CXUA 3I2KA 4M0EA 4YK7A 5JATA 3STUA 1CUCA 1DX6A 3TGLA 5LYYA 3RLIA 4E46A 1XZAA 3UMJA 3HJUA 4QWMA 3F96A 1N8SA 4AO8A 4MEBA 1AZWA 2ORYA 4DNOA 4ZREA 2VT6A 5LZ8A 5T4EA 2HM7A 2OPHA 3AIMA 3HLKA 4UPDA 1XQWA 2EDAA 4K2AA 1QIGA 1UK7A 2VQ6A 1LPMA 1CUEA 2HA5A 2JGEA 3KOOA 4E15A 1LBSA 2OCKA 3M81A 1IZ7A 3OG9A 3FLAA 2J3DA 5ALPA 4YPVA 3YASA 5FUMA 4BYMA 4KACA 4Q3OA 2WG0A 2HA2A 5DTJA 2OCLA 3N2ZB 4HRXA 4LXIA 1N1MA 2V97A 1JFRA 3Q0TA 3QPAA 4CIAA 4B81A 4BE9A 2RHWA 1HBJA 4V2IA 4Y2XA 4BRZA 2D5LA 4CCYB 2XQIA 5AK6A 5D3ZA 2VEOA 3WIBA 5J3JA 3HACA 2G63A 2O2GA 3WKCA 2WSLA 4GECA 1CUDA 1F0NA 2EEPA 1JJBA 2RGUA 1J1IA 2ZJFA 4W1QA 5AM4A 5K3AA 1I6WA 3GROA 4HTAA 3VKFA 4BVLA 2WU3A 1U65A 1LPSA 3D5EA 5AI9A 3QH4A 4H0CA 5CTAA 1MX5A 3MGAA 4FHZA 4D9JA 3BXPA 2CBGA 5JIBA 3IA2A 4I3FA 1YSCA 5EHNA 1R3DA 3FSGD 5AM2A 1QIEA 2DHCA 1J07A 5LZ5A 4K6HA 1W76A 1MO2A 3WJ1A 2CZQA 4W9RA 1W4LA 4ARAA 3GELA 5AM0A 1FFEA 2FUKA 2HU5A 4X00A 3R3WA 2OAEA 2HIHA 3BDIA 2BUAA 1QTRA 5ALXA 1ZD2P 3H2JA 4J0GA 3WKDA 4UHHA 1DWQA 4GDMA 5JD4A 4EB0A 4LXGA 3W05A 2J3QA 3DDUA 4ITVA 2E3JA 2ACKA 3KD2A 2XUFA 2V96A 3WL5A 3F67A 2BJHA 1H2XA 4Y2QA 4RE6A 3P2MA 3PUHA 1B41A 4PW0A 3QZUA 3G02A 4HXGA 4CCYA 4KR0A 1ZD4A 4FMPA 5EHQA 3AIKA 5HZGA 3HEAA 4JUIA 2CJPA 5AKYA 1P0PA 1TCAA 3WK9A 4J7AA 4PV7A 3L1HA 4Y2JA 5JD6A 3DQZA 1G4HA 3G0DA 3WYDA 2QUBA 4J0CA 5BWCA 4XX1A 4FOLA 4X6UA 5AKLA 4CG3A 3NWOA 4UBJA 2XUAA 2GBCA 1RYYA 3W04A 1THGA 4DNPA 3H18A 2OG1A 3GBSA 4KE9A 2QJWA 5C7YA 4FTWA 1ODSA 3AFIA 1DWOA 5ALSA 5EHXA 1GQRA 1MNAA 1CR6A 3DOIA 2XMZA 1MN6A 5C8XA 2XQGA 3FVTA 4FFWA 4PQEA 1XZIA 4QLOA 2HU7A 2Y2VA 3V1NA 2ZYSA 2FJ0A 4Y7DA 1JT2A 3RKSA 3SWWA 4UHBA 5ALRA 2WFLB 1QTIA 2V9ZA 4ZWNA 1VE6A 3I2JA 4Y2SA 5FP0A 5SYNA 3QITA 4OCZA 1IUPA 4X71A 4PF1A 3ICVA 1WCYA 5CT5A 5FPQA 3E4DA 1W75A 2QXUA 1L7AA 2ZYRA 1MU0A 1XZCA 1HDEA 4C4ZA 3WWPA 4F21A 1ODCA 1IUNA 2PBLA 2YASA 3ESBA 4C88A 5I8PA 4BP8A 3BL8A 3I2FA 4FBMA 2Q0XA 4KRXA 2QOEA 3G8YA 1ZOIA 1WHSA 4J0KA 5LZ4A 5HF6A 1N5RA 4GBGA 2QKYA 4BZZA 4HZGA 2BGNA 3DNMA 1J2EA 3HSSA 5CXXA 4J03A 5HK9A 2VAXA 1OILA 5AO9A 2J4CA 5K3DA 2PPLA 2R11A 2WIGA 3IB3A 5JASA 2JGFA 4W63A 1ZJ5A 3OTQA 2C5FA 2DHDA 3V1MA 2OXEA 3WKBA 5E4TA 3IVMA 3LP5A 3WL8A 5AKKA 3FOBA 5EIEA 2JBWA 3JW8A 2Y2UA 4L3WA 1XKLA 1PV1A 1E8MA 2AJCA 3PICA 1WHTA 1QFMA 3WI7A 1O6GA 2Z3ZA 3FLEA 2XUQA 4E11A 3C5WP 5K3EA 1XZJA 1EX9A 3AZOA 1SCIA 2WFZA 3WMRA 4FLMA 3WL6A 4Q34A 1NX9A 1VZ3A 1BE0A 1CPYA 2OCGA 3C6BA 2XQJA 4IH9A 4FNGA 1PJAA 3K6KA 4UHCA 1QIHA 3O9MA 4G4IA 3R3VA 4DM7A 3WWEA 4EY6A 2WUEA 1YA4A 2Z8ZA 3QBJA 1QONA 5CH3A 3KSRA 5IVDA 4UBKA 4BTVA 3DOHA 5EFZA 4JEIA 4K6GA 1EDBA 2PU5A 3Q8WA 5JYCA 5DYTA 5HCUA 3DL7A 6YASA 3FYUA 4AO7A 5JALA 5ALJA 1VZ2A 4H7IA 4UHFA 1GPLA 3EQ8A 3C8HA 3GUUA 4BDTA 1UOQA 3OC0A 2B9VA 5CT6A 1DU4A 2VF2A 4UBOA 2X76A 4UBNA 4PSCA 3FVRA 3I6YA 5AKIA 1KU6A 2ROQA 3B3QA 1BU8A 3V48A 2WHQA 4E14A 3RM3A 2GBGA 1A8UA 3B5EA 4RGYA 1QLWA 1HQDA 4F0JA 5ALOA 4B82A 2JEZA 4XJVA 4M0FA 4AQDA 1VOTA 2JGKA 5IVHA 3CN9A 1O6FA 2OCIA 4G5XA 1EDEA 2G5TA 4G1FA 4X97A 5HQ3A 4A5SA 3HABA 1CQZA 1Q0RA 3QYJA 4L0CA 2VAVA 2HA7A 4K5QA 4FNMA 2ACEA 4A23A 1R88A 3V1KA 2QXTA 2PM8A 4BC0A 1WB5A 2V98A 4KE7A 1GGVA 3DCNA 5JARA 1HL7A 1W52X 5ALHA 5T4HA 5AM5A 5AKXA 4C6HA 2XLBA 1XZDA 1ACLA 3I28A 4BAUA 3DL4A 4BVKA 3WL7A 4AN1A 1UKCA 2AJ8A 3STWA 1Q84A 5JZBA 1QFSA 2DCMA 4W1RA 5LLSA 4AZ0A 3O4GA 5DWDA 4HRYA 3T4UA 3G7NA 3JYHA 2Z3WA 5H3HA 2DSNA 3G9XA 1R1DA 5ALEA 5JZ9A 1NU8A 1ORWA 1SCQA 3D0KA 4P93A 3WYNA 1RWQA 3WQHA 2OLEA 5ALDA 4WFIA 4G8BA 1CUSA 5FV4A 3O4HA 4LIPD 1QOZA 1QIFA 3EIOA 3I6MA 4FKBA 1ZD3A 4IH1A 5F4ZA 4BDSA 1JI3A 1R4ZA 5K3BA 2VJAA 4UFNA 1UOPA 1BEEA 2BAGA 2BUBA 3QMVA 1CIJA 1U8EA 3R0VA 1QIDA 1ZD5A 3PDCA 4AMZA 3V1LA 1XRQA 1DWPA 3G0BA 4Q1VA 2HFKA 5ALYA 5BV7A 5K3CA 3F98A 3MUNA 3AINA 4DNQA 5HK8A 5BWBA 1LPOA 3VISA 4C01A 1YASA 2FX5A 4U2BA 2ZSHA 1QO7A 4BZWA 4BB0A 5K5EA 1Y7IA 1JJFA 3DEAA 2DHEA 1CUHA 4AMYA 3DJYA 3D2BA 2IX9A 5T4BA 1M33A 1XZBA 5AI6A 3VJKA 2FJPA 4Y2TA 1SOMA 4BATA 1IZ8A 5E2IA 3O95A 3FBWA 4QEKA 1K4YA 4QDXA 1AX9A 5KWIA 5IH7A 3C43A 4QDOA 2Y1KA 4EZIA 4BC1A 2WU4A 2HA6A 3AJAA 1ISPA 1ZI8A 4KJXA 3WKEA 2XLCA 3UUFA 1UT6A 1XKTA 1QE3A 5HF5A 3WZLA 1Q83A 2O7RA 5DYWA 3B12A 3PFCA 1TRHA 5KREA 1YAJA 3T52A 4JYPA 2WUFA 1CUGA 5ALZA 3W2TA 4RE5A 1Z68A 2AXEA 2XMDA 5IVKA 3DD5A 4S0XA 3RARA 3M3DA 1GKLA 2XDWA 5AI4A 2ONCA 4OB7A 3N0TA 3PUIA 1EA5A 3F9CA 3H2GA 2VJCA 3HRHA 2OGSA 1S8OA 4NVRA 5D6OA 4AN0A 5CH8A 1XRLA 2VT7A 4C87A 5K3FB 2J4FA 1E3QA 5JAHA 4PO3X 1XZFA 1A88A 1MX1A 1VXRA 2HDWA 1EK2A 1TQHA 5FOQA 4O08A 5C8ZA 3WK5A 2QJRA 1SC9A 1C7JA 5IVIA 4UFOA 4U2FA 4QWWA 1Y37A 4DMFA 1VLQA 4IHAA 5DJ5A 1WB6A 2I3ZA 1UOOA 1X2BA 5C81A 4Y2RA 4F60A 3QMMA 5FXMA 4N8EA 3IUQA 4OUKX 3MUOA 2VTVA 2Z5GA 3TJMA 4C89A 3O4IA 5A7GA 1HLGA 4JNCA 2DQZA 4H35A 3BE8A 4J0DA 5KWJA 2GZRA 3F97A 3DS8A 1MT3A 5A2GA 5EIAA 1WPXA 1K6EA 4HVTA 5FDFA 3ZV7A 3AUKA 4BBZA 3FNBA 3WK8A 4UFPA 2DR0A 1LLFA 1LPPA 4X95A 2B20A 2O2IA 4G9EA 5JADA 1QIIA 4ZGBA 4P92A 3CCCA 4AB1A 3NGMA 1H2WA 3F8SA 4CFSA 5CURA 2X5XA 4DSAA 4MQMA 4UBMA 4Q3KA 2WILA 1EVEA 3STVA 5T4FA 4H7EA 5K3FA 1WB4A 3A2LA 2C58A 3ESDA 2WIJA 2PL5A 2PSEA 4QE3A 5A71A 4B85A 1XLWA 5C8VA 5HKBA 4H77A 2OQVA 1GPNA 4WY8A 2RIPA 4X93A 2I78A 3IUJA 4N8DA 2QRUA 1MJ5A 5AI5A 4EY4A 1AQLA 1H22A 4L9AA 1IMJA 5CRIA 2HA0A 1G66A 5LZ9A 1ZJ4A 4BTLA 5AK4A 3H1BA 2WG2A 5AKEA 2QUAA 4GLBA 4IH4A 4IQ4A 1VKHA 1C4XA 4EY7A 1CUXA 2HU8A 3I1IA 1GPKA 4HXEB 1YS1X 3LCRA 1LZKA 4Z49A 4DGQA 3C5VA 2XUOA 2G4LA 1XLVA 3FAKA 4FLEA 4UUQA 1YS2X 5FPPA 3LS2A 2UZ0A 3C6XA 3FYUC 4DIUA 4AXBA 1ORVA 2R8BA 2GBIA 3H19A 4FFVA 2YXPX 3R3UA 2EDCA 3TRDA 2WIDA 1UXOA 2JEYA 3MVEA 3PI6A 4ZXFA 2CEKA 4BCDA 3R3YA 5CT4A 2XMCA 4KYVA 4OB8A 1FFBA 4Q3LA 1BN7A 2XQKA 3A2MA 3H2IA 1XRPA 4EHBA
chains in the Genus database with same CATH superfamily
4B9AA 1GL6A 1TTPB 3N6RA 4AG3A 3EFHA 4WCFB 5TVGA 5ADWA 1LPBB 4EL5A 1SJ9A 4MQLA 1XZGA 2J6BA 3B9BA 1RLJA 2I9PA 4QA9A 1TK3A 3WGHA 1GQYA 4ESHA 3DDCA 3HU3A 2Q62A 3TVTA 5DGDA 3WADA 3IMFA 1G7TA 3M2PA 3W9BA 2PUVA 4JU8A 1ZSNA 1D07A 3MK31 2CDCA 4QXPA 1T9GR 2MOKA 2WNHA 3CUWA 4IFEA 2QUHA 2XSZD 4REQB 4IEEA 1G21B 1X3LA 2JJYA 3A6GA 4ZI5A 4BE4A 3PFHA 3DVAB 1G59A 3FY4A 4TQAA 3UEOA 1TTQB 1WAMA 4DMHA 1GDHA 1XZNA 2A6PA 2R5WA 3ZHZA 4RKYA 1CJVC 4TGLA 3KJXA 3QWBA 4MGYR 1L7BA 4XE5A 3UCXA 5FPYA 3S8YA 3KJFA 5DTEA 5E7MA 4NBNA 1IQUA 1P4GA 1V4NA 4R3WA 5K03A 2YCBA 4IIXA 1N6OA 2RI6A 3N8HA 3P9SA 1BCSA 3GFSA 3U62A 1U02A 4XUGB 5GM2A 3P0JA 3S1AB 1W88A 3SX2A 3WWCA 4G0VA 3MFQA 3U0VA 3UQYS 5I7UA 3L8EA 4CWAA 1D9ZA 3GN2A 4DVGA 4BFLA 2D59A 1CBUA 1PT8A 2M9MA 4PXAA 1ORTA 4ZVKA 3RUFA 5AM1A 4YCNA 4A03A 5AOCA 1IB0A 4PTZA 3NJRA 4KQWA 3AQIA 3QIVA 5AXBA 2B7CA 1ECCA 3GMTA 5CYFA 2PGIA 3RVOA 5ALLA 5KYYB 3CVUA 4Q21A 1XVVA 2MINB 1JHPA 1E7MA 3LT5A 4RVDA 1J70A 3LLVA 5DI9A 1VKOA 1MH9A 2PKYX 3IT3A 4EJFA 2IHZA 2WG1A 1KMQA 2AKAB 2FQXA 3QJGA 1ZH0A 4JH0A 4N54A 4UXJA 4Y1RB 1MC4A 1F6BA 2ZITA 2R5FA 3KQQA 1PJTA 2Z5VA 3CVVA 3X1KA 3JXEA 5AH0A 3DKKA 2WT8A 1EG2A 1PFYA 3GUCA 3GZTB 4H15A 4IIVA 4DPMA 3TRHA 1TLLA 3UAGA 4X85A 4ER5A 1LX6A 1OTYA 3IVCA 5IAEA 4F6RB 3KQHA 1YH3A 4O6VA 5TGDA 3O8CA 2VP2A 1UZUA 2ZTUA 4K81B 3SOZA 1BG6A 4CMEC 5B57C 1IUOA 2K2QB 2WM2A 4LYHA 1YGYA 2N9UA 4G6ZA 3GFPA 3WRXA 2YMMA 4WJKB 1SQ6A 2J8ZA 3K2BA 1NJ6A 3VDRA 3GLIE 5JD3A 5CVCA 4G1UC 2H1IA 1QHHA 1TW2A 3TXAA 4MWEA 3TLAA 1U0LA 2QM8A 4HB3A 4GAEA 1NFFA 2QMZA 1DTWA 3TW8A 2IYEA 2YZKA 2FCRA 1UXGA 3QOWA 5K8TA 1W36D 3IIEA 4E1AA 1GJRA 3HG7A 2C7GA 1KMCA 4CMEA 5KQSA 4BKQA 3CX7A 4CTMA 2K7ZA 4N8SA 2J9FA 3NIBA 3MCVA 3ZCQA 1KRXA 2AX3A 1FP1D 2KYRA 2OCDA 3RODA 2C1EA 4Z4QA 1GQOA 5IMSA 1ZUIA 2VKQA 3JALB 3GV0A 2NXWA 4DBZA 3BSWA 4Z4IA 1M2HA 2V7BA 2IXAA 4D43A 3TZCA 1OPRA 5C4IA 3LZDA 4GP6A 5KNLA 1Z5NA 3ZWQA 1GLNA 1FVHA 1NP7A 1GADO 1JLLA 3IHKA 3QVKA 4ZRDA 2JI6A 2P0EA 1OLXA 1W1UA 3E2MA 1U7TA 2IXGA 3FF1A 3STYA 3VRHA 2SKCA 1Q1GA 3UA4A 5ESRA 4FFLA 2O3QA 3BXFA 4RXUA 4KPFC 1V95A 3IR5A 4KLZA 1AHHA 3T5MA 3WK7A 1PWEA 1YR7A 5FAKA 1IBSA 4LI0A 5FEUA 1SVMA 2X77A 2VDLB 4JLJA 2I6GA 4N39A 2WOJA 4AIRA 2A5DA 4BWGA 1QH0A 4OJTA 1F8UA 5AVZA 4DY6A 2VS1A 3K96A 3CS3A 1NUUA 3HY6A 1CR1A 4AWAA 3HWX1 1B8UA 3FTQA 4MWSA 2PCLA 5K0ZA 4MB0A 1U8YA 3K0HA 2R6JA 4O2AA 1M2OA 3HI6A 1L5NA 5K0GA 5DHQA 4JMPA 2CMFA 5DBGA 1ZA1A 1K6JA 1L5WA 4LMRA 1KDZA 3AHJA 4HUTA 2LBPA 3FW1A 1D2GA 2QM7A 4IIJF 1BU5A 1JAZA 4DFDA 5H4GA 1HNWB 3FOFC 2EFDB 2WUGA 4AX4A 1NN1A 2A7XA 1EESA 3LUFA 1HETA 1PR2A 3EAFA 4C6RA 1EFLA 2GASA 1HDXA 3DFMA 4R84A 4CLEA 3VI3B 2P4SA 4A2QA 3ZJ4A 2FEXA 1MJGM 2R47A 2JH3A 2JVKA 1FQJA 3QWFA 4MW6A 4YAEA 5JS6A 2ZE7A 3E7DA 1MC8A 1SC1A 1U3DA 3AILA 3ETLA 4ARUA 5A06A 1FPMA 2O1EA 5CAEB 5BVHA 1W25A 1MPTA 2Q1YA 3LUDA 1UMBB 4Q82A 1KO5A 4LXHA 4KAAA 1WBDA 2QRVA 2R87A 3L3BA 3OIYA 3PQ7A 3R41A 1KJZA 1CJSA 4B46A 4HDKB 4BZPA 4MKHA 2ESRA 2IXBA 4GMGA 2ZJ6A 2VDPB 3C74A 2AZTA 4ICIA 5IABA 3KSUA 3QOYA 1SOUA 1Y3FE 3D8TA 5D8DA 4ALJA 2FUG1 1N5MA 1Y34E 3ZIDA 4F56A 1CNEA 4ETMA 3H0CA 1I51A 4JVNA 2FPMA 2JKYA 3VR6H 4LJLA 3EQ7A 3QVVA 3ZZTA 2GZ1A 1ZIPA 2B8WA 4DUZB 4HDMA 3U9TA 1FRVA 2IS1A 2DFPA 2PX5A 3AEUA 2E4UA 2XZDA 2OXTA 4PLHA 3I5YA 4KR9A 3T06B 4EUSA 4MV7A 4IGFA 2UZ1B 5ICGA 1S9DA 5G0UA 2M1ZA 4E3ZA 2AF3C 1JYEA 3U19A 3II6X 2HF9A 5AKHA 3ZGYA 2CXNA 4RCYA 1IM2A 1FRZA 1R12A 2MYNA 1C30A 3L7IA 4F3YA 5JH7A 1C3OB 2ASEA 2PWAA 3ND5A 1Z6YA 4RHFA 1A2QA 1XRMA 1YRHA 3NBYC 3K6SA 1KJ9A 2J7KA 3SP1A 1Z8NA 3L1JA 4CZ2A 3FNFA 1FIUA 4PYLA 4WK2B 2EJTA 3FIJA 4P9NA 3LUGA 3PQ6A 4LRWA 3UJHA 1SHTX 4KRYA 1X19A 4TL9A 1UR5A 3L1IA 3BVPA 3E61A 3WJ7A 1WEKA 5CDGA 1SFRA 5CH5A 3VHXA 1FXUA 3GD7A 1I1QB 5JUWA 1URPA 1YE5A 4L7QA 4OQ4A 1MHPA 4G5FA 5MGBA 1B8PA 3AJ9A 1OXBB 1P31A 1HM5A 1W0KD 4ISBA 1WOMA 1Z56C 1XVIA 4P4TA 4V3CA 1EHYA 1TCBA 1YBMA 1HE3A 2PGDA 2AI1A 3OPMA 2BGLA 2FPIB 2X2FA 2VBFA 2MSKA 1KNQA 3UFBA 5KYWB 3TBHA 2IPXA 2UVPA 4Q03A 3BTSA 1RJ9A 4MUEA 1GQFA 1NU6A 2OKCA 2X9NA 3FRHA 1SEPA 2FB9A 4EQ6B 1FNMA 2GAFA 4H6WA 5HF9A 1Q3HA 4JENA 4RIHA 2HSDA 5FLKA 3LUAA 1AQJA 5AHRA 2FW8A 3QSGA 4B3JA 4ASUA 2WNIA 5EN4A 3ORFA 1QANA 2QTRA 2XWBF 2B61A 421PA 4D8VA 4GGPA 3PWZA 1CZKA 3GL9A 4MW1A 1EFRD 4Q4AB 3ZBPA 1FQWA 1T6XA 4FEYA 4TLAA 4QRHA 1F0KA 2XCUA 3U7JA 1A5TA 3PNQA 1ODJA 2H2FA 1KSFX 1VE3A 2NUPA 2WTXA 3AM5A 1U04A 4FJ2A 3E9EA 2R1VA 4B4UA 3CSSA 3D5TA 2J33A 3DZGA 3E9ZA 1XAJA 4GEKA 4A2PA 4JSTA 3EWNA 3SQLA 2IHYA 5CB8A 3AG6A 1KZ6A 3TCKA 1ISSA 3M34A 3KQOA 2HMTA 1FW8A 2VWQA 1ISJA 3KQNA 3H65A 2IF2A 3OZTA 4NDZA 3OZGA 3VR1A 4CL2A 1I2AA 4FQ8A 3KSAC 1Q77A 4TRJA 5SZJA 1F7VA 1CHNA 1SBHA 3LY8A 4P3PA 1JIJA 4LUCA 4HNTA 3OQIA 1P1CA 1ZP6A 2DPYA 1KVTA 2JFGA 2WFMA 4UUBA 1IB6A 3QX7A 3P26A 1T6YA 1YR6A 1E3WA 4GI1A 4ZT7A 4B33A 3NS7A 4ZYLA 1N5LA 4DB4A 1P0QA 3GN1A 4NS4A 4RZUA 1FDRA 1KDPA 5DSZA 2WHPA 1RPTA 3IEIA 4WRRA 4L5CA 3H3FA 3PC3A 5FTMA 3UMSA 2WTNA 3X1XA 4DRZA 1M1NB 3WYGA 1P6XA 4B6RA 4EFMA 1Z5ZA 4DLWA 2QN9A 2R8RA 1DLJA 2DGDA 4AKIA 3WAJA 3V2UA 3R24A 4N6NA 3EBLA 3IP5A 1H23A 5EIBD 1IEVA 4JP5A 4WOPA 4QLAA 3U6BA 5IUNC 2IIQA 5DBEX 3MQFA 1Q19A 5F5LA 4FKMA 1NWHA 5J63A 3KAPA 1VXOA 1EP2B 3AI1A 4PYNA 4M0LA 3D4IA 4ITRC 4C7KA 1SOAA 1M8JA 3NAZA 3PUWA 3EZ9A 3KVOA 2JAPA 4W6QA 3FWPA 3JQCA 3MTJA 2B3DA 3P9ZA 3T4PA 2PYIA 3FCAA 1M8GA 1HG0A 1HSZA 1LK5A 1JIVA 3D8BA 4RS3A 1JHMA 2VHXA 1PSWA 1BX0A 1FFSA 1DTEA 2C0PA 3EEFA 1EGHA 2F67A 2NWQA 3DV9A 4XIFA 3KXPA 3WP1B 2QM3A 2IY8A 2OGTA 4BMYA 1TZJA 2R6AA 1I7LA 3U4IA 2HT1A 3DE1X 3JWHA 1U2DC 2QTMA 2YZNA 4PFQA 5FAXA 3ZJ5A 2DY0A 1T4DA 2GNPA 3TNDA 5KYGA 3FWHA 3ZD9A 1WSBA 1BHO1 3AVOA 3GEHA 5SY9A 4YT4A 1G16A 1GZUA 1CTQA 1PEKE 3CRW1 4JEHA 1E6KA 4R2WA 4WA8A 3DMTA 3BJZA 3IXLA 3ZPXA 1QIJA 2JA1A 4UU1A 5FBZA 4UHDA 2FPIA 3A3YA 3UV6A 1PGNA 1U9IA 3C87A 4RZXA 3TM5A 2OUKA 1SBTA 3RPEA 1L8QA 4ALMA 1SPBS 1U0RA 3N07A 1ZUNA 2Y1XA 2E49A 1O97D 2RJOA 3DMGA 5IASA 2EG9A 2P7IA 3CM0A 2FRXA 1C0EA 3PF8A 2FJUA 1N2SA 1U1GA 5BYBA 1DARA 2ZT7A 4MDHA 4MIKA 4TT8A 5J23A 5EYPB 2DX7A 4EO7A 4I46A 2I91A 1QFJA 1TQ4A 1X92A 4I8XA 4XGNA 4A27A 3CBGA 1RM5A 1X1BA 1L3BA 2C5GA 5GTDA 2XEDA 4GQAA 3S40A 2ZULA 3T38A 3Q7RA 3F4LA 1VA4A 1CEXA 1WE2A 1Y8QB 4OYLA 2RK3A 1RXWA 4KAFA 2L69A 1ZN7A 1MQ8B 1BN6A 4L4SA 4LDJA 2JJ1A 1QJ4A 3I2IA 3FCXA 4DHWA 4JMLA 2VUTA 2G77B 1YDGA 1TKRA 3MIIA 4DIKA 3LBYA 5JQGB 2PLWA 4NQRA 1FB5A 1FU7A 1M0WA 3FWNA 3GRAA 4G24A 1KYWA 5GIPE 2W6CX 1Z38A 3ORRA 2MMGA 5EYPA 1DZIA 1O95D 3OTWA 1DHRA 4H6PA 1VG0B 1U0OC 1RI1A 5F12A 3UMVA 4ME6A 3LUBA 4P2GA 5JEEA 4MW0A 5IAOA 2GN1A 2IEZA 3A1UA 1DIGA 1EINA 4M9CA 4PLVA 2Q7OE 4EYOA 1DLIA 5LQSA 4PFSA 9LDTA 2GBFA 1F4LA 2PLNA 5CLHA 1UFOA 5JQWA 2NN3C 4BVGA 3C7DB 2AN5A 2CLIB 2G5PA 1CY8A 1Z2NX 2DTDA 3BCSA 1FOEB 5E1OA 1RR6A 4D92A 1JKJA 4EYQA 2BBSA 4RD6A 1NWCA 4MJ7A 4R9UC 1LZLA 3GOQA 3ZHYA 1CQPA 3ZHOA 4LN1A 2I3DA 4YJFA 4BNTA 2FEAA 4FP9A 4E2XA 1CDEA 1SIWA 1F2TB 2WM8A 2XITA 3IAS6 3P2OA 3QLEA 4GX0A 1VJDA 3U9SA 3WKAA 4AJOA 4D02A 4DMCA 4F4JA 2XSZA 1C0IA 4Z7JA 1VL5A 4X1KA 2HZ7A 2PGNA 4EBFA 3DEIA 4ENPA 2IQ5A 4YC7A 5D51S 1LVGA 4R16A 3TL6A 4BQIA 2KI5A 3OCWA 5TGZA 4QU0A 3EW9A 3N28A 3HTXA 3U1BA 2XD9A 4HEHA 4PRLA 3CVXA 5COQA 2FN3A 3AESA 3WK4A 2FRDC 1BDIA 3L6UA 5DI3A 4JI5B 4TYYA 5IC5A 1YDMA 5KVQA 5HIAA 1Z0AA 3TB6A 2CW5A 2VP9A 2EQBA 3O4RA 1P4RA 1QGDA 5LLTA 1J0BA 1SC6A 3B3AA 5DGHA 5ICMA 4HGRA 5FBQB 5H3CA 5EG5A 2LP4Y 5K6RA 3ADBA 3AU9A 3RS4A 1T3TA 2P3OA 3OM8A 3STTA 4BO8A 4FYYA 4MQEA 4M7WA 3UVEA 1TJYA 3UPDA 3VZQA 1LBEA 4PHTA 1AMOA 1KPIA 3H9QA 3AU8A 1K7EB 5F33A 5AT1A 3CUVA 1VKRA 1V5FA 2WSIA 1VYUA 2M6LA 1D6SA 1T35A 3VDNB 4EJ6A 4RA6B 5KDOA 1GRQA 2V8BA 1WY5A 1KQGA 1CNFA 3BM5A 3EIFA 3L0PA 1T4MA 3NHUA 4G4JA 2PWBA 1U2PA 4O2BB 3VPCA 2QVXX 2BFNA 3HV0A 3OFSA 4AKSA 3VTFA 4WKNA 5B58C 3UKOA 1HA3A 2OXRA 1LJ8A 3ZD7A 3RS5A 2C31A 1O0BA 4IIUA 4B7XA 2JARA 4ENWA 4Y2GA 1SVWA 1Z17A 1GSOA 2DBRA 2W2OA 1ABFA 5FRDA 4PNEA 2YQ4A 5JVDA 3DM9B 1EYZA 3I2HA 1ZNZA 3C8UA 4H3HB 3HBLA 3MCUA 4ZODA 2QENA 1USKA 3PXEA 4WCVA 1Q1ZA 4PO8A 1BXKA 1AUOA 2HWUA 3HJAA 4MI6A 3TSZA 1KEZA 4FXPA 4MMYB 5DRTA 7REQB 3AHHA 3DEYX 1GNSA 3IP9A 2XUJA 4WXYB 4OQDA 3TLJA 4FC6A 2ALJA 1C4WA 3GGCA 4D0LB 5C7OO 2QPAA 5FBKA 5T3YA 3CH5A 3R9KA 1M7GA 1NYTA 1AC5A 3EQ2A 5HUJA 4JC0A 3VOSA 1TEVA 2YWRA 1QGUB 3TXYA 2ZUEA 2IP2A 3GJSA 1KETA 1R0CA 3ILXA 2C29D 4BZXA 2VBCA 3A9VA 4DSUA 2E0IA 2V58A 1N6NA 3H4MA 5KSPA 4EQ6A 3TLCA 1V47A 3NTOA 1A8IA 2YW2A 1DQZA 2YXNA 3MLAA 1MC5A 2VLBA 1OBVA 1X7DA 1ZYUA 2QTNA 2KLHA 1JZQA 3FI9A 3QKSB 5EHZA 1PW7A 2HO5A 3Q7IA 4ND8A 4QQ8A 4F85A 1XF1A 1MV8A 4D6YA 5B58T 1OT3A 1W0CA 3DO5A 3K4QA 4MYUA 5DNWA 3G9QA 3KLBA 1CF9A 1P9NA 2GZMA 1P6QA 1EHIA 1EXWA 1R9NA 2EZ8A 1U8FO 1VMEA 2ZRDA 3QEOA 1EGQA 4OSOA 1LPNA 4DLNA 3RIXA 3K73O 3NLLA 3QBVA 3H2HA 4B0PA 3GZJA 1FSPA 4NYJR 1RYEA 3KQMA 4ZTZB 4K1XA 3RFCA 4BWFB 3ANLA 4KXFB 4B83A 2Y1FA 2OESA 4B45A 3V3KA 4V38A 4C6TB 1VLLA 4M88A 1G3IA 4OJQA 4F38A 3DMYA 1AY0A 3RB8A 2ZYUX 4IPTA 3CLRD 3HDHA 3A26A 3I0MA 1D4AA 2HHAA 4DA8A 2ODAA 5TMEA 3NATA 5CLFA 3MPOA 2V9PA 2O59A 2NX2A 3V7WA 5LQAA 3WLIA 3Q7TA 1Z4IA 3MTAA 2W2MA 4BNDA 1N5KA 1QQTA 1W6UA 3GC6A 3ZCXA 3U49A 3ZVRA 5L40A 2Z1MA 2XCIA 4FDTA 5ERGB 3ON5A 3UK1A 1WV0A 2PD4A 3RKUA 3R3XA 4PGAA 4EEXA 3PITA 2BKLA 3PQFA 3W2GA 3HM2A 1VSVA 1XDGA 1YNSA 3HB9A 3MGBA 1V2GA 4ZV7A 1YZTA 2EG5A 3KKEA 1GT6A 3V8PA 3ENKA 3SAJA 4HEA1 2AA3A 3Q9SA 1M2VB 3TCNA 3OMXA 4XVUA 1G2QA 2QXYA 3EZ7A 3NT2A 1V26A 3BRQA 3NHZA 4BX9A 2ZVDA 3O2JA 4WJLA 5F73A 3VAAA 3CCBA 1AKVA 4TZKA 3OUUA 3K92A 4A8TA 3H7IA 5EQDA 3DTNA 1EM6A 2XQFA 4BLRA 4U2GA 5K0FA 4B80A 4RH3A 4ZEOA 2JK1A 4G5GA 3ITEA 1TADA 2I03A 4ZOCA 5IKEA 2AQKA 3VVMA 4WKGA 1UMDB 3C5CA 3BD7A 4Q4DA 3V8EA 5BVHB 4QD3A 3AIOA 3LAWA 2N47A 1DQYA 4YRKA 4LY3A 4UVHA 5K45A 3MD0A 1DJMA 1UFVA 5KOIA 4IJMA 1G2PA 5AJUA 4DQKA 4YRSA 2NZJA 1YCFA 2R2GA 4NX2A 3AL3A 4H7FA 3GLIA 4LPSA 2V7QA 3I0ZA 1SR8A 3OCJA 2YYAA 4D8XA 3DF7A 2VHTA 1TC1A 1YI8A 3NBAA 4L0QA 2B5OA 3K9CA 1NW9B 4DIDA 3G2PA 1YC2A 3PSHA 4MH0R 3M83A 5JPIA 1PD0A 2YYYA 3F6EX 2EATA 2W7TA 3L8CA 4RLFA 3EAGA 3LPAA 1QO9A 4QFCA 2XUDA 1K7YA 2NOAA 1STOA 1FBTA 1L5YA 1SUPA 1W9MA 5ALFA 1MVLA 3KXKA 4TV9F 4I50A 2WVGA 2VJBA 4IYRA 2GX6A 5A62A 1DKPA 3PFBA 3X1YA 3L7BA 2GKOA 4BNUA 4TPKA 1SB8A 3W7BA 1XTJA 1YHNA 3N2LA 4LOIA 1U3CA 4MW4A 2QX7A 1G5FA 5AW5A 3VU8A 1V41E 1VIDA 2D06A 4OHOA 2XCTB 2NP7A 3KOZA 1NXPA 4CDGA 5K8JB 4S2EA 3A04A 4TSRA 4RU1A 4F04A 4ZEWA 4XRRA 1OZ0A 1P7PA 2J5RA 1E2PA 3D3QA 3TQCA 2FWIA 3ETGA 5A9TA 1N2BA 2LXNA 3JQAB 4EG3A 1DQPA 2BFDA 4TLEA 5FNVA 4YMVA 1BNCA 1QG6A 2WSSA 4JLPA 1J6UA 4KR2A 4Q3DA 3U7GA 2FW6A 1XKXA 3AT1A 4LRXA 4OQLA 3NBXX 2RSLA 3QNMA 4EOGA 3TIXB 3SZGA 1T5SA 1YO6A 3S99A 4AMUA 5AVWA 2JCVA 5K8UA 2YV2A 1J2YA 2WHYA 2J0UB 3CUTA 2EZ9A 4LQCA 4BNGA 5JY6A 4EY8A 2X1MA 3GEMA 2GILA 2ZCJA 2IGBA 2HEIA 2QNBA 1U2GC 2H1HA 5BPHA 4F6LA 4Q3EA 4N03A 3ESAA 1TYAE 4X90A 4D4KA 1JDTA 2VNIA 2PAAA 1O08A 1WM1A 2A94A 4E08A 3QUAA 1F2UB 1XEXB 1RZ3A 5I5EA 1KBZA 4BRWA 4QQKA 2DULA 4KKVA 5EWJB 3D0OA 4WVLA 4CEIA 1U8ZA 2BIFA 1TI7A 2C5EA 3IVXA 4MUKA 1KQ3A 4TYWA 4JJ6A 5E7IA 1QRUA 3MT0A 4X60A 1T3SA 3OZDA 4V0QA 1UWCA 5HCNA 3LX4A 3U40A 4OUDB 3H2SA 2CVQA 2V5UA 2VRBA 5FL3A 3O92A 1PGOA 4W5QA 3RHSA 2GEVA 5BOVA 1EFCA 3U81A 5A3RA 1I0ZA 4XWWA 4NMLA 1Q5PA 3T9BA 3WQBA 1T2VA 3P0RA 4BRSA 4Y2VA 2HUNA 3ROPA 1Z6XA 1N2OA 2NPIA 4I1IA 1QQAA 2YWBA 2PL1A 2GAJA 1E20A 1IY2A 2QL5A 2ZYTX 2XUGA 3DTVD 1AGYA 3L0SA 1C7IA 4NE9A 2ISQA 3FRIA 2Y9PB 4O4IF 5LC1A 4C7VA 5CYGA 5CFQA 4B8YA 1AQUA 5K51A 4DC9A 3MLEA 4Y9DA 1ACJA 4HMQA 3OPVA 3S8EA 2WD7A 5E6RB 1I1NA 3WLNA 2F8MA 4EW2A 2GWRA 4M54A 2EWMA 1C4KA 1NBEA 3AFMA 1K75A 3WRVA 5FA5A 2RKBA 5HTKA 4GP7A 3MD9A 4PBRA 4ZDIA 1OA1A 4DMRA 4COOA 2IYQA 5GGYA 2IYVA 2V6FA 3JAKB 4LZJA 3FUVA 4RHEA 5F2KA 1DCTA 2F43B 3W3AD 5C8YB 3PNMA 4M89A 3V9AA 1TD1A 1QCYA 2HBQA 1LLCA 3KNZA 1T6NA 4IAOA 2R84A 4RD3A 1XU4A 1ZCBA 3IKJA 5A5DA 3PGMA 5K6AC 2QRPA 4PANA 1P81A 2VHUA 4E4YA 2HL6A 1JEAA 3A2NA 2WIFA 3JRWA 4XIGS 3HZRA 3KKQA 2NACA 4HATA 4H1UA 4ZAVA 3M4YA 3LCCA 4UATA 4QTZA 3DYVA 5IDYA 3MRXA 2AUNA 5FFFA 1FMJA 4DLRA 1N78A 2O5EA 2AYYA 4AJNA 3GAFA 2Q5LA 2Q1SA 2GDJA 1N5OX 3G1TA 1QHFA 4U5XA 4B6GA 1BCRA 5JS2A 1QBKC 1MEJA 2A0YA 2PL3A 2RAUA 4U9IS 5B2ZA 3VR0A 2G72A 4Q4HB 2AN1A 2PH5A 3VC3A 3IUMA 3NH6A 1QVVA 1I6KA 1APBA 4FGLA 5DW3A 2RB5A 4G8JA 2NYVA 3K7EA 3V2IA 1E2JA 4JI8B 4H7DA 3HE3A 3UMRA 3UXYA 4QYMA 5CVVA 2VJMB 3AYZB 1X38A 4EG7A 4WZAB 2WQ6A 1WB9A 2INGX 1AKEA 1X2EA 3KO8A 4PAQA 4RLQA 1O1YA 3JQ6A 2B37A 1DBSA 1Y1SA 1RWPA 2FWJA 2QORA 3RQSA 3SR3A 4YMUA 2Q2VA 4FT4A 5A6VA 3T9AA 1THTA 3SN6A 4R6WA 1RYZA 3DO8A 2H0RA 3IBCA 4GGOA 1MUUA 2QI9F 5JXJA 2UUPA 2ZQYA 3L77A 2ZU0C 1WTAA 4HDAA 1AKNA 3UMFA 2PMCA 5IEBA 2AC4A 1P1HA 3DNPA 3DXZA 4UJ3A 5D3QA 5DGTA 3KEFA 3KTAB 5FR1A 5KKCA 3C7AA 3EFEA 4NAVA 3NVAA 3H17A 1GTZA 4ZHQB 2BOVA 4PAOA 4K9KA 1GPWB 1EFKA 3Q6NA 5KKNB 2M6SA 2XCRB 4CR7A 1B7GO 1NI4B 1UC8A 5I7EA 3NVDA 2X15A 4BVEA 1T8UA 1UCFA 5KTYA 3DAFA 4US2R 1GN9A 4JQYA 3JQAD 1XHEA 3BH0A 1ZIDA 4AZ3A 5CBKA 3H2YA 3NKFA 2NU7B 4B9EA 1C1YA 2D2EA 2RAVA 4PQGA 2FPGB 5EE5B 4RA9A 4LRUA 5AJHA 2PRYA 2W2KA 3QV2A 1OJ7A 1U8CB 3K31A 1SQFA 1JMKC 3OLCX 1HQKA 4RABA 4RW0A 5LZ2A 4LF8B 2ANCA 1MA3A 3IAM6 1YBAA 1DKRA 1RLMA 2W6ZA 1EBBA 3FROA 2V45A 1I94B 1AS0A 3PRKE 1KHTA 2HU2A 2YFKA 2YH2A 2ZRAA 3NDPA 5ALUA 3SYKA 1HPLA 2OZPA 3K1ZA 4EY5A 3KLPX 2HO4A 1QX4A 3SPXA 3JTMA 1N6KA 4E5DA 3RFFA 3ZX5A 2IYNA 1Z0ZA 3QLVA 1YUBA 5DE3A 2CLDX 1XJQA 3OETA 3FCCA 1QHYA 3G5TA 3V8BA 4R71A 4RDIA 4A36A 2FSSA 4AJ1A 1V4BA 3LUHA 5HILA 3ZKAA 4DDUA 3EVZA 3Q8KA 2WJAA 1H94A 3HV2A 4NULA 4I4TF 3KEGA 4IHJB 4V24A 2C83A 5LQNA 5LYYA 1AUPA 1EFHA 4V0OA 1N2IA 4MQ6A 5CB4A 2Z08A 5LD2B 4V1CI 1UBMS 4IIEA 3VZSA 4Q7LA 4QWMA 4YHBA 3UT0A 1QMGA 1T8SA 2WF5A 1BH6A 3B7PA 2J9ZB 3OCCA 4YCJA 4FMCB 5F21A 2FPWA 4G1CA 2I9KA 1G8PA 1ZL0A 2P3LA 3CR7A 1LDBA 4A8HA 1F3OA 2BFEA 4LGMA 5TRTA 3V1YA 4KV9A 4BX2A 1OAOA 3EBPA 4JJIA 4TXHA 1Y3IA 4L5BA 1U1DA 3CX6A 1Z28A 3CONA 1PEAA 2C3OA 2JFQA 3I34X 3EPJA 3JVDA 2GHRA 1W73A 1XQWA 1L1FA 5BRNA 5BWOA 2P6UA 4CQNA 1CQJA 3AESB 3IVRA 2VTBA 4RVNA 3WLSA 2ZBEA 3NKLA 1PI3A 3PTZA 1DB3A 3WIEA 4A10A 4MVJA 1LPMA 2HA5A 2MR5A 2XDQA 1AO3A 4E15A 3L8HA 4EGAA 521PA 1P4SA 5ENDA 3F5QA 4DIFA 4OH7A 3UAWA 4NFLA 5DSXA 5HW0A 5AJWA 3RSLA 3I01A 1I01A 4IRUB 4IQ8A 1QV6A 4DPKA 2C4TA 4UCQA 3QKIA 3YASA 4Z0PA 5FUMA 2FP4B 1Z16A 3W3ZB 2ORIA 3O94A 3ZDBA 3F46A 4KACA 1WF6A 4K46A 1BQ4A 1JHDA 1S1MA 2AOVA 1AF4A 1J7KA 1X7YA 2Q6LA 4Z3DA 5BQ3A 2AKEA 1JPNA 3IAS1 4LXIA 4LK3A 1UL1X 4PEVA 5B1HA 3PQ2A 3DF9A 5CJ2A 4Q7MB 2V3WA 4UNPA 2P65A 2HDHA 3Q7QA 4C2AA 2GXAA 1L4BA 3OZEA 3EFBA 2VDMB 3DZKA 4ER7A 2Q5JA 4F2PA 1E0DA 3WGTA 4FR2A 4YROA 3NTUA 1T26A 4C7OB 3A6KA 4B81A 3A6JA 1I3KA 4CM7A 1HBJA 4G0QA 3RS3A 2BV3A 4JP1A 5A0FA 3B1YA 4BRZA 3HJHA 3TKLA 1C9YA 3H5RA 1CY0A 1VPVA 1NJ1A 4FHFA 2QVLA 3IE0A 1HE5A 1X3SA 4W82A 1N2EA 2BMWA 2JAUA 3DMTC 3IALA 2NU6A 4OQEA 4JWTA 1KPHA 1O03A 2DKFA 5F64A 3WIBA 3X1JA 4BBPA 4C0LA 4YAGA 2ZDQA 3QTBA 3HACA 3U48A 1ZBDA 3AW9A 4OMDA 2GCEA 3K70B 2WE8A 4CUKA 5EJ7A 2YQ5A 3SDBA 1ZG3A 1NQOA 3CRMA 2IOYA 3OQHA 3SHWA 3FFWA 3WKCA 3RFXA 4BLSA 4OHXA 4ZT3A 1GFZA 2EEPA 5AHKA 5JCZA 1O6CA 5FX2A 1ML4A 1QKIA 1N8NA 4ZVLA 2ZJFA 1R66A 4CQLA 5LMCA 3JCZA 3ED5A 1I6WA 3DB2A 3GROA 4IF4A 1IVNA 1QGOA 3AUJB 4R8LA 3WLQA 5DHAA 3EZ2A 2A1TR 4BU1A 3KYDA 1C1DB 4BVLA 1FP4B 3GK3A 1XZPA 3C7CB 1CJCA 2PNFA 1LPSA 2QX6A 2SNIE 4X7MA 4D80A 2O8BA 1PT7A 3VPGA 1NIJA 3BD9A 4LCEA 5CTAA 3JVVA 5JY1A 4F71A 4CW7A 3HNOA 1GGJA 2JFOA 5KJ1A 4PSAA 3ZV4A 3ESQA 4EPWA 3E3NA 4ESVA 1U6KA 2JFXA 4GC5A 1GGMA 4UQLA 2B8JA 3IA2A 1XTQA 4BMDA 2XXAB 1XDBA 2QGFA 1ZZGA 1TUBA 5U4QA 1X9GA 3DGEC 1DXQA 2C77A 2J32A 1GTJ1 2OEPA 1QIEA 4ZRMA 5AM2A 4HSEA 1OR8A 1ICIA 1O8CA 2DHCA 2YZGA 3DCIA 3K2QA 3NBFA 3OJ0A 5D7NA 2ZM6B 1ONSA 1JQ5A 3DDZX 3HK2A 2MSWA 3VNAA 3QYAA 3NWEA 1ELOA 2YWCA 4TUYA 2CZQA 1Y80A 1CS0B 2R6CA 1RJ9B 4AS3A 3ZI0A 3HCCA 4R7TA 4WZBB 1W4LA 3KLNA 4GP9A 4L3OA 3VPXA 4E12A 4M4SA 3A0UA 4DIBA 2VF5X 4NFYA 4X00A 4TLCA 4A8JB 4BKRA 5E0KB 4FFBA 3I5XA 2OAEA 3SDSA 1PJZA 1SUBA 3DXFA 121PA 2XGSA 2X19A 3GVHA 4N1AA 1G0NA 2HIHA 3LO8A 2BUAA 4R2LA 1E77A 1FP4A 5A2QA 3PDWA 1G41A 2C7OA 5J2TB 4QTXA 2JHAA 4NP6A 5FI1B 2JFFA 1UMKA 1ZD2P 4DSOA 2BFCB 4OP3A 3NIFB 4HTFA 1TYZA 5JD4A 4QXAA 2XE8A 2AW3A 4K40A 5AVJA 3OT1A 2FWMX 3W05A 3DDUA 3PEEA 3IPAA 4K1LA 5JS8A 2KB0A 1GKYA 1WUYA 2ACKA 3CVJA 3KD2A 2XUFA 4P33A 5GONF 1H9CA 4TXJA 1USGA 1K3FA 1ZL2A 1PR5A 4HWRA 3PRJA 2AG5A 4QT4A 4F92B 1C80A 1QAQA 1H2XA 1Y5MA 2XNSA 4Y2QA 3KVRA 2V7EA 3BJIC 2WA2A 5JSHA 3S44A 4UMDA 4YMSA 4NKRA 4DE5A 1J2RA 4OIMA 4YCCA 1GTSA 2X1LA 3D6UA 3RHTA 1RLTA 4S1WA 2FVYA 5AW8A 3AM3A 1IHDA 1MRNA 4L8VA 3V8RA 4JP3A 3KUDA 3RDPA 4R8SA 1DQSA 3VSAA 1JH8A 3AIKA 2X41A 1LF5A 2ZJ8A 3B5IA 3TX6A 4LJ5A 3BQNB 5IC6A 2PY6A 3HEAA 3TECE 1CFZA 2H2WA 1KR2A 4LGYA 3TEMA 3VV3A 5HHTA 3AR2A 4C1BA 2XZTA 5I45A 4N41A 4C4PA 2GZ3A 1K8RA 3L1HA 6ABPA 4Y2JA 1XKQA 3NRBA 4CM9A 5JD6A 3DQZA 1T36A 3FXAA 2H1SA 4X1KB 4CLRA 4K87A 5FF9A 3OM9A 3UF0A 4N76A 2DZDA 1GILA 3SICE 1DFIA 1OBOA 1GFWA 1Z6ZA 3QQPA 4WKCA 1VI2A 3ETNA 4MLCA 5BWCA 4YLEA 2C1ZA 4YP5A 3RVBA 4CG3A 1OV6A 4IXNA 2I67A 2NV6A 4OJMX 3ZGZA 2Y1EA 2IXFA 4YRNA 4UDXX 1U90A 2PCJA 5CCEA 4YALA 1TU0A 5TQ2B 3DMFA 1MDFA 3R3JA 3LVFO 4Z9XA 3GAZA 3H18A 3UYKA 5H9WA 5HTOA 4O2BF 1A2KC 1RRVA 2OG1A 3DCYA 5E8RA 2PS3A 3PEUA 4O4LF 1S01A 2QJWA 3H97A 4FGSA 3LQYA 1ODSA 4AUNA 2QIPA 4B44A 3ER8A 1USVA 4DLBA 3HCDA 3NB0A 4JI0B 1G63A 2B35A 1QE0A 2H06A 4AI6A 1H3EA 2ATEA 2JIBA 4HUJA 4LYYA 4MARA 2JG3A 3MJHA 1W46A 4KIWA 3VNSA 2BHSA 1PZNA 1OYYA 3L1KA 4HWTA 2OMEA 1PV4A 3TE7A 1GYPA 3ZWVA 2X4GA 1CU1A 5DM0A 4CKWB 1I0IA 4PQEA 4AF7A 4MV0A 2WJWA 2AIRA 2J3KA 5ILOA 3O7WA 3E23A 4OK6A 3VPFA 3KR1A 2UUCB 2OL4A 3FIUA 5EJ6A 2FPPB 3DE7X 4HDOB 5HDQA 3CLTD 3THOA 5B55A 3ICPA 2QTZA 3LRXA 1WCWA 4X1IA 3LXRA 2ZYSA 1QKKA 4TWAA 4DA9A 2FJ0A 2Z8YM 1T25A 2HV9A 5F7XA 4KR3A 3M1LA 2UDPA 4FMBB 4UEOA 3HA5A 3UGQA 1UBRS 1Z5GA 5L3ZA 3J80A 1ZM3A 4JJAA 2WZQA 2O5RA 5E6UB 1QTIA 2Q99A 3GDOA 1N34B 3LWBA 3RF6A 4LYGA 3PCXA 1VE5A 4YRIA 4ZWNA 3EG5A 3PA8A 5J5AA 1B8OA 4BXOA 5FJIA 2DPLA 1B0AA 3CPHA 4PTLA 4RYLA 5SYNA 4PPNA 1MX3A 4B3FX 4C5AA 4OJYA 3VR4D 3CZCA 3E1SA 5EZYB 5A4DA 1EFDN 2BFDB 2OOSA 1IMOA 5FNVB 1JLMA 2VJOA 3AR3A 2H9IA 3INNA 1GV1A 1DKOA 2C2YA 3IRUA 3P5SA 4HQKA 1QRRA 1D2NA 4FGJA 4K7JA 5ELLA 4D98A 4CETA 2P2LA 3ZHXA 2RGBA 3QKTA 3R7SA 5L53A 3RR2A 2H65A 2I76A 2NV2B 3TD2A 3SVLA 3JQRA 1G8KA 2CDBA 2IF0A 2RH9B 3K0BA 2H1OA 3M5WA 5C8DA 1DJOA 3EXEA 3REOA 4IS2A 1YZNA 1NW8A 1ONNA 1QH8A 2FR1A 2KSQA 2PMDA 2X0KA 2QXUA 4JI1B 1MU0A 3UGJA 1JQ3A 5FL7A 2GCOB 1YVRA 1QQ6A 4IJKA 2IV7A 3B1KA 1HDEA 4C4ZA 4QJ4A 4KO3S 2YN4A 4BNMA 1E4EB 1EP9A 4EDFA 1KMNA 2P0AA 1ODCA 1IUNA 1XQ6A 2FMUA 4K6MA 1KAMA 3M9XA 3NNSA 4RJIA 1S4MA 2YASA 3L5KA 3PX3A 2HWXA 4H08A 4C88A 1WO8A 2ZTSA 5CLLA 5HEKA 1W19A 3LKBA 5KYYA 2YHAA 2HGSA 1Q1NA 2N1MA 4CFZA 1JA0A 5G0WA 1RXUA 2J3JA 3BL8A 1TW3A 3IOEA 3QLJA 1SBQA 3G7SA 2I22A 2YHSA 3GH1A 3IX7A 4MS3B 8ADHA 8ATCA 1QDEA 2V1UA 4LFBB 1SWVA 2EERA 3M9WA 5IXSA 5CM9C 3BEDA 4V0RA 4LX0A 1ZOIA 1UXHA 4INOA 4B6OA 1NKSA 3O0TA 2VVTA 4QARA 1E2NA 2JIMA 1M8FA 1XP5A 2RGNC 1PHPA 4GBGA 2X4LA 3CF2A 2BGNA 3DNMA 3UWSA 3PGLA 5KU1A 4LJSA 4NNPA 3DV0B 1RMYA 5BSKA 5IJ9B 2CFIA 3F3SA 1E3WB 1JR3D 2P7HA 5HK9A 2IBMA 4RD0A 1W7AA 1VE1A 3OQIB 4CLDA 1NLUA 4FGZA 4G2NA 2W0MA 1E96A 1XB2A 4JEMA 3KJQA 3WIUA 3PD7A 3KXLA 2VAXA 1OILA 1QVAA 3KOXA 3E0QA 4ACAA 4E6PA 4B4WA 1L6RA 2R11A 1H1TA 3EC2A 1BH2A 1M1ZA 1TM5E 1K92A 3ENWA 1DHTA 1Y5LA 3H9UA 2YMPA 4FEEA 4R1QA 1Z4JA 3W6ZA 4DG5A 2P1ZA 3RANA 1WPGA 2IEIA 4W63A 1ZBQA 4E07A 3KYIB 5KC8A 1YOVA 1N3BA 2UVQA 2V0CA 3PNSA 5DCLA 3TTVA 3ZXXA 1ZJ5A 3W78A 3MBIA 5HKOA 4NYJQ 5TDHA 1GA4A 2G76A 2BF4A 2P78A 2X4DA 3ZV3A 3T0GA 3REQA 2FK8A 2OXEA 1ZRHA 3T3EA 2Q3BA 5IT9A 2GD0A 3AJEA 7ADHA 1MVNA 3WMGA 2ZE5A 2E1RA 1NRJB 2GK7A 1YRWA 4RADA 5DKFA 4DDVA 1HDGO 5LU9A 3KHUA 4TTTS 1L8OA 3PR1A 5C7LO 5KO2A 4TTPA 2JH9A 2B4TO 4JBIA 1T4CA 1FSGA 1ZXXA 5EIEA 3TOSA 5B4TA 2G80A 5BSRA 1S2GA 2IY7A 4L3WA 2I4MA 3U4HA 2F43A 1JZTA 4QYIB 5I5GA 5C8YA 1G6Q1 1NXTA 1NPDA 1S1CA 3DZCA 3KQYA 4JHLA 2GRUA 2R1ZA 1RXEA 3FTDA 2X9GA 4Q3BA 3I9LA 2Z3ZA 1H0HA 4RBNA 3T5DA 2QGZA 3BCUA 3HYRA 4DARA 3LH5A 1GTL1 5L3SB 5A0VA 4G1MB 4OV6B 3NBKA 2UKDA 1QF7A 1CVRA 1FRNA 3IUPA 3SS9X 5LXTF 4R0MA 1SCIA 1TXGA 1DKQA 4US1R 1C9KA 3KKKA 4S1OA 5BNTA 3AHFA 5FWXA 2X7HA 3IQXA 4YJGB 5JE8A 1CPYA 1C14A 2XCLA 2W4MA 1EFPB 1WCIB 1JIIA 1CY6A 2ABWA 2PUTA 2H07A 2NGRA 3OFJA 1NLZA 4EH1A 4NAUA 1WLYA 1HC7A 1U9ZA 4DQUA 1JV2B 3BS4A 1V3VA 1SD2A 2H54A 1JJAA 4LA4A 5C35A 1YDWA 1P9WA 1YBVA 1RPAA 1UAYA 3WWEA 3GEBA 1VJCA 4JLVA 4UM9D 3F7MA 1XCJA 1YA4A 2JI4A 4G5OA 3R7WB 4B32A 2YVUA 3EISA 1QK5A 2RGNA 3K8OE 3QBJA 4QGAA 4X8OA 4I5DA 5IKPA 1HG1A 1G60A 1ADGA 3PGXA 1EVKA 1HT2E 1ZD1A 2D5IA 3KSRA 4UBKA 1CP3A 1XEXA 2VF4X 4OBEA 4F4UA 1PYOA 3FZEA 1IBLB 5EFZA 4I1SA 1CDZA 4Q9NA 4J16C 4OXIA 3CRRA 4K6GA 5IVPA 4KVGA 4R2JA 2CMKA 3GRFA 1AS3A 3Q8WA 4JJEA 2EU8A 4II3A 5E3IA 4BLTA 4E2YA 1U3GA 4OXKA 5EQTA 4IP0A 2ZCVA 4XTCS 3FX2A 3I23A 3J7AC 4IDDA 5A4KA 1SXIA 4KLRA 3A6FA 3GPLA 1D8TA 2C8VA 4GZLA 1ZCFA 3KB6A 5HCUA 2C3UA 5KHAA 4C29A 4D4LA 2Q6VA 1SZPA 1YD7A 3VYTB 1U8UA 3FYUA 4G1BA 2CCJA 5KTMA 2OV1A 2OO5C 4OJNA 1TECE 1IJKA 1NULA 1GTG1 1L4YA 2HCRA 4NATA 2OV4A 5AVXA 2FGJA 1UKYA 1NMXA 3L49A 4IOKA 3BBLA 1GZ5A 2F62A 1PLJA 2FEMA 2FUEA 4H7IA 5BSTA 3ONEA 4YVFA 3TNLA 3Q3HA 4MCIA 1YDFA 2O57A 3FJ1A 5EMMA 3RT1A 3BK1A 1VTKA 3PDIB 3IP8A 4IF6A 3TLYA 4CQMB 1RJGA 4X7PA 4BVHA 4XARA 5JPDA 4L22A 2FVXA 1AKYA 4PWZA 2BI4A 1ATIA 1NM5A 2QX4A 3HVJA 1PNVA 1DU4A 3BXEA 4YDRA 2F4NA 4JGIA 4C7JA 1Q2UA 2VF2A 1CNMA 5FWDA 4C0XA 2H1VA 1YB1A 2R751 4OFZA 5EP1A 3WLJA 1ISFA 2AMJA 1ML3A 5KSOA 5AKIA 3JZAA 3ZDEA 4EGSA 2I4LA 1O0CA 3OIDA 2NXJA 5MFZA 2LCIA 3NHPA 3AQ4A 2J3EA 4E14A 4FZ3A 3VO1A 2OWEA 3E58A 4LK2A 5KNBD 2PUDA 1TNDA 5IJAA 4WXEA 4YJ2A 8MHTA 4RV9A 1UBNA 3QHQA 1KY2A 2Z4TA 4HPWA 4PAGA 2GBGA 3PC8C 3FOEC 4Y1GA 1A8UA 1ENZA 2VJNA 1FMCA 2H11A 3G1UA 5H16A 1R4AA 4ZOBA 4YRJA 3VKHA 1JN0A 1G21E 1HQDA 1KI7A 1IQ0A 2AOUA 2WMYA 4RJKA 1C7QA 1UBUS 2ILVA 2RB4A 3T1HB 5ALOA 2OORA 1QAMA 4B82A 3MCWA 5I6DA 4HMPA 1E1DA 4M0FA 1VOTA 2W93A 3AFNA 3M6AA 1RWOA 1ULUA 4FYIA 4J9VA 1KH2A 5I7HA 4OHYA 4NFHA 2JGKA 3A1CA 3OTHA 4XKJA 4B79A 4F3NA 3SQXA 2NMVA 2EL9A 1IHXA 3CN9A 2OCIA 1UZMA 2PZ8A 1MG0A 4G5XA 3GVIA 3KEOA 5JC1A 1EDEA 2VOJA 3DXYA 3OZ7A 2V6JA 3NTVA 1AF7A 2G5TA 2PPVA 2C88A 2HMWA 2NZ2A 4FFDA 2D62A 2EP5A 4A5SA 2A86A 5HQ3A 2C3PA 4J1SA 4PR3A 2QLBA 2O7NA 3ISTA 4MS1A 5G02A 3EH1A 5A3SA 4MKXA 4L0CA 5ERXA 1FNSA 2G17A 1QSGA 5A9SB 5BR7A 1T9GS 4TUYF 4YIKA 2NO5A 3V55A 1Z83A 4M1EA 1K98A 3FM9A 3GD5A 3KJZA 1XC7A 5DOZA 1AHIA 2IYFA 3ZXSA 2AG6A 2VPYA 3PJEA 4NJMA 2YR0A 1VCNA 3Q5EA 1KL7A 1M2VA 4JJ8A 4NV3A 1R8YA 2QXTA 5TT0A 5JISA 3M70A 1M0TA 3O1JC 3QFHA 4KO4S 5J2UF 3JD1A 2QP4A 4PR0A 1N9KA 3DBRB 2R6ZA 2GAIA 3D8NA 1G3MA 4R8VA 4BC0A 4LC1A 4EYEA 3L18A 5B6JA 3BKWA 1K5GA 4DV0B 2C98A 5HDBB 2EF0A 2FZVA 2VQDA 1HL7A 3Q98A 1FJGB 1ZJYA 4LQLA 3OCVA 1KIMA 4M86A 3V80A 4E5VA 3NVKI 1T8TA 3T7IA 4YQFA 1WMFA 1C8BA 4C6HA 5T41A 3OWXA 3FKQA 4Z7OB 4TWRA 3HDTA 2FRDA 3OU7A 2GSWA 3T3NA 3OHSX 3EVFA 1ACLA 3TAXA 2C7QA 1EDZA 3K6JA 3D9QX 3IBSA 1IHYA 2JRLA 2ET6A 2EYQA 1OLSA 3LBFA 3ZLBA 5BWNA 3QJ5A 3C3CA 5GONA 4W9MC 2ECQA 1C1XB 2AJ8A 3O03A 4MHOA 2ZIZA 2FFAA 4P3NA 2KBEA 1QFSA 4QIHA 1V35A 2BTQA 1S5PA 3O4GA 4JLOA 4AF8A 1QRDA 2CZCA 1RI4A 3MT9A 2ZAGA 1LS6A 1QG0A 2Z5FA 2YV5A 4U2FA 1Y81A 3KFXA 1FX1A 3AR6A 2EW2A 1YS4A 3TNFA 3UQZA 3TW6A 3WMXA 4OOFA 1H93A 3UCEA 1N2CB 3LL7A 1J24A 3DPUA 4IM7A 2OD7A 4B3BA 2H4XA 1TOAA 3SJZA 4KXVA 1D0SA 2Q3FA 3WLRA 2ZIEA 1G2IA 2ATCA 1T0JB 2CBXA 3TH5A 5CBPB 3T4EA 3NQ41 4WFQA 1Y89A 3PNBA 4C3UA 3AVUA 2BMEA 2W6JA 2F2TA 1H05A 1NVVR 4P8RA 3V7UA 1KSJA 3WYNA 2DCUA 1PDWA 4AIIA 1HOTA 2ZEJA 3HKEB 2MT9A 4HQFA 2FSVC 2G09A 1EUDB 2WC1A 1CUSA 3W5HA 1ISGA 2P67A 1QOZA 1N7IA 2IU6A 4HS4A 2Q0SA 3C98A 2QZSA 3RK0A 4POOA 4DV3B 3EVCA 3FCSB 2EV9A 2FEWB 5AW9A 3IMEA 3I61A 3E9QA 5JAIA 5AUQA 3VJRA 3ZQUA 1A4RA 2PQ2A 4WE3A 2FFRA 1FW6A 1T0HB 1F38A 4EJSB 4FFMA 1U0BB 5ENVA 1HWYA 3L4SO 4DJTA 5EP3A 1E9CA 1WKVA 3EA0A 1WNFA 1S2IA 3EVBA 1E6LA 4YFYA 1NPYA 3G2LA 3TVYA 5KTPA 2P90A 4UAGA 2LCFA 3G49A 3VU0A 4U39A 4QL3A 2JH8A 2IW3A 4H16A 2GXQA 3DE0X 1POXA 3I72A 5IKMA 4N47A 1E4EA 3DWIA 4YXWA 1BQ3A 1RWMA 3KWMA 5LUAA 1X74A 3CB4A 2W2VA 1W93A 1R4ZA 4DA7A 3FVQA 5J2UB 2Z9BA 5K3BA 2HLPA 2A3RA 3DC7A 4INPA 1UOPA 4WZZA 1BEEA 1XDDA 2JBAA 5DK4A 5GY7A 4HWGA 4NHEA 4UCWA 1M0EA 2AJTA 2H18A 3ZE1B 5DHPA 3OEYA 4DCUA 2DP4E 1U8EA 1U1CA 2XADA 3R0VA 1O94D 1W8IA 2ID9A 1CR4A 4GOLD 4MCHA 5E1MA 4RM3A 5FWAA 3GR6A 4XWOA 1V43A 1CJKC 3OLQA 2HZBA 4I36A 4P7KA 4C5BA 1N6RA 4XWAA 5EP4A 5IWAB 1W8DA 2IUSA 5D85A 4H7PA 2X0DA 3G0BA 4ZJYA 2JKZA 2YQZA 1W35A 4G0PA 4Q1VA 4RWEA 2H17A 1L7DA 2PGJA 3AJ8A 4REOA 4EMUA 3F98A 4BB5A 4MI3A 2O19A 1DQNA 2B4YA 2VK2A 1RJWA 5MF6A 4RUKA 1LPOA 1EGMB 4U2BA 4YXWD 3EZ6A 4MQFB 4O4IB 3AYXB 5BR4A 5ARBA 2ZSHA 5EKUA 4EMTA 1OLSB 3BMQB 1LSOA 1GCIA 1U7ZA 4WESB 1WXHA 3OI7A 4BZWA 2ORWA 5D86A 2P6RA 2D5AA 1SXPA 3CINA 2JZCA 1P33A 1SKYB 2WIBA 1I8TA 1U7WA 3IP1A 3G6WA 4NPHA 1SXJA 1MC1A 1Q12A 4CLHA 2XZOA 2V03A 2JLQA 2QAGC 1DCKA 4B3XA 5KJCA 2YVLA 2BH2A 1EWYA 2IOQA 1Y8RB 1CUHA 4LMPA 3OX1A 4FSXA 4Z2YA 4AMYA 1NYLA 3PCRB 3TGWA 1HF3A 1KOJA 3RSFA 4LFCB 1L4KA 4MR9A 5C5DA 4IJ5A 4ON9A 3TRFA 4C0HA 2F3UA 2WSMA 1ESMA 2AB0A 3B7WA 4E2WA 3HVRA 3VU9A 1OLUB 2V7QD 4ER3A 1G5TA 5J9FA 1HV8A 4A5OA 4BATA 4C4AA 4DDKA 3MW8A 1XLTA 2NQTA 1C50A 3PC8A 3TBFA 1TYEB 3NYIA 5E2IA 3MB8A 1TU4A 1JIKA 5H82A 1J9EA 1YR3A 3QF4B 1AX9A 3N3BC 1IM5A 1ZNQO 3PZBA 5EXPA 2AKYA 2K87A 2IV3A 1IWOA 4KQCA 3EDCA 4ZFNA 5J1SB 1M2KA 1OU0A 1I1HA 4Z1MA 2QMEA 3HLTA 4B3GA 4BC1A 5KQRA 5AJZA 5HZKA 3COJA 1KFEB 3AJAA 2AR7A 2IYXA 3DEFA 4CIAA 5B2EA 4Z1OA 2W0SA 2B21A 1QMPA 2XLCA 3T4XA 3UUFA 1UT6A 1GZDA 1KDOA 3R5TA 3NHSA 4WOKA 5DT9A 1R4NB 3IDOA 4LZWA 1OI2A 1GUFA 4WECA 3ZD8A 4Z7NB 2G1JA 3RD5A 2VRWA 2O3SA 2VUSA 2NZVG 2VZEA 4W6ZA 4U9HS 3WQRA 2R86A 4CLRB 5LN1A 4MITA 1GZVA 3VKUA 3OJXA 1UXJA 2D1SA 3SXJA 3EXHA 4L8FA 4DM4A 1DG3A 4JUDX 2N46A 3L93A 4HGZA 1AKMA 4X63A 5CPBA 2WAYA 1WOYA 3O3OB 4D82A 3PS9A 5KREA 1IEQA 2PO5A 1WF3A 1R0SA 3AL0C 2A9PA 1ZCJA 1GA6A 2WUFA 1CUGA 5ALZA 2Q8QA 4LJ7A 3W2TA 2AXEA 3ZCRA 4Y6GB 2HRDA 1H8HA 2AK2A 2BHTA 1FY2A 4BWVA 1GUDA 4ZEMA 1OGIA 1LW7A 5JDIC 3M3DA 3L04A 1F5NA 2G83A 1T3LA 1G8JA 1XU9A 2JCSA 2OCAA 1Z2AA 2QU8A 3FI0A 3H1PA 1O8BA 3A6EA 3SMVA 4D0NA 2ILTA 2GZAA 1G8AA 3H3XA 5AI4A 2EP7A 3DTYA 3F1LA 3OCUA 4RQUA 3CUYA 4HAVA 5LBUA 5DM60 3N0TA 2OHHA 3PUIA 4UZSA 3QRWA 1YCGA 3LUJA 1V7PC 1VMKA 3GUVA 1C0PA 2A0KA 1OYOA 3KHSA 4HRAA 4NVRA 3S27A 3TL3A 2YJGA 2JIPA 4MDEA 3ZY3A 2N75A 5ANRB 3RCBA 4R1UA 3BMOA 3ZDFA 2VT7A 1W36B 4C87A 5K3FB 4DILA 2J4FA 4EKIA 4P4GA 2VNSA 3CLRC 4NYIR 5GIOE 2COEA 4RO0A 3WYAA 5IZCA 4FT2A 4HB4A 3O9ZA 2ZUUA 1NSFA 2HCFA 4ZOEA 3VC2A 3DMRA 1PQYA 3O91A 3R23A 1A88A 5J2TA 1VXRA 3GLHA 1FUEA 1M2OB 1SCNE 5DYGA 1SUSA 2HXYA 4HLNA 2ZSAA 2B8TA 4WZAE 1N9GA 2GEUA 4C0WA 1ZOOA 3R5FA 4L7VA 2C2HA 2OBFA 2E21A 4O08A 1Z74A 1FNBA 2EX4A 2GPAA 2JIZA 2JLSA 2P77A 3OX2A 1SC9A 3W8DA 4EJSA 3IUYA 3I5AA 5AESA 3CU5A 3EUFA 3PE3A 3V1UA 1HQYE 3KYCA 1ILEA 1CE8B 5FUBA 2VO1A 4LZPA 1ZH6A 4E51A 4XEUA 2YICA 3BMNA 4PTYA 4M6WB 1Y37A 1EXNA 5KOJA 4DMFA 1VLQA 1BS1A 1KI6B 4AW9A 3QTTA 4PLFA 3LF2A 1NI5A 2QYOA 3BC1A 6AT1A 1NE7A 2HNBA 2OZEA 3AHIA 5KQGA 3OZVA 3R9WA 1ULHA 3T34A 3MCZA 4GOJA 4YP6A 2ATIA 621PA 4O2LA 1XA4A 1X2BA 1SRRA 4I8IA 3W6OA 4DR3B 4FMCF 1ADJA 3F4KA 4MPDA 4WOJA 1QYWA 3QMMA 1RWBA 3BGWA 3D6NB 3L0BA 1KMIY 2EKZA 2MYTA 4Z8YA 3IUQA 1WUTA 4XJSA 3RWMB 3W9SA 4NMXB 1YRYE 4LZAA 2ZWVA 4EELA 5I3CA 3KZNA 1T5IA 4X1YB 3TJMA 3WYEA 4QGGA 2BTQB 4BRUA 4COKA 3WGQA 2H4HA 3LQ4A 2WTUA 2R0QC 3F3KA 2HJGA 3SS7X 2J7PD 3K5IA 1AKTA 1KA9H 2BE7A 3LQFA 3V2HA 5KWJA 3WR5A 2EWWA 2GZRA 2P9TA 1L7OA 2YIMA 3TQIA 4LE1A 1T1SA 1DDGA 3DMDA 1WABA 2YDXA 4K3UA 3THRA 5JNSA 1O5TA 1WPXA 4INJA 3ZV7A 5EMNA 2DM6A 2VR1A 3K8ZA 3L8ZA 5GOZA 3AUKA 4CMGA 3WK8A 1DBRA 3WDMA 1SY7A 4QUDA 4YDHB 1VLVA 4EGCB 1K8ZB 1LLFA 2CL7X 4R54A 5DGIA 4G89A 5A5GA 3LGAA 3COVA 5JMOA 4BEJA 1QYXA 1UUFA 2E48A 2B20A 2W98A 1YL6A 3LI2A 2O1SA 4GPAA 3UK6A 4ARVA 5BPFA 4LKRA 3QXSA 4ZGBA 5JADA 4BPBA 4P92A 1B0ZA 4AB1A 4WCDA 2R4QA 4C7OA 3GEIA 1JKXA 1AXEA 1E5DA 2NT3A 1H2WA 3QMPA 4URZR 4MUGA 4LECA 3VVCA 1KEVA 3E3MA 4F84A 1XYYA 3C3WA 4P4UA 2GUWA 2PG3A 4QPJC 4PX2A 2VZ0A 3GLHE 3MS4A 5FLXA 4ZYUA 1XPOA 1RRPA 2JLBA 4KO2S 4BFXA 3SFTA 1MOQA 3C3DA 3PVZA 2DH6A 3DKPA 1EUDA 3F6PA 3STVA 1BVYF 4H7EA 2CNWD 5K3FA 3PYXA 1W5EA 3UJ6A 4IQ0A 1Y1PA 1G20A 1SO8A 3SBXA 5CB6A 2BT4A 5K0LA 5JH7B 3CZQA 3T3HA 2D1YA 4M37A 3U0BA 4KXNA 4P4LA 2ACWA 1I4OA 4MAMA 3W1WA 1IBMB 1TIPA 2ISCA 4IQGA 1JEQB 1KAGA 2R25B 3E82A 4QU9A 4REQA 3RHFA 1NHGA 2CJWA 5EJ2A 4RL4A 4JBXA 5KNCA 1YJ5A 3IPCA 5C8VA 3T5AA 3CHYA 2YV1A 3GT7A 2FPRA 1TT7A 3BAZA 4UM7A 2G1AA 3O6VA 4RM2A 1U4SA 3L4BC 5DNEA 1TB4A 1SRQA 4TMYA 1NT4A 2JIOA 4R1MA 4BASA 3WWYA 2IS2A 1UBJS 1SG6A 3DL2A 1W49A 3UANA 5KIAA 3DOJA 2REOA 3U7QB 1PZFA 1K97A 1Q7BA 3V4ZA 4ZI7B 5EJ4A 1SC3A 2PV7A 4LCJA 1FA9A 4X93A 5T6BA 1OBFO 3T0IA 3K09A 2Q1UA 1Z33A 1K3UB 1MJ5A 3B1JA 3OM0A 4MV6A 2DT5A 4FJ1A 5AI5A 1M6YA 4TQGA 5P8WA 3SKYA 3DONA 1R8XA 1VLHA 3CMMA 4GI3A 4L75A 6REQB 3HADA 1IMJA 1YGPA 3VO2A 3AVPA 4CEIB 1Y4AE 1EGVB 2UXCB 4F4IA 3GIWA 4AK9A 4QGFA 5CRIA 1JH9A 1GZ6A 2IXTA 1KNXA 1ZJJA 2HA0A 2JAQA 1VG9B 1AKWA 1UFKA 1W85B 2HRZA 1PS8A 3DH0A 3EZXA 4JIMA 4MP8A 3NEPX 4FU0A 1NY6A 1PG0A 3PLNA 4QJBA 3LOQA 3KKZA 1IYZA 2I8CA 5BXQC 4OQFA 3I9NA 3PNPA 5K8IA 2NYUA 2LR0A 1KO1A 4J90A 1Z2EA 3OCXA 1DAFA 3KPUA 3VYUB 1EBFA 1RQXA 4H3SA 1I7SB 1P2GA 1HYQA 1Y82A 1ZAYA 1P74A 3GT3A 4M7OA 3QOFA 1CR2A 1K4MA 1RKUA 1AIPA 2WMOB 4QXRA 2J07A 5GINE 2P9EA 2QLJA 2ZUFA 1E5VA 4YUVA 5P21A 1AQNA 4XGKA 4IQ4A 4AY6A 4QFBA 2XX3A 2C54A 3PXXA 2WVHA 1IWBB