3V1NA

Crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, after exposure to its substrate hopda
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGQWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of an Acyl-Enzyme Intermediate in a meta-Cleavage Product Hydrolase Reveals the Versatility of the Catalytic Triad.
pubmed doi rcsb
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
molecule tags Hydrolase
source organism Burkholderia xenovorans
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v1nA00
4X91A 1BEEA 5DYYA 1XZLA 1ODSA 1GKKA 3CN7A 2Q0XA 5BWCA 1IZ8A 2HU7A 1W4LA 2OLEA 4KRYA 1ZJ5A 2QJWA 4AMZA 4RE5A 5FKJA 4M0EA 5IVIA 3GFFA 3WL7A 3EF3A 5ALLA 3MVEA 4FBLA 2ZSIA 5AKLA 4DMCA 1XZGA 3QMMA 4V2IA 4MQLA 4G1FA 1HQDA 4UBJA 5JD5A 4G4IA 4OU5A 3AILA 5FDFA 3IA2A 3V48A 3H1BA 4FNMA 3PICA 1UK6A 3V1NA 2HDWA 1N1MA 2C7BA 3SWWA 4B83A 4FKBA 3IULA 4WFJA 1P0MA 3QVMA 3LP5A 1H2XA 4HRXA 1UKCA 1GQSA 4KE9A 1N5MA 1UXOA 2Y6UA 2WKWA 3H0CA 3H17A 4N5HX 1TK3A 1IUNA 3AZOA 1FFDA 4BP8A 3KOOA 3MUOA 1XZHA 5CTAA 3BWXA 2EDCA 1SCIA 2XUDA 2XLCA 5H3HA 4J0DA 2PSEA 1IUOA 4LYDA 2QZPA 2Y2UA 1HKHA 1MAHA 5K3DA 2WTMA 1MX1A 2XMZA 4QDZA 1A8UA 4AMYA 5EHQA 2JF0A 3G8YA 4S0XA 2PSHA 3WL8A 1CPYA 5E4YA 2WQZA 5ALUA 4Z49A 1Y7IA 1XLWA 3WKEA 4DLNA 4MJ3A 4BDTA 2FUKA 4UHDA 4AB1A 1ZI8A 3L1IA 1T4MA 2I03A 4BE4A 4EHBA 1ZICA 4U2CA 1J1IA 2VF2A 5AK5A 3DYVA 4QDTA 2C4HA 2JGMA 1DWQA 1XQXA 2JBWA 3O4GA 5FP0A 2BUCA 3WA6A 5DYWA 3D59A 4Y2PA 1ZIYA 5AIBA 3GROA 5JYCA 3VDXA 3HACA 1GT6A 1Z68A 3TEJA 3R3UA 4LXHA 2PBLA 4P92A 2CUTA 4C4XA 2V97A 2XT0A 4H7HA 5ALFA 4QZVA 1C7JA 4C01A 2Z8XA 4QDXA 5C8XA 2PL5A 3PF8A 3ILSA 1TRHA 1QIMA 5JD4A 3WI7A 4I3FA 5LZ5A 3N2ZB 1W76A 1XRLA 1F8UA 1BRTA 2OQIA 4FTWA 4NVRA 4MWSA 4M0FA 4X93A 3WLAA 4H7DA 5CBKA 2XMQA 3IIIA 2Z8ZA 4MEBA 5D3KA 1BE0A 1TQHA 4DSZA 5I7UA 1H2WA 2RHWA 2G4LA 3HRHA 2VEOA 3FBWA 2H9YA 4H7JA 4Y2XA 4P9NA 1CUJA 1YB7A 2OQVA 2DCMA 4MYSA 2J4CA 5LZ8A 4F5ZA 3F97A 5C8VA 1R88A 1DX6A 1XZAA 1GGVA 4LYEA 1G4HA 3E1GA 4BCCA 2XUIA 2AXEA 1QZ3A 2WU4A 5A7GA 5K3BA 4QLOA 1EXWA 1XZEA 4UUQA 3ESAA 5HCUA 4Y2QA 1QIKA 2ROQA 4IQ4A 3I2GA 5CRIA 3ICWA 2GYUA 1CFJA 2H1IA 2B4KA 5T4HA 5A6VA 3UUFA 1CRLA 4HXEB 1YCDA 2I3DA 3DYIA 4Q82A 3VVLA 3EQ7A 4M0MA 4P93A 5AK6A 3W9UA 4TGLA 1YA8A 2QTBA 3W05A 5DYTA 1XZIA 5ALXA 1NU8A 4U2DA 2JGEA 1XZMA 2WIKA 4JEIA 3FLBA 4AN0A 2IITA 3ANSA 4C6HA 1GPLA 1H2ZA 4PO3X 1ZD2P 2I78A 4INZA 4BE9A 2OGZA 3D5EA 4JYPA 3PFCA 3BF7A 4IH9A 5AOAA 2JGLA 4BCDA 4H7FA 4U2EA 5AKJA 2AJ8A 3I2JA 5JADA 3FAKA 4AO7A 5CXXA 3ZV7A 4AZ0A 1YA4A 2WUFA 2XLBA 1XKTA 5FUMA 4BVLA 4Y9SA 4OD0A 5K3EA 4EY8A 3KD2A 1VOTA 3LIPA 3DEAA 2O2HA 4XWGA 2C5GA 2O7VA 1JFRA 2CEKA 5I8PA 5AKYA 1AGYA 3BXPA 1NX9A 2OXEA 2DHDA 1E89A 4X85A 1MT3A 2BGNA 5AH0A 2VJAA 3BF8A 1K63A 1N8SA 1AX9A 2G5TA 3M83A 3D7RA 4WY8A 5HF5A 1ZIXA 2UZ0A 3ESDA 1YR2A 4KE8A 2WHPB 5EHXA 5ALVA 3MUNA 5ALOA 1LZLA 4EY4A 3S2ZA 2FJPA 4EA6A 4F0JA 4U2GA 4BZZA 2ZSHA 4DM7A 4HAIA 2WFZA 1DT3A 4UBKA 1WOMA 4J0HA 3ZLUA 1CLEA 5ALDA 5FRDA 5K3AA 3I1IA 3QH4A 3I1YA 3HABA 4HTAA 4D9JA 4LXGA 2XMBA 3M81A 1G66A 5EFZA 2YASA 4HXFB 2XMCA 5HK9A 1QO9A 1EX9A 5HF9A 2HHAA 3K6KA 3WQHA 4BVJA 3HJUA 5AI4A 5LZ2A 2BKLA 1W1IA 2D0DA 4BP9A 2PVSA 1I6WA 2HU8A 2VATA 3ESCA 5J3JA 3STWA 3K2IA 5T4EA 1JMKC 3VJKA 2QKYA 2OG1A 5IVKA 4UHEA 4XIIA 1PJAA 3H2KA 2HADA 1QFSA 4E46A 3I6MA 3HEAA 1QIHA 4A23A 2IIVA 1XROA 5ALPA 3AFIA 3STVA 4X00A 5AKGA 4ARBA 2OCIA 4N8DA 3DL7A 2XUKA 3CCBA 1YSCA 2EDAA 5JAOA 3AIKA 1XZCA 5E2IA 1J2EA 4G4JA 2JEZA 3IUMA 2G63A 4H18A 5LKRA 3YASA 5AHXA 4OSEA 2RI6A 4UHCA 1QIIA 1GZ7A 2ONCA 2WTNA 3HYSA 1O6GA 2WHPA 4OYLA 2CJPA 1ACJA 1E8MA 3WJ1A 2WUDA 1MAAA 3R3YA 1MU0A 4BAUA 2QUBA 3WK7A 3G0CA 2HA5A 4N5IX 3HI4A 3QMVA 2QOEA 1BROA 2DSNA 1EK1A 2C58A 2GBCA 1BN7A 3QMWA 1KU6A 5AI6A 4Q34A 1UWCA 3A70A 3IUQA 1EDBA 4ZXFA 4IH1A 2CZQA 2XUJA 5CT4A 5JIBA 5LIPA 3FYUB 1IZ7A 4L3WA 3EQ8A 2HFKA 3WK5A 2CBGA 3V1MA 4J0KA 1MNQA 4Q1VA 2XUAA 1UZAA 3STTA 3ESBA 2B20A 4ZGBA 4ETWA 2AJBA 3IUJA 4B82A 1XRQA 1UK7A 2YYSA 2QJRA 4X94A 1UKAA 1M33A 4KRXA 1QIDA 1QFMA 3C43A 5JASA 3OM8A 4BAGA 1E5TA 1BEZA 1K5PA 1QTRA 4Q3KA 1MO2A 3D2AA 5AK4A 1XZFA 4G9EA 5HF8A 5DNUA 3C5VA 4KJXA 4ZI5A 3QITA 1WB5A 5K3FB 4C88A 5IVHA 2G5PA 3WWOA 2RONA 2BGRA 3D2CA 3FOBA 4X6XA 1ZI6A 4X90A 1GPNA 5CH8A 4W63A 5AK3A 5HK8A 4DMHA 2GZSA 5LZ4A 1RWQA 4X71A 3R40A 2ZJ7A 1XQYA 1CQWA 4WFIA 4EY6A 2C0PA 4NS4A 3O9VA 1QIGA 1JMYA 5ALGA 4BCBA 5ALIA 4GLBA 2PSJA 4AZ3A 3C6BA 3HXKA 5AKHA 3G9UA 4Y2JA 3WZLA 3FYUA 4C89A 1CUIA 3DLTA 4EUSA 5HZGA 5ALHA 3PUIA 5KBYA 5JANA 1H23A 1SCKA 3JWEA 2X76A 2YH2A 3RK4A 3A2LA 3G0BA 5KREA 2OAGA 4FWBA 1K4YA 3FSGD 4WJLA 2B61A 1QE3A 2X8BA 2WG2A 4P08A 5LP1A 1P0IA 2XUHA 2DHEA 2DR0A 1YAHA 3WWPA 3STUA 5BWBA 1CVLA 3A6ZA 2XDWA 4LKOA 2HL6A 1VXRA 5T4FA 1HL7A 3C8HA 4H35A 4B85A 1MX9A 1CUGA 4ZWNA 4I19A 4QDOA 2WFLB 1JT2A 5BV7A 1JJIA 3F8SA 4IO0A 5EIAA 4BRZA 5K3FA 4C4YA 2J3DA 1XZJA 4W1PA 3RARA 4B0OA 3I2IA 3W04A 1HBJA 1AMNA 5ALSA 3O95A 3B3QA 3FNBA 2H7CA 4Q3LA 3WWCA 1ORWA 3U0VA 5HKAA 1B41A 1FFBA 5LZ9A 1KEZA 3E3AA 4FLEA 3G0IA 3U1TA 7YASA 4WDRA 4PSUA 2BAGA 4KAJA 1OCEA 1QOZA 3OC0A 2IX9A 5ALJA 5IH7A 1ZGCA 3PUHA 1LGYA 3K9BA 3G7NA 2DFPA 1W6RA 3KXPA 3L1HA 4UBIA 1ZOIA 3ICVA 4G8BA 3WJ2A 2HA4A 5AM0A 4RNCA 5AJHA 1LPOA 4ZRDA 1QJ4A 5E4TA 5C81A 3I2KA 2VTVA 2OCKA 5JATA 1BN6A 2PKYX 3DD5A 2PSFA 2XMSA 2VSQA 1E8DA 2O7RA 2PX6A 2WIJA 5AM3A 1TCBA 5JZSA 4ZV7A 4EB0A 1XRNA 2ACEA 4OUKX 2DHCA 2H7XA 2EEPA 1CUFA 2RHTA 4GHWA 1EI9A 1CUSA 1F0PA 3M3DA 5JALA 2H7YA 1MJ5A 1DQZA 1A88A 3WK4A 4K6HA 2WFLA 3NWOA 3AZPA 5ESRA 1W75A 5C7YA 5AIAA 3TGLA 4HRYA 2I3ZA 3WK8A 3EBLA 4UPDA 1VE6A 3IURA 1LPSA 4UFNA 3EQ9A 1H22A 3OG9A 4J0JA 1XLUA 4W1QA 3N0TA 2XUPA 4WFKA 5AKIA 2BUBA 4BC0A 3A2MA 1EB9A 1H2YA 5EI5A 3V1LA 3JYHA 5CT6A 5AO9A 1LBTA 4EY5A 2HIHA 3ZLVA 4IHAA 1QTIA 3G9TA 4KEAA 3D3NA 2R8BA 1SOMA 3P2MA 1DT5A 4JUIA 2V98A 2XUGA 4G8DA 1XZDA 1ETHA 3G9XA 1ORVA 3R41A 3QZUA 1XFDA 3LLCA 1XLVA 2CKMA 1U65A 2Z3WA 1UKBA 4WDQA 4UBLA 4PF1A 4CI9A 3RLIA 2Z3ZA 4BRSA 1RYYA 4X6UA 4CCYB 1AQLA 3IVMA 5F4ZA 4A16A 2CMFA 5K3CA 2Y6VA 3T4UA 1KU0A 2RIPA 3AIMA 4C87A 4RPCA 4CG2A 5CH5A 4B0PA 1BCRA 5DWDA 3DS8A 3NUZA 4F60A 3WKAA 1EDEA 3BJMA 3FSGA 4DNPA 3FCXA 5EHNA 1CIJA 3PI6A 4KACA 5FLKA 4CFSA 1LBSA 3FCYA 4JNCA 4Y2SA 2ZYHA 1TIBA 2GBFA 5ALQA 4AXBA 2HFJA 2PM8A 2XI4A 2QR5A 1UK9A 3BE8A 4QDUA 4UHBA 2ZJFA 2XMRA 1LPMA 2VJDA 1JKMA 4NZZA 3DOIA 1NU6A 5AI5A 2QUAA 4NMWA 1WPXA 2AJCA 1CUEA 4I4CA 4B84A 1E8NA 5DNVA 4OPMA 4Y2RA 4QWWA 4LIPD 2XE4A 4X6YA 3AIOA 2O2GA 1OILA 4DMFA 2V96A 4J7AA 4XJVA 5JD6A 4BBZA 1IUPA 5AICA 4W1RA 3T52A 4X92A 3I28A 3WKBA 1RP1A 5FPPA 3TJMA 1UOQA 4EBBA 1R50A 2PU7A 3QM1A 4YPVA 4Y7DA 2XQFA 4B81A 5ISMA 1SCQA 5FOQA 1R1DA 1C4XA 4CCYA 4BDSA 3OPMA 4HS9A 4G5XA 1DTEA 1IVYA 4YK7A 2VA9A 2W22A 1QIFA 2CB9A 6YASA 5CH3A 5AI0A 3WWDA 1JJFA 3B5EA 1FFEA 5D6OA 4EY7A 3DKRA 3IB3A 5AP9A 5JARA 5AKXA 5AOCA 1UOPA 4ZV9A 4B80A 2QMQA 2WILA 4OCZA 2RGUA 4CIAA 4X95A 2DQYA 2WG1A 1EVQA 4U2FA 4QEKA 1YAJA 1YASA 1ZD5A 5HKBA 1MTZA 1EDDA 4H7IA 3C8DA 2WU3A 2HM7A 3WYDA 4DSAA 2OCLA 4BZWA 1R9NA 3OTQA 4MQMA 3C6YA 2QXUA 2J4FA 2QXTA 2HA6A 1F0NA 3WL6A 4X7BA 1W52X 1AKNA 1R9MA 2WJ4A 5AM4A 1QGED 4Y2VA 2Z5GA 4J0IA 4AO8A 5JZBA 5T4BA 4BYMA 1P0PA 1G5FA 3C6ZA 2PUHA 4JH0A 1MX5A 1VA4A 3R3VA 5ALRA 5K5EA 1T2NA 1THTA 1CEXA 2Y2VA 1L7RA 3VJMA 4BB0A 4UBMA 4HZGA 1CUDA 1U2EA 3OURA 4X3CA 1Y37A 1UK8A 3SC2A 4DTCA 5YASA 2C5FA 3STXA 4OB7A 1Q84A 2HA3A 2PU5A 1UFOA 3VJLA 2PSDA 3C87A 3WZMA 4GDMA 3FLAA 4N8EA 1XQVA 2ECFA 4KE6A 2ZYSA 4B9AA 4GWLA 5HF6A 2XQJA 1WHTA 3PF9A 2RAUA 1MNAA 5AM2A 4W1SA 3ED1A 1AZWA 4O08A 1CUXA 4KAFA 4J0GA 3H18A 4K5QA 5IKXA 3BDVA 3F98A 4J03A 3VISA 1F6WA 4GI1A 1E3QA 1ZD3A 3CN9A 1PV1A 4L0CA 2HU5A 1U4NA 3H19A 4H0CA 2VAXA 3W06A 3G9ZA 2WHQA 4EZIA 3DL4A 2GBIA 3STYA 3DKKA 2ACKA 2VJCA 4MXDA 1GPKA 1LPNA 1QIJA 1CUCA 5AM5A 5SYMA 1HLGA 1Q0ZA 1MPXA 1WB6A 1CR6A 4CG1A 4J0CA 3D2BA 3KDAA 1CUAA 5A62A 4HXGA 4K6GA 2VT7A 3LIIA 5A2GA 4RGYA 1JI3A 4PQEA 3D0KA 3QPAA 2OPHA 3ZPXA 2XB6A 1LPAB 5HFAA 3PE6A 1CQZA 4FFWA 1QLWA 1ZI9A 3AJAA 1TCAA 3UUEA 1J07A 4E11A 1JU4A 1A7UA 4BVKA 3Q0TA 4OB8A 5LKAA 2P8SA 3R3WA 1HPLA 1CUWA 3B12A 2ZJ6A 4GXNA 4CCWA 3MGAA 3D4LA 4IH4A 3FYUC 2AJDA 1TCCA 3WKDA 2XUFA 5IVDA 5JAHA 1EHYA 2VQ6A 4E15A 2BUAA 3C45A 1K6EA 4K6KA 3FWHA 4GBGA 2J3QA 4QA9A 1Q0RA 3Q8WA 4B7ZA 3BJRA 3WIOA 1DX4A 5FXMA 5A7HA 4FOLA 4RE6A 1ODCA 3AUKA 3WK6A 2XUQA 5JZ9A 2ORYA 3GBSA 4TPKA 1K8QA 2GYWA 3F67A 1XRPA 5SYNA 1VLQA 3AINA 1D07A 3H1AA 3WIBA 4Y2UA 3QPCA 2QRUA 1JU3A 1CUHA 5ALNA 1EINA 2WUEA 3GELA 1CV2A 5D7BA 2PUJA 5HQ3B 5CT5A 1CUUA 3DOHA 1Y7HA 1YS1X 1X2EA 1AUOA 2E3JA 3AZQA 4UHHA 4DGQA 3HLKA 1U8EA 4FMPA 5FPQA 4OYYA 3O4HA 1C7IA 1EK2A 5ALMA 4FLMA 3R3XA 2WJ3A 1E66A 3H2GA 3X3HA 1LLFA 2ZYRA 2GBGA 4G4GA 2XMDA 2XMGA 3CXUA 4N8SA 4KYVA 2WLSA 5CXUA 1FJ2A 3EIOA 2QM0A 4X97A 4E14A 4FHZA 4FFVA 1WM1A 1EB8A 4L72A 5JAPA 1EA5A 2GZRA 1S8OA 2FX5A 4U2BA 2JEYA 3FVRA 3DNMA 1BS9A 3I6YA 4AX4A 1FFCA 3LS2A 2HA2A 3QBJA 5ALYA 1R4ZA 4GW3A 4OB6A 3E4DA 1FSSA 3R0VA 2JGFA 5I9IA 4OU4A 3WWEA 1N5RA 3LCRA 2WSLA 3A2NA 3RM3A 1VZ3A 3BL8A 3VXKA 3ZLTA 3E0XA 2JGJA 1XRRA 1OXMA 1YB6A 4CIBA 5HQ3A 4DMKA 3ZI7A 4QNNA 4BATA 2DQZA 1DU4A 4Q3OA 1QIEA 2HRRA 3H2HA 1UT6A 2ZVDA 4PNZA 3R3ZA 4H7KA 4QLAA 5DTJA 1QO7A 4TVKA 1LPPA 1XKLA 4UHFA 1QONA 4ROTA 5LYYA 4L9AA 4BC1A 5DTIA 1VKHA 3IUNA 5CW2A 1TKRA 3G02A 1J06A 1L7AA 3KWFA 1PFQA 5EIHA 3DDUA 5CMLA 4GEGA 3ZWQA 4PW0A 2GYVA 3BIXA 5ALWA 5ALKA 3DJYA 5EHZA 1X70A 2BJHA 1A8SA 3H2IA 2K2QB 5CURA 2FJ0A 4UBOA 3BDIA 4C4ZA 3WKCA 1DQYA 3O4IA 4YX9A 4UFOA 2WHRA 2OAEA 4KAAA 5LLSA 2X5XA 1JJBA 4QWMA 5ALTA 1EH5A 4Y2YA 4HVTA 3HZOA 2WJ6A 3O4JA 2HA7A 4DIUA 1LNSA 5D3ZA 4DYHA 5CT9A 1THGA 5DJ5A 1VE7A 5AI9A 1DWPA 2VT6A 3OOSA 2Y1KA 1CUBA 4MEAA 5EIEA 2R11A 5C8ZA 4FBMA 4FNGA 3M82A 1R3DA 5AOBA 1DINA 3I2HA 3C5WP 1CUZA 2VJBA 2XQIA 1VA5A 1AC5A 4ARAA 1AURA 5KWJA 3HC7A 4XX1A 4J3JA 5AM1A 4AN1A 3DQZA 1CUVA 1XZKA 3FYTA 4DNOA 3FLEA 1EVEA 3FVTA 2QS9A 4H7EA 3PDCA 1WPRA 5FV4A 2XQGA 3O0DA 4WCVA 2WFMA 4MYDA 1X2BA 2JGKA 3CCCA 4Y2TA 1VJ5A 2O2IA 1ISPA 3WMRA 2BCEA 2BFNA 2XUOA 2QVBA 2WG0A 1P0QA 1VZ2A 3GA7A 1XZBA 4BTLA 1WB4A 5LZ7A 3V1KA 1YS2X 1FFAA 4WY5A 1TAHA 4PSCA 2B9VA 2QT9A 3H04A 4DNFA 4F21A 2OGSA 2YXPX 3IDAA 4ITVA 1ZGBA 1ACLA 1IMJA 4CG3A 1SC9A 4AQDA 4QE3A 2VAVA 1GKLA 3SX4A 3TRDA 4UFPA 4B9EA 3HSSA 4G8CA 4A5SA 5AKZA 1XRMA 3GUUA 2HA0A 3C70A 4JYMA 3KSRA 4ZREA 3DCNA 1CUYA 2NW6A 5E4JA 5AKEA 3BIWA 5ALEA 5A71A 4LXIA 5HFNA 1ODTC 2ZYIA 4BTVA 4FLFA 2XQKA 4K2AA 4BAZA 3V9AA 1WHSA 2AJLI 2V9ZA 1LPBB 2WIGA 3UMJA 1ZD4A 3QPDA 5DLPA 3W9BA 3F96A 5ALZA 2PPLA 1XQWA 2WIDA 3WL5A 5CT8A 4XVCA 4MWTA 1WCYA 3G0GA 5DNWA 3PFBA 3VKFA 4KR0A 5JAUA 1G42A 3H2JA 3IBTA 4B6GA 2D5LA 1BCSA 1B6GA 3VVMA 1ZJ4A 1USWA 3RKSA 1BU8A 1Q83A 2C0QA 4PV7A 1L7QA 4W9RA 4GECA 1GXSA 4UBNA 1VXOA 2WM2A 4Q05A 2JIDA 4H77A 5EGNA 1SFRA 5AKKA 3WK9A 3W2TA 3GZJA 3KWJA 3JW8A 3C6XA 1MN6A 3O9MA 2ES4A 3NOXA 4FDMA 3I6ZA 3L1JA 4KE7A 3ANTA 1LZKA 1A8QA 2LIPA 3QYJA 4LHEA 4G9GA 4PSDA 3SK0A 3G0DA 1O6FA 3NGMA 1UOOA 5A7FA 2W6CX 3S8YA 3WYNA 3F9CA 2JGIA 2OGTA 3I2FA 2WIFA 5BOVA 5AI8A 4YASA 4DNQA 1DWOA 5KWIA 1GQRA 1HDEA 2HRQA 2WUGA 4AO6A 2OCGA 3WA7A
chains in the Genus database with same CATH superfamily
4X91A 1BEEA 1LI7A 2JIZA 3EY9A 3LOUA 3O90A 1C9EA 3MXTA 2C00A 1OWPA 4OKNA 4WZBE 5DYYA 5GOTA 5B1YA 1DUSA 4GGOA 4WZZA 5LCXA 4EZEA 1ODSA 1GKKA 5JO0A 3U16A 1U1DA 1CNFA 5B53A 1BFKA 1L5MA 4PZYA 1H3FA 2C4MA 1FP7A 4P53A 3BEOA 1W0JA 4EFNA 3L6BA 5CHEA 3HXMA 4CMEC 4RKEA 3TMAA 2QTFA 4I4IA 5IX8A 1CJCA 4EVSA 5SV2A 1O96B 5BW8A 1NLFA 1EM8A 2E6UX 4FN4A 3D8TA 3RC7A 3VVCA 4DIEA 3P9NA 2CVFA 1XMXA 4RZQA 5K6TA 2AK3A 2DUNA 2KHZA 2QUKA 4WN9A 3QE4A 2ZAIA 3WL7A 2OCPA 4DHWA 2H52A 3EF3A 2J1LA 3A14A 2PGOA 5AJVB 5ALLA 4EYGA 5DIFA 4ZTUB 1GA6A 4QRIA 5BSUA 2YQZA 4P0QB 3TLGA 5JS6A 1WEKA 5GINE 1DJOA 1VLVA 1F2UB 1NVKA 3B60A 1KI8A 1T4CB 4I5FA 2G71A 4JJ6A 4JUCA 4Y1GA 4PR0A 3QMMA 3WMWA 4V2IA 4YVFA 3OIYA 5IZCA 5AD1A 2NSLA 1RWWA 2DFTA 1CHNA 3M3HA 3VV3A 3FPKA 4YRZA 1FVFA 3BWBA 2V4MA 3LW7A 4HQOA 2VPXA 4G63A 4TL8A 5KPJA 3GPLA 2Y66A 1TGVA 5C3UA 4DADA 5JD5A 2J9YB 4MAFA 4LNHA 1TJYA 5LBUA 2O19A 1BFUA 5HUHA 4XUCA 2JDID 3IV7A 2A9OA 2LIVA 4ZA2A 3K5IA 4RPJA 3IA2A 3ESYA 2ODNA 3IBGA 3W4JA 4F4UA 4LSGA 3H1BA 1EFVB 4EQZA 4HCJA 3PICA 1UP4A 2JHFA 1UK6A 2IHBA 1ZSNA 5EYPA 5K8UA 4TSRA 3AP3A 1B74A 1WDWB 4JI6B 5JCOC 2XCSB 3OQMA 4I6EA 5DHQA 4MS4B 2EKBA 4ZI7F 2HN9A 1RQRA 3EVEA 1N1DA 2XCOA 1M10A 2UVPA 5KJFA 1PT8A 4HV4A 5F3WB 4O2BA 3D9QX 4MQ5A 2VHXA 5KNDH 2PE5A 4HRXA 1UKCA 2GRAA 2X8JA 3GFBA 3HVKA 3Q9NA 1Q11A 1RFLA 3R5FA 5EP4A 4AWBA 2L82A 4KE9A 1N5MA 4BFZA 3ABZA 4XCXA 2B9EA 3H0CA 3O3OB 1EFPA 3H17A 4N3AA 1D6MA 5EZYB 5C34B 1ZK0A 1WDKA 1GYRA 3TQQA 1C8KA 4WXMA 1VCIA 3QU5A 2AJTA 4DW8A 4EVQA 5JI2E 1IUNA 2IHJA 1YB2A 1X7HA 2H1SA 1TCUA 4NYJR 1M0EA 4YRNA 4BP8A 4ZVMA 5JNLA 3KOOA 1ISGA 4JJEA 1AV7A 2ZITA 4IIEA 1KFCB 2E5LB 1CCWA 3PDWA 1JQLB 2EDCA 3D7MA 2CXTA 1NG9A 4OMFG 2XLCA 2ZS8A 4FU0A 5H3HA 2JLRA 2F17A 4C6RA 3ELYA 1OXVA 2YWGA 1KKUA 1GARA 3OP4A 3PDHA 2CCJA 4OIFA 3GLFE 1OTHA 4FWTA 1CE8B 4LYDA 5C0OE 1M2OA 3RAPR 4I4TB 2ZS7A 3K2EA 1YKFA 4QEZA 1QRTA 1MAHA 1SG9A 3CS3A 5DHPA 3DAOA 4IRUB 3GP8A 1AIPA 2O3JA 3DWGA 3B9PA 1IM8A 4RS4A 3OD1A 5EQDA 5FIUA 5LOVA 1Z7BA 2I62A 1O89A 1O95A 4TS4A 2IS4A 4RWZA 3QYFA 3EIWA 2YV5A 3GRAA 1VG0B 3EFBA 4PX3A 1A8UA 1RP7A 4N40A 4M1OA 3RHSA 1C1XA 4JI2B 3L6CA 3AVXA 5EHQA 1BA2A 5KKCA 2GPTA 1WF3A 2JF0A 1DPFA 3F6PA 1M6WA 4AJ9A 4DT1A 3JZFA 4MGKR 5D3MA 4NC9A 2A94A 3U19A 1CPYA 3EYAA 1T3LA 3CC8A 3QOYA 4IINA 2BBTA 2FPSA 4BO8A 4CKWB 1GL3A 1GSOA 1RE0A 1U7DA 1ENZA 1Z73A 2FEWB 1Y7IA 2FMKA 2WQZA 4HAVA 1HDXA 3WGTA 3ZTWA 2D1YA 2IW1A 4GL4A 3IEKA 5K45A 3FUVA 2BGIA 3F5QA 4FB4A 2EIHA 2KWIA 4NCKA 4BDTA 5AVSA 5B1DA 4HWPA 1UKEA 2BR4A 2Y9PB 3SYNA 3I5XA 3ETDA 5E6UB 3T4PA 2R1ZA 1PJQA 4I4TF 3PGVA 5L3RA 2R4QA 2AFVA 3GCXA 3NR2A 2D7DA 1SCJA 4MV6A 5CDGA 1NF2A 1O94D 2CFRA 2FRVA 5F21A 3TXXA 5KHOC 2Q8PA 3CUEF 4J4HA 2EF1A 3HJHA 1DJMA 4H1UA 5KYUB 4JKYA 3KR9A 1IPEA 2EQ5A 2VF2A 3PKZA 4QDTA 5AK5A 4Z9FA 1I6MA 2QL7A 1ECBA 1JWAB 4JGBA 1W19A 3K0FA 4TS9A 3USZA 5AVVA 5DN6A 4FS8A 1EYZA 3DSRA 3EPKA 5KNDD 2C4HA 5JH7F 1OASA 2EJVA 2BH2A 1ORRA 3PEUA 5F1KA 1XQXA 5E9WA 1W93A 4XWAA 4MP8A 5CK5A 4PG7A 1M54A 1U6KA 1A77A 1V45E 2JBWA 3OZIA 3AR7A 3EWNA 4H08A 4X6LA 1KNXA 4WXRA 3L7CA 1V7QA 2HCFA 4UTZA 3UC9A 1RABA 4U7HA 3W8DA 1AGPA 3MJTA 2BUCA 4H1VA 3RROA 3WA6A 1KFJB 4FC7A 1QZUA 2GN2A 4DA6A 2NO0A 2HXGA 5AIBA 2P9ZA 3CW8X 3G23A 4PICA 5JYCA 2KM1A 5GVRA 3BIFA 2F8SA 2G36A 2IP4A 3RFCA 4QECA 3L49A 4C4TA 1Z68A 2F90A 2OB1A 1Z62A 3A25A 4NPCA 4YAOA 3TX6A 5JO9A 3ZE6A 3UT5B 3ZV3A 2HK7A 1P81A 1T8UA 2OCYC 2QLJA 3OCJA 4J2TA 4PFKA 4TYQA 3TEJA 4F9FA 2PX8A 1U6JA 1L7MA 4M1WA 4LXHA 2PBLA 5BXYA 2C5BA 2GAIA 2XQVA 3VPHA 1FVHA 3OPYA 1P2BA 1ZGGA 4WLOA 4BFWA 2H2AA 2LKCA 4HAUA 1QUFA 2V97A 5CFOA 4AKTA 1CJKC 2P7HA 1V35A 1SGWA 4ECAA 2O2EA 2ZQZA 1W59A 3KB6A 4DA9A 1MB4A 4KTVE 2R68A 2XYGA 5KYWA 4QZVA 4X24A 1PR6A 3CEJA 3FNQA 4U7TB 4C01A 3QWFA 3D8SA 4PC3A 3THYA 4R9NA 3UXYA 1RC8A 2GARA 1DBVO 4FOTA 4RNDB 5J4KA 4K03A 1VGVA 5A5DA 1V95A 4HUQA 3T15A 3R5HA 3ILSA 3AFGA 4NE2A 2YHSA 3Q3IA 4HSGA 2PWYA 5EZQA 2C42A 2AN1A 3HYRA 5LD2B 2B6HA 2BFMA 4RUKA 5D7NA 4O63O 1KZGB 2FPKA 1U0GA 2Q0SA 1IWOA 4RPKA 2AW3A 2RGNA 5KOHB 4WBNA 3SVTA 3VPGA 4B45A 2P2ZA 3WIVA 4JIGA 1NNLA 2C20A 2FWJA 4OQZA 1BRTA 1DXOA 1YC2A 1E6WA 5JZMA 1KZ1A 4KU4A 4H0NA 2VLIA 3RJMA 3CONA 2D3TA 4H7DA 2W11A 3KKOA 1CQPA 4JHXA 5HTOA 3C3PA 2FDCA 1A04A 4AULA 4C4AA 2FP4A 2EX1A 4I55B 5J4YA 3KQHA 1KF0A 2O05A 4MEBA 3KKNA 5I7UA 2RHWA 4MQEB 3WLIA 3K73O 3D6MA 3HRHA 1QTQA 2NQTA 2H9YA 4ALJA 2MT9A 4QYIB 4B7CA 1KPGA 2XYPA 1A97A 3PRJA 2DHRA 2P6UA 3R3JA 3I9FA 1CUJA 2ZYVX 3E27A 3MRSA 4PLYA 2VK1A 4MYSA 2A5DA 4JI7B 2C8LA 1W94A 2ZBRA 3KJGA 3SVZA 4UEKA 1P60A 2IYFA 1JXOA 1R88A 2C2OA 1LLDA 4P36A 1BD4A 1UBKS 3RVRA 2OLJA 4JI5B 1GGVA 1JS1X 2CD7A 2AHRA 3CVOA 5CLJA 1XTBA 4N76A 2BHTA 1RHJA 2G1UA 2RKWA 3MLEA 2W7TA 2REBA 3GJRA 3CX8A 3ZCTA 1KI4A 1UPCA 2GKOA 2UKDA 1ZK1A 1TXGA 2C03A 2BHRA 3PQ7A 4KIFA 3EGDB 5K3BA 1XZNA 3ZIAA 1ZZGA 1HEIA 1J7KA 1WY5A 1U31A 2XTAA 2WNHA 4N4AA 4YUVA 4PZEA 3RSHA 4F97A 1GFIA 3HU5A 3ZWXA 3OCUA 5BR1A 5EMNA 2UYHA 3ORHA 5TY0A 4D0SA 3FGPA 1CZKA 1XO1A 1RC0A 3OHMA 2FVYA 4OA5A 3TZKA 4ZMRA 2AFHB 4PZUA 4D4GA 3CX3A 3ZBTA 2W70A 3KUXA 3C3YA 2ZFUA 1CFJA 3ZHOA 5ITWA 3OT1B 2B4KA 4BRUA 4HDRA 2EJUA 1N9GB 1TFRA 1PZGA 1XD8A 2JJ8A 3FPSA 3SXPA 2DEUA 3OEED 3VVLA 3W9UA 2Q5LA 3HEMA 1ZVVA 3PR1A 5JAQA 1BDBA 2QYOA 3BZBA 2MCFA 5LB2A 4F4CA 1P6XA 2IGTA 3JD3A 5E6RB 2I1LA 1PS9A 1VI5A 3O4RA 3W1WA 3BRWD 3ZS9A 1V9SA 1XZIA 4PYIA 4A0SA 4DLTA 2ZTLA 2J08A 1V47A 3CT6A 4YJDA 4HAYA 1R0BA 2NPIA 4C7JA 1TAGA 2WIKA 1ISJA 3ESXA 4HAZA 4JIMA 3CLTC 6GPBA 3FLBA 1ZQ9A 2IITA 3IUSA 2JFWA 3ANSA 2NXWA 3U31A 1JR2A 4PO3X 3CE9A 2O5RA 2YIMA 3ML1A 2VDJA 4INZA 4ROSA 4BE9A 1SNYA 3I53A 3KDPA 3BGSA 3PFCA 1NMXA 1X1EA 4DZRA 4PZCA 4IWYA 4B2IA 5A6SA 1Z2AA 3L8GA 3N76A 1N5JA 5ERGB 5F3RA 3RBAA 1BMFA 2EIXA 3CF2A 2GILA 4H7FA 4IWNA 3RC2A 1LX7A 1DDGA 2CYAA 5DLYA 4M2LA 4DZZA 3PUKA 3MS7A 2RSLA 3M9XA 3KQWA 4LRWA 3O84A 5BN5B 5JADA 3QWHA 4EBFA 1E2IA 3ZV7A 4XVRA 2WU8A 2QXYA 1XHFA 1ZG3A 3OOHA 3AT1A 3H87A 4EF6A 2REQB 5DCWA 1Z2OX 2WWVD 1LDGA 1RHQA 1FTQA 4G1CA 2E4WA 4I3GA 1SVSA 2E21A 1JEOA 3CLVA 4OD0A 5CPFA 5FBHA 3WSTA 1KH2A 4AG6A 1TJNA 1DVRA 1E3MA 1AN9A 2LP4Y 2VDPB 1W2WB 5LSAA 2H0AA 4O0MA 4R2LA 2H31A 3DEAA 3O92A 1CRZA 2O2HA 1OLUA 4WBSA 2C5GA 2DF8A 2WK1A 2W4IA 2IEZA 4RK0A 1EEXB 2CEKA 4EVRA 2M9MA 1A9YA 3DVAB 1P18A 3IHLA 4HEJA 5AKYA 3PC2A 2RC5A 1FY2A 3KLOA 3OLCX 3BXPA 1C3OA 2ZRGA 4OLJA 3VNRA 2ZM5A 4CM4A 4X85A 4D44A 2IYSA 3S2FA 4G65A 4HWOA 3X1ZA 4S1WA 2PNJA 1W1WA 2IELA 2VJAA 2IV7A 3VO1A 2C98A 2YV1A 3BF8A 3A0UA 1FXUA 1K63A 2HSDA 4LSMA 3SIXA 1OJ7A 3SR0A 3TN7A 4AUEA 1I3CA 2REOA 3IKTA 3M83A 4WY8A 5HF5A 1ZIXA 2UZ0A 4ZVPA 4BNXA 1SQ5A 3URMA 5GY7A 4KE8A 1EIWA 5AJZA 2WHPB 3T3IA 2FOLA 5FR2A 2IH2A 2WTBA 4MUXA 1TJ5A 1OXXK 4MLCA 2WQ6A 1X92A 1IVNA 3N9IA 4ND3A 3S2ZA 3D02A 4U2GA 5D6NA 3FCAA 5FYQA 4TQAA 4BZZA 4XX0B 4MB0A 2WD9A 4NBRA 4K6FA 3BIOA 1PGQA 3BOSA 4QJBA 1X15A 3EVTA 2V59A 2GGSA 2HI0A 1PGNA 4IXTA 1DT3A 2PUVA 3ZH2A 3ZLUA 3J80A 4GC9A 2V5AA 2AOVA 4DARA 1E3SA 4LJSA 5K3AA 4HTAA 1FUIA 3OO0A 4EKDA 4MR8A 2QA5A 2J31A 4QRHA 3CB4A 1K6IA 3LJKA 4XFDA 1HE4A 3RCBA 4WQMA 4PNPA 3M81A 5B2ZA 1BW9A 1GPAA 2BGWA 2ZSJA 4DAEA 4FOOA 2ZJ0A 4JOSA 3TXYA 3HSYA 3GLIE 1H5QA 3MS2A 4HXFB 2WM8A 1BH2A 3F6CA 1KYTA 4FKMA 5JDIC 5CA1F 3PTAA 4QYTA 4X7RA 2C9DA 1AG9A 3IOCA 2LNDA 4N82A 1GKYA 1VMDA 2YRFA 1AS2A 1JEAA 1E6CA 2I7TA 4L6IA 1CEYA 4MI3A 3OBBA 2XNDD 5TPZD 1U0NA 2PSSA 3B2EA 4N18A 4HKTA 3H0KA 1Y8ZA 1JFVA 3OCZA 5FPHA 4YQYA 5G0WA 2CLEB 1K8RA 2BKLA 3GVIA 1QB8A 3JXEA 5J1TB 2IUUA 3VKWA 3WV4A 4ENTA 2PVSA 4QUAA 2NP6A 1SU7A 2PV7A 4WLFA 5EAIA 2FUG6 5F7ZA 2UZAA 1NIPA 1IHDA 3O2SB 4DMLA 4O4HB 5GGYA 1C9KA 2R8YA 5DI3A 3R3SA 4DCNA 5C52B 4B3MB 4MGEA 4C2BA 5BN3B 3VJKA 3HYCA 4FC6A 3IE1A 4PLWA 1Y8QB 1NL3A 1TUBA 2BRUA 3KKLA 2XCLA 1RCFA 2PR7A 4KBFA 2DFNA 4BJ1A 4CQNA 1G38A 2J7KA 1G8MA 1GR0A 1JT9A 3H2KA 4IIJA 2HADA 1QFSA 3I6MA 1J0BA 4NQRA 4Z1MD 4JLVA 2DFDA 5IVPA 4YMTA 5IANA 1G8AA 3HEAA 1KDOA 1QIHA 4RA6A 4A23A 1G5QA 3LAWA 2O3QA 1WXIA 3S4YA 1YS6A 1T8RA 2IU3A 3DJFA 3STVA 4GR5A 2B0CA 4X00A 5DBFA 5FOUA 1K6JA 2OCIA 4UVHA 3B5JA 1G4UR 3L4JA 4ADSG 4DWOA 5K8VA 1A8IA 1A9XB 3GLGA 1DQPA 2PKEA 5FPTA 3SLGA 2O20A 1P4SA 2R66A 2EKZA 1TQ2A 1Z15A 2A4KA 2HNBA 3C48A 4PEVA 5HFJA 5B1HA 4D9MA 1I7PA 2ZXFA 3UB4A 3ONEA 1IONA 1BMTA 4G4JA 1WKBA 3GEPA 4UPVA 1KMMA 3NHAA 4H18A 1L8AA 3LF1A 1VCMA 4O33A 4XYEA 3ZXSA 2BFEB 2QRZA 5LKRA 2QRPA 1PWZA 4G3XA 4P3KA 5DHSA 1J0XO 3T7IA 4GM0A 3UAYA 5IAAA 1U7UA 4W6QA 1KAGA 2FDRA 1IN4A 3BA1A 3BHMA 3MGCA 3KEMA 3ENVA 4OSEA 4RHXA 1JWBB 2R62A 1AUVA 4UHCA 3NV9A 3T0GA 3EISA 1RRCA 4WXHA 3O8RA 3I01M 1U3VA 3AHDA 4YLGA 3ZBPA 1Z7EA 1YBFA 4OYLA 2W37A 4XSVA 3AYXB 3FUXA 3KXLA 1S5PA 1C2YA 1KWKA 1AKWA 1VLJA 2PEZA 2FVXA 3NX4A 3SJBA 3J81k 1E2KA 4BGIA 4XJSA 2R8OA 3ADKA 3T61A 2R6DA 3OY7A 5J40A 2YYYA 1RHRA 3RKUA 4EGCB 2VHQA 4WOBA 2YV4A 4BAUA 2QUBA 2OFXA 2WAAA 5DV9A 2OM2A 4YAGA 3TQRA 2R1TB 2WMNB 2ZUBA 3N3AC 2AWOA 2JHCA 2OP0A 4NJOA 3RVNA 1FVOA 3NBUA 2VS1A 1Z22A 4Y1EA 4YCAA 3TL3A 3QMVA 1EVZA 5LXTB 1EK1A 3KX2A 3IS3A 3N6VA 2R8RA 4FDUA 3WLLA 3VU1A 5BOSB 5KDOA 1LU9A 2QL9A 3JQQA 3FPGA 1HQKA 4ARSA 3OCVA 3IMKA 1J8MF 3E2MA 1KU6A 4WJZA 3X44A 2D8AA 1F1BA 2FPMA 1XF1A 2X3YA 3D3WB 3IUQA 3SE0A 4BZXA 1FMJA 4C6TB 3HM9A 4AZ3B 4ZXFA 2IKQA 3ZGZA 4IH1A 3IIJA 2FW8A 1FQJA 4OJMX 3DCYA 3P2KA 5CVUA 2BP7A 4GPTA 4OGWA 5JIBA 5MFZA 3ZJ4A 4QSHA 4YY3B 1DG9A 3PEVA 1II8B 5TQJA 1B73A 1IZ7A 5I3ZA 2ZAYA 1B8OA 2CNDA 3EQ8A 5AVUA 5EMMA 2F43B 2HFKA 2QV7A 4W5OA 1ZAKA 2Z6UA 4IGEA 3BMNA 3JQ7A 3WK5A 2VR1A 1YZTA 2DLDA 2O7QA 3BXXA 4QOEA 1CNMA 4R9RA 5KHAA 2JLZA 2OSVA 2NAPA 4CNQA 1WU8A 1AVTA 4Q1VA 5HG0A 5LXTF 1EP2B 3I01A 3ZCXA 3DLHA 1BX0A 1WUHS 2G7MC 2QLFA 1N2CE 2VDLB 2Z1DA 5SY9A 4G0UA 2AD5A 1W36B 1UT8A 3VRHA 4QAJA 3EUFA 3STTA 3ROEA 3ESBA 1H66A 5EZ6B 2AJBA 3IUJA 5GM2A 1XQ1A 4PG8A 5MN5A 2CT8A 1E2NA 3F4LA 3PNQA 3LHFA 3QOXA 4I9HA 2D7JA 3KKZA 5JS7A 4MV4A 2R79A 1UKAA 2J85A 1K2WA 1M33A 3DTVA 2AOUA 1Y8RA 3GG9A 3P4XA 5EQJB 4F1WA 1HLFA 3BWMA 1H4QA 1QFMA 1EAYA 2VYND 2LE0A 5B7GA 4WNAA 2JLQA 1HGXA 3R7AA 1BGWA 1WZ2A 1L5LA 2LCQA 4CQMD 3MLAA 3L8FA 3T3EA 3EZYA 2FG7C 3L0PA 3NUQA 4G1EB 4Z9BA 1JWLA 1WV1A 4LOLA 4NIMA 5JYEA 1I0LA 1X7XA 3AF2A 4EW1A 5FT9A 5IMBA 5JW6A 2NXNA 2RK6A 1OH5A 5EPUA 1M0SA 4ZZ3A 4Q16A 1YR8A 4KO1S 1KMHA 4CV2A 4NEHB 1HOTA 4Q12A 5EMKA 3D54D 1S8FA 3F1KA 3KJIA 2V7UA 3KYBA 1C14A 1QQTA 1ZONA 2QTWB 5LQUA 1UMBB 2AR0A 2D1QA 3D2AA 4O4IA 1ONOA 1P6UA 1IHYA 2IBMA 3G82C 4FFNA 2UUOA 1COZA 4QGFA 3RRJA 1V71A 4BNDB 3ZD9A 4DXDA 2QUZA 3NHZA 2IHVA 5IBCA 3PEEA 3O2QB 4F85A 4ZIRA 2RDMA 1I4LD 3JQAD 3L04A 3OPVA 3QITA 3QYAA 3NC4A 3UKDA 2IUYA 5KQLA 1E2UA 3WWOA 4FUTA 2AFIE 2WT8A 2LVBA 1A2QA 3OQVA 3S70A 2OORA 1OB5A 2UZ3A 2VK4A 3FOBA 3HYLA 3IEXA 4HN4B 3NEAA 3KZMA 4NWIA 4X6XA 1K8ZB 4GI5A 4HH4A 4OP1A 1GOTA 4X90A 4CEHA 1A5TA 4TMXA 1I5OA 2SCUA 5CX4A 3HBAA 5HK8A 2GZSA 4J75A 1ZJYA 4YGYA 3D5QA 4YAEA 1PDVA 2OFWA 2JAQA 3LUAA 3SZ3A 3HVJA 2JHPA 1NQ5A 2ZUTA 2BMWA 2P5YA 1CQWA 4YFVA 3HUDA 1AS0A 1L2TA 5I7VA 1RJGA 2B7BA 1ID1A 3CRMA 2HLDD 3PJFA 3VVBA 1WG8A 4I50A 3O9VA 4PC1A 2QN3A 4HR7A 3SICE 5BSFA 4LFBB 4YJ2A 3BXOA 1LLCA 4BCBA 5AFSA 5AOVA 5B7PA 2AN9A 3LVRE 2PSJA 4CLXA 1H65A 4DABA 3NYIA 2P9HA 2Z9BA 2XOXA 4CKXA 2F00A 4PWZA 5AVZA 5KSYA 4KIWA 4GR4A 1BHSA 1ZINA 1TE2A 2I87A 3MCUA 2R6HA 4CIYA 2Q5HA 4Y2JA 2AK2A 2PQ6A 4JMPA 2OXTA 1BKSB 4QASA 3OIFA 4LA4A 4DCVA 4DNXA 4EFKA 1S7GA 3IR6A 1CUIA 4FEAA 2WWFA 3REFA 2C94A 5ALHA 3N0WA 3EDCA 3Q8XB 2ORVA 4E4YA 1T8TA 1TAQA 3BSSA 5FHQA 1SCKA 4GPBA 3E9RA 1VDMA 1SUSA 1IZ0A 1I6KA 1QZZA 2IPAB 2YH2A 4YJGB 3A2LA 1YB5A 3RK4A 2ENUA 3GU3A 4QKQA 3L1UA 5KREA 2JLAA 4M7OA 4FWBA 4YDSA 3A58B 2B0JA 1Q7RA 3GBPA 2IT1A 3OZCA 2R97A 1M2WA 4NYMQ 3THRA 3UTCA 1QE3A 2X8BA 3KYDB 4P08A 3VYVA 2IYVA 3WFJA 3ZU4A 1BQ4A 3BB1A 1JLLB 4KV7A 2Q4RA 4E09A 4EPXA 4V38A 5A5FA 1ZK2A 2VSOA 2QAGC 2VP4A 2SHKA 2XCQA 1BXZA 1P80A 4MX8A 3AETB 4CZ2A 4QT0A 4UOEA 3TNFA 3WWPA 2A35A 4NPAA 4WCDA 3RU9A 2IYUA 4MLZA 1EK6A 1N1EA 1CVLA 1TZJA 3H1EA 4L51A 2XDWA 4WY2A 3AIIA 5H7XA 2ONJA 4LKOA 5JVDB 5D84A 4DDKA 3MS4A 1WTCA 3QFCA 1DXQA 4GX1A 3RWOA 1DLJA 4EJSC 3C24A 1VXRA 3PNPA 4IICA 2VRNA 5T4FA 1HL7A 4DDUA 5FTLA 3BC1A 5BN4A 3U1BA 3X2FA 4H35A 1SIOA 3EAGA 4XE5A 2AYZA 1MX9A 1XQ9A 1RMQA 1WIWA 4GLLA 1T9BA 1DTWA 1V0JA 2A5FA 2HBYA 3GFQA 1D1TA 1ZOOA 3G8BA 3R3HA 4X44A 2H54A 4UATA 5KWEA 3FOEC 1IN7A 4RIFA 4QDOA 2WFLB 4KWEA 1UQUA 4OUDB 5BV7A 1ZKDA 3ODGA 1HNWB 1VJTA 1EKXA 2JGAA 3IVAA 3L0CA 1NF9A 2OWDA 4UM8B 1I3LA 4WZBB 3IP3A 4RMGA 3C85A 4XQCA 2FGKA 5EIAA 1UDBA 4X5OA 3B1YA 4OHOA 4UUMA 3LT2A 2YL2A 4D98A 1GGJA 3W04A 5H68A 1HBJA 1P9OA 1QH9A 1ND5A 3KJQA 4UU1A 1CRQA 4YDRA 2DULA 3B3QA 2ENWA 3H9EO 4YJHA 2QNRA 3BQ9A 2H7CA 3FWPA 1Z36A 4KXMA 1NUSA 3DZGA 1OXTA 4N3NA 2DPHA 4BB6A 3OJLA 4P22A 1EK0A 1DEXA 1VI2A 2NIPA 2FFJA 2NO5A 3ZEAA 5H9WA 2RG1A 5D1HA 5EE3A 3MT7A 3LUJA 1OX5A 4NQZA 4QPDA 1Z6PA 2DBQA 3OHSX 4DDHA 3HADA 2Y76A 1U5CA 3PUYA 2V55B 4TUYA 4FLEA 1Y1TA 1XP8A 1N78A 3CPHA 2ZATA 4UHKA 2NTJA 6PFKA 3U1TA 1G2IA 3UC5A 7YASA 3B3AA 1EDOA 1OCEA 2YWFA 1VL5A 2BFDA 2X4IA 3QHAA 1L4FA 5ARBA 5IJAA 1M2FA 3MOSA 5JBIA 3FFBA 4BVGA 3RC1A 1H3NA 4YJ3A 3QKIA 1NULA 3HGMA 2C7RA 2GRJA 3LKBA 3OZFA 4ETMA 1MKYA 2Q46A 2OM6A 4JLMA 8ADHA 3DUFA 3N2EA 5K3OA 1DXYA 2IYLD 3G7NA 1HT2E 2DFPA 2PCLA 1OKKA 3EVGA 4M1KA 3VI4B 2QX8A 1MOPA 1MIOA 2PA3A 3CFYA 4CKEA 1XTPA 2FMIA 2YS7A 1G8JA 3L1HA 3I0MA 5JAIA 3I12A 3L93A 1X7GA 3K8YA 3QFRA 3K30A 3KIPA 3WOVA 5I4CA 2GFHA 1KYIA 4WA8A 4A6EA 4Z7QB 3HPQA 5J59A 2F6RA 1F6DA 1L7BA 5HGXA 5MGNA 3U26A 2GVDC 1A98A 3N8GA 3H4IA 2C2WA 2ZIXB 5F73A 4YV7A 5FTNA 1QJ4A 1JFTA 3DXFA 3ZZ1A 1I94B 2FMHA 3U3XA 1XTIA 2VTVA 3W5CA 2IYPA 3GLQA 1C4KA 4AKGA 3CRNA 4FZVA 4N6NA 4FZJA 2M6KA 3CLSC 4JP5A 3KUUA 2J6IA 2PKYX 4L28A 3DD5A 5EJ8A 2HUPA 3R5KA 1Z88A 2G8NA 2VSQA 5CNMA 1G20A 5FWXA 4QT4A 5EJAA 3VFDA 3UGTA 5AM3A 2YJ4A 3FNFA 3KZVA 3ND5A 4OLHA 4UNRA 1KETA 1DUVG 3U44A 2GCGA 1KDTA 1X39A 2GHTA 1NN5A 2YIVX 3NC0C 2I2WA 5HRUA 3SBXA 4F04A 1AQIA 5K2OA 1L5GB 3S99A 4QTXA 1T2VA 3DE1X 2OVBA 4AZTA 1M83A 4BN5A 1OH8A 4FFDA 1CUFA 1CQIB 3Q7EA 2XVZA 2E6KA 1GG9A 3R24A 1KC3A 1EI9A 1PYDA 2F1KA 5SY4A 3PDUA 1F0PA 3JTEA 3T0IA 4DDTA 3W5DA 5JALA 3R44A 1CRPA 3TOXA 3WTCA 2CXOA 1MJ5A 1UDWA 4EJMA 3BTSA 4RVSA 1P9LA 3SYKA 3WK4A 3SBDA 1NW9B 4R8LA 3NWOA 1G8FA 2JIBA 2PT9A 4B17A 4EUNA 3HVRA 1PV4A 1W75A 4GOND 5FCDA 1IBLB 4TKUA 5JQGA 4NU0A 5HKOA 2YFKA 1GM5A 4LK2A 3EBPA 2I3ZA 4ERXA 3IURA 1DZIA 3BXGA 2ZJAA 2DBYA 4AKSA 2Q2VA 4UVGA 2FMTA 4LSZA 3BT7A 3ZNQA 5LUBA 3UG7A 1XLUA 4EW2A 2B94A 2H1RA 4BO4A 3N0TA 2FMFA 1LBHA 4OY3A 1GPWB 1E7YA 5AW6A 2HDHA 2I67A 2XB2A 1EB9A 5EI5A 1TEXA 4JYZA 4MPRA 4NYMR 3TMKA 3QI2A 3CXRA 4ZJPA 3K5WA 5AO9A 2COUA 5TARA 4GQBA 3RYFA 2JD2A 1YZYA 4URUR 4KYTA 1ZH8A 4WVLA 5CXSA 5JNVA 1AGRA 1QTIA 3TQSA 5K0BA 3T3OA 2OO5A 5E9AA 5KYKA 5CCXA 1EU1A 2PD3A 2ZT5A 3FY4A 4MKRA 3WLEA 2CFSA 3C3JA 3PITA 4KI0A 3ZGXA 3H13A 3N8KA 4D42A 5L53A 4KR7A 2ZUEA 3T4EA 1U0BB 1U3GA 3DMTC 1ESMA 2V98A 3HY4A 2C5HA 4YDHB 4LOJA 4B40A 1PJBA 2XUGA 4BJHB 4B2YA 4G8DA 621PA 3W8NA 1KYZA 2Q4OA 2ODEA 1ETHA 1T6BY 3FW1A 3IP1A 3M34A 5H02A 2Q7DA 4E2XA 4E5NA 1IB0A 2V5VA 2H06A 1NQOA 2G67A 2XHZA 2W6NA 3R41A 5HVNA 1XFDA 4JSYA 4AP6A 5EGSA 5CCEA 4Z0PA 5IF3A 4JFAA 1VIYA 3KEGA 4I1SA 2V7TA 3NOOA 1XTJA 4JI3B 4UBLA 1GUZA 3K9WA 1G64A 4MVXA 5LB4A 1JUDA 3PZBA 3PCTA 5GONB 5KAPA 1HG0A 2R751 2Z3ZA 1N8NA 3LG2A 4MITA 4REQA 2XA9A 3P26A 5DASA 5JNSA 3NTOA 4OBWA 3MJVA 1AQLA 5SZIA 1XNQB 5DMHA 1OIVA 4E08A 2XW6A 5FD8A 3JRNA 5KC9A 1M74A 1T5HX 3RV4A 1YDHA 3TK1A 3B78A 2PZAA 4R98A 5ARCA 1QH0A 5PNTA 4DB4A 4LMPA 1O97C 3A06A 3BBLA 3RVOA 1PX2A 4E21A 1XEWY 2GF0A 3AVOA 4TLBA 1VJ0A 4GE3A 5JXHA 1RJDA 5K3CA 1GTSA 1E63A 1QO0A 1KU0A 4TXLA 5HKLA 4EHDA 2XJ9A 3UGKA 3GBVA 4JI8B 4D9IA 5TT0A 1RRFA 5CD9A 1LDYA 4XCVA 3FTQA 1BDJA 1BCRA 1QHFA 5AHWA 1BGVA 1KY5A 4L15A 3VZQA 3BMQA 5A4IS 4GM1A 4AS3A 5DWDA 3QA3E 3LKVA 3HCEA 2VXCA 2QN6A 4I99A 4RKWA 4M53A 5EZSA 2CVZA 3WGYA 1ZMTA 1UOEA 3WKAA 3AKZA 4EG3A 3SJCA 3T95A 3HB4X 3WJAA 4EG4A 1EIZA 5GONF 2O5CA 2W2LA 2C9YA 2FZEA 3AP2A 4JVMA 3B89A 1JSZA 2GVZC 4X3OA 5CVDA 3PIIA 5DX0A 4RTKA 4MV9A 1FLDA 2F3RA 3ON5A 3TTSA 4ZKDA 1VECA 1N3LA 4HH0A 2H5LA 4HB4A 1CIJA 4KAXA 4PBRA 5LD2C 3W9YA 3H6KA 2ZBUA 2HLHA 2NYRA 3WAGA 1QP4A 1TDJA 5LP6F 4BO0A 3K72B 1I30A 1GYPA 3ZJVA 1LF5A 1UPFA 1XZPA 1R7RA 1E9VA 1KE2A 5HWSA 1ZO8A 3FCYA 1V8PA 3P2JA 3QXJA 4JNCA 3ZTYA 4IIVA 5ALQA 4AXBA 3RYCA 3JSXA 1T4DA 3QWAA 4OLAA 1ENYA 1XDGA 2NO4A 3G6WA 5DWQA 2QR5A 3QLUC 3GIDA 1UK9A 2P79A 1NSFA 2CBZA 5E3HA 3GFPA 3QI7A 5E7IA 3T0FA 4RY9A 4HZUA 4UHBA 3LUDA 3M5PA 2VJDA 4HMQA 4M9SA 3DG9A 1XJQA 4NZZA 1SH7A 1FZQA 1R18A 3D8RA 1NW6A 4MS3A 4PLFA 4AWXA 5ITZA 5DGXA 5KYYA 3LKZA 1T4GA 1WPXA 2AJCA 3T3NA 4UTOA 1CR2A 2V6IA 2JEOA 3G2QA 4OQNA 3NHLA 4B84A 1M2KA 2QSZA 2B21A 3EXEA 3JSAA 4XIFA 4Y9DA 3ZYZA 3IV9A 4UXHA 4QNRA 2CDRA 4Y2RA 4QWWA 2QTTA 4LIPD 4G4SP 1S3GA 4RZXA 4L9WA 3BZUA 2UYYA 5ITSA 4ZCLA 3UAOA 3IODA 4RIHA 1OILA 4R31A 2O8EA 4IGIA 1J70A 1KS9A 3F2VA 3I6IA 5LBIA 1LVGA 4YRIA 3DYBA 3A4IA 5L3QA 2R5NA 3WNBA 1CC1S 3S2EA 5AICA 3LT0A 2CCKA 4W1RA 1B4DA 3O74A 3GWGA 4P4UA 3T52A 3VR5H 3E81A 4R2IA 2QTGA 3TPCA 1ZCAA 1KZYC 2GN4A 4P8RA 3CUWA 4MW6A 4QQFA 1WEHA 2GUWA 5CBPB 1SXJB 5TGDA 1WMFA 3G2IA 1OBVA 2R2GA 2DM6A 5LVAA 1N5KA 5KKNB 1UOQA 1RYNA 3C5EA 3ADDA 1F0KA 3PDIA 4DLWA 2QNBA 3SF0A 4Y7DA 3WG9A 2W6PA 3UV7A 4RTJA 3JVVA 2JJ1D 2ZUSA 3MCZA 5C5EA 4B81A 4DVJA 1DBQA 1HK7A 2QK4A 3L40A 1X7ZA 2Z5LA 4PANA 1AKVA 4LC9A 2I2CA 4XDGA 3UJDA 5IJ9B 3C7KA 4BDSA 3T1VA 4ND5A 1XJCA 5BV0A 5G4KA 1NHGA 4HS9A 3ACDA 2QU7A 3CO5A 3NT4A 1DTEA 4IJUA 1UMCA 2AT1A 2H2DA 2I65A 4U9UA 4GMKA 3ED5A 2IEAA 1IL0A 3R9XA 3OQBA 5FTWA 1ISFA 4XVUA 2GKGA 1QYXA 1SOUA 1LC3A 1CJTC 2O3RA 3E5MA 1N92A 1N7HA 1A27A 3P0HA 3RAEC 4RK6A 4TTRA 3LLMA 3T5DA 4CIWA 1N3IA 2C5EA 2P3OA 3K9QO 4Q9LA 4YR9A 1RE1A 1RPTA 2R84A 2X6QA 3PNKA 3MGGA 4WK6A 3ZHZA 2YWRA 4UCXA 4N5DA 3WWDA 3ZGVA 2R6GA 1C4OA 2X1LA 1DEAA 1PBTA 2A5YB 4EY7A 2BBWA 2VF8A 4I1UA 1PCXA 2FFRA 3FF4A 4M9CA 4Q1FA 1U8YA 3O4VA 2PKQO 3QEKA 3V7WA 5G4LA 2BBOA 4JELA 4MWDA 4PPQA 2AWNA 4OQLA 3EGXB 4KQHA 5BQFA 4B3TB 4MVJF 1EESA 1MFPA 3EZXA 1MO6A 1OE0A 1VRVA 2RKBA 2VSYA 3GMIA 5AOCA 4ZV9A 4AN4A 2C2GA 4B80A 4RFLA 4TV9F 1J21A 3AEKA 2CNOA 4PC2A 2COKA 3DFKA 5JFTA 1PEYA 1TMYA 1NATA 2LRHA 1YBHA 4X95A 4PPGA 2WB4A 1BQEA 1T9DA 2IF0A 2NTNA 4GPD1 5IK2A 3TJZA 2AUTA 3UHAA 5JCXA 3ILYA 3W3AA 3SN6A 1S4QA 1Y89A 3TCKA 4PAQA 4DKXA 8ATCA 1D2MA 2XUZA 1YAJA 1Y5MA 3O4FA 2ECPA 2QM8A 3A3YA 3V8NA 4QPZA 1YASA 1FMTA 5IDVA 4HAWA 4JT9A 2WY2D 3SJUA 2B4AA 4XVQA 3RJTA 4F9TA 2Z6QA 2O8FA 4H7IA 1SR8A 3TUIC 2HJGA 2EKPA 5FOWA 5IXJA 3NHJA 2GN0A 3AHFA 2LPMA 4DSAA 2OCLA 5JMTA 1BWRA 1R9NA 2MHCA 2ODWA 4XSGA 3VR5D 4DMMA 3MMZA 4R9UC 2X7JA 3O82A 5BWLA 5KNBA 5K0ZA 4TX1A 1DCFA 2FN4A 3C6YA 1M2HA 3Q9UA 1ZNZA 2M1ZA 1DC3A 1EFLA 1PEDA 1S1MA 3B85A 3CG4A 3GAFA 3V1TC 2IEIA 3UK2A 3VX3A 4BO1A 1F0NA 3WL6A 1MW8X 5ILGA 2VDOB 2H2GA 2YFHA 3INTA 4MW4A 1P9NA 4RMNA 3V42A 3HPRA 4J8PA 4JL6A 2QX6A 1Z0AA 4I7EA 1ZH2A 2FRDA 1R6BX 2VCEA 1JI0A 3GMTA 4HD8A 5FBRB 4B46A 2NU8A 4P4SB 4NOMA 3DLPX 4EHAA 1KQGA 5AM4A 1L5RA 2BKVA 2GM4A 3AVWA 4Y2VA 2Z5GA 4J0IA 1Z5GA 2YTZA 1EE9A 1V5IA 4I9NA 4BQQA 3A3NA 3AESB 3L82B 4B71A 3UJCA 4E33A 5JXWA 2HZ7A 3M6AA 4JH0A 3FPCA 1L4UA 4B3GA 3NDBB 1B8VA 3BMCA 1MX5A 1QH1B 1PE0A 1N6RA 3G2NA 4M46A 3A1UA 1KGDA 2EKLA 2FPOA 2XKKA 1CEXA 2PANA 1ZJZA 3ZBQA 3QPWA 3OE7D 4ETNA 1V3UA 1ZM4A 5BSRA 3VJMA 5BSKA 3DR3A 4IFBA 3NP9A 2PFKA 2G4VA 1NMYA 2F67A 1VTKA 2GM5A 1IM2A 1CUDA 2XZTA 1E20A 2XYHA 3SEQA 2XR1A 3GLIB 3PYLA 4YECA 1T2FA 1TIPA 2WPDD 3PHIA 4R3NA 4X3CA 3MWFA 3HYNA 4N7JA 1QAMA 4JA2A 3M4XA 4C2AA 2DTEA 3VR4A 3L46A 1L4HA 3MWLA 1E3JA 4DILA 1JYFA 5IAOA 2JAOA 2W2KB 4JFRA 3KQVA 3JQ9A 4OJYA 5AW5A 3RIXA 3C7TA 2CXUA 8ABPA 3WYEA 5MF6A 2VUIB 2P4UA 2H6EA 1OAOC 2PU5A 2VDQB 3FDIA 2EWVA 1XCBA 1RAAA 3SSOA 3JQ8B 4GDMA 4AC9A 1XDSA 2F8LA 3FLAA 3GLHE 3IPLA 3KXDA 4WESA 2Q5QA 4OO3A 2UVDA 3KOWA 3LHKA 4P1ZA 4ZD6A 4YMLA 2AR9A 2FEKA 2GZHA 2W2VA 4B9AA 4TXNA 5IKPA 3IMEA 3HXOA 2O54A 2EFGA 2EJBA 4GWLA 1SIBE 3OHPA 4E6EA 1WHTA 2DUUA 3AW9A 3PF9A 3Q12A 4W7SA 3ICEA 1W34A 1RJ9B 3SM9A 1WPGA 1CUXA 4NXNB 4J0GA 3MYRA 2M98A 1G3IA 4GOXA 4DPLA 1SCBA 1OW3B 2GA8A 3F98A 4HZIA 4LQDA 1WCV1 1MB9A 3HZZA 3VISA 4CKBA 1F6WA 4JHLA 2AMVA 4YUZA 1KL7A 2G9ZA 3ESQA 1ZD3A 3CN9A 3HKEB 3LCMA 5DKFA 4HQRA 4P31A 2P1DA 1W5AA 1GUFA 1U4NA 5HIMA 1F5NA 2VAXA 2YJNA 4LRUA 4QOFA 4LQLA 3W06A 1X42A 1FP6A 1Q74A 1R8XA 5LC1A 4A92A 2J7PD 2C4NA 3OJEA 2OENG 1OBOA 3DL4A 3VUEA 5EIHA 3QW2A 2GBIA 1ODFA 2FAXA 4JOBA 3UQZA 2P2CA 1WXHA 1D2AA 3F8TA 3WYAA 3PZRA 4BX2A 4M0UA 3T34A 5LMCA 4L22A 1NVWQ 5B6PA 4MXDA 2FR1A 1Y5LA 1DEHA 2RH4A 1K7SN 4IDCA 3RU7A 3TSYA 1GLNA 3ONVA 5BNZA 1CUCA 4HLNA 3RV3A 5B6JA 3EY4A 4DCOA 2Y1WA 1Y3CE 3IIEA 4HATA 4ZXPA 2XDAA 3IAFA 1IJEA 3NV7A 4JBWA 3ZK7A 1DDIA 2JRLA 1FU8A 2INGX 3DFZA 1WUYA 2BHSA 1BVRA 1MTOA 4EKGA 5KJEA 5FI0B 1KR5A 3RYHB 1KFEB 2OLKA 3WGMA 3KDAA 3HB9A 1CUAA 4AYWA 5AW3A 5IULC 4HXGA 3S8MA 1PV2A 2OZKA 1Q17A 2JBAB 2FSVA 2WZDA 3H5NA 2B25A 5J1SB 5H9VA 3UMYA 4Z4HA 4FI3C 4EL5A 3A1SA 2A8YA 3P4YA 4JLUA 2OT3B 4QARA 2G8LA 4ZVNA 1R8SA 5LMZA 3TD2A 5L3VA 4FHCA 3O2NA 1I3MA 3JU3A 2NOAA 3GLVA 2OC4A 3LYLA 4LY0A 2QTHA 5HTKA 3SX0A 5B3JC 2OPHA 2ODAA 1K9SA 1CJBA 3LDAA 3M6VA 1AKMA 1TQ6A 1XLTC 2XB6A 4OHKA 4PSVA 4DC1A 1E1NA 4HHEA 4HUJA 3PE6A 4GO1A 4K9PA 2R48A 1JA0A 1BU5A 1NUAA 1A96A 1P1FA 1B23P 2R8EA 2Q6LA 4JJ7A 1J2UA 2F55A 3AFMA 3KLPX 3Q0EA 2C7QA 4YAFA 3DB1A 1YULA 3BJIC 3ZCSA 3EZ6A 3QE9Y 3P4UA 2ODTX 3IQIX 3TR6A 5ECGC 4LZOA 4KJZA 5DO9A 1WCIA 1UBNA 3U4AA 1GFWA 2IPMA 1A7UA 3LU1A 1KIMA 1OGIA 2YBDA 3VYWA 5I7SA 1VJCA 3MHTA 4R84A 3ISTA 3DOCA 3K5PA 3VAYA 3C97A 1HPLA 3SCZA 3SYTA 3W7VA 2AE1A 2NZYA 2H4YA 2XGOA 3B12A 4V02A 3FB4A 1S3IA 2R5WA 1C3VA 1FFWA 3H42B 3UTDA 3ZI4A 3ZV4A 5LNK6 4WKGA 1L8QA 4H60A 5GJWC 2NVUB 1D2CA 3CZMA 5LA6B 4KG7A 3E58A 3IDZA 4HDKB 2FPIA 2ISCA 1LJLA 2Q3EA 2R87A 3HKDA 3WKDA 2ZG6A 4ZEVA 3UOAB 2XUFA 5A4DA 5JSUA 2HREA 1W7AA 1WSDA 2H4JA 3M1AA 2E5WA 4TSFD 5JT1A 4L7VA 4YBZA 4HH3C 4EABA 2F2TA 3CISA 2SKCA 4DXHA 3WS7A 3ABSB 2HD4A 2VZEA 3I3SR 1BWPA 1OAAA 1KSHA 2VZ9A 4GX5A 1RNLA 1IN5A 1NFFA 5B4VA 2O0MA 2F62A 1BMQA 2CYCA 4DQUA 4EG0A 3VOSA 4QA9A 4QGGA 4R6XA 2WOJA 1T2DA 3ASYA 3X43A 1W36C 2V74B 2VFAA 4AKHA 3I73A 4RVDA 3NHSA 3MTBA 2BMDA 2PX4A 2PRJA 4RE6A 1FC0A 1ODCA 1FDOA 1E1RA 1QBKC 2ACVA 5F23A 1DOZA 4LBVA 3RE1A 4F3KA 2B36A 2PVCA 4XTRA 5EIXA 2XUQA 5JZ9A 1O6CA 3O2JA 4ATNA 4PCUA 1F8GA 3L01A 5I51A 3OCCA 3OM1A 1JAZA 1K8QA 4EFLA 1J49A 2YC2C 3IX7A 4G8JA 2SKDA 1MLDA 2GYWA 3F67A 4JBLA 2ANCA 5SYNA 3ZW9A 4C7OB 3DO6A 1S1CA 1C9NA 3AL2A 4GXQA 5DULA 2WPNA 1DC6A 2XB8A 3FCCA 4HRAA 2ATCA 1Q3KA 2GZAA 3U0BA 4Y2UA 1DIBA 1HSOA 1ZUD1 2WYUA 3DONA 2QRUA 5CA0F 5JCZA 2W0SA 1CUHA 2JW5A 2P4SA 3C16C 2CV0A 3HWSA 3HUTA 3AK4A 2H08A 1GNSA 3ZWVA 1SUEA 1Q44A 4J1TA 4D82A 1A8PA 5IRCD 1CV2A 2QMZA 2Z95A 5D7BA 4PLPA 1U1IA 3EC7A 4FNAA 5BR4A 5BW4A 1S2IA 2M32A 2R7AA 2G9RA 3E9ZA 2A1TS 4NONA 3UOGA 4FYIA 2E49A 4EPVA 2AFIB 4MR7A 3JYPA 2OZEA 4GT1A 1Z35A 4Y6OA 1UJ2A 2QZ9A 4MHTA 1P0CA 5FLEX 1XD9A 1EX6A 1X2EA 4AMBA 1AUOA 2E3JA 3TH5A 3AZQA 4UHHA 1AA6A 1N25A 1KSFX 3HLKA 1U8EA 1AXEA 5HXAA 6ABPA 4FMPA 4JZKA 4OYYA 6LDHA 4J9VA 5A4AA 1E7MA 2TMYA 2JVIA 4WOCA 3N0XA 1EK2A 3COSA 1Z07A 3EZGA 2FB9A 3D5TA 3U4QA 2ERXA 1K98A 4LKRA 4LYFA 5IM4A 3R77A 1CY1A 1XMSA 3QX8A 4YNBA 3VR2A 1VB3A 2BSXA 1K8YB 4ZAXA 3HKCA 2WJ3A 4DLAA 3H2GA 4ENVA 1Z5ZA 3X3HA 2ORWA 3PL1A 3I42A 4G86A 4Y9TA 1MCZA 1U0FA 4IUBS 3VU0A 3OLWA 4G4GA 4A27A 3CXUA 3HA3A 3MRXA 1C3XA 1EGVB 4N8SA 4ARIA 2C8KA 4IHJB 4KYVA 5I4BA 1FJ2A 2ODBA 3OFSA 2QM0A 1MABA 4E14A 4DG9A 5I6DA 4FFBB 4MTLA 1JR6A 2BY4A 4Z8XA 2TMDA 3N5CA 4FFVA 1A76A 4P58A 1ST3A 1EB8A 4DM3A 1HA3A 1XDWA 3ZJUA 4JC5A 1EA5A 1QR6A 4MVJH 3UK0A 1PSZA 2XNSA 3TNDA 1S8OA 1JKJA 4DV7B 2J33A 1TVEA 2FX5A 821PA 2Q1WA 1W29A 3AXTA 4V0MA 1M0WA 1W88B 2XMPA 1T9GR 1L7XA 2P30A 3H1GA 1U02A 2JJ2A 2GD6A 3AFNA 2RGGA 4O1MA 3DNMA 3REQA 4BWFB 1Z06A 2X86A 3R7SA 1BS9A 1T26A 1M2VB 2HJWA 4D8XA 2WI8A 3NXSA 3SYRA 2FR8C 3AQ4A 1CULC 3LCUA 1KVRA 3CGGA 4F5DA 3O8DA 1T5DX 1XB2A 4G0XA 4BBPA 5KYXA 3ZZTA 2JFVA 2WAOA 1CEQA 3LS2A 2HX1A 4NDAA 1T29A 1VHQA 1QVVA 4N5LA 3V34A 1A5SB 1R4ZA 5ALYA 4GW3A 1PQPA 1M5UA 4JKOA 1GNTA 1Z4JA 2OAQ1 1KERA 3S40A 5GP1A 4BFUA 1C50A 3ZZMA 4HSEA 1PWYE 5EZYA 3ROZA 2AZ4A 2JGFA 4KMMA 2GD1O 4OU4A 4F93B 1CERA 4R1OA 3HE3A 3I32A 3WWEA 3H83A 2IOYA 3IXMA 4RY0A 4XLTA 1XE3A 1E1MA 5ICSA 1PK7A 1FX1A 2GXUA 1N5RA 2DLCX 4C5BA 3G2PA 3LCRA 4YCMA 2PG3A 2B8NA 1L4EA 2E1RA 1PG0A 3CNBA 1O87A 4KQGA 3QXGA 3B6JA 5LL6P 4KHZA 1VZ3A 5DNDA 2FK8A 3VXKA 1UAYA 1CFZA 1DZ3A 1QJCA 1YU9A 3HVUA 4G5GA 5DMXA 1FDVA 5CR9A 3UJ6A 1JHAA 1AUPA 3PS9A 4E32A 3WNQA 1BDIA 3H9BA 2Z4RA 2GOYA 4OOEA 2QORA 2VWPA 2WOOA 4OXNA 1D1QA 4L16A 1OHHA 2MYNA 2DERA 2HSGA 4OKIA 4PTYA 4LHVA 2N1MA 3PHBE 2H4WA 4PO8A 2OKCA 3CR8A 3GFTA 1YMUA 4QBIA 1U90A 1YB6A 4ZOLF 1DRWA 2ZSFA 5A4FS 4EB3A 2CL7X 5CFRA 1BYUA 3QNUA 2I9PA 1YKSA 3JWPA 3NPMA 1V8ZA 3D6HA 4CJXA 4GSLA 4NESA 4OV6B 1NVEA 4PO1A 1W4CA 1KSGA 2X2PA 3BMOA 4UMFA 2BGLA 3PD1A 1XNRB 3LTNC 1GIAA 1ZH4A 1E60A 1WF6A 4RZIA 1AQ6A 1XTUA 4RFSA 1V9CA 3D43A 1XNGA 5IYZF 1VDZA 4B3IA 2XGJA 3RFVA 1NVVQ 2FZ4A 1YRWA 1Z28A 2A6PA 4KO3S 4L9RA 1DEKA 3A11A 4NENB 4E03A 10MHA 2D59A 2FFQA 4GEKA 2ZVDA 5I4KA 1HMYA 3R3ZA 4H7KA 5MGBA 1UMDB 4UEWA 4B31A 1SBNE 3EXG1 1IOZA 3MWJA 1YHNA 5EWJB 3VR3A 1PL6A 4MVJD 1QONA 1B16A 2L42A 5HDBB 3MAAC 2YMLA 1P5HA 5EJ7A 4RD1A 4CEIB 3L4EA 1RMTA 2RGBA 3JASA 4RACA 2DAPA 4BC1A 5I8WA 1ML4A 4UVDA 4EI2A 2H07A 3C3CA 2ZT6A 4QD3A 1TKRA 3WRYA 4F4FA 2JZCA 3G02A 1N6LA 1NUUA 2EJTA 2F3SA 2QQ5A 1JQBA 3AJDA 5AUPB 4DQLA 1PFQA 3EMKA 4R9SA 2DUWA 3EOBI 3DMNA 2CXXA 3UW3A 2JIQA 1ONSA 5FI1B 4ESHA 3F3MA 2WTEA 2VPTA 4K9QA 4AG5A 2GYVA 1WBJB 5G2OA 5JG7A 4LOHA 1XRSB 1KEEA 4CKCA 1P1IA 5FAXA 2P6MA 1X70A 3Q40A 2JFNA 5EHZA 5CURA 3MWYW 1GZHB 1N2GA 1WDMA 3W78A 5B4TA 1P72A 1VPWA 2Q4EA 3CHYA 2RI1A 1J1ZA 3LCCA 1X86B 2P78A 1EFTA 3GRYA 2R7NA 1GCUA 2FJ0A 4WK0B 2BISA 4PQRA 3TTXA 1ZHFA 4RZ2A 3GP3A 2V4ZA 4DCPA 5EINA 2P9YA 3V8MA 2GCEA 3IOEA 1EVIA 1LH0A 1NPTO 221PA 4FZRA 4M8IA 3SOZA 3WKCA 1E7WA 4D5EA 5INTA 2R7MA 2DC1A 2FPRA 4YX9A 5A4KA 1H0SA 1Y5NA 2WHRA 1OT5A 3P5SA 2PQ0A 3QVWA 4QHYA 3TIVA 2NU9A 3NIWA 3OKPA 2YXBA 1XL0A 1SD1A 1GJRA 2NUPA 1NJFA 1IXRC 1EMDA 4Y2YA 3V1YA 3KAJA 2ONKA 1G41A 5BV1A 4CU5A 1XEAA 3L79A 3MTJA 4PE5B 5K6RA 2FLWA 1A4RA 3RVQA 5AHOA 4DIUA 1I3NA 1HDCA 1GUYA 2EZ8A 1IG3A 3CWZA 3ZKAA 1YWGO 5CT9A 4BVBA 5LDHA 3Q9SA 1R0LA 2ADFA 2JFGA 3K2BA 3OSZA 4YQFA 2UU9B 2V7QD 4NZOA 4TYYA 1UWLA 3C2QA 3DZHA 3KUKA 4V0RA 3E53A 1QCDA 3SHQA 4EG6A 1QYCA 4AYTA 1OH6A 2UZIR 1W47A 1CIVA 1O3YA 2D1TA 3A6LA 3EEBA 3Q4GA 4R2KA 5CVJA 1CG6A 3EEIA 1NDHA 2Y1KA 3PBKA 4B33A 5J2UA 1PYOA 1AMUA 2QTLA 3MT8A 5EIEA 2AI1A 4L3OA 3T5CA 4EUHA 3SOPA 5CAEA 3ND6A 1YK0A 4PZAA 5DYNA 2FZKA 3S44A 3I04M 4ITRC 4Q39A 3LPDA 3IAS6 5AMXA 3F78A 1MW9X 2JFBA 5F5XA 5DLQC 4NCAA 4FM9A 4HDMA 1FYFA 4E1VA 2NU7B 3WNDA 1GNRA 4EGFA 4N49A 5T3YA 2GCIA 2VK8A 4GOLD 2HQBA 5A02A 4PG6A 4B48A 3EAQA 1H5NA 2NZ8A 3VO2A 2DTXA 2NYAA 4V0OA 3OEHA 2QTZA 4RLFA 2XQIA 2YVQA 1E4EA 2X2EA 1FXWF 2CXHA 3LOPA 3GEBA 4ARAA 4ZCPA 3UA4A 3ZHBA 1D7AA 3PLAE 4XX1A 4KBYA 4FFPA 5G0VA 3QOWA 1AQNA 3ND9A 2QVGA 3GT7A 4NNPA 3QTLA 4PFQA 2JKYA 3TZQA 5AM1A 1AKTA 1QC5A 1Z5WA 4MIEA 2BI4A 4XSHA 2GERA 3VOBA 1XZKA 4D9KA 3AR5A 2Y0PA 3FYTA 3EIHA 4B6SA 4KFUA 1CLUA 1NSTA 3A31A 2QS9A 2YQ4A 4TTTS 1WPRA 2GFIA 3O8OA 1M6NA 3D6AA 2ZRLA 1H8HD 1HZZA 3ER6A 3TR0A 3O0DA 1WP9A 4HNTA 2PS3A 3M7IA 3SY8A 1MUUA 2WFMA 5JSFA 2Z9DA 1ZU4A 4ARZA 5L4SA 1X2BA 3CR7A 2I6UA 4KPEC 1FJHA 1U3UA 2GDJA 2WJJA 3A1TA 3FCOA 2YW9A 1V7CA 2HF8A 2VI5A 3BXEA 3P94A 5GMOA 4D43A 4EGAA 1BHQ1 1ISPA 1GZDA 1XXHA 1RQLA 5IS2A 4DEYA 2BCEA 1ZUNB 2BCJQ 1G4AE 1PJCA 3KQYA 3QSGA 1IRXA 1BCSB 2HHHB 2WG0A 1T3HA 4JLAA 1GPH1 4CMAA 4AFNA 3LHDA 1JFFB 3IE0A 1DC7A 5I9BA 3MERA 1Z5NA 2FEAA 4H6WA 1DHRA 1E94E 1XZ8A 4J7XA 1KDZA 1UINA 2VPZA 4C30A 2HOQA 4TQUS 5FH9A 1Q7CA 1GXSB 5T7BA 5LZ7A 1N2XA 1H2BA 2KPOA 1HDZA 2OCDA 1Q77A 2KE5A 1FFAA 2P0AA 4DV3B 4II2A 3TZ6A 2PUEA 5U4QA 2VYQA 4HYYA 2IHZA 4KVFA 4OVKA 4D6PA 1XGKA 5CYOA 1UPBA 3SYMA 4WY5A 5KX5A 1NVVR 4KQEA 3KTAA 4G37A 2QT1A 4PSCA 2V4UA 1USIA 1NMEA 2I8AA 2OHOA 3L8EA 3K32A 4OA8A 1L5FA 1X1BA 2ZIGA 3IDAA 5JE8A 4OX9B 1ZGBA 2J5QA 4YRDA 1R4NA 2XBUA 3ASZA 4D6XA 4BASA 3FHLA 4URWR 1CDDA 3UMRA 4B87A 3X1XA 3M4JA 1RXWA 3SXUA 1KI7A 2CMDA 3GVHA 1YRHA 2HJRA 1JQEA 1O8CA 1R0SA 3BHJA 3H1FA 3EJ6A 1VRCA 3SX4A 3V3KA 4BMYA 3X1WA 4E94A 3DDWA 3VNQA 3K0CA 3PSHA 3QVXA 4MCAA 5TF4A 2BR3A 3EASA 3AO0B 2BFCA 4F38A 4RH3A 2HBQA 1XRMA 4GNRA 1XAIA 4MI1A 4MRNA 1Z4OA 2HK6A 3ES9A 2AOXA 4HEA6 4X60A 4PM4A 5IW8A 3UYLA 4U6SA 1Q2XA 5FNVB 3VOAA 5HE8A 3V6LA 2E4YA 1TM2A 3B9RA 3JY6A 1PQWA 4CKZA 1S2DA 1Y33E 2ZWAA 4NHOA 4ZREA 4YMHA 4QU0A 2XGGA 1D1PA 4YT2A 4EENA 3DCNA 1ZEMA 3LY7A 1PHRA 1OT3A 3GEMA 2AOTB 3BKXA 4P3YA 4J3NA 1M1XB 3F71A 1WQ1R 2RC6A 4O5OA 3T99A 1CUYA 1E9DA 2CFIA 2R7LA 3I0ZA 3U3JA 2VUTA 1CF2O 5AKEA 2BEUB 1M1NB 3FCUB 3PNMA 2IS6A 3T3PB 1XVVA 4RJKA 3HY3A 4IG9A 3S5UA 3SD7A 3T7RA 1HEUA 4GI7A 2O8BA 2P90A 4BAZA 4YO7A 2H4FA 5EMHA 1L1QA 4FR0A 2AJLI 3O73A 5EXPA 5IDYA 4NP6A 3IHKA 4ZEOA 4Q00A 2OYCA 2Q5CA 3QPDA 4F45A 3EWAA 3QUAA 4NG5A 5CU7A 4D6YA 5IKMA 1IY2A 1PLKA 1PVVA 1U5BA 2ATXA 3JQRA 1VL1A 4QELA 5C4MA 3W9BA 3I62A 4WLUA 4F8JA 4P33A 3S55A 1Y1RA 3GUZA 3HWRA 3GDGA 4XJXA 2A86A 4W5QA 1MJHA 2MYUA 1J97A 4V0LA 3OQNA 1T8YA 1OOEA 1PF7E 1B00A 2H0RA 3ROXA 3IOMA 2BFOA 2GYYA 4JQSA 2J9XB 3E8XA 4JP3A 4MWTA 2P35A 3SDSA 1EM8B 3BL5A 2OK7A 1U1FA 4IZ6A 1J5EB 4G09A 4UU7A 1C7ZA 1EFDN 2DY1A 4ZAWA 3ROKA 1JG4A 2A0XA 2GEUA 4WN9B 4HLDA 4YROA 4EI7A 1WBBA 4YBRA 4PIVA 5K8TA 3MGKA 3R6LA 3TLGB 3ZVLA 3IBTA 4FMCB 16PKA 2VDMB 2RCNA 1IEQA 2WINI 1PK9A 7ABPA 1W8IA 4YP9A 1P62B 2IWHA 3ZK9A 5LQAA 3CNNA 4M7RA 1USWA 2YC4C 5HMLA 2JFUA 1XBTA 2PKRA 2J3KA 3IT1