3V1NA

Crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, after exposure to its substrate hopda
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGQWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of an Acyl-Enzyme Intermediate in a meta-Cleavage Product Hydrolase Reveals the Versatility of the Catalytic Triad.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v1nA00
4AX4A 3PFCA 2OCLA 2WM2A 3M3DA 2YH2A 4BZZA 3FYUA 4FBLA 3FCYA 4Q05A 4LYDA 3D2BA 2P8SA 3IA2A 5JASA 1LPBB 2HM7A 4DIUA 1SC9A 4F5ZA 1XZKA 2C0PA 1EDEA 1E8MA 3KSRA 4UHEA 4O08A 4WDRA 3STXA 3EQ9A 1XZAA 3R41A 1C7IA 5D7BA 5ALZA 2BGNA 4Y9SA 1Q84A 2XMBA 5CH8A 3WA7A 3VJLA 1G5FA 3E3AA 1ZD3A 3QBJA 3WKBA 4J0CA 4J03A 1JFRA 4H35A 2I3ZA 1E3QA 3R3ZA 2DCMA 1GKLA 1VLQA 2GYVA 3GROA 5AIBA 5ALYA 2C58A 3N2ZB 5C81A 2VF2A 4GWLA 2XUQA 3IUMA 1UK6A 4BAZA 1BE0A 4B82A 3C43A 1XZFA 3STUA 5A62A 4ZREA 4M0FA 2XMZA 4DNOA 3IVMA 5LYYA 3JYHA 4EY4A 1K8QA 3AZOA 2QJRA 4U2BA 2AJCA 4C01A 3C6BA 1MX5A 3QMVA 3U1TA 3WYNA 4V2IA 5A2GA 2BUAA 4ZXFA 4X91A 1DTEA 2ZSHA 3STWA 3I2HA 1J07A 5JYCA 3H18A 4OB7A 2XMCA 2XMDA 3EQ7A 5E4TA 3B12A 3IUJA 3HSSA 1J2EA 1ZIYA 2WJ6A 1ZJ5A 2OGZA 4G4GA 1CUWA 4AZ0A 1R4ZA 4HZGA 3W04A 3E0XA 2WIDA 1QIKA 3G0BA 2ZYIA 5CTAA 2CUTA 1QO7A 5ALQA 5JAUA 4UFPA 3WIOA 1BN7A 2XUHA 4GEGA 4OYLA 1GGVA 5AOBA 1CVLA 2XI4A 4IQ4A 1BEZA 1CUAA 3BIWA 3UMJA 4M0EA 1QJ4A 1CUFA 4UBLA 2J4FA 1JMKC 2WU3A 4P9NA 3WMRA 1XZEA 5HK9A 1QLWA 5CT6A 1LGYA 3HXKA 3IULA 3S2ZA 1QONA 5CT8A 2OLEA 1NX9A 1W4LA 5DYYA 5AKJA 2H7CA 5CH5A 1UOPA 3DYIA 3EIOA 3H19A 4FHZA 5EIAA 1LPOA 2B9VA 4E15A 5ALDA 5EGNA 3OOSA 1ZICA 4J0HA 5AM4A 3QM1A 1YAHA 4BE9A 2XB6A 5AK5A 2QR5A 5T4EA 2JBWA 4GBGA 2YASA 1XLUA 2WHRA 5HCUA 1Y7IA 1MJ5A 1A8SA 4QLOA 5AKHA 4JNCA 1AKNA 1WHSA 5EIHA 2JEZA 4DYHA 2PSDA 3MUNA 3WKEA 2CBGA 4Q82A 1E8DA 5AH0A 4C89A 1ZD2P 3WLAA 1CEXA 4KE9A 1QO9A 5CXXA 1UK9A 5CRIA 1XRQA 3I28A 1MO2A 3VJKA 4YX9A 4KYVA 4BP8A 1WB5A 3FLEA 4HXEB 1UXOA 1W1IA 2BFNA 5CT5A 3KOOA 1ZI8A 3ANSA 3V1KA 4XVCA 1Q0ZA 4BC0A 1QZ3A 3F96A 2XUFA 1ORVA 3T52A 3AJAA 5ALXA 3DL4A 4KE8A 1UZAA 4Z49A 1XQVA 4XJVA 1DU4A 5AICA 3LCRA 1DWOA 2VTVA 2HHAA 1X2EA 5FPPA 4ZV7A 3AIOA 3HEAA 1TCCA 1PJAA 1GXSA 5K5EA 4C4ZA 5JARA 3M83A 3BE8A 4UPDA 4DSAA 2W6CX 5AOCA 2DHEA 3QMMA 1ZGBA 4MYSA 5KBYA 1U65A 2PU5A 1P0PA 5DNWA 5C8ZA 2RGUA 2LIPA 5JATA 4N8EA 1ZGCA 3M81A 4NVRA 2XMSA 1KU6A 3JW8A 3VJMA 4Y2QA 2AXEA 4I4CA 3I6YA 1JMYA 2PSFA 1H2ZA 1CQZA 1E8NA 2VJBA 1QIGA 2QMQA 4ZI5A 3C6YA 1YA8A 1YS2X 1S8OA 5FDFA 1L7RA 1MPXA 3FLBA 4MXDA 4FFWA 1MX9A 3RKSA 3RLIA 4G8BA 4J3JA 5K3FB 4YPVA 4RGYA 5CH3A 3ZV7A 3O4GA 2WUEA 3R3WA 3OM8A 2R8BA 3M82A 2QXUA 4N8SA 5AI6A 5A71A 3C8HA 5ALKA 4X71A 2WFMA 3QH4A 3D5EA 5IVIA 2HFKA 1ZI9A 3FYUB 1EDBA 2HA0A 2O2HA 3ZLVA 3I1YA 4DMKA 5AI4A 3TJMA 1ORWA 2XUJA 3W9BA 1MTZA 3EF3A 4G9EA 1UK8A 4X6YA 3FCXA 5ALHA 5E4JA 3TRDA 1WOMA 2H7YA 4B0OA 3ICVA 5AI9A 5K3BA 3I2FA 1CUDA 4PSCA 5HF6A 2HU5A 1RYYA 4Y2UA 3ANTA 4QDXA 2WU4A 5HQ3A 3HLKA 4AMZA 3OTQA 2XQFA 2XUAA 2WTNA 1UOQA 4Q1VA 2JGIA 2PSEA 3C8DA 1XZIA 2RI6A 1MAHA 5I7UA 3W2TA 4F0JA 1WPRA 4OUKX 4GXNA 5ALTA 2DQZA 3DCNA 4GDMA 4BB0A 3IDAA 3OURA 2OG1A 2JIDA 1Q0RA 1TRHA 5FKJA 1EVEA 3DQZA 4KR0A 3R3YA 4K6HA 1IUPA 2WTMA 2JGMA 1GQSA 2QOEA 3FVRA 4UFOA 4X90A 1XZLA 5BWCA 1D07A 1GPNA 3WL8A 2ONCA 4UBNA 2PUHA 4G9GA 4J0KA 1ISPA 2YYSA 1XQYA 4LIPD 2J4CA 3BL8A 5AKEA 4EY6A 1A88A 3O4JA 3H2GA 5E2IA 1UKBA 1EB8A 4HXFB 5JANA 3OC0A 3SX4A 1CV2A 1MNQA 3SWWA 1EHYA 4WDQA 4U2EA 4FDMA 2HA6A 5K3EA 2X5XA 4X6UA 5IKXA 3NWOA 2PKYX 3GA7A 5EIEA 4A16A 1LPSA 1CUCA 1GQRA 5DTIA 3GUUA 5T4FA 2GBGA 3NGMA 5AKZA 1TCBA 3CN7A 3G7NA 4K6GA 3W9UA 4DMHA 2QXTA 1GPLA 4QNNA 4K5QA 5LIPA 3HRHA 3FWHA 4BRZA 3FVTA 3QVMA 3I2JA 5CXUA 4KAAA 2RHTA 3WA6A 4IH4A 3R3XA 2WUGA 2DQYA 1AUOA 1MNAA 2PX6A 5LZ7A 3O0DA 4B81A 3U0VA 5HK8A 5FXMA 3D0KA 4PSDA 5AKYA 5IVKA 5T4HA 1LLFA 1QIMA 2GZRA 4BAUA 3PF9A 4BVKA 2DFPA 4FNGA 1N5MA 3BWXA 5ALUA 4WCVA 2JGJA 4CG2A 5EI5A 3T4UA 3SK0A 2G4LA 3DEAA 1YASA 1JJBA 2CJPA 4JYPA 4FLFA 3H1BA 2J3QA 4TPKA 2VQ6A 3D2CA 4U2CA 3WL5A 4C4XA 2ORYA 2WSLA 2VJCA 4EHBA 3WL7A 3FSGA 4LYEA 4INZA 3DYVA 2DHCA 1A8QA 1JKMA 1ODTC 1XZMA 1JU4A 3F67A 4J7AA 2WIFA 5IVHA 1EINA 1CFJA 3WWPA 3FNBA 5LLSA 3I1IA 4QDTA 1C7JA 3BIXA 4B0PA 4DMCA 1AMNA 4P92A 1DQYA 5FUMA 3STVA 3PUHA 3H04A 1YSCA 4WFIA 1QOZA 1GT6A 4Y7DA 1ZJ4A 2RIPA 1WB4A 3WWOA 2HA4A 1UT6A 3FAKA 1BCRA 3IIIA 4OSEA 1XQXA 2GBCA 3N0TA 2EEPA 3GBSA 5JD5A 3WWCA 4F21A 1UKAA 2GBFA 3C6XA 4BCDA 3O9VA 1BROA 1CIJA 1G4HA 4HVTA 3R3VA 4P93A 1XRRA 5ALVA 4PNZA 4X97A 1BCSA 1A7UA 4NMWA 1RWQA 3GZJA 2PSJA 4BDTA 2W22A 3IURA 1VA4A 2VAXA 1IMJA 4J0DA 1LBSA 2Y6VA 1SCQA 4KJXA 4I19A 3O4HA 1YB7A 4DTCA 2VT7A 3EQ8A 5HKAA 2WFLB 3AZPA 2Z3WA 4DNQA 3AZQA 4IO0A 4AZ3A 5JD4A 4MEAA 4AXBA 2BAGA 1UKCA 3L1IA 4FLEA 2XQGA 4A23A 4BDSA 4RNCA 4EZIA 4ROTA 4BYMA 3G9ZA 4FWBA 3PF8A 4EY7A 4UBJA 3ILSA 1Z68A 4QE3A 6YASA 4QDUA 1QTIA 1XKLA 2B4KA 2WG2A 3I2KA 4MYDA 2XQJA 5ALGA 1E89A 2WLSA 2E3JA 5ALOA 3QPCA 1CQWA 5ALFA 4B83A 4Y2SA 4E14A 4BC1A 5E4YA 1R3DA 3VVLA 4X94A 3AIMA 5K3AA 2V96A 2ACKA 3L1JA 4H7FA 2O7VA 1R9MA 1H23A 4G5XA 2FJ0A 3H1AA 2CMFA 5FLKA 1GPKA 4BRSA 1O6GA 4TVKA 4L0CA 1CUIA 4MQMA 3AUKA 4JEIA 5F4ZA 1FFBA 5BOVA 1CUSA 3IUQA 1EB9A 4H0CA 3K2IA 3IUNA 1J1IA 4M0MA 1R50A 2XUGA 1OCEA 2ES4A 2HA3A 1MT3A 4KACA 4B9EA 1ZIXA 1EI9A 1WPXA 4FFVA 3RM3A 4J0JA 1HDEA 1XZBA 1QE3A 1ODCA 2QVBA 4DNFA 5ALWA 5AI8A 1AGYA 1KEZA 2EDCA 4EB0A 2QM0A 2JF0A 3A2LA 1TKRA 1FFAA 1THGA 5HZGA 2G5TA 1LZKA 4EY8A 5LKRA 3D2AA 5D3KA 1IVYA 1ACLA 1X70A 4NS4A 4FKBA 2ZVDA 1SCIA 5IVDA 2ZYSA 4G1FA 3WQHA 1DWQA 2FJPA 3A2NA 5I8PA 2OCIA 1GKKA 3VKFA 2Y2VA 3Q8WA 3V1LA 4ARBA 2C7BA 3STTA 5LP1A 2HDWA 4W63A 1B6GA 5JZBA 1X2BA 2V98A 3A70A 3IBTA 5CMLA 1JU3A 4H77A 4NZZA 5K3DA 3QPDA 2GYWA 3UUEA 4B7ZA 1OILA 1CUBA 1QIFA 5CT4A 5HFNA 4CCYA 3HJUA 3ESDA 4H7EA 2BCEA 1N5RA 1ZD5A 5KWIA 1QFMA 1CUXA 1XRNA 4WFJA 1G42A 4X3CA 2ZYHA 2B61A 2HRRA 4N8DA 4UHFA 1WB6A 1JT2A 2G5PA 2PSHA 5BWBA 4QDZA 3BJMA 3FLAA 1J06A 4IH9A 2WHPA 1ZI6A 2VJAA 1DINA 3FSGD 1LPPA 5AKLA 2WFLA 1EA5A 5AM3A 1CUJA 2WG1A 1N8SA 2O7RA 1XZJA 1K4YA 4GI1A 4KAFA 4EA6A 3DS8A 1CUEA 5J3JA 3V9AA 2XE4A 1MN6A 5AK4A 2JEYA 1BU8A 2R11A 3DOHA 5KWJA 4C88A 5DYTA 2XQKA 1HLGA 5K3FA 1H2YA 4GHWA 4WFKA 4MEBA 4W1RA 2HA7A 4UBMA 3UUFA 4EUSA 3KXPA 4OCZA 5C8VA 1DT5A 1TIBA 4CFSA 4UHCA 5DNUA 3WIBA 2HADA 1F6WA 1XLVA 4RE6A 4B80A 4MWTA 4Y2VA 2ECFA 4Y2TA 2D0DA 4XX1A 5D3ZA 4CCWA 1VZ2A 2OAEA 3LS2A 1AC5A 5LZ5A 2H1IA 3ESBA 2WILA 2HIHA 1W52X 4FMPA 1VE6A 4UHHA 2ZSIA 4PSUA 5JAPA 3O9MA 4OB8A 2XLCA 3NUZA 5AM1A 1HBJA 1W76A 4AO8A 2IIVA 1XROA 3VXKA 4BP9A 3SC2A 4MQLA 1CUHA 4AN0A 4P08A 3WK9A 4DLNA 1JJFA 3ZI7A 3TEJA 3G8YA 4FLMA 5ALMA 2QTBA 2AJLI 3FBWA 4D9JA 1QIDA 5LZ4A 1XZDA 1EXWA 1XZCA 4JH0A 3RK4A 4AO6A 5AK6A 3W06A 3JWEA 4N5HX 3FYUC 3WYDA 3C5VA 5BV7A 4U2DA 1E66A 2WHPB 4CI9A 2CEKA 3C45A 5EHZA 2QT9A 3E1GA 4Y2RA 2BUBA 5LZ8A 3ZWQA 4EBBA 2XUPA 5D6OA 5CBKA 2WJ3A 2JGEA 4H7KA 2ZJ6A 4XWGA 4OYYA 1EK1A 4MJ3A 1IZ7A 1NU6A 1T2NA 3G0IA 4KE6A 5CURA 2DSNA 5AIAA 1TQHA 3QYJA 5LZ2A 1U8EA 4EY5A 3WK4A 4DGQA 3F9CA 3F8SA 4AQDA 2VAVA 3A2MA 2K2QB 5AKIA 2G63A 5EHQA 1QIHA 3V48A 4Q3KA 1VA5A 3GELA 2Y2UA 4I3FA 2VA9A 4J0GA 4U2FA 2PM8A 3I6ZA 4K6KA 1Y37A 5JIBA 1CUVA 5HF5A 1SOMA 1TK3A 1CRLA 2WG0A 5FOQA 2XUDA 4UBKA 3PE6A 4KRYA 3PI6A 1RP1A 5CT9A 2GZSA 1EK2A 3R3UA 1XLWA 2WHQA 5AO9A 4W9RA 1IUNA 1EDDA 1R9NA 4BVJA 5AI5A 1CUYA 2FX5A 2PBLA 5HFAA 1U4NA 1USWA 2XT0A 2NW6A 3A6ZA 1VOTA 3I6MA 1FSSA 3W05A 2YXPX 2HA2A 4GECA 1SCKA 3BJRA 7YASA 5AM0A 2WKWA 1EVQA 4HAIA 2VATA 3G0CA 4FOLA 4C4YA 1AURA 2BGRA 3WWEA 5C8XA 5AKXA 5H3HA 2XMRA 4X6XA 4G8CA 2XLBA 4H7IA 1JJIA 1ACJA 1K63A 1L7QA 4DM7A 1P0QA 2O2IA 3R40A 1CR6A 2D5LA 3R0VA 5HF9A 3BXPA 2ZYRA 3O95A 5LZ9A 4H18A 3G0DA 2ACEA 5AOAA 1H2WA 2QRUA 3LLCA 2JGKA 2UZ0A 2O2GA 3G9XA 3CCBA 4PO3X 5DWDA 2Z5GA 5FP0A 5HQ3B 2VJDA 5EHXA 1A8UA 2Y6UA 3QZUA 5HKBA 4HTAA 3H2IA 3VVMA 5A7GA 4S0XA 3NOXA 3HI4A 2OGTA 1NU8A 4AO7A 5YASA 4Y2JA 3QMWA 4G4IA 5JD6A 4X92A 4CCYB 1F0PA 5EFZA 4RE5A 4KEAA 5ALSA 1CUGA 3C5WP 3FOBA 5ALRA 1H22A 1THTA 5ALJA 5ALLA 3WKDA 2RHWA 1PFQA 1DX4A 1BEEA 4BAGA 1XZGA 5JAOA 1LNSA 1QIEA 1CLEA 1KU0A 2GBIA 3KDAA 2QZPA 3LIPA 2OXEA 1FFCA 2Z3ZA 3ED1A 2XUKA 2OQVA 2AJ8A 2QUAA 5AKKA 4FTWA 3C70A 3WK7A 1XQWA 1IUOA 1F0NA 2CZQA 5AKGA 2H7XA 2B20A 3GFFA 4AB1A 5ESRA 2Z8ZA 3DNMA 5DLPA 3PICA 1UOOA 1LPNA 3O4IA 1CUUA 4OD0A 2XMQA 1FFEA 2IITA 3KWJA 2Y1KA 5SYMA 4DNPA 4YASA 4PW0A 3H2HA 4UBOA 1YA4A 4BCCA 4A5SA 4CIAA 4B85A 1Q83A 4B6GA 2XUIA 3L1HA 4OU5A 3H2KA 3WWDA 1L7AA 2EDAA 1U2EA 4G4JA 1YB6A 1ZD4A 1DX6A 3E4DA 3WL6A 4ARAA 3OPMA 3I2GA 2PUJA 3D7RA 1ZOIA 1VE7A 3YASA 4IH1A 3STYA 5I9IA 2CKMA 1XRMA 2JGFA 4BCBA 5A6VA 3D3NA 4AN1A 4WY8A 5SYNA 4WJLA 1ETHA 4X85A 5AJHA 4J0IA 1VXOA 4L72A 2AJDA 3DL7A 5KREA 4BBZA 5LKAA 2X76A 3WK5A 3KD2A 1OXMA 1O6FA 5AK3A 4U2GA 5ISMA 3MVEA 1WCYA 5FV4A 3DKKA 4LKOA 1FFDA 2QJWA 2QKYA 4Q34A 1MU0A 3Q0TA 3KWFA 2VEOA 1P0IA 4RPCA 2XMGA 4X93A 1YCDA 2OCGA 3V1NA 3DDUA 5DJ5A 3G9UA 1UFOA 4ITVA 3PFBA 2HRQA 2BJHA 4LXHA 2PL5A 4W1SA 3D59A 4BVLA 2VT6A 1TAHA 5AM5A 2IX9A 3ZPXA 3HZOA 5JAHA 2HFJA 2PVSA 4XIIA 4C6HA 5AHXA 3WZLA 4BTVA 3HABA 4QWWA 2BUCA 3B5EA 4ZWNA 1VJ5A 1HPLA 4QLAA 4H7JA 4H7DA 4AMYA 4KE7A 4UBIA 2HU7A 3K6KA 5C7YA 1R88A 3MUOA 2DR0A 4L9AA 1FJ2A 2I03A 4Q3OA 3LP5A 3DLTA 2QUBA 4Q3LA 3VDXA 3D4LA 2RAUA 3C6ZA 3CCCA 3I2IA 4K2AA 4PV7A 5ALIA 2C4HA 2C5FA 4IHAA 1LZLA 4LXIA 3CXUA 1F8UA 4BZWA 4KAJA 5AP9A 4BTLA 5AM2A 1YAJA 4GLBA 1CUZA 4MWSA 4BE4A 3BF7A 4QZVA 1MAAA 2WUFA 4QDOA 3H17A 4FNMA 3PUIA 2OQIA 1H2XA 2XUOA 3V1MA 1LBTA 5JZ9A 3IB3A 4ZRDA 3BDIA 2WFZA 4UUQA 3K9BA 4FBMA 2Q0XA 3DKRA 4YK7A 1VXRA 3B3QA 4W1QA 2WQZA 1N1MA 1VKHA 2QS9A 3ESCA 2V97A 1P0MA 2OGSA 4KRXA 4H7HA 4CG1A 2I3DA 1XFDA 1TCAA 3HACA 3AILA 3BDVA 3DJYA 4X95A 3ZLUA 1E5TA 1DT3A 3ICWA 4ETWA 1CPYA 4E46A 1QTRA 2WJ4A 1SFRA 4E11A 4UHBA 1ODSA 4PQEA 3X3HA 3C87A 1K5PA 3CN9A 3QPAA 1HL7A 4G8DA 4PF1A 2XDWA 1QFSA 4B9AA 4QEKA 3MGAA 1LPAB 3HC7A 3QITA 2V9ZA 4TGLA 3VISA 4OU4A 3AIKA 1BRTA 4B84A 3WJ1A 4LHEA 1W75A 1YS1X 3F97A 5ALPA 3WZMA 4UHDA 4OB6A 4HRYA 4WY5A 1B41A 2J3DA 1VZ3A 2RONA 3EBLA 5ALEA 3ZLTA 1AX9A 2WIJA 4HXGA 3H0CA 3WKAA 2AJBA 1HQDA 1BN6A 2X8BA 3TGLA 5JADA 1QGED 2CB9A 2PU7A 1DWPA 4W1PA 3G02A 3BF8A 5EHNA 1XZHA 1PV1A 4HS9A 4X7BA 1I6WA 4F60A 2ROQA 1HKHA 1XKTA 3DOIA 2HL6A 4OPMA 1C4XA 5T4BA 5AI0A 5IH7A 1M33A 1UWCA 2HU8A 5ALNA 1W6RA 3RARA 1DQZA 4ZV9A 5FPQA 3F98A 3DD5A 3LIIA 4QWMA 4Y2XA 2DHDA 2H9YA 1EX9A 3AINA 5FRDA 2OPHA 1AQLA 1G66A 1BS9A 4DSZA 1JI3A 5A7FA 4BATA 3G0GA 4Y2YA 3WKCA 3P2MA 3WI7A 2ZJ7A 3AFIA 1Y7HA 5DNVA 2XQIA 1K6EA 1AZWA 3WK8A 2VSQA 4N5IX 5CW2A 5HF8A 1XRLA 1UK7A 3H2JA 4X00A 1EH5A 3FYTA 1T4MA 5DTJA 3S8YA 3WK6A 4Y2PA 1QIIA 2BKLA 2C0QA 1WHTA 2ZJFA 2Z8XA 5A7HA 1LPMA 1XRPA 2WUDA 2C5GA 4HRXA 2FUKA 1MX1A 4L3WA 1R1DA 4ZGBA 1IZ8A 4CIBA 3OG9A 2GYUA 4LXGA 2JGLA 2I78A 4DMFA 5K3CA 2WIGA 3WJ2A 4JYMA 4C87A 2PPLA 1GZ7A 3ESAA 2WIKA 5JALA 1YR2A 1QIJA 2HA5A 3HYSA 1WM1A 4UFNA 3PDCA 3G9TA 4CG3A 4JUIA 5JZSA 2OCKA 4GW3A 4QA9A 5DYWA 2OAGA
chains in the Genus database with same CATH superfamily
5DULA 4AX4A 2EVWX 1H1LA 4BLUA 1XEWX 5FB3A 3ROGA 4F72A 1PQUA 1ESCA 2C7QA 1IY9A 5K2MA 3M3DA 4W5WA 4WLNA 2AN3A 4BZZA 1UBJS 1FUEA 1RLIA 3FR8A 3HVUA 3K94A 2JVKA 1K7FB 5B3KA 1Y5LA 1KQPA 1B6RA 3VH2A 5D3QA 3TDNA 4MKRA 4UUNA 3TBFA 3IV6A 2FUCA 4UKDA 5FNVB 2JH9A 3RBZA 3D2BA 2IPOA 3E5MA 4HQLA 3CNNA 5JI2E 4NE9A 2D6FA 1ZO8A 4OI0A 4EA8A 2E6UX 4BFUA 4PZCA 3HCPA 5BMVF 1LPBB 3TE6A 2DUWA 2QQ5A 3VNAA 2IX3A 1SC9A 3IAXA 1AS2A 2CXPA 2A86A 4NENA 3AG5A 3PB3A 1XCGB 2C0PA 2JFQA 3AP3A 4RTKA 2D2VA 4WAUA 3MIIA 2HJRA 4FYHA 5K7SA 2FUNB 2IH2A 4GF5A 4A2CA 4GOLD 3EISA 4PLHA 2GPJA 3WGIA 1KP9A 4MW6A 4QHSA 4WDRA 2PWYA 1D6NA 1F2TA 2C4TA 3EQ9A 4PCVA 4PHFA 5D7BA 3UJPA 3ZCSA 1NGSA 5U9CA 2WI8A 2ZR0A 2FRDC 4H59A 1M72A 5FI5A 4Y9SA 1Q84A 1VMEA 4G36A 5EL0A 3V9PA 4C22A 4CKBB 2IEZA 5KQMA 2O8BA 5IJ9B 5JDIC 4GOMD 3T7TA 3BZBA 4IFTA 1PG5A 3LYUA 3MJVA 3H2BA 2V6IA 1NZDA 1R66A 1QH1A 2QRVB 3PQDA 1E3MA 3PEYA 3GLIA 1OUMA 3E3AA 1QF6A 2W7TA 1R4MA 2BFEB 1S1CA 3CG0A 3FCSB 3A4LA 4Z3OA 1UJCA 4FFMA 1P4SA 1EQAA 3JWIA 4EMBA 4AKSA 5JJCA 3ZWDA 1U6IA 1IZYA 1J90A 4OM8A 1TZJA 1KYWA 2I3ZA 1DZIA 1O96A 4RZUA 4CF5A 2ZR8A 1TYAE 1Y6QA 4N40A 1FU4A 1NVFA 2VPXA 2FW9A 1C4OA 2COEA 4J16C 4HDOB 4I6EA 4NOKA 4KO1S 1KI6B 2GYVA 2J0EA 5EE5B 4UC0A 4B47A 4WOJA 3N2ZB 3RHZA 3TD2A 3MINA 3QX9A 4GI7A 1DBQA 1RBYA 2FPUA 1UP4A 1OI2A 2P6NA 3IUMA 4MUXA 4R1OA 2I1WA 2GK3A 3UK2A 1IVSA 4YRQA 1X1BA 4PQFA 2WSYB 3MXTA 4I6GA 4BAZA 2A0YA 1ZKDA 3R5KA 3W79A 2EZ8A 3N8IA 4AC9A 3ZIAD 2G72A 3IDSA 3QXSA 4KXWA 4YCSA 5CLIA 2ZI9A 3IUYA 3STUA 4EABA 3OFND 4OHCA 4LK3A 3ZHUA 4GKJB 3NXSA 1QHIA 4R2HA 5IASA 1JQEA 1CY2A 4M0FA 4MUEA 5MFPA 2F55A 1SXHA 3UPTA 2XMZA 3VO1A 2AUTA 1HLDA 1L7BA 3KEMA 1RQ7A 2IEDA 5HJ5A 1JAYA 1DKQA 1JE1A 3CXRA 4HMPA 4TRNA 4UEOA 2R6R1 3QMPA 4AJ4A 4NV3A 1GXSB 1NAHA 4L2IA 3S68A 2IDKA 4Z5XA 3HVIA 1US8A 3MTGA 4U2BA 3T38A 4CM8A 3D4IA 5F7ZA 2LV8A 2E82A 2H2FA 3UG6A 1MX5A 2G83A 3EUEA 1YQUA 2C84A 1OA1A 2WFAA 2VBIA 4V2IA 3WYNA 1HE8B 1AQYA 2JANA 2RHGB 3BH6A 4M38A 5A2GA 4EATA 5IXYA 1AKWA 1ZJ6A 1YBVA 1C2TA 3E18A 2BUAA 5ADUS 4RNDB 4I4IA 2DUJA 2DMRA 3H9BA 1ZMBA 1LKZA 3Q3GE 1I6MA 4HDKB 2WJIA 1KJWA 1RAAA 3GRCA 3DEFA 1WVGA 2PQMA 3D8RA 3LPDA 2BBWA 3DE1X 2QTAA 1UMCB 1YKSA 3RHTA 5AJWA 3V4LA 4ECEA 3PHBE 1ZZEA 4B6EA 3GEBA 3DLCA 3S2IA 1LK0A 1EHCA 2HOQA 4R51A 4KUEA 1UXGA 1X7ZB 1CUWA 2IV7A 2FPSA 1R4ZA 2X4IA 4K3UA 3JZDA 2G9ZA 4OAQA 4OXRA 5LB4A 4D8VA 1S7GA 3IVCA 3ZVRA 4AD8A 1QIKA 2PZFA 2QVYX 4TN1A 3TCXB 4RCYA 3T7DA 2H1HA 2PD4A 3G0BA 5C5DA 3Q7QA 4F6RB 4WH0A 1V0JA 3Q5GA 4LVNA 3VPFA 3ER8A 3IV9A 2FPGA 4JZKA 4V0LA 2ZBDA 3BHIA 5EWMA 3H9CA 1IBCA 1SQSA 5ALQA 1WR8A 3U4HA 4ZHQA 2WEKA 1OROA 5FH9A 4HH4A 4BXOB 2WOOA 2CJWB 2NYUA 3K30A 1V5GA 4AIRA 2Q9CA 4JP1A 4L5JA 5MHTA 3GGPA 4MYRA 2C2HA 3AU9A 2ZQZA 4TTAA 5JQWA 1MAVA 4FT4A 3E53A 4JUFA 4RLFA 3U40A 3SEFA 4NBLA 4IMIB 4RIEA 2XNCA 3R0JA 5DCYA 1PLKA 1SJ9A 1V5FA 2BTQA 2EHJA 2JLXA 1DO2A 2PRSA 3HY6A 2ZJ3A 5B57C 1M1YE 1Z07A 4L4ZA 3VA7A 3S70A 4M0EA 1P0CA 4R9RA 2FG7C 1QJ4A 4RFSA 2HXGA 2XYHA 2J0UB 5J5VA 3PGXA 4NCKA 3VMMA 4XCXA 3VX3A 4B2YA 821PA 1CQIB 3JQAD 4XGRA 3DWGA 5DSZA 1CDZA 2BFDA 4ZI7B 5CT6A 2YYAA 5CDUA 1LGYA 1FVOA 1PK7A 4M98A 4CV1A 1E4EA 2WDPA 2HO4A 1RZUA 5HDBB 4NG5A 1TJPB 1L5SA 1RQNA 4YQZA 4F3NA 2H7CA 1ZSVA 2IZ7A 3KV1A 2HYDA 3VR5A 4JYBA 5CH5A 1XZQA 4EP1A 1PZEA 2I3AA 3MC1A 4RK4A 1DC5A 1UAGA 1ZH4A 3ETCA 3GCDA 4R2JA 2QMUA 1GR1A 5DXJA 4CE6A 4EG8A 2X0JA 3DEHA 1T9BA 2P2LA 3KC2A 3RB8A 4DVJA 3OZFA 4Q21A 1Q7RA 2IIQA 1WDKA 1ZGJA 2VHZA 5HQTA 1E6WA 2QLTA 1P2SA 4URZR 1K08A 4HQ0A 1GUYA 1GSHA 1P4JA 2WW8A 4TKLA 3UQZA 2VSXA 2B9VA 3BOSA 5EGNA 4E15A 3KTDA 4TN5A 2LR0A 1P60A 4K88A 3H16A 1VCOA 3FETA 3CZAA 2IUUA 2JA2A 1UDRA 2VPZA 1TKBA 4P81A 5FWXB 3VYWA 5AM4A 4W5OA 3QM1A 3NBKA 2G82A 4PX5A 4QOEA 4EKDA 1T3LA 2YRWA 5AK5A 5MGNA 1WU8A 2BBTA 3KOYA 4DLBA 3GCXA 4TS3A 5EJGA 1MVOA 4Z1MA 2GAAA 4CMCA 2PCLA 1NYTA 1RHKA 3JWJA 1CQXA 2B2XA 2YX1A 1Y7IA 2FEXA 3MWLA 4UM7A 4ZQFA 5HOEA 4IEFB 2XCOA 2GAJA 3I9V1 4WVFA 2F1KA 1EFRD 1JHRA 4REMA 1XVIA 5AKHA 5I6DA 3QOXA 1V4BA 4JNCA 1EGHA 1EPUA 3D3WA 3R44A 1ODKA 1R00A 4FXPA 3OZAA 4GBED 1PNRA 2FP4A 3KPVA 1RNLA 1MRSA 1JLMA 5D2CA 5HDQA 3CNEA 1OFHA 1ILEA 1NMSA 1OI4A 1GITA 3KYDB 3QVTA 2H1VA 4PZZA 3LUJA 1DRJA 4MUIA 4X54A 3GLFA 2GZ2A 2CBGA 4Q82A 1E8DA 1BOFA 4HXYA 5AW0A 1QQTA 3BXGA 1J9EA 3EGXA 4LTDA 4RVFA 4HNUA 5JSUA 2OFPA 4KV7A 2NU6A 1WE2A 3DEJA 1QTNA 3I01A 2GN2A 1M2VA 4KE9A 1XCOA 2O1EA 1PQYA 1DO8A 1PT6A 1XRQA 2GTIA 3I28A 3IC5A 1W4BA 3BD6A 1MFZA 3DVAB 4RY2A 3RU2A 2A5GA 4KIGA 1LDMA 3HM2A 1M2NA 1FFXB 1QBKC 3RU7A 1TQDA 2ZS9A 5CT5A 2ECPA 2RARA 4EKNB 5KYWB 5DTMA 5EJEA 4M1KA 3OLWA 1FYXA 3JQAA 3KQOA 3IALA 1QE0A 4UE3S 3I9OA 4NRDA 3G13A 3PR1A 3FNRA 3FFWA 1Z6AA 1Q0ZA 1Z5UA 5K0SA 4Y98A 3WQQA 1X1AA 1KL7A 1QZ3A 3NWPA 3EAFA 2DPLA 4IZHA 2NVUB 4D8TA 2B6NA 3WVNA 2YXDA 4HGQA 4WKCA 1GLNA 5K51A 3IMFA 1PJ2A 3F96A 5F98A 2VWPA 3U7GA 1RI2A 4X8LA 1NPYA 1T4CA 2V9CA 3NLLA 3SG0A 1KGDA 3IT1A 1XD9A 2BC9A 3BFXA 1NT4A 2JFNA 5AICA 2Q29A 3LCRA 1IPEA 1Z6XA 4IICA 3TZLA 4M54A 3Q2IA 3JRWA 4PXSA 1X2EA 2GZAA 4N01A 5KYYB 1HR0B 4WBNF 4C2TA 2ONZA 1M1YB 3BMNA 3AF2A 1TCCA 1PJAA 3MJ4A 2V7VA 4M8IA 4MJXA 4RANA 2WHEA 1I6KA 3BHMA 4N54A 3M83A 4L74A 3S8MA 3VX4A 5I45A 3FDXA 3RVPA 1Y9EA 3U5TA 1E3JA 4HPXB 3A32A 2JFBA 2W5UA 3LFTA 2KMLA 5IUJC 1TJ5A 4BQRA 4YXWD 1YE3A 3QMMA 4GX2A 1VI6A 3IXMA 3V1YA 5BYKA 1WO8A 3GL9A 3K7EA 4H0NA 1D3AA 3FUUA 5EJIA 1R10A 1F20A 1HDCA 3KEQA 1R18A 3KKQA 3OM0A 1KDVA 5CCXA 5C8ZA 2WAOA 2ABWA 2FZCA 2OFFA 2LIPA 3RG2A 5JATA 4JI6B 1BW9B 5CDTA 3M4ZA 1POXA 1U9IC 1PK9A 3THXA 1BXKA 4CM5A 4POOA 5JDIA 2R4TA 2PWZA 1G9SA 2CSUA 2DFDA 4ALIA 5A9TA 2GHRA 2WKRA 4J1NA 4YXFA 1ZXLA 1ZVVA 3NJRA 4BO7A 1G20E 3LBHA 2F1JA 2CFIA 2VDWA 3TLJA 3ZNPA 4IOMA 1A97A 3O3CA 4KBFA 3JW8A 4E7OA 4IX9A 2AXEA 5A05A 3AJDA 3SZMA 1NW7A 5IKEA 4EJ0A 1PT7A 4PM4A 5EZSA 3WIDA 1H2ZA 4JLKA 2WF7A 3BGVA 3FMPB 2PV7A 4HMOA 1ZS9A 4ARSA 2H65A 3VYVA 1QIGA 4UNQA 2A0FA 4J16A 4YUXA 2QMQA 4ZI5A 5KYUB 3KK0A 5IFLA 5FL7D 2QX7A 3TWOA 2GHQA 4A0QA 5CK4A 1E7RA 4KG7A 3LCJA 1P81A 4PGGA 4MXDA 3V4OA 5I9NA 4ZHQF 3PP8A 5BQPA 1CERA 5IBQA 3ND7A 3T5PA 3LYHA 4RGYA 3GEGA 5BUZA 4TLEA 1B2LA 5CH3A 3MOSA 4PLZA 1TTHA 1TA4A 4C3VA 1JA0A 3I23A 2WUEA 1Y3IA 1SD5A 3L6EA 2TSYB 2YS7A 2R8BA 2BGMA 2YYZA 3GMTA 2ODPA 4BQSA 2PZ8A 1VKJA 3CPEA 4Q7JB 5AI6A 4WZAA 1MHTA 3VC3A 1P6XA 4F4UA 3EXHC 1JBKA 2GUGA 3RU9A 4HKTA 5IVIA 3BD7A 2DF8A 2H6EA 4DEXA 3IAHA 3FYUB 1PNQA 3MF4A 3AL0C 4BO5A 1EDBA 1JHOA 2HA0A 1ES9A 1WKVA 4FFLA 2NVBA 1XJ0A 2GRJA 4FYKA 1HZJA 3HMQA 4FT2A 5DH9A 3SSOA 4DQ0A 1XRJA 2I8CA 3OAAA 4TZ6A 2FSPA 4UM9B 4CKCA 2V0GA 3BK2A 4ZOLA 2HCBA 4WQMA 2LW7A 5FPKA 4EHJA 3D9QX 1ORWA 4JB0A 5B2FA 3W9BA 3DG9A 1S3FA 2ZP1A 3OE4A 3FX2A 5DB4A 2BR4A 4GNRA 1E1NA 2P6PA 3LKDA 4X84A 1Y42X 5CLQA 1PEAA 4JOSA 4X9XA 4FZ3A 3VBEA 2B5VA 2J09A 3QUSA 5BNTA 2RD2A 2ZATA 3K0CC 1ZGAA 1IXYA 2Y1CA 2ZEJA 3N2YA 2NTVA 1VGQA 2PO7A 2ZRMA 4RZ2A 1JLKA 5FWDA 4JI0B 4RPKA 2C03A 4UULA 3C4VA 4NXNB 3CW9A 2AF4C 2Q3LA 4B0OA 2R4QA 4DRXB 3EXFA 2IGBA 4US2R 2KBEA 1NULA 1V3QE 3I2FA 4MVJF 4N49A 3UJHA 2ZT8A 3QX7A 721PA 2XVYA 2P9GA 1FBTA 1ORIA 2I9PA 4Y2UA 1E2UA 1T9AA 2R6JA 2VDRB 1RRKA 3GFGA 3IEIA 2XHZA 4TMYA 3U39A 3WGHA 3DZDA 2Q5LA 4G67A 5JXHA 3HWWA 2X2PA 3HN6A 1E2BA 3OCXA 2WTNA 3DDSA 3GJ6A 4C0SA 1UOQA 3ADPA 3FZEA 2JGIA 3GNTA 2NMVA 1XZIA 4D9MA 1MAHA 1ZFNA 2QM8A 5IPFA 1ZD9A 5I7UA 4YRSA 4QQFA 3OIWA 1BH6A 4QPDA 2GCNA 2L69A 3VGPA 1MXHA 4B46A 1PR4A 1WPRA 5J23A 4XUDA 4C08A 2DQZA 1H94A 3D7NA 1ULUA 4HWRA 3BILA 4QPNA 5REQA 3I9JA 1SELA 3FSRA 3L8GA 5JTTA 4Q9DA 2A4MA 1WEKA 3TXYA 5I7WA 2YJ6A 3RH0A 1WCIB 2OG1A 4YR9A 3V3TA 1TLFA 5T8KC 5KJ1A 2OAGA 1CEQA 2XOEA 3GOHA 4PPYA 4X7PA 3C3YA 5B36A 3VJRA 3MWGA 2PKQO 4K87A 1CRWG 2PWPA 3PXDA 2JFHA 3ITNA 4ID9A 1C8KA 2JBAA 5CDGA 3M1IA 2NVWA 2H2IA 2FWNA 3R3YA 4DREA 2PUEA 4GOXA 4QT0A 4WBXC 1OWLA 1SBYA 4AF7A 3RS7A 4N82A 1PFGA 1T29A 2O8EB 2VJOA 2TS1A 1QRAA 3CBGA 2GEBA 2YV4A 3W3AA 2Z1DA 4UMDA 4ZZ2A 3REQA 2DPMA 4B6OA 2WQ6A 2H7VA 2ZUCA 3ROKA 5EA2A 1B2RA 4AMGA 4HQRA 3VGJA 2CCKA 1W0KA 4ZZ3A 1D8AA 1Z35A 1T5OA 1Z6GA 2OECA 3N8KA 4PY2A 1P2UA 5L7YA 2FCRA 4UBNA 4YALA 3N5CA 1KRWA 2B4YA 5J4HA 3FOFC 2YYSA 5I7RA 1YKGA 2YMMA 1JJ7A 3LOUA 4I36A 2H92A 3MERA 4MS1B 2BLNA 5DX1A 3RF7A 2EAUA 1Y6FA 3U3KA 4YMWA 4BZPA 4LF5B 5BYAA 3KSMA 3QU4A 4N1AA 3W34A 5HZKA 1ISGA 3ZE6A 2IYZA 4WV3A 5E2IA 2IU3A 3I1JA 1L7DA 2XYVA 4LPKA 4JODA 4CKWB 1EB8A 1P4GA 2QYHA 3PI7A 4HXFB 4JUCA 4GPTA 2FZGA 5FBHA 4OHBA 1BGVA 1L5HB 1I0ZA 2VHWA 4P84A 3SX4A 3VR4H 4E2YA 1JNYA 3D6MA 1JBEA 1JZTA 2X7HA 1JP7A 4HWGA 3LECA 1VPWA 3DVLA 2P4UA 5HR5A 3LM8A 5HZHA 2PH3A 5A5FA 1RWKA 2ZIGA 3EDRA 3K0EA 1O9HA 1F2TB 1FQJA 1MO4A 3FPGA 4JASB 4FW8A 3WGMA 1RBZA 4HNQA 2J48A 1KH1A 2EERA 1YOVB 1JQKA 1KJYA 3OHSX 3A1NA 3OESA 2FN3A 3RRFA 3DZFA 1XN4A 2N47A 5D00A 2RSLA 4Q00A 5GM2A 1GRRA 1YFJA 4HNAA 3L4EA 4UQLA 1HDRA 2A9KA 4ZVPA 2VQDA 3SICE 5A4IS 4NG4A 2KX7A 4ZI2A 2BI8A 3UMYA 2X1VA 3UMGA 2J5XA 3L5OA 4BMXA 4ENPA 4DARA 3CN7A 2BEUA 3D0RA 3JQ8A 4DM4A 1GYRA 3IEVA 2QXYA 2HTFA 3N58A 1ZEMA 5JRDS 4K7JA 1GV0A 5L45A 3H6HA 1Q3KA 3U81A 3QVMA 3UQYS 1ZLXA 4FJ0A 1TTTA 1LI5A 2IYQA 1OI3A 1DADA 2WYHA 3WA6A 4F1KA 3ZVNA 4Y8VA 4U0JA 5EKXA 5C8YB 5LQKA 1DP4A 3FPFA 1VCIA 3TR5A 3ZVLA 2AQKA 1TEZA 1G2OA 2GSDA 3GCGA 1XEFA 4YCDA 3BDAA 4DA8A 4ER3A 2R3SA 2R66A 3HWX1 4HGRA 2IS1A 5LDDC 5I7VA 3U61B 1WBBA 4J29A 3LBYA 4C5AA 1XL0A 1FLVA 4RVUA 2WNHA 5CPFA 1TRKA 2FETA 4H6XA 1XU4A 2AOUB 1SEVA 3C6QA 3FHLA 3O93A 4UJ3A 3DM9B 5HX7A 4MGKR 1YS9A 1DAFA 5JH7F 2F9MA 2ZUFA 1D4FA 1N5OX 2DB3A 5AKYA 4RIIA 4TLDA 3AP2A 1LLFA 4C3ZA 3C3WA 4CKWA 5ITWA 2P4QA 3K4HA 6REQA 2YUIA 3P0FA 4RWZA 4M0CA 3PF9A 2R0QC 2IDJA 4Q9AA 3PZBA 1KSGA 4F1JA 4TZ0A 1W8IA 2ZREA 2UXDB 3AUXA 2YWCA 4FBGA 3TMKA 1A8IA 3HVRA 4FNGA 3FNFA 4B2IA 5JO0A 2B98A 3P9PA 2PE5A 1DIAA 4WCVA 3VR2D 1NJ1A 3T4UA 4FS3A 3LI2A 3E9EA 1FX0B 1TXGA 1XTIA 2R1VA 2VPPA 2YJ3A 2KW5A 3N28A 3DEAA 1YASA 3T3OA 1U4OA 2WYVA 4JYPA 1KEEA 3BFJA 3WYEA 4BNVA 4F4IA 1NNI1 2WWHA 1HT1E 5DHUA 1UZUA 3WAKA 5D7NA 1GILA 2BL4A 2DSTA 1RYZA 3NHUA 3OEEA 5LFAA 1L0BA 2XBLA 3KOUA 5ES3A 3GP5A 3PPXA 1VPTA 5H9WA 1WD5A 1ISHA 2NZYA 4PG8A 3V8EA 3VU8A 3G2OA 1CK4A 1E1KA 5ECDA 2VPYA 3FSGA 4AUKA 1FW6A 5LIRA 4INZA 3DYVA 5B30A 2HH9A 3LO8A 2EJUA 3OMXA 4KXQA 3U17A 2LTAA 3ZQKA 3HBJA 5GV7A 1FS5A 4EECA 5CA0F 1E79D 1ODTC 2JPDA 1XZMA 2R5WA 1VMAA 5C4GB 1CF4A 4NBTA 2C4NA 1ISFA 2H8GA 4LYHA 3ZE2B 4D56A 1N92A 4WZAB 2MDTA 1AHIA 3P1JA 2H8KA 4AMVA 1XCPA 5FO0A 1OX5A 1TT7A 3BIXA 3I58A 3RHSA 3QVLA 2P3QA 3P9XA 1GZ5A 4OFBA 3RABA 1AMNA 4LNAA 1CZHA 1ULZA 5FUMA 2H1CA 2XVXA 1YSCA 4WFIA 5DM60 4O4JA 4D0NA 2CZCA 3VOTA 3BHNA 1EU1A 3H1PA 1E9RA 5HCNA 1O0CA 1T10A 1WB4A 4IG4A 3VKWA 3ULKA 5IZCC 3FAZA 1IMOA 3FAKA 2X41A 4OSEA 1EZ4A 2Y1GA 1B8PA 3TTYA 1YE8A 1RYMA 2NAFA 3A8TA 4MW5A 4IXNA 2YCBA 3AWDA 4CTNA 2GBCA 1LVHA 1USKA 4KGVA 2V8BA 4ALJA 4ER6A 3BMXA 3GBSA 1KWKA 4OBEA 4ZN6A 3KT0A 4GOKA 3I37X 1M6YA 1PCXA 1Y4ZA 3NV9A 2FSUA 1RWMA 1UKAA 2UVPA 2E87A 1UBNA 2BI7A 3PG5A 3TFQA 2DX7A 3B2EA 4I1IA 2PUVA 5DHSA 4ENQA 3PDWA 4F9EA 3TQTA 5JPCA 4ESEA 3DAHA 5C32A 3H9JA 3TL2A 4LMBA 4DT1A 1XMOB 2AMJA 4CLEA 4Y6PA 1V7ZA 4GP6A 2W2KB 1G3UA 2GF2A 2V7BA 3O1LA 4B3IA 2FLWA 3PFGA 4Q39A 1FUKA 3AUUA 1FRVA 2Z9CA 3AY0A 3BFVA 5TE9A 4V0RA 4Z3DA 3PDJA 5ALVA 5JV5A 3DSRA 4HBZA 2I6TA 4PONA 3NANA 4GU5A 2LIVA 4X97A 4ZYLA 1DKRA 3V1TC 4CT4B 3E9YA 4CDNA 3NRBA 1PWZA 4J2HA 1AO3A 3AF0A 3RCBA 2FWAA 1I33A 2G67A 5FHQA 3PC7A 2Q45A 2FU5C 3RGWS 1AT1A 4NCBA 4B76A 4BNGA 1ORHA 2SCUB 2ZVQX 3AEKB 3MTDA 1TU3A 3PT5A 4S1WA 1FFGA 4TV8F 2Q7DA 1Z13A 1FUIA 1UBTS 3U4IA 3B3GA 2W22A 1F5SA 2I6XA 3OZWA 5BQXA 3KZMA 2VAXA 3ICCA 2OMEA 3QFSA 3OT1A 3P9CA 4JAVC 5AHWA 1RQRA 3PQCA 3VDRA 4KTTE 4U1RA 5JO9A 3SOPA 2IOHA 1TKAA 1EA7A 1JG7A 1EWTA 3MTIA 4FMCF 1AY0A 2UYCA 3S2GA 2R1TB 1T36B 1ZMOA 2LUOA 1U2ZA 4HD8A 4B6JA 2G8NA 4HNTA 3F6YA 4KJXA 4KU4A 3H8WA 3RQIA 1Q1NA 4NZMA 3AJRA 2A6PA 4MAAA 3K9CA 4BLPA 1YB7A 3FPCA 2D1FA 1EVLA 1LRJA 1C0PA 3JCZA 3GLKA 2Z3WA 4JLWA 5K0JA 3PLRA 5TS2A 2O59A 1PF7E 3F4KA 2G6TA 3NP9A 1N33B 1FMJA 3AZQA 2ARKA 3RSLA 2P7IA 2YNMC 3MS7A 4EPXA 4MEAA 4YWHA 2BAGA 1M83A 3O1HB 4LV6A 1UKCA 2FPXA 1T2FA 3LVFO 4FZJA 1JQAA 4HDRB 3W9YA 4WADA 3O1IC 1L5FA 4LVOA 4NMMA 3IOMA 3KR1A 3MCUA 3HVHA 3VYUB 2QSJA 3IODA 3JX9A 4Y1GA 4A2WA 5L6LB 1U7OA 4EZIA 3GN1A 3C0KA 1EG7A 1W4RA 1NMXA 1D1SA 5K8CA 3NHSA 4BYMA 2JFWA 2O8NA 4WCDA 4LRWA 5LU9A 1PK8A 3F8TA 4FEEA 2YWEA 3HEMA 1UJMA 3SX0A 3IAS6 1Z68A 4PWYA 2X6QA 2M6RA 4QE3A 6YASA 4QDUA 1Z8HA 3INTA 4G0YA 1HMYA 4KMSA 4OBXA 3WRYC 4C14A 5MFZA 1GEGA 3TKAA 3I2KA 2Z57A 3AFGA 1GV1A 3B6ZA 4HR7A 1EFUA 1GWNA 3IRUA 5ALGA 2ZRPA 2ZI6A 4F2GA 4TWJA 1ZNQO 3ZWYA 4CN8A 4YMVA 2N42A 2IDZA 4GG1A 1W2WB 1VJCA 5AJXA 3Q7PA 3QVOA 4B83A 3WP1B 3DBOB 3U9SA 2CWWA 1L6IA 2V3VA 4L7VA 4E1VA 1IJFA 4P3PA 1TM3E 2IQ5A 1CLUA 2INGX 3CUWA 3MCAA 5DLYA 3TJZA 2CL5A 1EM6A 1ESZA 1TO1E 3GRYA 2LCFA 4YRIA 1QS0A 2H1WA 3HMKA 4HQOA 5JH7A 5LU8A 4UM5A 2CDBA 3A1EA 4QBGB 4MGZR 2YCLA 1OSNA 2JW5A 2ACKA 2CZGA 2Q3FA 3Q5EA 3VI3B 4CQMB 4EDFA 1DKMA 4YJ2B 4FFPA 1HETA 2G40A 4H7FA 2BGKA 3TL3A 4QUBA 3BMOA 1H23A 1T8TA 3DGEC 3FUXA 4JKYA 4G5XA 1JIKA 2Y27A 1MQAA 3OEHA 2FPRA 4G1MB 1PP4A 4KJZA 3NWEA 4D9EA 5LMNB 2YV3A 2YZMA 3QFCA 3ZTTA 4YY3B 1ZEJA 1IK6A 1YCFA 3LLSA 3FPJA 2P9EA 4TVKA 5D86A 3OQIA 5AVRA 4Z0TA 2OV2A 4JIGA 3GJXC 4A8PA 4IJ6A 4EJFA 1JAZA 2F90A 1XHEA 2W6JD 4MS4A 5F4ZA 2QORA 1O8CA 5KVSA 3PITA 2XZLA 1ZP6A 2FPIA 3IUQA 3DE3X 1ZC3A 5BW8A 1KERA 3W2IA 4OJMX 4U7PB 5JD6A 3BL6A 1CY4A 1WTAA 1G8YA 3DAFA 1Q50A 3A6HA 4K0RA 2SCUA 3AEKA 1J1IA 1JVBA 2FFBA 3GLHA 5LSAA 1TE2A 1R50A 5EMKA 2NLOA 3RJZA 4KGZA 5E9QA 3ZI4A 1EWKA 2ES4A 3OOYA 4FKZA 3I05A 1VRWA 3BE5A 1MT3A 4AJ2A 3WHIA 1E1MA 4ARVA 3F73A 5EOVA 4MR8B 2OYRA 3RTAA 5C7IO 1A27A 1T9KA 2JB9A 4J0JA 5EINA 2BEVA 1Z08A 4PG4A 1HDEA 4QYWA 3UEOA 2FAXA 1G3QA 3IBSA 1T6XA 1XZBA 2B69A 4ZT7A 3SS9X 2PKEA 1L5YA 1QQ5A 2YFQA 3QRWA 1ODCA 2AG6A 2QVBA 4CODB 2G70A 1OH5A 3BICA 1LNZA 1SUEA 4DNFA 5LJLA 1IM5A 1M2FA 5G3ZA 5ALWA 2WJHA 1AGYA 2EL9A 3ZGVA 1EWYA 2GXSA 2EDCA 4L22A 4PTLA 4EB0A 3EW7A 1TKRA 4PS0A 3N0VA 3HYCA 2Q1TA 5K0BA 2G5TA 4N9WA 5FTWA 5EWMB 3K70B 4NCNA 1BMFA 4C1BA 2AZTA 3DV0A 3LAWA 1F17A 3OMLA 4HB4A 1ZQ9A 2WWFA 2NZJA 2CMKA 3A6FA 3KWLA 1EBBA 1G2QA 3KPUA 5DTRA 1IONA 3SXJA 1ACLA 3NX4A 3JRXA 2WUVA 4NICA 3RNOA 3OEED 4OOEA 3CLHA 2ZBQA 4ZEMA 3SR0A 1J00A 2AHOA 4I1YA 1EKXA 5FX2A 3K35A 4HPJB 2ZYSA 2W2XA 2APJA 3HDYA 1N0UA 1I2AA 3GUYA 4YRTA 3VHRA 3WQHA 1E77A 4MR7A 2AN1A 3INGA 1DWQA 3WMXA 2FJPA 4XWOA 3A2NA 4JI8B 3SC2B 4FUTA 2ZT5A 4DJTA 2RE8A 4KNWA 1DQRA 1GKKA 4WXMA 3RLFA 1U63A 4R6XA 1POWA 3VR2A 4EMUA 3WBKA 1R16A 2FXVA 5JYBA 3EH2A 4HRVA 3GRAA 2WHYA 3EXG1 1A5SB 4RELA 4DQUA 2HEGA 4MV8A 4DGSA 4EMTA 4LF6B 3RRXA 3ZZ0A 5LNK6 5E4FA 1FUUA 1W5AA 3VR3D 2X22A 2V98A 1LB1B 4FGWA 2YMLA 5F5LA 1BDHA 2G77B 4WOPA 3T4XA 4IIVA 2JKYA 1FP4A 3MUEA 4MA5A 3T5GA 3QVGA 1JU3A 4NBRA 1RFLA 5FAKA 2VF5X 4NZZA 7ABPA 3OZEA 3QPDA 2GYWA 3TFOA 4ADSG 3PENA 1RPZA 4XOIA 3E3OA 4AUNA 4B7ZA 1CQIA 4GI3A 2ZI5A 1CJMA 2GCGA 5HFNA 1Y9ZA 2YINC 3BWMA 3FUCA 2HZ7A 1M67A 4I55F 1OPXA 3MT0A 4WVLA 2A5FA 4Q4JB 4B3TB 3FB4A 2W2QA 2XKKA 3AETA 3UMSA 3VPBA 1R5NA 1KO7A 3LL4A 3EHDA 2PGXA 4L8GA 4YDRA 1KS2A 4ASUA 4CEJA 1CUXA 3RYFB 4X3CA 2W93A 2YY6A 1JB9A 2CE2X 2B61A 2WE7A 3BQMB 3BT7A 1RAFA 4N18A 2X3FA 3DCJA 1WB6A 4RKWA 1TOAA 2NTNA 4IRMA 2UYHA 1PL8A 1IBSA 1U0BB 4P4GA 4DC0A 4D0SA 1GQOA 1JDJA 2OESA 1LK5A 2DYKA 4AN4A 2OV1A 2P77A 1T25A 3NHRA 5EERA 2BKUA 4HZUA 2HF7A 1KS9A 5TRTA 1R27A 3A1TA 5CVDA 3ZDEA 2EFHB 3EUFA 3QVVA 2BOVA 3RS5A 3VTFA 5A06A 1AV6A 3D54D 5D6NA 5L95A 2ZIXB 2VJAA 1DINA 3FWNA 3ZQ6A 1LPPA 3CF4G 4OSOA 3DAGA 1WF6A 3KJNA 3EZXA 4EI7A 4BE7B 3NW9A 3A37A 2IY9A 2V7TA 1KKMA 4GH5A 2N1MA 4GOOD 4FZRA 3RC9A 4RXUA 3LA8A 2HU2A 4BFTA 5E3JA 2ZRNA 3CMMA 2H1RA 2JBHA 4WKOA 3L8CA 1NWCA 1Y1RA 2ZB2A 2PK3A 1KR2A 3PU6A 4H1WA 4N47A 3MMNA 5K8IA 2I54A 5GV8A 3O0TA 3PPVA 1X7HA 3FWZA 3BYZA 4EFKA 5B6JA 3KQSA 3DCYA 3VU1A 5K01A 1EDOA 3EVNA 3TZKA 3GRVA 1UWVA 3UNXA 4X44A 3A1CA 4GI1A 4I14A 4KAFA 2X0FA 3U3ZA 3URMA 1G5RA 1JG6A 2V5AA 2XWSA 3HCWA 4WZBA 2IVZA 5TF4A 5HOQA 1CUEA 1MVNA 1WXGA 4WI1A 3SVZA 1VQ1A 2W6ID 4EJ2A 1CY6A 2I66A 3E7WA 2OL4A 3HDHA 4GI2A 4IRUB 2O2EA 2F48A 4ISBA 5MN6A 4WA7A 1BZYA 2C9CA 1KYTA 4UEKA 1PIWA 3UT5B 2ZDQA 4C4PA 3HLYA 2PY6A 2D1RA 2XE4A 3DUFB 3IJ5A 4CMEC 3NUQA 3M4JA 4HSEA 4JI1B 3L4JA 2O1SA 4IGIA 3SHQA 3MB5A 4J0FA 1VHLA 3DOHA 3KB1A 5KWJA 2I0FA 5DYTA 3PYXA 1Z2AA 3IBCA 4PO8A 3IP6A 1CRPA 4MPRA 4NFSA 4XOUA 2NP6A 1SXJC 2UZ1A 3IQDB 1PLJA 4HH3C 3V8MA 5I7FA 1JXOA 2OVBA 4W1RA 4TTTS 3BD9A 4UBMA 4YT4A 2W2KA 3GCZA 1T0IA 2AKYA 5GADl 2IPNA 3LP8A 5FOWA 4DT1B 1GPAA 1RLOA 1XZPA 1MF7A 3SAJA 4I1RA 3UV7A 2FK7A 1E7WA 2WJPA 4CWAA 5C8VA 1NBHA 1OOEA 2QW8A 3HYRA 4OK5A 5IUNC 3LF1A 1DBIA 1NE2A 3FPBA 1RACA 2AYYA 2Q5IA 4C30A 4OHOA 2I22A 4Z7JA 3M6IA 3AI7A 4JJKA 1TVKA 1F6WA 2B21A 2W71A 4YO8A 3TW4A 2H07A 3UK7A 3HTXA 1DPFA 3TTSA 4ZMSA 3BCHA 2BFEA 5G41A 5CCBA 4WECA 4YV0A 2F8TA 4EX6A 5IARA 4UCFA 3ES9A 1QYIA 4UNRA 5A4JA 2D0DA 2HIAA 1H4VB 2D54A 1VZ2A 4XSVA 1L1RA 2PO5A 2HDNB 5LMZA 2PIDA 4QELA 4MDHA 5LZ5A 1U8CB 1KYIA 2Q1YA 4DA0A 1ABFA 3ESBA 3TD6A 2YY5A 3ZDFA 2NO4A 2ZSIA 2D5IA 2PKRA 4PFKA 1S8AA 3HH8A 2G4CA 2XRZA 4OB8A 1ZM3A 1EFRA 4NU5A 5AM1A 4QBHA 5H4HA 3UKOA 3HSYA 1XROA 3PL1A 2W0SA 4A9AA 2J9FB 2NNWB 1G5HA 3TZCA 5LOVA 2Y0PA 3QKTA 2OCXA 1S8FA 2XYRA 5K4GA 2DFNA 4Y6QA 4MQLA 5C80A 4C21A 4LWPA 4S1VA 3OZDA 2AG5A 1YTUA 4Y3UA 2Z30A 3DWFA 1SGWA 4JLJA 1CSEE 4IG9A 4K1LA 4MRSA 1I6LA 1Y33E 2OORC 1VJ1A 2VUTA 4FLMA 1XZ8A 4UQPA 5JSQA 1QQBA 3T61A 2GUWA 2QTBA 1NW3A 2QY9A 4KI7A 1D0VA 2VAWA 1RCFA 4AY5A 3FBWA 2J9GA 4YMLA 4LDJA 3PX2A 1DB3A 1UPFA 3EZ7A 4EJ6A 4IP0A 4G2NA 1TPZA 3ICEA 1ZW1A 3DO6A 3QYPA 3ZXXA 5BSKA 1FJXA 1T8UA 2IXEA 1P75A 4UATA 3RUEA 3IOBA 1UBHS 4QOIA 3FPKA 1XR3A 1KIMA 4JHXA 1CB0A 1DG1G 1PGQA 1QAMA 1SXJD 4JH0A 2OZEA 3D3EA 4QAJA 3RK4A 2GO1A 4LWQA 4RCZA 4ZO6A 1VL1A 2Y1XA 3JATB 2C4VA 1CIPA 3JWEA 4N5HX 3W06A 5IWAB 1LVUA 3EXHA 4TM7A 3I5YA 4DR7B 3UG7A 5HTKA 1P8JA 2QNIA 3GJSA 3T0FA 3C5VA 1PVOA 2D5CA 7GPBA 4M0KA 2C99A 1N2ZA 2ORIA 4X24A 4B71A 4G0VA 3RC8A 4BXOA 4TXMA 2BUBA 1NUQA 5LZ8A 1YU6A 1T9HA 2G8LA 1KAQA 4IDAA 3QBDA 4OXXA 1SXJE 4Q0MA 2UZAA 3R5SA 3ZGOA 1YMQA 3ZWQA 1PGOA 1Z0FA 3W3ZB 4IEEA 4EBBA 2XUPA 4BPBA 3KTAA 4TTIA 4QDKA 4ML3A 1DRKA 3P19A 1DXHA 3FOAA 2JGEA 2FSFA 3F1KA 3OECA 2F8MA 1JEYB 3P9YA 5TLSA 3UKJA 4WBNB 2D8MA 1SD2A 1U3FA 5ARDA 5BR4A 1JDTA 1DKNA 1B76A 1KVTA 1LV8A 2D0OB 4KE6A 2WK1A 4OQNA 4QTTB 5CURA 1WA5A 3URKA 1YR1A 2DSNA 2UU9B 2QV7A 5IJ0A 1TQHA 1X7DA 3JATA 1DC4A 4PINA 1C4KA 2ZIUB 1G8JA 3BTUA 4BBPA 5LZ2A 1U8EA 5TPZD 3HKDB 3K3PA 4UOEA 3FGOA 3WGVA 1IZZA 1L5LA 2FR8C 3V33A 2QP9X 5AW7A 4HK4A 1EE2A 2E55A 4G5GA 3LT4A 1GUAA 3KFLA 1XTUA 1IK4A 1MC8A 4PCLA 4DRZA 2CN1A 1H9AA 5J59A 2PUWA 2G63A 4KQ6A 1QIHA 2H4XA 4Q3KA 4H9GA 4ENRA 2HK7A 3SCZA 1B42A 5KNBH 2OZKA 3LW7A 3IEXA 1QXSA 3QUQA 4PSAA 3V5NA 3VNVA 2W83A 3ZE0B 3U4GA 3WLNA 1U11A 2PGJA 3FPHA 4U2FA 2RBKA 5BWOA 1GPH1 3GRZA 4ZC8A 1TYCA 2NZVG 5JIBA 4D46A 2KI5A 1QK5A 3UCXA 1R0BA 5EXPA 1YL6A 1Z06A 2X5JO 4JJGA 1R8XA 5LP6B 1Q17A 1E62A 1QYDA 4HNAB 3X1DA 4E32A 2VJLA 1DCKA 2XOXA 1Q0LA 1RTTA 1ZK0A 4FOOA 3RV4A 1VG0B 4LJ6A 4DHWA 1KJNA 1VRVA 2XKBA 3UYKA 1DC6A 3Q4GA 4C7VA 1JR3D 1Z0ZA 1J8QA 2NUTB 1MENA 3HNOA 3NYRA 2VRCD 1G8HA 4HMQA 2QYTA 3Q8KA 1I4LD 3JR3A 2ILVA 3PI6A 4YRJA 5TV2A 2FQXA 1FJGB 3X1MA 4HCJA 2VNJA 3ELWA 3LCUA 9MHTA 1NBAA 2POCA 5CNMA 3DE0X 4OHWA 1PGPA 4LG1A 1SCDA 3VHXB 3FRHA 4OHMA 5IP5A 4G41A 5AVQA 4W9RA 4LJ4A 1AKMA 1JA1A 1JSCA 4MVJE 4Q4HB 2QP4A 3DTVA 3DBHA 5H80A 1XVAA 3TECE 3OLVA 2AT1A 1JLRA 4FZ5A 4GAEA 1CUYA 2FX5A 2HQOA 2PBLA 4MCAA 4TKZA 3RHFA 4HEJA 2NV6A 1L7OA 1BE1A 2HK9A 2HBZA 5L3SB 1LF5A 2DCUA 1FRQA 5BSMA 1O6ZA 3BQNB 2HA2A 2PQ2A 3HU1A 3OJXA 1GUDA 3BJRA 2EGHA 3LXUX 5AM0A 3NORA 2IP1A 4HYTA 2BELA 4JZYA 4ABYA 2J3EA 2ZI7A 3ZE7A 2G4VA 1X7WB 1EVQA 2X9NA 1FW8A 3QXGA 4HAIA 2VATA 1SN7A 1SMKA 3WFIA 2JAUA 2P6MA 1RBMA 3H11A 3M9LA 5FTKA 4BQPA 4CKYA 1X94A 1VP9A 3G0CA 1L7MA 2E5LB 3VSDA 2HR1A 2ODBA 3BVPA 2ZJBA 1E6KA 1W19A 1ZN8A 4FOLA 4TS1A 3WJAA 4XQCA 1AURA 4C4YA 2BGRA 1AKQA 1H0KA 4L6CA 3T7KA 3WGTA 1G59A 5C8XA 1QH9A 4M1SA 4J75A 1PRYA 5H3HA 4B3MB 4KFRA 4NZPA 1H66A 4R7GA 4X6XA 1GL7A 4G8CA 1X8LA 4DCMA 4KRFA 1ESNA 4W4TA 3REFA 5AVSA 3AM4A 2NG1A 1ACJA 4WZBB 4OXQA 1D9ZA 2CXRA 5IJZA 2Q3CA 1K63A 3DB2A 4IUBS 4XDYA 3M3PA 1OAAA 5JFGA 3R40A 2OYCA 3BE6A 3UK0A 2C3YA 1CR6A 5FD8A 1D04A 3PQ4A 5DYIA 5HF9A 2PQ0A 2JDIA 3HBNA 3OO0A 4OI2A 3MQ2A 4LJAA 2HSWA 4RVNA 2XCLA 3N2KB 1M1YA 2Q21A 1E0JA 3QF7A 5BN4B 1XAGA 3GVXA 4M7PA 4DDVA 2QRUA 3O8DA 4LK2A 4TKMA 4C4SA 4Z4CA 2DQSA 5ESDA 1MW9X 3PSAA 4EG7A 5T8KA 3AHJA 3PD1A 3RSGA 3U31A 1ZUNB 5SV2A 3BMQB 1T4CB 5KTNA 5BV0A 1S9DA 1JXQA 2O2GA 2DPYA 3G9XA 1TGYA 1NUSA 5E6SA 3V4PB 4I81A 5F64A 4MIKA 5AUQA 2ISCA 3DHWC 2DXIA 2WABA 2WJYA 3GGOA 4E4TA 2I9KA 4L51A 4BNDB 2ZIXA 2IPMA 1V6AA 3LPNA 5EIWA 1T8YA 4XJTA 1PNVA 5I01A 4WERA 4G0ZA 4QTXA 3IQHX 5DWDA 2Z5GA 2BJWA 5FP0A 5FBVB 4DUYB 3BXOA 2R8OA 2VJDA 1G98A 4HLDA 1G41A 3EGDB 3WJ7A 1K3TA 4DA6A 5ITVA 2QMZA 5CCEA 3ADDA 1DQPA 4JI7B 1HY3A 1D6MA 2Y6UA 4XVRA 1BX3A 1V8PA 3TNYA 1SZPA 1HDZA 2RGXA 3B6JA 2HHLA 3DYBA 3AB3A 1XQ6A 1SUBA 4KQ2A 4M1EA 4RSGA 1WY7A 4YT8A 1CULC 1RI5A 3LUAA 2H48A 4G86A 2A14A 3N59A 1B43A 5F52A 3FXAA 5B1IA 4JXXA 3W2EA 1CS0A 1ZR2A 2NACA 4J2OA 3IAUA 3PUYA 2ZXEA 4V0KA 1GSAA 4QVGA 1J2UA 3K0AA 2GEUA 1G8GA 3GJYA 1I4TD 1TK9A 3QMWA 1KPHA 4G4IA 3REQB 4KWIA 1JTFA 3WMFA 1IHPA 1RMTA 3F7MA 4JT4A 2XTMA 3MQ4A 1RVDA 4BB9A 4ESHA 4LFAB 1Q1AA 1KKUA 2ODTX 4MV6A 3HUDA 5F1KA 5EFZA 4II3A 4M1WA 2HREA 3QE3A 4I9GA 1CUGA 4X61A 3IILA 5IDXA 4DV2B 4IMPA 3FOBA 5EYPB 1ULSA 5AVXA 4DEYA 1H22A 4CKXA 1THTA 5ALJA 4BEWA 5JWHA 3DF7A 4GZ6A 3L84A 5I9TA 3QENA 7ADHA 2Y68A 3BN3A 1LDNA 4KYIB 1GFSA 3CH6A 3T1NA 3T3MB 2Q27A 2O5RA 2HSGA 3DO5A 3QE4A 4DADA 2EX4A 5EWLB 4MKGA 4B5LA 5KJFA 3NHKA 3R0ZA 1JEQA 1XK7A 4MUFA 3I5AA 3KHTA 4P3NA 2ERYA 5B64A 1N36B 3EVBA 3GEPA 3T1TA 3QU5A 5DBGA 3ED1A 4BNUA 3LSYA 1SHUX 1NZFA 4JB3A 3DDNA 4FTWA 3C70A 3WK7A 2PMCA 2M98A 4IDEA 1B23P 1M8JA 3PJDA 1XMIA 4IIEA 4YAEA 5AKGA 3HJAA 5A2QA 4IR7A 4IIJB 4IQGA 2V58A 2B20A 1FPQA 2YJNA 4GT1A 2J45A 4JC8A 5ESRA 2QR3A 1XAHA 2Z8ZA 3GJZA 4DXHA 4IYJA 1ATIA 2J07A 3DNMA 1V6CA 1ZCJA 1VBMA 3EG9B 5DLPA 3NVDA 2C2OA 1MGOA 3EVGA 3L7BA 3LUHA 2DPHA 3E9RA 4C0AC 1SKYB 4FEYA 4EW3A 3PICA 4ZK2A 4FPXA 1OF1A 3P71T 2PUFA 1GLVA 2MR5A 3S1AB 5AKIA 2B4RO 2HMAA 3F2VA 2PN1A 5JNRA 2IITA 1XCLA 3JQQA 3KWJA 3O31A 4MKZA 4YBZA 2D13A 3DE4X 5UKDA 1ZGHA 2ISSD 3ZW8A 3CZPA 2ZE5A 4IF6A 2IF0A 3RVQA 4B7XA 1Z25A 3IVGA 3BL5A 4MV4A 2NUPA 4DA9A 1KJ9A 2Q7OE 4MUHA 1ZRNA 4CR8A 4B3BA 1ZMXA 2RMKA 2R9VA 3AY6A 3FZGA 3NTOA 1H8HD 2O8FB 1T3TA 4IDFA 3NIWA 4R7TA 3VI4B 1HLPA 4I5EA 3THXB 2XUIA 4G0WA 3L1HA 4RA6B 1U7DA 1RXEA 2A0KA 3H05A 2C82A 3H2KA 1DRUA 4JL6A 1L7AA 2GCIA 2YOFA 3WWDA 4DBLE 4QLBA 1NM5A 5AUOB 5TIIA 4MUKA 3NJ8A 3MJDA 4JEMA 3T7RA 3THSA 4ARAA 4X1KA 5LVAA 4R9VA 3DDCA 4FD3A 5DHRA 5AMXA 4KSBA 3RTDA 1ARZA 3VC7A 3ICQB 2VYVA 1KNQA 5B3LA 4AXXA 3V7YA 2B1QA 1MO3A 4IH1A 5J5AA 3YASA 2XCRB 3DM5A 5AHRA 2DP4E 3QY0A 3AR4A 1UBEA 1N2XA 4DHEA 5I9IA 4CMGA 3TQHA 4RH3A 2JGFA 1L4YA 4YJFA 3GEIA 2Z6QA 2CFSA 3PUKA 1GSIA 4B8YA 5B3JC 3K4PA 5CGZA 3ZOKA 1IFXA 5A6VA 2HRBA 2WZQA 5E9WA 4AN1A 3BAFA 2VA8A 4L4UA 4ETMA 1HSOA 4OO3A 4WY8A 1JDSA 4LBZA 3E9MA 1PZHA 3NHBA 3RT9A 3U7EB 4TV9B 5DWVA 1WZCA 3AM5A 4KKXB 3JQEA 4U0KA 4JUDX 1YK0A 1VXOA 3IQZA 3A9TA 5COBA 1FRZA 1R0XA 1LH0A 3UTCA 2DFTA 3N86A 1I51A 4O59O 1GA4A 3WDKA 4F8EA 5LYJA 1QAQA 2ACVA 3A0RB 3PQEA 4OKIA 4CYMA 3AHFA 3WK5A 4UVEA 3O75A 1OXMA 3WS7A 1FZTA 2BKAA 2OFWA 2ZETA 3ZR4B 1BG6A 4XIYA 3DKVA 1GTJ1 4MKFA 1FU8A 2RGWA 3TB6A 2ZRDA 2P9BA 1WCYA 3TIFA 2VHTA 4IJUA 1XYYA 4H4CA 4L9SA 3TR0A 1KI7A 5LBUA 4FE4A 4FB4A 4LZLA 3LQ2A 3NS7A 1VHDA 2AX3A 1O58A 1N77A 4LV8B 1ITZA 3AF1A 1C3JA 4O63O 3WGGA 8ADHA 5MN5A 1NUAA 2TECE 3QP9A 5G0WA 3OPQA 3GFSA 3CTMA 4RM2A 4Q34A 3BJIC 4BNXA 1LI7A 2VIIA 1Z2NX 3KWFA 1E2QA 2X9LA 1HL3A 2WJZB 3LX6A 2FMHA 3IKMB 4QG7A 1AA9A 4G5FA 3ABQB 2G7MC 4JT9A 1Y5MA 3OX1A 4J3FA 1FE8A 3RJTA 1I3MA 9LDBA 5AW2A 1NTRA 3DXFA 2PRKA 4G5HA 4J6FA 5KCMA 2QNBA 3DDUA 5SICE 3HM9A 1JFVA 1HYQA 1BMQA 1KEVA 1NM5C 3G9UA 2O0KA 2OVFA 4U8GA 4XD7A 3NTLA 5AWFC 1T3HA 4GRIA 3DR5A 4JVSB 1Z88A 2K5UA 5KNBA 2CFTA 2NTEA 3R75A 2BJHA 4X6LA 4D99A 3A6JA 4HDRA 4BVLA 4F46A 5JUWA 3VR5D 1UBSB 2IEIA 4Q3BA 4NR0A 3LYLA 2OFOA 4BMSA 5MDHA 4PSVA 2WF5A 3MWEB 1FDIA 2EQBA 4N5NA 1C3OB 2BFAA 2BZSA 5F2KA 2AYXA 3SVLA 1NONA 2WB4A 1IXZA 4Q4AB 1DG9A 4AJOA 4DBLC 3G2IA 5KHAA 2HFJA 1OZGA 2ONYA 1KYZA 1NW4A 5B1HA 3AVUA 5JSZB 4YRFA 4MUYA 1Y3FE 2BPOA 4M53A 3BMQA 4XIIA 5AHXA 1KFJB 3KSUA 3WZLA 5BY2A 4QWWA 3FYDA 2VL7A 1WXXA 1ZLYA 1HT3A 2NM0A 3K16A 4GQIA 1QNFA 2OAQ1 4QLAA 4UDNA 1RI1A 3D6AA 3DV2A 3REOA 4YP0A 3MJFA 4RVDA 3RASA 1O5IA 3RNLA 3B3AA 1Q2UA 3FBTA 3N2KA 4KE7A 4A73A 5ELXA 3I76A 4M7RA 3CRZA 4KWEA 3TZ6A 2PUBA 1QVAA 1PX0A 3V8BA 3K6KA 4DCUA 4HDNA 5CEJA 2WD9A 4GKAA 1GTL1 3OQ6A 2A4KA 4NAVA 2IYWA 1D9XA 1BXGA 4QX6A 2PXHA 3T3PB 2OBYA 1KRHA 2PL9A 4O4IF 4Q3OA 4F12A 3DLTA 5KYWA 4HFRA 3QHPA 2FPKA 4PNPA 5LQCA 4NOMA 1DOHA 4Q3LA 5J4VA 1UM9B 1C7FA 3QOFA 4LJSA 1EEHA 3RJ5A 5H70A 4L5YA 2HXYA 3FDJA 3CCCA 3O7MA 4P33A 4UOQA 3SYKA 1G8SA 2ATXA 3OFSA 4G97A 3NCTA 4HAVA 4WEQA 3D7MA 3DPUA 2DLNA 3IUPA 5IBRA 3WYBA 2C7PA 1IWBB 3DZHA 4FYJA 5ALIA 2YWRA 2DHRA 1MGPA 2B7CA 4U4AA 3M9WA 3FY4A 3KQLA 1GNSA 2I4TA 4X65B 3CW2A 3U0BA 4DCVA 3Q3VA 5LBTA 1F8UA 5C1PA 2PPVA 4BZWA 1AUPA 1E61A 1Y7TA 2Y67A 1ZCBA 5JVDB 5AXCA 2O3JA 3H1EA 5TQVA 1QWOA 4BTLA 2C61A 5TPWB 2I4NA 3N74A 1R5OA 3FNHA 3RC2A 3D3WB 2BGGA 3JQ9A 3U6BA 1XDSA 3TSOA 4BE4A 3DDWA 1SG9A 3BF7A 3EY9A 3AW9A 4G6ZA 5F78A 4NDNE 2BN4A 4RVCA 5CVVA 4DQLA 2PRZA 3I73A 1Y1LA 1E2IA 1ZHOA 3DZIA 3MFQA 5IKPA 1RJFA 1KZGB 4FNMA 1Y1TA 2GK4A 1MB4A 5ER6A 1HYHA 5HYVA 2RI0A 3FZYA 3GLVA 3HPQA 4V0SA 5LP6C 3TVTA 3L77A 1ID8A 3DW1X 4FIDA 1V48A 2XUOA 1A77A 3Q7IA 3V1MA 4LYYA 1I1HA 5DI3A 1WPGA 3D4OA 1S5PA 2VUIB 5JZ9A 4GL4A 1W581 1E0DA 3OOWA 3PA8A 3R6DA 3TNJA 2ECKA 3UWDA 5KNCH 1LS6A 2EWVA 2H63A 2XNDA 3WV5A 1V45E 3BDIA 4HHEA 2CC2A 1RYDA 3LQYA 7REQA 4YUWA 3JQBA 3R7FA 4LBVA 4QXPA 2BVNA 3EAQA 4TTVA 5G0TA 2VHCA 1EP2B 1GRQA 3OZGA 4B3CA 4QBFA 1L1FA 3KSAC 1RYEA 3GZNB 4YK7A 3NKLA 1YHNA 3KKKA 2BM1A 3D4PA 1E3WB 4W1QA 5IAAA 1QJCA 2P1RA 1D2CA 1LW6E 4R8SA 4A3SA 3WWYA 4RK0A 2EBFX 2GLXA 2JD2A 3AEYA 4JYCA 1NRXA 1E1RA 2MMCA 2YMQA 3OMWA 4G2TA 4XD7D 1H2HA 2F43A 4MQFB 4ND5A 1ZN9A 2Q1UA 3P9RA 4YDSA 2PH5A 1SB9A 1R6DA 1AGXA 121PA 4Y6OA 2F3SA 1AGNA 1QH8B 3CRW1 2I3DA 2FR0A 3ANNA 5HWSA 3ZU4A 5EUCA 4KPEC 5BR1A 2ZTLA 3RS9A 3F6PA 3AILA 2IYXA 1ZM9A 1FMCA 4I4NA 1DE0A 3BDVA 1XCMA 2J3LA 1I1NA 1H0SA 1LEHA 1UC4B 1QQAA 3FYHA 5JG7A 1C7ZA 2ZYGA 3CX7A 3ESRA 3GT3A 4MHOA 3WRXC 1JFTA 4TZKA 1E5TA 3AR5A 4MRNA 2ODNA 2Q7XA 4XR9A 4HVCA 1NXQA 3OU7A 3I9LA 1D0IA 2FPLA 3LV8A 1DARA 4HGNA 1XEWY 2F64A 2XIJA 3O8QB 3W7BA 3Q3CA 1CPYA 1UODA 5FA6A 1TA0A 3PXGA 1Y4DE 2HLNA 2WJ4A 2ZSEA 3EY4A 3VPSA 3RO7A 3OWHA 2OV4A 2V6MA 4Z2YA 5E8JA 3SPXA 3MINB 4UHBA 1WXIA 1Q1ZA 2XF2A 2AR0A 3NH9A 3ZHVA 3W5SA 3PXEA 3INYA 4BJHB 1QANA 3QPAA 4PF1A 2OOKA 4G8DA 5I9BA 2XDWA 5KPJA 2R8PA 1AF4A 1DSSG 1H5UA 1P7ZA 1XXHA 2J9RA 2WWIA 4H6WA 4OP1A 4QEKA 1J0XO 3FJ1A 1RJGA 3KZNA 5TEWA 5HIKA 3R9WA 2QZJA 3K9LA 1OXTA 2HHCA 3HC7A 1DAMA 5KJEA 5I4KA 2HSJA 4B2PA 3JYQA 3QITA 3ISJA 5LYJF 4PPFA 1C3LA 1IY1A 2GPAA 4FM9A 1X86B 3QQ5A 2PZAA 4I5IA 4CUZA 4ZCRA 2NQ8A 4L4XA 2FN8A 3R7WB 3O83A 3G8DA 4OQPA 5JXIA 1PSWA 5FNZA 3W5UA 1IY2A 2YNMD 4KDRA 4OU4A 4O5OA 3ZV6A 1EAYA 1MEJA 5JNVA 1HG1A 4CLXA 5DVZA 5KOIA 2ZJOA 4D4HA 4A7PA 3IAS1 3SLGA 3VV2A 3N70A 3UIEA 1AF7A 3HSKA 4ZPXA 3BRWD 5D8DA 1UZLA 1J24A 2GEFA 2BI4A 2W6NA 2W90A 3B9QA 1MABA 3JWPA 2VYVD 3JZIA 5L3RA 3ZBTA 5JAPA 3OE5A 3UB3A 1NNEA 1B41A 2J3DA 1VZ3A 4OFWA 3DTVD 4ZO4A 4B8WA 4LMPA 4WFQA 4A1OA 5ITZA 5A0TA 3PCTA 3UAYA 4P1ZA 4YRDA 1LJ8A 2RONA 1HX7A 1NQUA 2XTAA 4BFCA 1G38A 5F5NA 3EBLA 2P9YA 5EKTA 3P2EA 4E7PA 4B81A 3L8MA 3KO8A 1J5XA 3Q85A 2C2YA 4C2AA 3DOEA 2WIJA 3TINA 1XAJA 5FBZA 4F11A 1UM9A 2PBFA 5ESXA 5DRYA 1BN6A 2YYYA 3UAXA 1LTKA 3OBIA 2X8BA 4NLLA 3SKXA 4UE2A 1EESA 1U2TA 1QGED 3TIGA 3WB9A 3DV9A 4YGXB 1DWPA 1ECGA 4MRVA 1PLLA 1U0SY 2I33A 2CHFA 1WNTA 2WTEA 2F8LA 3G02A 2P3LA 4ARZA 2IU0A 1VECA 1ECPA 4FGLA 5BRJA 1QHHA 1NX6A 3ZH2A 1XZHA 2PH7A 4MMYB 2X15A 4D0GA 4DCCA 5EXEA 1KEKA 4YI5A 1I6WA 3H5NA 4INAA 4XJSA 5IJXA 4F60A 4G1UC 2ROQA 4ZDKA 2Q3HA 1NBMA 4Q18A 4XXHA 2HL6A 5F9FA 3TZHA 3DHVA 4ZCSA 5ED4A 3GDHA 2RG7A 2KWIA 4D3FA 4PU0A 4J1TC 1Z4IA 2V54A 1FZQA 3OIYA 4Q9KA 4LCJA 5FBKA 2II6A 2HU8A 1J8MF 3HXLA 3Q2OA 2PT7A 5BORA 3H6KA 3RARA 5DTEA 5THKA 3OQBA 2NUBA 4TSFD 4JLDA 1TVMA 4LHZA 4E0BA 4MMXB 3GH3A 1OT5A 2Z04A 5JMWA 4Q01A 4LJ9A 4S2EA 3OP1A 2BONA 3W8DA 2QTVB 3EZGA 3GXBA 2X5OA 2ON6A 3JQFC 2V6JA 4TTRA 1OIXA 2DLDA 2DHDA 3BB4A 3NGLA 4TMFA 4CKBA 2O8BB 1II8B 1EUQA 1EX9A 2IRWA 1H2BA 3TUIC 1KAOA 1JIXA 4O29A 4R2XA 1UZNA 1ZU5A 2ERCA 4M4SA 3HCFA 3MJEA 2OPHA 5JDCA 5EIBC 3ZHBA 4RPGA 1LW7A 1WULS 3OQ1A 1UMBA 2PGOA 1K4KA 1ZCZA 4MWBA 3TNLA 4YIHA 2H4HA 3G0GA 1RJ9B 2HWWA 4CCSA 3DD1A 2IUSA 1E2HA 2ZJ7A 3KXLA 3WI7A 1A7AA 4YJ2F 1BTOA 4HUTA 5IANA 3GJRA 1AXEA 1PBNA 2GZMA 3GWGA 4IWYA 4ZEOA 1JKFA 1ACMA 1F06A 1T0BA 2J3HA 3AJ9A 3CWZA 4ROSA 4RSHA 4TWIA 4Q9LA 3A4MA 1E3EA 1QR6A 4Y2GA 4MWCA 3WK8A 5A6SA 2YHAA 1RMYA 2VSQA 3SIPA 3H3JA 1BS1A 4N5IX 4ASUD 2JBAB 5K0NA 2FK8A 3R5FA 3R24A 2R5NA 1NJ8A 3KB8A 5AUNB 1BGWA 3OCZA 5JMOA 3IPCA 1IL0A 1XRLA 3UXEA 4BMZA 2PFKA 3QVGB 4M0LA 4XLZA 3AVPA 1P9LA 3C14C 3QWHA 4PX3A 2GAOA 1QHFA 10MHA 1MV5A 3AEUA 4WOCA 5JAMA 1UBUS 3HDGA 2ZOSA 4D4JA 2VSOA 2C8JA 2JA1A 3OPNA 1NSFA 4IRXA 1AA6A 4UAGA 3S8YA 2R79A 2JI7A 1B8NA 2WQ7A 1B74A 4AI6A 2NZXA 5CIQA 4PZAA 2ZPTX 4H1HA 1YXMA 4URHA 3RRNA 4AG5A 4MWGA 1LX6A 3DXXA 3WSVA 3ILYA 1INLA 2PA3A 4N3CA 4YYEA 3KCNA 4K9DA 4J7CA 4BMDA 3Q8LA 1IXRC 1B8VA 3DC2A <