3V1NA

Crystal structure of the h265q mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, after exposure to its substrate hopda
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
283
structure length
283
Chain Sequence
LTESSTSKFVKINEKGFSDFNIHYNEAGNGETVIMLHGGGPGAGGWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDIDRAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMLQVFLYDQSLITEELLQGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKCGQWAQWEHADEFNRLVIDFLRHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase
publication title Identification of an Acyl-Enzyme Intermediate in a meta-Cleavage Product Hydrolase Reveals the Versatility of the Catalytic Triad.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Hydrolase
total genus 107
structure length 283
sequence length 283
ec nomenclature ec 3.7.1.8: 2,6-dioxo-6-phenylhexa-3-enoate hydrolase.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3v1nA00
4B9EA 5LIPA 5D3ZA 3A6ZA 4WDQA 3ZPXA 2B61A 5A7FA 1HKHA 2PX6A 5ESRA 1FFDA 1DT5A 4FTWA 2C0QA 4FNMA 3IIIA 4UBJA 5EI5A 5DJ5A 4XWGA 4BC1A 3VKFA 1CFJA 3OC0A 4BVLA 1ZIYA 2ES4A 3V48A 3F97A 1XKTA 5AK5A 1PFQA 3R3UA 2XE4A 3G0BA 3TGLA 4I4CA 3OURA 1VJ5A 1KEZA 2XMGA 2O2GA 2RAUA 1L7RA 3WL6A 1CUHA 4FLFA 5ALDA 2D5LA 2WLSA 3B5EA 2WKWA 2WU4A 4KACA 3PF9A 1U8EA 5ALQA 2V97A 3ESCA 3EQ7A 2QZPA 4B84A 4UHHA 4C89A 3WLAA 4XJVA 3HXKA 2WIKA 4QA9A 2HIHA 3K6KA 3E1GA 2GYUA 3NWOA 1BRTA 5CT6A 4UBOA 1UK8A 1J06A 5JAUA 4JEIA 2XQKA 5FOQA 1BU8A 3PF8A 5I8PA 3C45A 4B82A 4EA6A 1QIHA 1UFOA 5DLPA 3ICVA 4FNGA 3M3DA 3O9MA 2OCKA 1QIGA 3EBLA 1M33A 4OB7A 2HA5A 1IUNA 3HRHA 4FBMA 5C8XA 5EIEA 2QRUA 1OCEA 3I6MA 1JMYA 5IKXA 1XZCA 1CUBA 5AKXA 1HL7A 1J1IA 2XUKA 3WK5A 1WPXA 4J03A 5CH3A 1GXSA 5A2GA 3BF8A 2RHWA 4FLMA 5ALUA 5CT5A 3O0DA 3STYA 2JGJA 5ALXA 5A71A 4N5IX 5F4ZA 3D2BA 4PQEA 2PSDA 4ZREA 4RNCA 5H3HA 3FAKA 3QVMA 5A62A 1T4MA 4UHDA 1WPRA 1E5TA 3LIIA 3AFIA 1FFCA 5LZ2A 4RE6A 1TCAA 2C5GA 1DQYA 2JIDA 4XIIA 5AM3A 3KXPA 1EA5A 3C5WP 5AP9A 3D59A 2WIFA 4AZ0A 1O6GA 4WFKA 4UBKA 3ANSA 2P8SA 1QONA 1JJIA 5K3AA 2ZYIA 1MPXA 2BFNA 3STXA 4X6YA 3RK4A 4GI1A 1ZD3A 2C58A 3WIOA 4FFVA 5EHQA 4WDRA 1L7AA 2WQZA 2Z3ZA 4X92A 3UUFA 4PSCA 3QH4A 5AKYA 4EHBA 5JAOA 1FFEA 1XZAA 1R4ZA 2XDWA 2K2QB 1P0PA 5HKBA 1CEXA 4Y2XA 1LPMA 2WG1A 1Y37A 5JD5A 4QDUA 1ORWA 2XMZA 4PNZA 4DLNA 2HM7A 3S8YA 4BAGA 5ALIA 3UMJA 2QUBA 1RP1A 2HRRA 3I2FA 3K2IA 4LYEA 1LPSA 3V1LA 3G0DA 4BRZA 2PU7A 2H7CA 3O4HA 1L7QA 2B20A 4I19A 3O4IA 2PL5A 4WY8A 2JGFA 2Z5GA 3H1AA 1DINA 3MUOA 1QJ4A 1EB9A 2XQIA 1R3DA 5BOVA 5CXXA 3NUZA 1B6GA 3NGMA 1SCQA 4OCZA 1XZIA 2XUGA 3STTA 4DMFA 4NMWA 2OGTA 2XUOA 1E3QA 2HU7A 4YX9A 4QEKA 3RLIA 4EY5A 4HS9A 3D2CA 5LZ4A 1U2EA 3GUUA 2YH2A 3S2ZA 3H19A 3I2GA 4PF1A 4WJLA 2OQIA 5HF5A 2CEKA 3WA7A 4KE8A 3W05A 4P9NA 3DEAA 2OGZA 4K2AA 1DU4A 2DHCA 3HC7A 3OPMA 1SFRA 4BZWA 4H35A 4IQ4A 3QMWA 3W9BA 1MTZA 3VVLA 1G42A 4LHEA 4W1RA 3VJLA 1JJBA 1GPKA 2VEOA 4D9JA 4EY8A 1BEZA 2FJPA 1E66A 1YB7A 4FLEA 3JW8A 4EY7A 2QKYA 1SOMA 1R88A 2G4LA 1CUXA 3MUNA 1G66A 3AILA 3QMVA 4FHZA 3FNBA 1CUCA 2BUCA 2FJ0A 2H9YA 3FOBA 4WY5A 4OSEA 4X71A 2JGKA 3G0GA 4ZV7A 4HXEB 2DQZA 1MNAA 3HEAA 4H77A 3QITA 2C7BA 1ACLA 4Y2SA 2QM0A 3V1MA 2H7XA 3DYVA 5CTAA 1ZD4A 3RKSA 4KRXA 1P0QA 4IH9A 4G8BA 2VJCA 2ROQA 4FWBA 2RI6A 2GBCA 5ALYA 2XQFA 4J0HA 5YASA 1AUOA 3FYUA 5KBYA 1QE3A 4Y2JA 4TPKA 4RE5A 4UHBA 1VA4A 3JWEA 1H2XA 5C7YA 2VSQA 3D0KA 1QIEA 3DOHA 1EVEA 3I2HA 2IIVA 3LCRA 5DWDA 5IVIA 3G8YA 1K8QA 4BC0A 3FSGD 4Q05A 5FPPA 4HRYA 3VDXA 1J2EA 4ZGBA 1GT6A 4FBLA 3YASA 4U2DA 5CT4A 4AO8A 2OAEA 2XLCA 4BAZA 2CUTA 1VE7A 4KEAA 1NX9A 2ONCA 3WWPA 5D7BA 1NU8A 3SK0A 3DKKA 4J0KA 1CUYA 2PKYX 3BJMA 3TEJA 1XZHA 2HA3A 4BE9A 4X90A 4UHFA 4Z49A 1ZJ5A 2BGNA 4BCDA 1H2YA 2ZSHA 2ZVDA 4QLAA 1SCKA 4ZI5A 1XRLA 1LZKA 1LPNA 2DHEA 1CUZA 4FKBA 3DNMA 4J0CA 4AX4A 1LLFA 1XQYA 2ACKA 4BDSA 1UKCA 5HK9A 3ILSA 1UZAA 2HA7A 4DSAA 2V98A 4DNOA 1CUSA 3H2IA 5T4BA 5CXUA 4UBIA 1D07A 3K9BA 5LZ7A 4EY6A 2ZJFA 3GROA 1ODTC 2WFLB 5SYNA 4X85A 4UFNA 3A2MA 3IUNA 3DQZA 3I1YA 3G02A 3VJKA 2WUGA 1XZMA 1UK7A 3G0CA 1UK6A 1HQDA 1UK9A 3D4LA 1AURA 4K6KA 1IVYA 3DLTA 4K5QA 4ZXFA 1OILA 2R8BA 3PE6A 3FYTA 2Y6UA 3DS8A 5LYYA 1MX9A 1EHYA 1UXOA 4JYMA 4DM7A 2JEYA 2RIPA 5E4JA 3D2AA 3IVMA 4DTCA 2PSHA 3H17A 1ZI9A 2HRQA 1A8QA 4CFSA 3KWFA 1MNQA 3TRDA 4U2GA 4KAFA 5CRIA 2WJ3A 1LPOA 1AKNA 3STUA 5AI8A 3LS2A 3PUHA 1MAHA 1LBSA 2GBFA 2EEPA 4TVKA 4MWTA 2CZQA 2CJPA 2WIJA 4U2CA 4BTVA 1DWOA 1Q0ZA 1AGYA 3F96A 3HABA 2ZYRA 4BCBA 3WKEA 3GELA 3WYNA 5EHXA 1JT2A 3G9XA 2GZSA 4Y2PA 5AI0A 5A7GA 3W06A 3ESBA 1VKHA 3IDAA 5SYMA 5CH8A 4KRYA 3R0VA 4HRXA 4BZZA 1J07A 4N8SA 1F8UA 5K3DA 2BGRA 2ECFA 4UPDA 5I9IA 5LZ9A 3KD2A 4RGYA 2OAGA 1ZD2P 3DYIA 3ZLUA 3U0VA 1CVLA 1A8UA 4N8DA 5FXMA 2VATA 2ACEA 4MWSA 2RHTA 3ZLVA 7YASA 1Y7IA 1EDEA 2OG1A 4XX1A 2O7VA 3HZOA 2PSJA 2WHPA 1HLGA 4AMZA 5AK4A 3T4UA 1LGYA 4Y9SA 5AM5A 2PPLA 3V1NA 1ETHA 4IH4A 1QO9A 1B41A 5AKEA 5ALHA 1CUUA 2VJDA 3U1TA 3A70A 4UHCA 3F9CA 5AI5A 4B81A 1F0NA 3H04A 2XUIA 2VTVA 4P93A 2OCLA 1VZ2A 5ALSA 3W9UA 4FOLA 3I6ZA 4DMHA 3Q0TA 5ALVA 3G9ZA 1VA5A 2YXPX 4KR0A 5JATA 4BDTA 3DKRA 2WUDA 2IITA 3WJ1A 4DYHA 4DSZA 3DDUA 3RM3A 5HQ3A 4X7BA 4FDMA 1CUFA 1G4HA 3WL7A 3B3QA 4H7EA 3FSGA 5ALOA 4B9AA 2GZRA 2HA4A 4AO7A 1QFSA 4AN1A 5DNWA 1R1DA 3D5EA 2WUEA 3WK6A 5AKIA 1JU4A 3FLBA 4INZA 2WFMA 1VOTA 2HL6A 2PM8A 3WJ2A 4B0PA 2JBWA 4JH0A 1XRNA 5ALGA 3WWDA 4G9GA 4CCWA 5CBKA 3FCYA 3C70A 4F5ZA 4W1QA 4AO6A 5D3KA 5AI6A 3B12A 3O4JA 1EINA 4A23A 1TQHA 3QZUA 4V2IA 3C8DA 5LKRA 4BTLA 3FCXA 4HXGA 4X95A 2O7RA 4F21A 4DIUA 3C5VA 3R3WA 4CIAA 4A16A 4GW3A 1GPNA 2VAXA 3WI7A 4K6HA 1ZD5A 2NW6A 4NS4A 2ZJ6A 1DTEA 5JASA 5AJHA 1Z68A 2PUHA 4Y7DA 4WCVA 5K3FA 4J0JA 1QIFA 3C43A 1N5RA 3H2JA 3QMMA 5JD4A 4E46A 1UOPA 1SCIA 5AK6A 4ZV9A 5AM0A 4H7HA 5HF9A 2E3JA 5K3EA 2HU5A 2OLEA 3CN9A 5BWBA 3ANTA 2V9ZA 2QVBA 5AHXA 3WKAA 4EB0A 5AKKA 3AIKA 4X91A 5ALPA 3HJUA 4M0EA 1WHTA 5E4YA 3ESDA 1XROA 2AJBA 4B7ZA 3R40A 2DSNA 5ALTA 4H18A 3WWCA 5HFAA 5HFNA 5AKJA 3WZLA 2WU3A 4I3FA 1WHSA 3PFBA 3QM1A 1UOOA 2Y2UA 1K4YA 1DX4A 1QOZA 1EB8A 4QDXA 5EHNA 5A6VA 1EX9A 1UWCA 4U2EA 2HA6A 2HFKA 4EZIA 3FVRA 1VXOA 4A5SA 4C4ZA 5LZ8A 1XZKA 1BE0A 3AIMA 4MXDA 2GBIA 2I03A 2Z8ZA 3DOIA 4CCYB 2J3DA 4DNQA 4UHEA 4EUSA 1U65A 3WL5A 1W4LA 2DHDA 5HKAA 2QXTA 2XMDA 1BN6A 4PSDA 1USWA 2PSEA 1CRLA 3I1IA 1FSSA 1N5MA 3BL8A 3D3NA 4C6HA 4QWWA 1LNSA 1EDDA 4U2FA 5HZGA 4YASA 4MEBA 4OPMA 1QFMA 1KU0A 3DCNA 5C8VA 1G5FA 4N5HX 1MN6A 3I2KA 5ALMA 3E0XA 4DNFA 3WQHA 4XVCA 4KAAA 4L9AA 3AJAA 2XUFA 5A7HA 1XLUA 3KWJA 1F6WA 1A7UA 1ZGBA 2ZSIA 5HF8A 4ZRDA 2W22A 3R3YA 3BJRA 4ARBA 4E11A 4OYLA 4J3JA 1VZ3A 4W63A 4C01A 2QXUA 3SWWA 1YR2A 1TCCA 4P92A 5EGNA 4E14A 5ALWA 3ESAA 2R11A 1BS9A 1X2BA 1CUJA 4H7DA 3OTQA 3BWXA 3O95A 4BP8A 4BRSA 4ARAA 5CURA 5AI4A 4Q1VA 3GFFA 1TKRA 1ZOIA 3FLEA 3IBTA 1QIKA 1CV2A 2DCMA 1GZ7A 4IHAA 5AKLA 2DQYA 1EK1A 1K5PA 4Q3LA 1H23A 1SC9A 1YA8A 3F8SA 4WFJA 4J0DA 1O6FA 5D6OA 2QJWA 3FVTA 2JGMA 3IUJA 3QBJA 1JFRA 4F0JA 4QDZA 5AM4A 1S8OA 1R9NA 3IURA 1TCBA 4EY4A 4Y2VA 4Y2TA 5AI9A 4HTAA 5EFZA 1FJ2A 1CUAA 3HSSA 2C0PA 4S0XA 5DTJA 4GEGA 4C4YA 3C6YA 1X2EA 1TK3A 3AINA 3DL7A 4L0CA 4G4JA 4J7AA 1AZWA 5JZBA 1YSCA 3ZV7A 1CUEA 3PUIA 3G9UA 2WUFA 2J4FA 1YAHA 1HBJA 5LLSA 1CQZA 2VJAA 4E15A 3LIPA 2XUAA 2BUAA 2PU5A 3ED1A 3G9TA 2JGLA 1QTRA 2VQ6A 1HDEA 5BV7A 4CIBA 3BIXA 1MAAA 3E3AA 3C6XA 3BIWA 1FFBA 1YASA 4GECA 1XRPA 5AIAA 1IZ7A 3A2NA 4O08A 4Y2QA 1XRRA 5ALJA 1ZI6A 2HHAA 4H0CA 1C4XA 3FYUB 3N0TA 3RARA 3SX4A 5FDFA 4W9RA 1UKAA 2XMQA 4B83A 3AIOA 3LLCA 5JAHA 4B80A 1EXWA 2ZYHA 1JKMA 4PW0A 1PV1A 1XLVA 2WJ6A 5JYCA 2ORYA 4W1SA 4HXFB 1WB5A 5DYTA 4KE9A 2HDWA 4MJ3A 5JAPA 4WFIA 2QOEA 1W76A 3QPCA 1ZICA 5HK8A 1CUDA 2G5PA 1U4NA 2JGIA 3HACA 4M0MA 3WMRA 5DNUA 4KAJA 4KYVA 4Y2UA 1UT6A 4X94A 4HVTA 1BCSA 3C6ZA 5CT8A 1MO2A 1ODCA 4W1PA 1C7IA 4MQMA 1WM1A 6YASA 1THTA 4OD0A 3IULA 3O4GA 3UUEA 2WILA 3PICA 2WIDA 1CIJA 1ORVA 3CXUA 2G5TA 4BP9A 1QTIA 3X3HA 1PJAA 5K3CA 4P08A 3QPAA 2FX5A 4H7JA 2RGUA 2WM2A 1XZJA 5JD6A 4BBZA 4G4IA 3WZMA 2XUQA 2AJ8A 2WG2A 3ZLTA 4DNPA 2GBGA 4KE6A 1EVQA 1WOMA 1Q84A 4CG3A 4UBNA 1H2ZA 2B9VA 4MEAA 3PI6A 5DTIA 2EDAA 2VA9A 2BKLA 4BVJA 4DMKA 1MX1A 1XQVA 3BXPA 1ZI8A 1EDBA 1JJFA 2I78A 4BAUA 1N1MA 1Q83A 1TAHA 3WIBA 1TIBA 3M83A 5FPQA 4C87A 2I3DA 3IUQA 4PO3X 2PVSA 4JUIA 2XMCA 3VJMA 5AOAA 1AMNA 1W1IA 1Q0RA 4GWLA 3R41A 1GGVA 1BN7A 2CMFA 2W6CX 3H2HA 3WKCA 1VE6A 1DWQA 1CR6A 4QZVA 2WSLA 3EQ9A 1I6WA 2GYWA 2H1IA 2UZ0A 3I6YA 3FLAA 5E4TA 3STVA 2OGSA 3C6BA 3OG9A 1RWQA 2X76A 5AM2A 3ZI7A 1F0PA 3C8HA 3W2TA 5JIBA 5ALZA 3M81A 2B4KA 5I7UA 4QNNA 4B0OA 4IO0A 2XMRA 1LPBB 2AJDA 3BDVA 1YCDA 5ALEA 5ALLA 3R3ZA 4G8CA 1E89A 4LYDA 4NVRA 1EH5A 1GPLA 1EK2A 1K63A 4H7FA 1DQZA 3A2LA 3WA6A 3H2KA 1GQSA 2VJBA 2WHPB 5K5EA 5CH5A 2OXEA 2RONA 1RYYA 5JANA 1XKLA 1CLEA 2QJRA 1XZLA 2AJLI 3I2JA 3IA2A 3AZOA 2X8BA 4GHWA 4B85A 2ZJ7A 1R9MA 4MQLA 2HA2A 3VISA 1JU3A 3I28A 4ETWA 3V1KA 1XQXA 3DL4A 3BE8A 3QPDA 2QMQA 3H0CA 2HFJA 4DMCA 5HQ3B 4GDMA 3HYSA 2XUJA 3IUMA 3H18A 4H7IA 1GKLA 2PUJA 3WK8A 3CN7A 1QLWA 4CG2A 5DYYA 4BYMA 3AZQA 2QS9A 4BE4A 1BROA 1E8DA 1R50A 3OM8A 3C87A 3I2IA 3FWHA 2WG0A 4U2BA 3FYUC 4GXNA 1GKKA 4CCYA 1CUGA 1IZ8A 4J0IA 2HU8A 2WTMA 1W6RA 1YS2X 4AQDA 3WKBA 3IB3A 2Z8XA 1W52X 2V96A 4FMPA 3MGAA 5AICA 2XUDA 5AM1A 3GBSA 5ISMA 4YK7A 2HADA 5IH7A 1QGED 5T4FA 4K6GA 5FRDA 4BATA 3H1BA 1BCRA 1QIMA 3BDIA 4AXBA 1A88A 5FLKA 4Q3KA 2QR5A 5FV4A 1WB4A 3NOXA 5FKJA 4CG1A 5HF6A 2DR0A 2XUPA 3WYDA 3BF7A 3P2MA 4OB8A 4DGQA 4KE7A 3STWA 4G9EA 4X6XA 5T4EA 1FFAA 5K3FB 2XI4A 2Z3WA 1AX9A 3L1HA 4AN0A 4AMYA 3QYJA 1LZLA 3KSRA 4C4XA 2XB6A 1XZDA 3N2ZB 1ZIXA 5HCUA 2VT7A 2CB9A 2O2HA 2WFZA 3H2GA 3TJMA 4QDTA 1AQLA 3WK4A 4L3WA 4X97A 2Y2VA 4B6GA 5AKHA 1LPAB 3G7NA 5CW2A 5KWJA 2H7YA 4X6UA 3EQ8A 4NZZA 2Q0XA 2G63A 2BUBA 3ZWQA 1XRMA 5LZ5A 4G8DA 4ITVA 2CKMA 1DT3A 4MYDA 4X3CA 2QT9A 5EIHA 3F98A 4F60A 5AIBA 5BWCA 4QWMA 1YAJA 3V9AA 4QE3A 4Y2YA 5LP1A 1K6EA 3AZPA 4EBBA 1UOQA 5JARA 4M0FA 2JF0A 5CMLA 2OQVA 1MJ5A 1YS1X 4Q82A 4JYPA 4MYSA 5JZSA 4QDOA 5AH0A 2WJ4A 3MVEA 4UFPA 1XFDA 2OCGA 2LIPA 5T4HA 1WB6A 1X70A 1MT3A 4HZGA 2J4CA 1MX5A 1IUOA 1ZJ4A 2XQGA 5AOBA 3SC2A 3LP5A 5C81A 3KDAA 1Y7HA 4OU4A 2DFPA 4LXHA 2BAGA 2BJHA 5LKAA 2XMBA 2Y6VA 1CQWA 2WIGA 1QO7A 1ZGCA 1TRHA 1DX6A 1JMKC 3T52A 4G5XA 3VXKA 4G1FA 4PV7A 1XRQA 4Q34A 1P0MA 2GYVA 4BCCA 3E4DA 5ALRA 3VVMA 2WHRA 2QUAA 1ACJA 3PDCA 4J0GA 2O2IA 1QIIA 1CUVA 3GZJA 1KU6A 2XLBA 1YA4A 1UKBA 2WFLA 4BVKA 5EIAA 4C88A 1A8SA 2PBLA 2BCEA 2HA0A 3WKDA 5AOCA 2WTNA 4AZ3A 2YASA 1OXMA 4KJXA 2Y1KA 4ROTA 3W04A 1E8MA 3CCCA 1LPPA 1XLWA 3EIOA 2AJCA 1T2NA 4LIPD 5AKGA 5JALA 3D7RA 5ALNA 1GQRA 3DD5A 2C4HA 4UUQA 5FP0A 4Y2RA 3KOOA 1CPYA 1QZ3A 4QLOA 2ZYSA 5FUMA 3WWOA 4N8EA 1XZFA 5AK3A 1N8SA 5EHZA 2IX9A 1XZGA 5DNVA 2FUKA 2D0DA 1H2WA 3HI4A 2J3QA 4L72A 4UBMA 1H22A 4GLBA 4OUKX 3G0IA 3R3VA 5KREA 2AXEA 4OYYA 1NU6A 2XMSA 3OOSA 2XT0A 4RPCA 4H7KA 3WL8A 2XUHA 3EF3A 4JNCA 4CI9A 4G4GA 4LXIA 5J3JA 1IUPA 1QIJA 3GA7A 5ALKA 1VXRA 1QIDA 4IH1A 2XQJA 1C7JA 4HAIA 2OCIA 5KWIA 1MU0A 5K3BA 5JZ9A 1AC5A 2WHQA 1XZBA 4ZWNA 4FFWA 1DWPA 1ISPA 2X5XA 4GBGA 2OPHA 4AB1A 2CBGA 2VAVA 1E8NA 5IVDA 3L1IA 4YPVA 2I3ZA 1XQWA 2VT6A 5CT9A 5C8ZA 4UBLA 2C5FA 1CUIA 3R3XA 4LXGA 1WCYA 1BEEA 4UFOA 2YYSA 3ICWA 1P0IA 1EI9A 4LKOA 5JADA 4OU5A 2JEZA 5DYWA 5AO9A 4X00A 4BB0A 5E2IA 3AUKA 5IVKA 3DJYA 3JYHA 1HPLA 3O9VA 1JI3A 3FBWA 4Q3OA 5IVHA 4OB6A 2JGEA 2QTBA 1XZEA 3WK9A 3WWEA 4TGLA 1IMJA 4X93A 1LBTA 1CUWA 2EDCA 1THGA 1YB6A 3L1JA 3Q8WA 3CCBA 3M82A 5ALFA 4PSUA 2VF2A 2PSFA 3F67A 3PFCA 5AKZA 1W75A 3HLKA 1VLQA 3WK7A 1ODSA
chains in the Genus database with same CATH superfamily
1BCSB 4RDXA 4I5DA 3H87A 4DQXA 2JHAA 1PDWA 2UAGA 1KZ4A 1MO3A 3NHZA 4MWCA 3CUUA 3INNA 2H1LA 1XIVA 3LPCA 3CZMA 4BWYA 1WTAA 2FPGA 1I2CA 4B75A 4LF6B 2VDWA 2F3TA 1C0IA 2TMKA 1DT5A 4MVXA 2K5UA 4KQXA 2C0QA 1RQXA 4JXZA 3GNQA 4H0NA 3IIIA 2WP8J 1YRYE 3R5JA 2XYQA 3VTFA 2HYIC 2CNKA 1JQKA 2YIJA 2HK6A 3EA4A 1G20E 2GZDA 1QCCA 1P73A 2BM9A 2W93A 1G6OA 4IIJF 2J7KA 4KN6A 4BKQA 3R6GA 4A8JA 3KM0A 3QX7A 1CFJA 3I09A 3TX2A 4BVLA 3WLHA 5JJ5A 1GUFA 2BGTA 1M7HA 4PRYA 2H51A 3THXB 1ECGA 1DJPA 4Z51A 4CN8A 3PVZA 2FSFA 3W5IA 1LDGA 3A4NA 4Z99A 3BQMB 1PFQA 3SX0A 4HH3C 2CFSA 3ZWNA 1ECJA 2XE6A 1K2WA 4UASA 1RS0A 2RE8A 1G4AE 5GP1A 2QYSA 3G5AA 3TGLA 2X0DA 1VIMA 2O3SA 1S89A 1VJ5A 1KEZA 1R12A 3OURA 3VNAA 3RVBA 2CNNA 2UUAB 3EEYA 1TW3A 1VL0A 1QFYA 1X1QA 2BFCB 4IHJA 2DT5A 4J4HA 1CY0A 3T3IA 1FJHA 5BT8A 1AGRA 4LVUA 4OJKA 3TR0A 5CYPA 1C7QA 4FLFA 1ATZA 1EQ2A 1VG0B 2L17A 3PRYA 3V9PA 4C6SA 4DCOA 4D82A 1JG4A 2YV1A 1FFWA 5JXIA 4NF2A 2R6ZA 3FNEA 1UFRA 3JQBA 4LJKA 3T94A 3BMCA 1PNTA 3II6X 3PWKA 3KT8A 3U4QB 4K3VA 4KACA 1U8EA 2R6GA 1UJ4A 1T6YA 2PGAA 2VDLB 3U0BA 4ZGWA 1UMBB 1EVLA 2I6UA 4MICA 4C89A 1CNMA 4QXRA 5L7TA 1DQPA 1TMYA 3OF3A 4J9VA 4WV3A 3WY9A 4B7CA 4ROSA 1UBKS 5C35A 2Q9BA 3M1IA 2XYGA 3KUDA 2QVGA 1JSLA 1S9HA 1MLDA 3K6KA 1JEQA 3QYFA 5FOSA 4Y98A 3G1WA 3NWOA 1BRTA 1HG1A 4JSRA 3HKBB 4WZZA 3PNSA 3GG9A 3TJZA 1Z82A 1T3LA 2BMJA 1OF1A 2ECPA 4D0NA 4IMIB 4EJ0A 3R9WA 2YDYA 1Q0PA 4D3SA 2QTLA 5IJZA 2Q5LA 5FOQA 3TDNA 1H5QA 1NUQA 3PWZA 1JHRA 3SVTA 3ZVNA 3E7XA 3M1YA 2PFKA 4BV8A 4MK4A 2DGDA 1U1FA 5DMHA 3TO5A 3AF6A 1JZTA 2GPNA 4MVCA 2ZVJA 3LT0A 4PTZA 5EKUA 3C45A 1IJBA 2WNSA 4F4HA 5CU7A 2O8CB 4BLWA 2OOSA 1QIHA 3DPIA 3RVPA 1RXYA 2AN4A 3VSEA 2G08A 4NDNE 3S99A 1XNRB 1JWAB 1J99A 4FNGA 2UXBB 1D03A 3USCS 3UT5A 2CXHA 3GWGA 3M6XA 5DISB 3M3DA 1ECBA 2OCKA 3PUVA 1PQPA 3CVOA 4MP8A 5GJWC 3G89A 3U60B 2IZ6A 1U8UA 4M36A 5EYPA 5P21A 4YPFA 5IABA 2FUEA 1WIWA 3ZWXA 5CDHA 1M33A 2B5VA 3TOXA 1Y6JA 1KQGA 3KT6A 1NHGA 3OT5A 4HTFA 4TSRA 4V0NA 2PX8A 4C4AA 4MMYB 1ENPA 4Z4CA 4BY9E 3HRHA 3PCTA 4FBMA 2WM8A 5C8XA 2R8YA 1XTRA 3P52A 1TUBA 3R2JA 4DBLC 2QRUA 3PL1A 1NJFA 2YZMA 4MKRA 1OCEA 2HJWA 3I6MA 4OXNA 1JMYA 2PGJA 4DLKA 5IKXA 4NCBA 1CUBA 3GAZA 4L8YA 5AKXA 2DY0A 1VFPA 1G0NA 4OLJA 3GMTA 2A84A 1DVRA 4PAMA 1DKRA 1V6CA 2D4AA 5CVUA 2MCFA 2O0LA 1ZAYA 3IYLW 3NNNA 1DEXA 3UT0A 4Q24A 1GZHB 4MW1A 4N3BA 1LBHA 3N2NA 3AYZB 3SR0A 1PBNA 3C3BA 4YT2A 4L4SA 4YCBA 4G81A 2HQ1A 1NW4A 3KOXA 4LOKA 3TPFA 1P3JA 2J67A 3EGOA 1I0IA 1ZONA 2JGJA 1D1PA 1Z4KA 4MDHA 5TIIA 3I52A 5J43A 5K8CA 2JCYA 2FWIA 3KJQA 1ADFA 4HDKB 3ZCVA 1YZYA 4RJJA 4FILA 3MTEA 2JFPA 3I6BA 1XTIA 2D1YA 5ALXA 5A71A 3QVTA 3WLTA 1S0UA 4CV2A 4N5IX 4GGPA 1SURA 5FV7A 3R7NA 2F43A 2FW0A 3TNLA 3AC0A 3FD8A 1GGNA 3TW4A 1CXZA 4F3KA 1TT7A 4UM9B 1YS6A 3WGGA 2PSDA 3AEUA 1DC4A 1XEWX 4HAWA 2ZB4A 2Y0BA 2ZITA 2GPJA 3V8QA 3PCRB 4ZREA 4YUWA 5IHPA 3ETNA 3I64A 3QTLA 4GH5A 3VAAA 1PS9A 3IT2A 4P7FA 2D06A 1IM2A 1NAIA 2HHJA 5GV7A 3A1DA 3CUSA 4RHUA 4WXRA 1RYZA 3EUAA 4P3KA 2JLSA 3ENNA 5L3RA 7MHTA 3G79A 1EJ6A 3HFJA 4RDCA 3HDHA 3L79A 2IUYA 1QG4A 1BTOA 1YZ3A 2GO1A 3M89A 3MS7A 3LIIA 5D5HA 1F8XA 5EUQB 1FFCA 3D2LA 1X1DA 3PQ7A 3RYTC 2ZIWB 5K3SA 3KJXA 2ZQYA 1TCAA 2JIDA 1JSRA 1ARZA 3X2FA 4XIIA 2Z58A 4QJ3A 1XTSA 4XGRA 2V03A 4ZMRA 5ELXA 4GMGA 3D59A 4MRMA 1AS3A 3EY9A 2P4EA 4DABA 1U7WA 2EQAA 5EXEA 2VWGA 3G3EA 4BQRA 3CZAA 1O6GA 5BSWA 4UBKA 2H1VA 3E61A 3L8HA 4FXPA 3K1AA 1ZIPA 1DI0A 1X7ZB 5D3QA 3AUYA 3UC5A 5K3AA 4L5CA 2ZYIA 3DQQA 4AMUA 1ODKA 5DW3A 3EMKA 4X6YA 2UUBB 3H1GA 1USVA 4EUFA 4GI1A 1WW8A 2C58A 2VK2A 3ASVA 4KSYA 1GNRA 1RLMA 1ZD1A 4WKNA 3K0FB 2IUUA 3KZMA 5EHQA 1M2VA 4OBXA 4Q9AA 4WDRA 1Z17A 2CYAA 1GGEA 3ORHA 4L9WA 5EHGA 1G0OA 1V6SA 1WSWA 4B45A 4R8MA 4V0MA 1U9IA 4ZCPA 1T8YA 2IZ7A 1FP2A 4QXQA 5AKYA 3VPCA 3SFZA 4DQVA 4EHBA 3J7AC 1XXHA 3GRPA 1FFEA 1XZAA 2J9RA 2MSNA 3NB0A 4Z7JA 2Z9BA 1RPAA 2J30A 3ND8A 2DG2A 2QX6A 3AQIA 4WZ6A 3VKFA 1SBYA 2ID4A 3EVEA 4NNOA 2IBSA 3B48A 1PR2A 3QBEA 4Y2XA 2QF7A 1QQ5A 1DRKA 5JD5A 3E3LA 1NW5A 4B5LA 4GLFA 1XCMA 3AONB 4LQDA 5C5IA 5JOQA 1E9RA 1KDPA 5EUBA 4TV8A 4AY5A 4KRFA 1Q1QA 3OMLA 2AI2A 3FB1A 4GZLA 2WKSA 1WOYA 3KPUA 1Z73A 1NV9A 1PLKA 2I2FA 1RP1A 2QX4A 3JTMA 2HRRA 2J46A 2FMFA 2R6AA 1E7MA 1R0LA 2RJNA 2OA0A 5ADUS 1MGOA 1S3IA 2DUMA 1YDHA 1L9KA 2F3SA 4M9CA 4QGHA 5EVCA 3K2IA 2HMYB 4KWTA 4LYEA 3UICA 5KQGA 5J5CA 1YJ5A 1LPSA 2C0CA 3RR2A 2DFKB 3V1LA 5JNUA 4LPSA 4KXWA 1P75A 3QBTA 5A1TA 1EFUA 1N4DA 3O8LA 2FMKA 1I32A 3PEEA 4E5SA 3EVBA 3FGNA 4JLNA 4JWTA 1ZY2A 3B1WA 3L6OO 3LSYA 4NECA 4R1UA 1L7QA 1F5NA 1A82A 1OFUA 2YHUA 3OJWA 1VBMA 2FEWB 2I7XA 1JPUA 2MSCB 2Z5LA 3QLTA 2AIRA 2BFMA 4C2UA 5B3JC 2JLUA 2JGFA 4FDTA 8GPBA 3BM5A 3M1LA 1EB9A 1HNWB 1IK6A 4MW7A 1WKBA 1R3DA 1P2UA 5BOVA 2P9TA 1B0ZA 3NUZA 4PPGA 5CJ2A 3U4DA 4YRGA 4ID3A 5JE8A 2CCJA 4GP9A 2VP9A 1XZIA 4FEAA 2XUGA 3BXXA 4KNYA 1V25A 4DMFA 2UXDB 2OGTA 5CX4A 4L8GA 4DLAA 3GT0A 2LE0A 5JG7A 5EHIA 2MINA 1HZZC 1RABA 1M1ZA 4F5WA 4QEKA 3TCKA 3C3MA 1GUZA 5PGMA 3BD8A 4EMTA 4EY5A 2X4IA 3N0RA 4DDUA 5I5GA 5K9ZA 2QRKA 4TQUS 1P4JA 1QQAA 3ECCA 2G70A 2YH2A 4MYTA 4BNKA 2GRAA 1NFQA 2MR5A 5B4TA 2OXFA 4WJLA 3LQQA 1EE1A 2KW5A 2OQIA 5HF5A 3LNCA 3H3FA 1RC0A 1JQ3A 3BVPA 1XA3A 3NRBA 4G1BA 4R6XA 3A27A 2EV9A 5CVEA 2NU9B 2F8MA 3W05A 5LP6C 4ESEA 3Q41A 3DEAA 5L3ZA 3AHEA 4E5YA 3BKWA 4KN5A 1HRDA 4ZVKA 2BLLA 4HAYA 3OCJA 4DM4A 3PNKA 2EKLA 3HC7A 3LUPA 2IQ5A 2ZIXA 2YW9A 1YRAA 3RSCA 1NQUA 1VL6A 4Q4JA 1MTZA 4WZBB 3UJDA 3W9BA 4GX5A 3FBTA 2JIZD 2YV4A 3DHEA 3ST7A 4QUBA 3OM1A 3VJLA 3WYBA 3ND6A 1CJCA 3MRXA 2JKVA 5DLQC 2I22A 2QPTA 4MYCA 4HV4A 2GEKA 1BEZA 2FSGA 1NLYA 1FVXA 4YCMA 1E66A 1U0LA 3HV2A 3KV1A 1NRXA 3DZBA 4GI3A 4NBUA 4D9NA 1XMQB 4HATA 3L4BC 5J2UB 4EY7A 3FZGA 3R3HA 4ZCQA 3KQHA 3LY8A 2CHUA 3FSRA 3R7DA 4DCNA 1QYDA 2YS6A 2HWWA 2R9VA 1H3FA 1PVVA 4TT3A 1R88A 2C20A 3DDZX 4FEEA 1XCGB 5C5EA 4DDTA 2G4LA 2PWAA 1UXGA 3CLHA 3MUNA 1FP6A 4IV0A 3EVFA 3OPYB 1Z4JA 4JODA 5CVDA 4KK3A 5I8ZA 5TS3A 1JFVA 4JEUA 1IHPA 1PR4A 1TD1A 4LOLA 1C9DB 3E0QA 3ZY6A 3KJIA 1ADJA 3N58A 3FNBA 4IIUA 4HS4A 1RAEA 3H5TA 4NOKA 4YGXB 4PN3A 6AT1A 3FUUA 1RC8A 2FFJA 1E7WA 3P9ZA 3G23A 2FCRA 3TLJA 3LM8A 1T5DX 2BEVA 4WY5A 3IS3A 3WISA 4V3CA 3U49A 4WL0A 1XDGA 3EIUA 3SR4A 3ZWKA 2DQZA 2V4MA 4NV0A 3G2NA 4H77A 2VKTA 1IY1A 2RBGA 3UAYA 1MKYA 4ZT7A 2QM0A 3H97A 5LLTA 1Q7GA 2X0KA 2R79A 2WE8A 4UU8A 4YBZA 4GP6A 4JK3A 5H81A 4GL2A 4N41A 4CPDA 4TZKA 1P0QA 4FGZA 4PG7A 3E48A 4Q48A 1KNQA 3SF0A 2GERA 5FBKA 2FN7A 2PANA 2H29A 3FMGA 1SC6A 2VP0A 4YP9A 5LYJF 3OIYA 3P26A 3F6YA 1P0CA 4HLQB 3A1EA 2GLUA 2RI6A 2X2EA 3GEGA 4FWBA 1FUUA 3DE7X 4J0HA 3RF6A 2QMOA 3WBJA 1G19A 2EZ9A 2A5GA 3GZTB 1Z6PA 2IXGA 4XWYA 2IZZA 3RJ9A 2E0IA 5JNLA 5MN6A 4Y2JA 3ZJVA 1Q1EA 3NTQA 2QZ4A 1YR3A 3F7TA 4FR5A 3SXUB 3BGIA 4Q7EA 1FYXA 1H6DA 2OCAA 3WV5A 5C7YA 3TKAA 2VSQA 3BGOS 4FGKA 1AS0A 5EXSA 7AT1A 5JCJD 5JY6A 3TSWA 4Z9AA 7REQB 2DTDA 2EW2A 1H2FA 2J45A 3CLKA 1EVEA 2LRHA 3LRTA 4DEXA 3RB8A 1HFJA 3QP9A 1RM5A 1G5HA 2O8NA 3C85A 1UC9A 3HLTA 3LH5A 5JD3A 2O2JA 3ANLA 3KQLA 1K8QA 1TKCA 2HLDD 3AF3A 4HCJA 2DCUA 2GD2A 2D1RA 3JQFA 5GGXA 1S1CA 1CYDA 1D2EA 3Q4GA 4QUHA 3NBXX 4BC0A 2G5GX 4B71A 4ZC1A 3SDSA 5BYKA 4XH9B 4EP1A 1OV6A 1E2GA 1ZVKA 3SZRA 2C9BA 3VDXA 2X4DA 2AB0A 1BW9B 4M1KA 1N7IA 1KEUA 4YMWA 4FHDA 4I2VA 3OD5A 2FHSA 3LWDA 4A82A 4C9BA 4QYIB 1A1VA 3VI3B 3B20A 4JGIA 2YQ5A 4QHYA 4Z1OA 1NMQA 3MWGA 4H6XA 2WTAA 1GRCA 2DTEA 1YL5A 4BAZA 5EWMB 2XZOA 1YOVB 1YQTA 2CUTA 4P82A 1VE7A 3GCWA 3QVWA 4FX2A 1VRVA 4FIZA 2IEDA 4KEAA 1NX9A 4NRDA 4P5PA 3CRRA 4JQOA 3OQVA 1NU8A 3T5AA 5EE9A 3DKKA 1WF6A 4MHTA 1KMIY 3AUXA 5SZHB 1PG5A 4CEHA 3TIVA 4GQIA 2R8EA 3A9SA 1YI1A 2ZRNA 4ZVQA 2EKZA 5JXWA 4MWOA 4YRBA 3TBKA 1R3UA 1UDCA 2QM7A 1H6AA 4KXUA 1P1HA 4CM3A 1ZJ5A 3CMCO 3ZIAA 4LNHA 4EB8A 1GYQA 1DG9A 1H2YA 2F1IA 2RHRA 4TXLA 2V5AA 1RRMA 3BTVA 3SVLA 1UPXA 2ZVDA 4A8JC 3OC6A 4MLDA 1SCKA 4HDRA 1JE0A 2EWMA 3CXRA 1YFKA 2MTBA 4ZXPA 1DJLA 4KJZA 1CUZA 1A76A 4ZAYA 1MW8X 3WGUA 4C0QC 5GMOA 4FKBA 3SMVA 2JEOA 3DAPA 3HP7A 1YKSA 4LZWA 1HKUA 4AX4A 4CKBB 1QK5A 2X22A 4A36A 3MJEA 1LLFA 1NT2A 3VR0A 4GVPA 3WLRA 3ZHQA 2E4ZA 1U6JA 3IEXA 3NPMA 1UKCA 2W48A 1UBJS 3NHUA 5HK9A 1XAHA 3EISA 1B23P 3N28A 3ILSA 4D9IA 3D81A 1JEOA 4ZQEA 3TD9A 1Q12A 3Q40A 4KBYA 3QUQA 4F8EA 2V98A 1PJ8A 4GOMD 3LL7A 1NBAA 2FW6A 3HBAA 3TEMA 4DNOA 5T4BA 3OF2A 1E0SA 4WUVA 3NTRA 5AW9A 4RS3A 4OIMA 2EGUA 5EJFA 3W4KA 2FPXA 3VNSA 5MN5A 3JQBC 4NENB 1NGSA 1EVJA 4KO3S 2Q8NA 1U04A 3PRHA 2JFOA 3QELA 4B17A 4LN1A 1Z0SA 3B2EA 3PQFA 2PXHA 1ODTC 1XEWY 2QBYB 1Q1AA 1II0A 5IXJA 3KR2A 3IDFA 1W87A 3RCBA 2G6BA 4UFNA 3A2MA 3R0ZA 1U0JA 1O2DA 3HH8A 1I7LA 1SCNE 3IOBA 4PEVA 1K7XB 3I1YA 3G02A 2LGJA 1JQJC 5J9FA 1FU7A 1GO2A 2H4ZA 3OTOB 5J2TF 3KUKA 1UK7A 3MT9A 5DIZA 2OC4A 2DULA 3LHKA 3QFTA 3S55A 1YZKA 3P4UA 4DJDC 3S0JA 3D8HA 3PK0A 2FF7A 1HQDA 1UK9A 3GDGA 1B43A 2C7RA 3MGKA 4P32A 4S1OA 1AURA 4NZPA 4U8GA 2Y4NA 3P2YA 3DLTA 3IDSA 5F1KA 3W4JA 4RTLA 1F3OA 1OILA 4OFXA 3BWVA 3HL4A 3KNZA 4QVKA 1DL5A 3C3KA 3ML1A 5FCDA 3V7YA 5KC8A 3PE6A 4RKRA 1IZ9A 2QTCA 2OXIA 3VFDA 2C54A 2I80A 3R9IA 4PG4A 3A0UA 2VZ8A 3DS8A 3ETEA 1S3GA 1KDZA 2C84A 4NU8X 1UXOA 1QV9A 3E18A 3KCQA 4JYMA 4DM7A 5DX8A 3NAZA 4Y6LA 1OPXA 2BGGA 2RIPA 2WMNB 4CG0A 1OSNA 1I3KA 2WV9A 1Z0IA 3VHLB 2B82A 1JAHA 3ZR4B 1QH8B 4DTCA 3H17A 2J4DA 1DUIA 5DKFA 4NOJA 2W58A 3B1ZA 4OHPA 1U0EA 4JU8A 1P2TA 3THRA 2AHRA 3KWFA 1MNQA 4I14A 4RK0A 3TRDA 3U1VA 1Z0ZA 4PGGA 1TVKA 2BR5A 1UL1X 3LDUA 3ZKWA 2LDBA 2OXCA 3D64A 5CFPA 2RG7A 3AESA 2LCQA 2X0IA 5HQJA 2FPLA 3HPQA 3P97A 4L27A 5BW5A 2A7QA 2RH4A 2DWCA 2O20A 4KBGA 2MYNA 1NT4A 3GQBA 1TIKA 1E2DA 3FFTA 3IE0A 2B8TA 2NYRA 2P2NA 4BNUA 5KPDA 3PUHA 4KPFC 4CMJA 1CJVC 1IY2A 3AM5A 5I6DA 2EOAA 9LDTA 4XJSA 4MWTA 4N54A 3EZ9A 2CZQA 2WUVA 2ADFA 4L4XA 2BE9A 4AZWA 1I6LA 4DA9A 4EFNA 4U2CA 3UXHA 4EB6B 3QKTA 3ACDA 2WR8A 2RJOA 2ODNA 1FSFA 3GYBA 1AGYA 1E79D 1DMRA 1NXSA 5KNCD 1GUYA 3IH5A 1JRLA 1IATA 2RMKA 2XF2A 4CF5A 1EX7A 1M6EX 1TMOA 1FBNA 3WYNA 3IXQA 1JT2A 1ZCBA 2Q21A 2YV3A 3G9XA 3HHPA 3ZU3A 3RAEC 2CUNA 4PLTA 4C05A 3AW9A 1WQ4A 3LT5A 4PICA 2C3UA 4LXTA 3RODA 2JD1A 4MDFA 2BGKA 3OMWA 1U0SY 3SHFA 4K9DA 4RV4A 2B3TA 4FCWA 1VKHA 1PR9A 2B7LA 2IOFA 2EAUA 2LR0A 3IDAA 4GPIB 4QOSA 4PXAA 3ROTA 1J23A 1AE1A 4HRXA 3W8EA 2JGNA 3N2KB 1JL3A 2W37A 4W7IA 3UQZA 3ORYA 4PANA 5HIMA 5JAIA 1UT5A 5JO9A 1SXPA 2R1ZA 3I4CA 3U7EB 1VB5A 2C5LA 3WO1A 3VV2A 2C7GA 1ZD2P 1M0WA 1YI0A 5IAKA 1C3XA 1H2AS 1Z25A 4V02A 8MHTA 1QF6A 3L6DA 1ZEMA 2DTXA 2N46A 1RFGE 2C94A 4DZZA 1P6QA 1QH1B 1V35A 1K1EA 1K8YB 4II2A 2DUUA 4IPTA 4YJ3B 4YDSA 4OQXA 4QQ8A 3DUFB 3KKKA 3ZBQA 2A88A 5FNVF 2O2CA 2EKQA 3I9JA 4MWSA 4FGJA 2K6GA 4KVZA 3ZLVA 2G28A 2YY7A 5F7XA 1B76A 3LWNA 1IEVA 3QVXA 4IUCS 4O4LB 1LS6A 3MPOA 1P7CA 2I71A 1IHDA 4D3FA 4MUNA 4JT8A 4B2LA 2PSJA 1KP9A 4H17A 3OQ1A 1JXOA 1WKCA 3HRKA 2WHPA 4PAGA 221PA 4YACA 1HLGA 1VJGA 4CEJA 5AK4A 4YJKA 3T4UA 1HFKA 4I9UA 4JA2A 3OTGA 1SBZA 3QKUA 1RZVA 4BFUA 5IX8A 5A9RA 2XBLA 3Q8KA 1IQUA 3V1NA 5AM5A 3I4LA 3KKNA 3PD7A 4P4UA 5AHKA 1ETHA 3JSXA 2WWRA 1ZRSA 2V7QD 5AJWA 4MVJP 3H5VA 5JEDA 5BORA 4WKBA 3QXHA 2QN9A 2ERYA 3WG9A 1CHNA 3IV7A 4ZT4A 4NSNA 1EFRD 3VHQA 5DPMA 4TKUB 4NZMA 4BFWA 4ZVSA 2I4NA 4O8ZA 3RJMA 2QPLA 1M67A 1MVOA 5A5DA 3LC2O 2WWYA 2NU6A 2GAIA 2R68A 3Q5GA 3WLPA 3TYXA 1F0NA 1DE0A 3H04A 4R7GA 4BQEA 2C5EA 2JATA 1T8UA 2XUIA 4IOKA 3V34A 2J8ZA 2HTFA 4M99A 4L9SA 3ZE9A 4PQYA 1T2VA 4M9ZA 2HREA 1A50B 3A9UA 5TS2A 3ZGNA 4C07A 3T12A 5KJFA 4IF4A 5IXSA 5E6RB 2YUTA 3B82A 3W9UA 2GJ4A 1BXGB 2J6CA 4JJ6A 4LYFA 5EG5A 3BL5A 3PGVA 3DMRA 4PR0A 4JELA 5ARDA 2O8BB 4FOOA 3G9ZA 4EX6A 1D04A 1V5FA 3GRAA 1I10A 4OMFG 1E9SA 2QX8A 4KR0A 1Y80A 4M3NA 1A2KC 4QFCA 1KMMA 3ND9A 1XC7A 4K9KA 4PPYA 4RORA 5FUXA 2HQSA 2JDID 4KXXA 4UPEA 1J21A 3KAJA 5HS4A 3AVTA 2IITA 3R23A 4FVTA 1XZ8A 2C29D 4K6CA 3DEJA 4AP6A 4X7BA 4DJAA 3A4YA 4EABA 1H9CA 1CUFA 1G4HA 3BD9A 4MAAA 3EODA 4TQ9A 4IRXA 2GD1O 3ZD6A 2J5RA 5K3OA 1E2MA 2AFIA 3FSGA 2YZKA 1TYEB 3P7MA 4J76A 2A9VA 2GZRA 4B9AA 1EZ1A 4N03A 4G5RA 3T7EA 1F12A 1ZNQO 2FG5A 1C81A 2X77A 3HB5X 1E1RA 2G88A 3BWDD 2GPYA 2Q5OA 1JE1A 2H06A 4AN1A 2V45A 2ONYA 4GKAA 1J2UA 2JVJA 3V2IA 4DA8A 4J6FA 4BNGA 5DXAA 1R74A 1XMVA 3DLAA 3OZDA 4A3SA 4G8JA 2H18A 2FCAA 1L8XA 2WUEA 3DOUA 3URKA 1RU3A 3RKRA 1ZKMA 3MQ2A 4M9UA 4GSKA 5DNYB 2ZSBA 4BNNA 2A9KA 2O54A 3FKQA 2JW5A 3FLBA 3EEOA 4ZTUB 1VOTA 2IV7A 1I2ZA 1NXQA 3OFJA 1KR5A 2VJNA 3VYUB 1U1IA 3IPRA 3UN1A 1G3IA 2FFQA 3QLVA 2I54A 3HN2A 4RA6B 1FW8A 4MVJM 2F7SA 2FPRA 3FOZA 4NFSA 1J5PA 4R1MA 3PEFA 3DV0A 2IPXA 4HUQA 1DQRA 3X43A 4F56A 3BGVA 1TM2A 3QUBA 4JEHA 1IXSB 1LC3A 5LBTA 4B6OA 4CCWA 5F23A 3FBGA 3NU1A 2GHTA 2B8EA 3FCYA 3G5MA 4ILKA 1T2FA 1T4CA 4RO0A 2Z6AA 2ZXFA 4UDYX 2WF6A 4H6WA 4K88A 5GJVC 2DAPA 4J43A 4W1QA 3VR5D 1T3HA 4AO6A 3O3CA 2C5HA 5FD8A 4RTPA 1N8NA 3L4JA 5JWOA 3B12A 3O4JA 1X86B 2WY2D 4A23A 1M10A 1NOKA 2Y71A 2BZGA 2FN8A 4V2IA 3LRXA 1YUBA 3IKJA 2QG6A 3MBOA 3TW8B 4EHAA 4X95A 2UU9B 4RD4A 2QN2A 1NIJA 5GGYA 1EQAA 1Y5MA 4Q7LA 2HK8A 1TQ6A 4FKZA 1JIJA 1QFXA 2ZIGA 4ZDWA 2B92A 3CLRC 4BS9A 3C6MA 1OZFA 4YRNA 4YJ2F 3HJTA 4YDRA 4YV0A 4JXXA 3D6UA 1JZSA 1PEKE 4UNPA 1OT5A 3R3WA 4G36A 2O2DA 4WIAA 4CIAA 3ZHBA 3SBDA 2Q1XA 2RGAA 4R4JA 2V7EA 3KPVA 4DXAA 4GW3A 4KGDA 3COJA 1RYBA 3C48A 1FTSA 3RBZA 2FLKA 3FWNA 2B35A 4NS4A 1L5LA 3OQNA 3PCXA 1VLZA 3MW8A 5A5VA 1IXZA 3INTA 1N3BA 2QX7A 3VH1A 1TLFA 2WKPA 3A26A 4LSZA 3LBFA 2H0QA 4KLNA 3A37A 3CNNA 1UBHS 4ZYVA 2EJBA 5KNBH 3T34A 4X7PA 2PUHA 5FH9A 5HWSA 2WT9A 1OHHA 2YFYA 3C15C 3HA5A 3LXMA 4WCVA 1UOEA 4XZ3A 4A2WA 4BWGA 2NVUA 3VH3A 2R8XA 3E8SA 4O2AB 2PJUA 4PO1A 4KPUB 1PHRA 4DN6A 4J0JA 8AT1A 3UW3A 3C43A 1N7JA 5FUWA 3QMMA 3SJAA 2CMDA 1Z7YA 1FNBA 4KVGA 4M21A 4F4CA 4IDPA 3L84A 1PJRA 4XVRA 5MFZA 4OQNA 1V48A 1N2CA 1P1JA 2P3QA 5HF9A 1AA9A 1TJ5A 4C76A 2J48A 5I9LA 2PE5A 2E3JA 2C04A 5K3EA 5IDWA 2ZSKA 3L0YA 3C4VA 2DKNA 3ZU6A 4ZC8A 1LDYA 4B33A 4KPEC 1W5FA 1MXFA 2UUOA 2WOOA 1LV7A 1SC4A 2UV8A 3OJXA 1EP3B 1HUQA 2MSLA 3GNLA 1K7SN 3HJUA 5ALPA 4P7BA 5IDVA 2WEKA 4OM8A 4MRNA 1EWTA 1GL7A 4HADA 4LHZA 1RWMA 2P6OA 5E4YA 3IV6A 4NG5A 4YAUA 1YZTA 4FBGA 2J5QA 4HO1X 4CKWB 2FE4A 5B1DA 2FVXA 4R6WA 2AJBA 2Z6VA 4WTOA 1Z4QA 1XTZA 3IQHX 2C4NA 1R8JA 4H18A 5HFAA 3NDPA 2B78A 4I4TF 4EPRA 3EZNA 4KGXA 5CG1A 3B89A 3CGWA 1P8JA 5C5CA 4P4GA 3JQFC 1U80A 2J32A 1YRQA 4PLPA 1FU8A 3MERA 3WRWA 1T5SA 2W6OA 2IOYA 4UNSA 2PUGA 2HT6A 4NXMB 3WQRA 2WRZA 3A58B 2Y67A 4UQLA 5DH9A 3PQ3A 3LMKA 2WVGA 1C2TA 4I3FA 1WHSA 3JR3A 1DAMA 1AZSC 2I65A 4DADA 4KITB 3KETA 3LVQE 3T3GA 1P1BA 1SU7A 3HY3A 2XTJA 3EZXA 4CCSA 3NHWA 1SXQA 4DV5B 1K4YA 1Z0AA 3FDJA 4P4TA 1R2QA 4JGBA 2H3EA 4JASB 2G9NA 4DE5A 2DFNA 1DKNA 3CPEA 4XOUA 5A6VA 1B73A 1EX9A 3NC1C 5CLIA 4QQRA 4MGHA 1OTHA 4K3UA 5KAPA 2BSQA 2KLBA 1UWCA 3MJTA 7GPBA 2LNDA 4G0ZA 1T36B 4OUDA 1D2RA 1MBZA 4OFBA 5CUQA 3OZTA 3RAJA 3W7BA 3ZBUA 2C2HA 1VXOA 2HCJB 3AHGA 4RVGA 4IXTA 4OV6B 5KNDD 3H7IA 3VPXA 3WBFA 3HVIA 4RTRA 1N9GB 3I5AA 3U56A 3UB4A 2C2ZA 2XGGA 5TPWA 3WMGA 2R6JA 2JIRA 1F6BA 2X5NA 3GUCA 1IWBB 4MXDA 1D0IA 4FHEA 3A4VA 5HKKA 3F3MA 1MJGA 1U8TA 2GBIA 4HNAB 4TTIA 2B8JA 5F5NA 2EJTA 4RBNA 2Z8ZA 5THQA 4TYYA 1L4MA 1YBAA 2FPSA 2J3DA 4DNQA 3JYQA 4Z4QA 2WSIA 3LGSA 3THYB 2PT5A 2AW3A 3UAGA 4QM6A 1Z2EA 2DHDA 3V4RA 1N6IA 2CXXA 2PSEA 2F9MA 1E6CA 3GLFB 4AG5A 5CCXA 3IT0A 4KQFA 1BU5A 4G5YA 1GTVA 2L19A 2AQIA 2HSWA 5A4DA 5IK2D 1QF9A 1HGXA 3HBMA 3W5AA 3SD7A 2P27A 3AK4A 1YFJA 1E3MA 1WY5A 1CRZA 1QPGA 1KEWA 3DUWA 2P90A 5IJXA 4WNAA 2OHGA 4U2FA 1DIRA 3FR8A 5ECDA 3CX8A 3KUCA 2BCJQ 3X1DA 2WNIA 1R00A 4ENSA 1CDZA 1EFCA 4RSHA 3K5WA 2WD8A 3WLLA 5CB0A 1GLGA 2YXDA 1KZGB 1X7DA 1JP7A 3P96A 5F9FA 2G07A 2CLEB 4E2FA 5C8VA 1PF7E 2W4QA 4EKNB 2JI7A 4P53A 1MN6A 5HE9A 5C1OA 2GTIA 1SZCA 1L4NA 2B8NA 5JWRA 1J7KA 4OBWA 3VPAA 3USZA 2DB3A 3IQGX 1SXJD 4Z6KA 5K0LA 2PUVA 1VMEA 5G1OA 1L4YA 1GD1O 1B2LA 4TTQA 2WMYA 4L9AA 3O8OB 4LCEA 3AHCA 1KVQA 4FMBB 3TG2A 3A31A 3OHSX 1YO6A 1N0VC 4MVYA 3VYRB 2PBZA 1F6WA 3ZE1B 1SWWA 5ANRB 3VNQA 1N2SA 4QNRA 5GVSA 3ZV6A 3EZLA 1L5VA 3B3JA 3REFA 3EXHA 3VM6A 3BJRA 3KZ1E 1FL9A 3GOHA 1PGPA 3COVA 5L3SB 5A04A 4WKPA 2RBKA 1NM5C 4FC7A 1RJGA 2AG6A 4GR4A 4MPPA 4R5MA 1K8XB 5JDCA 2XOKD 2YJZA 4W63A 4C01A 4EVIA 2QXUA 1N0IA 5FBRB 4U3JA 5JNTA 5M5BA 2VS1A 3KXLA 4FSDA 2P2CA 1IJFA 1Y3CE 3LQKA 2YXBA 4PC6A 1FFHA 4MR7A 3QK7A 4M38A 1M75A 4J0FA 5HJEA 3MWDB 1VKZA 1KJWA 3U7HB 2NZWA 4KXNA 3SBEA 2GR9A 3I6IA 5K0TA 4XXHA 1MT0A 1C1XA 2NXEA 3C3EA 5L95A 2O0HA 1BS9A 1SKMA 1Y9AA 4DCUA 4FFOA 2GZMA 2X41A 2GILA 4QSMA 3DFZA 3FTDA 2YOGA 1FPMA 4NZNA 4GGMX 1NDUA 5HA5A 1GY8A 1OH7A 3ZHXA 2I6XA 4V0OA 4BRSA 4KOAA 4DLXA 3NJ8A 1HTTA 3HDYA 2QQ0A 1RD4A 1DJQA 1JG3A 1FQOA 1LY1A 3LXXA 4L9RA 3GFFA 3RW9A 4JEMA 1WG8A 1MP0A 8ABPA 3BRQA 2Y66A 3QXXA 1UJ5A 4NFYA 1Q1BA 1WD7A 3OIFA 1OGJA 2GAFA 4KODA 4XCQA 3TMAA 5JXGA 4H1VA 1TJ3A 3M2PA 4MQBA 4F84A 4D9HA 3IQDB 3AF1A 3PXUA 4LGCA 1ZAKA 4Q9KA 5AKLA 4ZI7A 3THXA 4H1TA 2WQ7A 1K5PA 1YR1A 3CGGA 3CFYA 4URZR 1ZRNA 4FI3F 4MP6A 4PYJA 3D8UA 3H8SA 2RGCA 4IG9A 4MUGA 2ECQA 3WNDA 4WFJA 4BLUA 4Q0MA 2GM4A 1WB9A 1RBYA 3RD5A 5MHTA 1I1QB 2QJWA 3NM5A 3MJSA 1Z74A 3FWKA 1GCAA 2RGXA 1P1FA 2JGDA 4HN4B 1ZYUA 5AM4A 1FDSA 1YUMA 3QE0A 2H48A 2NXNA 3KLNA 3NYIA 1HI9A 5U1PA 4KDFA 1J9EA 4HB2A 5ICEA 2AEJA 4RA9B 4XPIB 4WK2B 1IAVA 2BMVA 1N8TA 3B6KA 4HBZA 4I55B 4TMWA 1C41A 3MD9A 3MM4A 1OX4B 4IEEA 5EKTA 1TCBA 5CFQA 3K6SB 3DZKA 3QQPA 4YRRA 1T10A 2YOHA 4Y2TA 5REQA 3IBFA 3TOVA 3KUXA 5CFOA 2VPQA 2RCNA 1FJ2A 2G7MC 3AEKA 4J1NA 1L7MA 2VYQA 1C0PA 2C0PA 1ZHFA 2PLAA 4B73A 1WUHS 4ENTA 1GDDA 3B70A 4Q1BA 1PW5A 1TM1E 1PT7A 5JDIC 1R64A 4J1QA 1CNFA 2B0JA 1JDJA 1TK3A 5F1PA 3SSOA 2I6SA 1OJ7A 3HB1A 2OEPA 1CRWG 1G3MA 4L0CA 3TD2A 5KYGA 2PKCA 4PFQA 1HYEA 4Q4HA 1B16A 1CS0A 4UU0A 3K9GA 4CLEA 2EW1A 2GT1A 3L8MA 4R5HA 3RIGA 3EK2A 1GT91 1CUEA 4YXWD 3G9UA 3CEHA 4B3CA 3U19A 1Y4UA 3NBYC 3LD9A 4TRNA 1H6BA 4QVGA 5F2EA 1HETA 1VIDA 1ZH8A 1KOJA 3IQZA 1WD5A 1YAHA 4IGKA 2QGZA 3DTVA 5C1IA 2WU0A 1PAUA 1HBJA 1KRHA 5FWAA 2VDOB 4C0AC 1XA4A 1VHLA 1H65A 1JSZA 3L7NA 1BX1A 2ZUBA 3DKVA 3RIXA 4KV9A 2VJAA 2PXAA 3O92A 4O5OA 2FR8A 5KHAA 5IM4A 4N0PA 2XUAA 4BN4A 2O59A 2VBCA 5K0CA 3UAVA 1M73E 2CHFA 3OCYA 4EG4A 3GVXA 5GZ1A 2C7VA 2ZWAA 4OJMX 1MAAA 2CCKA 5JT1A 1U63A 3BA6A 2E87A 1MPTA 1Y3AA 3AEYA 5ER6A 3PU6A 5T6MA 4ISBA 3ZXSA 2ZSFA 4DMUB 1P0FA 3AETA 1FFBA 3GPDG 4ZIRA 2Q0SA 4ZJYA 3KJZA 3GJ8A 4B3HA 3KVYA 3OHMA 4ETMA 1T8PA 3O1JC 1E18A 4ZEWA 3ORQA 1WE2A 4F4JA 2F6RA 3IHLA 3SNHA 4L7QA 4EG7A 1P19A 2I9KA 1XRRA 4K8OA 1QE0A 4HH1A 5EEHA 3BJZA 4PO9A 3R7LA 5KU7A 3UWOA 3FYUB 2I0FA 1U0GA 3KPYA 4CDRA 3AH8A 4GZMA 4BGDA 1R66A 3BORA 4LV6A 1KXJA 3RGWS 3KB8A 3BMQB 3MCVA 5F9MA 4YCSA 4WJZA 2HJHA 1UKAA 4ENPA 1OYYA 5BNZA 4CTMA 1ZQ9A 3AIOA 1DC5A 3QXJA 3SCZA 5BN3B 1O96B 3U62A 3FRJA 2G0TA 1E99A 3UMVA 1OYWA 1XTBA 2QE7A 3FCEA 5C37A 5GIPE 3OOHA 3ROXA 4RTJA 2BWJA 2NO7A 2ZBGA 3HNPA 1IQPA 1DNPA 4E2YA 2GN1A 2H0RA 4BMXA 1L5RA 2IGBA 4HXFB 3N7UA 1U7ZA 4KE9A 1NJ8A 1L4HA 1Z12A 1BVYF 4IDHA 3JSAA 3DAYA 3M7IA 4UNIA 2HF2A 3TZ6A 2CY0A 5CHYA 3ZZ0A 5BXYA 1Q1GA 3M6FA 1HO3A 3PP8A 4NULA 1IOVA 1KDYA 4B79A 4EA7A 2A86A 2I2XB 4W7HA 4MJ3A 5JAPA 2XW6A 3IQEA 3OKAA 3U7FB 2ODQA 3CLTC 4H3HB 3I58A 3T38A 2A67A 1KC1A 1P61B 3MT7A 3QJGA 1MVLA 4LYHA 1VJ0A 4E94A 1XPOA 2AX3A 3EJWA 1VTKA 2IXEA 3UH0A 2NO9A 2C3MA 4L75A 4LE0A 1MB2A 1QGOA 2E5FA 5LMUB 1V3VA 3MN1A 1RAGA 2JRCA 1U3UA 2JGIA 1N1DA 1AQIA 4D9CA 4LGVA 4Z4EA 2CL7X 2IF2A 2ZM5A 1NZFA 4I1PA 4KAJA 1GR1A 4KYVA 3AKEA 1P7WA 4C0JA 5G0UA 2IA5A 1NBOA 1BKYA 1NNI1 4G5HA 1VDMA 5LLDA 2QAJA 1O95D 1NSYA 2WVJA 1DTWA 3SDBA 1JDSA 2OHJA 3ZXYA 5TARA 3M34A 3N8DA 1P2FA 4P4NA 4ZDKA 5CA1F 4DXHA 5TXGA 3AOEC 3GU3A 2XB2A 2AMYA 4HEJA 4DRXA 1QGZA 2D1QA 3S1AA 3T9AA 4B3BA 3ZJTA 1WM1A 1KYXA 2CNDA 2H4JA 3AVQA 3QLVC 3CZ4A 3FA2A 5L6LB 3HSYA 2VWHA 3CF4G 3TFQA 4EENA 4G0WA 1JYEA 1FLAA 2EFGA 2F48A 1KJ9A 1MEOA 4P22A 1J6UA 1A96A 1PGOA 1LSSA 3PLAE 2ST1A 5FBVB 1W0KD 2XNDD 4M0UA 2WILA 4TWRA 1FTNA 4FFRA 5FOWA 4BNWA 2ON6A 2GSWA 4N65A 4ARZB 5GTDA 1Z33A 2ZJ1A 3EPPA 3GJRA 5F3RA 1KETA 3KR9A 5KYKA 1CIJA 3FJOA 3CXUA 1J0XO 3DMTC 3ZWPA 5DM70 2FPIB 4Z8XA 3A9TA 2IX3A 3K9CA 1ECCA 4QX6A 3FG9A 3X3HA 1U28C 1UQRA 3LLMA 4C20A 4LHYA 1C8BA 2DU8A 2OCDA 1MJFA 2C95A 3KSUA 4K6MA 4TKZA 5EIXA 3BWMA 1JIUA 3IGFA 1M74A 3CRVA 4N6GA 4KQ1A 4W5HA 4CDMA 4LFAB 4H7JA 4R41A 4XSHA 4XWKA 4J2OA 1A5AB 2FQQA 3AV0B 2Q1WA 2R96A 3ZUGA 4ZV4A 1XZJA 2X1HA 3C5EA 1NV8A 4O1IA 4M8KA 4QAQA 4QD3A 4BBZA 3GNTA 3KQPA 3O8DA 3I53A 3N9IA 1MJHA 3DE1X 3EFEA 4UMDA 1W36B 2XUQA 2PKEA 1YXMA 1TK9A 1I51A 4O4IF 1I5OA 1COWA 3P0IA 4G1VA 3GAMA 3VNVA 1EKXA 4KE6A 2ECKA 2Q6KA 1EVQA 1CX9B 4UUNA 2ZT8A 3H9BA 4LC9A 1Z3IX 3PQEA 1D1SA 1DX9A 2F1JA 1AUQA 1ZHHA 4P7JA 3EGEA 3FHCB 5KX5F 2J07A 3UFXA 5GADl 3L8ZA 1YMVA 3L8GA 4MEAA 3VZSA 1EBFA 5ITVA 2WUWE 5JNSA 2PZGA 4MVJH 3D6MA 3MRVA 5DTIA 3EGDB 3WMWA 2VA9A 1V39A 4O59O 1FFYA 4NKRA 1GZ3A 4BVJA 4YMLA 4DMKA 4DMRA 3OE7D 4DR4B 1KKUA 4G0UA 1MX1A 3B1JA 2Z1MA 3R9XA 2C57A 2AV6A 3FZYA 2YMLA 1JDPA 2OCYC 5KJ1A 2OESA 3SYRA 2HW8A 4Q9LA 1ZI8A 1B0UA 2C3PA 2P4QA 5TQJA 1TLLA 3T3MB 4AS1A 5TC4A 3IB6A 4XIJA 3I9KA 4BP1A 5BR7A 5B1IA 2FOLA 2I78A 3BEOA 1WA5A 1JHOA 4RH0A 2AT1A 3HDTA 5DGXA 3T8YA 5CFZA 2H63A 4Q4AB 1N2GA 3JQEA 2VP2A 3C6KA 3DBLB 4UUBA 4ANFA 4F91B 1JAXA 4L73A 2WJJA 2NYUA 2FR1A 3HE3A 3ILHA 1QH9A 3GLTA 1IDN1 1I7PA 1TIBA 1OWNA 3AFNA 2E48A 1G9SA 3M6UA 4QASA 3SICE 3SF8B 4RD3A 4MAMA 1U2RA 3L0DA 3IUQA 1S4MA 3VO9A 4E0BA 2PVSA 2XMCA 3N3AC 2VYNA 4M7RA 4PZ0A 2CL0X 4L8LA 4MWDA 4RM2A 5D5PA 4DG8A 2PJZA 1GN9A 5CNJA 3TG8A 3LT2A 3R41A 4FCCA 2BEWA 3WR5A 3BULA 1ATIA 1WULS 3QFFA 3AB3A 4NOMA 1NQWA 2CMFA 2ZXEA 1OAOA 5C31A 3V3KA 1AK9A 1WCV1 3CT4A 3FF1A 4HAOA 5DYGA 4IP0A 1CR6A 2QP4A 1XSEA 4GNKA 4ND3A 1E9AA 1ESEA 3M1AA 3MQ4A 4IJ5A 3ROZA 5B5SA 4QZVA 1FRZA 4LBWA 2N3ZA 4YJGA 2IYWA 4BLVA 3X1WA 1DAHA 1SZJG 1RI5A 4PZEA 1I6WA 1XO1A 4JL5A 4ND4A 4Q66C 4GRAA 2BBTA 2CK3A 3HP4A 4X8LA 4YUAA 1M8KA 2BM0A 5CVJA 2R6CA 1E0DA 3LQFA 3W5JA 4ZAFA 4C7MA 3OG9A 4K2HA 2JLQA 3UAWA 3V4OA 3C7KA 3RYCA 3NVAA 2X76A 2XWQA 2VJOA 3C3XA 3CW2A 2XHZA 3MWKA 4IQ0A 1IOZA 1NW8A 3C8HA 3M33A 1RVV1 3MGCA 4QRIA 4UE3S 5KYTA 1YB1A 5DK4A 2DBRA 2P62A 3CVYA 3U4AA 1WDKA 2VJMB 3URMA 1FXWA 1ZNXA 3M81A 4F3RA 5I7UA 3GX1A 5JO0A 4B0OA 1WXHA 1LPBB 5AUNB 4MVJG 1F0KA 4CUJA 5A5FA 2W6JA 1OVGA 1DP4A 1YCDA 5ALEA 1AN0A 2GNOA 2WPNA 3HCFA 3TDKA 1DELA 1QAMA 2BPOA 3QG5A 4MS4B 4IWYA 3ZDZB 3QKRA 4EPTA 4XWWA 1EA7A 2DE0X 4EELA 4R1OA 5FUVA 3K70C 3C5CA 3K35A 6CHYA 2XKJE 1GPLA 3KR0A 1PR0A 2FJUA 1HLDA 2ZATA 3EXIB 4NEQA 3LP8A 4YWJA 4XDHA 4UDOA 2AZ4A 3TTYA 2JAUA 3FIJA 4H7FA 3QVGA 1ZJWA 2EGGA 2QLMA 2W8ZA 3EC7A 1U4SA 2OD2A 1KHHA 2Q5FA 3ADPA 1QCZA 3G2OA 1BGVA 4H2DA 4ZT2A 2VRNA 3DFKA 1AHIA 3WGMA 4CF3A 4DCTA 5KTYA 5KQSA 2IELA 1QKKA 1D7OA 4KQIA 3VSDA 1GFSA 1P72A 1S9DA 1YACA 2HQOA 4EKYA 1NE2A 1T4DA 2ANCA 3HBNA 1VI2A 4GPTA 3TX6A 4WGGA 5CA0F 1EWKA 3ZYCA 4GMFA 2VF7A 2I4TA 2VDMB 4KVFA 2BP7A 5KB3A 1ZNYA 4C6TB 2X23A 4JU9A 4QTTB 5B3AA 4BVAA 2OXEA 5K5EA 5F9HA 4ZDIA 1EJ0A 5JS7A 1KRWA 4KIJA 2RONA 5J47A 5JANA 5F3WB 1ABFA 2WU8A 3V8PA 2AR7A 3OZXA 2P4UA 2Z2IA 1XKLA 1PGNA 3PNMA 4GAEA 3W5DA 3WGOA 2A0YA 5AVVA 1NLUA 2KHZA 3SEAA 3P20A 3I2JA 2AQKA 3IVRA 3IA2A 1OXKB 3HWX1 4IHJB 3VZBA 1JR2A 2BBOA 5FFNA 3M8KA 2DLNA 1U1EA 3LV8A 3H9GA 3PQ4A 5BYBA 5I7HA 4MGIR 1RADA 1WCXA 2IZOA 2WM3A 1NRJB 4OOEA 1Q1ZA 5JVDF 3EXHC 5BRJA 5HEKA 5LNK6 4V1CI 3UOWA 4M55A 5DTMA 1POXA 5EQFA 3TZHA 3VKUA 4WZAB 5EY5B 4AIIA 2WTUA 4OXIA 2C5BA 2Q4TA 3I3OA 5JDCC 2YHBA 3BFPA 3PGJA 4LJAA 2XCLA 3UUGA 4OQPA 4B46A 3GN2A 2G5CA 3GLIA 3FMFA 4RSRA 3AR8A 3JYLA 4N9QA 3GV0A 3UMFA 5TJ9A 1NFFA 4KUHA 3L5KA 4W5WA 3W78A 1GZUA 5DHRA 1WZCA 3N6RA 2VYFA 1VCHA 4DV2B 5L45A 1A5SB 5A9SA 5IF3A 1PJQA 3ZX4A 1T5IA 3H0CA 3G0OA 4EEZA 4DMCA 2CFTA 5HQ3B 4BO9A 1YNOA 3NHSA 3O8CA 4NJMA 1KO4A 1M2EA 5JISA 4PR3A 3ODGA 5DEOA 4NV1A 1YRBA 4MROA 2PUJA 1ZOPA 3DTTA 3VX3A 1RJ9A 4TL7A 1FSGA 4DS3A 1OBOA 1JDZA 4OMUA 4PCVA 4BXOB 4BYMA 3AZQA 3EXAA 2FHPA 3NC0C 3UT5B 3VSCA 3BHIA 3W3AD 1HE8B 1ORTA 2JFGA 2P2ZA 4G0XA 4MV4A 2FWMX 4ZU1X 1HV8A 1N5KA 1G55A 1N5JA 3GLHA 4PZCA 3SYKA 4IIVA 5AK0A 4GRDA 4M8SA 2GHRA 1R50A 1T5TA 1U02A 2H17A 3OM8A 2QVYX 3KZVA 2RH5A 4U2BA 5IANA 4NBLA 3NG1A 3FYUC 1G7TA 3K1YA 1UT8A 2FDRA 3KB6A 2LW7A 1Z4OA 1XUOA 1M6NA 1PR3A 3IAM1 1TUBB 4P81A 4ZA2A 1TM4E 3FDIA 3GBPA 4DAOA 4DRZA 2QAGA 5JU6A 1SPBS 4Q21A 3Q7QA 1MO4A 1S2LA 1OJLA 3T7AA 3VQTA 4WNIA 3G49A 3HY6A 1YS2X 1X1AA 3LQ1A 3HCRA 1WCIA 2JJ8A 4MS3A 3GP3A 4MQEA 2OBMA 4R2XA 3ZDRA 4CR7A 4EGCB 1CT9A 2RI1A 4QPNA 2A1TS 4IJMA 4QYMA 4DQUA 3FLMA 2FN3A 3A0RB 3HM2A 4FMPA 2Q7XA 3CX6A 2HEGA 5HW0A 4LC0A 4URHA 3IAUA 3L01A 4AP9A 4DDMA 2GAAA 2QZZA 2TMDA 3L77A 2UDPA 4MP3A 5ISMA 5BVGA 1HC7A 4KDEA 2YWGA 5EQJB 3W5UA 1ZWLA 2BI7A 1I9GA 1MC1A 3EZ6A 4D9BA 2VNIA 4INOA 4YONB 1MMFB 4DW8A 1XAIA 2XOEA 5BV2P 2HXGA 2ZS7A 3JQAD 5T4FA 2Q3BA 3T5MA 5CNMA 2JCSA 2BFEB 4YS6A 3AEUB 2YNMA 2ZJ8A 2CDAA 3L7OA 4BATA 3D7MA 4KHPB 2I5PO 3H5AA 5JCPA 4K1LA 1QIMA 2LV8A 3WQBA 2ZPAA 5HUJA 3IKLA 4NJOA 2HZBA 1C3VA 1LK0A 4PYKA 1N1GA 4F4UA 4KR2A 2LP4Y 3OEEA 1NXVA 2AXNA 1RMTA 1WB4A 3T3OA 5HNKA 3E03A 3LUBA 4XJXA 3H75A 2V58A 3EF0A 1NBMD 5ICFA 4AY4A 5IKPA 3NNDA 1RQGA 3QG1A 3QV1A 4M7WA 4MB6A 2FR8C 3RFVA 4M37A 3AF0A 4DGQA 3TECE 4HAZA 5FI3A 3H83A 5T4EA 1BS1A 1G21B 1GNTA 1LRJA 2FU5C 3CWQA 4DIDA 1EFHA 2EYQA 4NZYA 5I8WA 3ETGA 1AX9A 3HB9A 4EBFA 3KU1A 1QC5B 1TJYA 3E5HA 3L1HA 3RHSA 5TB5A 4AN0A 3WGIA 2E2WA 3NWPA 2PZAA 1CIVA 4QJBA 3ZZMA 4EUEA 4C4XA 4C1BA 3AWIA 2NYAA 4YP6A 1X8LA 4EQZA 1XZDA 2YN4A 3N2ZB 3UW1A 3BS4A 4KFSA 4QOGA 2CWDA 3PPVA 4DBLE 3E3OA 3FPBA 3SKXA 2VT2A 1ZFNA 2O2HA 2QL5A 3EFOA 4FOTA 1U3TA 1XTPA 3LTNC 2WFZA 3RE1A 3PDHA 1ONBA 1P77A 5DYIA 1N0HA 3UEOA 1IU9A 3UWSA 1HQKA 1JALA 4KNWA 3R0QA 4Y1RA 4AECA 3C8ZA 3CJQA 1V8BA 1CR2A 1JR3D 1M2VB 4HX9A 3COPA 4QEDA 5EP1A 1T2UA 3LYUA 1OOEA 5CX1B 1XTUA 4DUGA 3I5YA 2PL9A 1C50A 4GI5A 2GJ9A 2WICA 3B78A 1GSHA 2C8LA 2C7QA 4D4IA 5KWJA 2H7YA 4IEFB 3PQ5A 3GMDA 4BV3A 1GU0A 3RBXA 2ODEA 3PV0A 1KIFA 1PSWA 2Q0XA 3HKCA 1H94A 2QLBA 3LKBA 1GTG1 3GVPA 3OT4A 3SQLA 1JLSA 1TF2A 3GGGA 4BNLA 3QKSB 1ZRHA 1TE2A 3EEIA 4ZCLA 1H3EA 4MW9A 4NCKA 5CCDA 4BU1A 1XMJA 2QT9A 4TV8B 2WBLC 1ZPDA 2HMWA 5KQLA 4IJKA 1JJ7A 1U2DA 2HO4A 4OH1A 2Q2QA 2CGEA 1YAJA 3K94A 4FFBB 2HMAA 1EM6A 1P9WA 3HCAA 3O2NA 4H08A 5FR1A 5IZCC 4IWXA 4EG3A 2ZTUA 2PWBA 2ZT5A 4IG4A 1NXPA 5ES3A 3AZPA 3B7WA 5H83A 4IXWA 2AQ8A 5CMLA 3KSZO 1PN3A 3NRJA 1JAYA 4OA5A 4HUJA 1IONA 3GARA 3NC4A 4R1PA 1YS1X 2MJLA 2VWQA 4OQDA 4TVOA 2PL3A 3NQ41 4YAFA 3RREA 2F1RA 3P2OA 5E7MA 3LWZA 2IU4A 1Y1RA 3LK6A 3HL0A 4IW3B 4KH1A 4PYLA 1KIMA 3V5NA 4UFPA 1YONA 4AKIA 2IJGX 2OCGA 3TE7A 3LTEA 2NV2B 3OLXA 3PHBE 4U63A 2FUNB 1B8VA 1PNQA 2EFCB 2GASA 3GZ4A 3IEUA 4LVCA 4QJ5A 4ZCSA 2Z6QA 4KSCA 2O52A 1WU8A 2AOTA 4XDZA 3S2IA 1Q92A 3N8GA 5ICCA 4FYVA 4KZKA 1Y1LA 1TX4B 4I5EA 4TYMA 1MX5A 3N0WA 4N40A 3WJAA 1TO6A 1F2VA 4HF7A 2B8WA 4Q7JB 5J2UF 2BONA 1JKFA 1NLFA 2GF0A 3V32A 4CL0A 3OX4A 2MINB 2ZYTX 1QK4A 5C81A 1FA9A 5H16A 4QATA 5FBLB 1GWNA 1GTJ1 3COSA 3FWYA 1OX6A 3EW9A 2K87A 2VO1A 3Q0EA 2WWHA 3SFTA 2CLMB 3KDAA 3OH8A 4OL0A 4RMJA 1MB4A 2ZAOA 2EP8A 5CD9A 1J8QA 2ZDHA 1Y7HA 1VPLA 2IIPA 4US0R 3WHLA 1B93A 2DFPA 3GMIA 1J8DA 4LXHA 1UEIA 5FA8A 3OEWA 4LMBA 4B47A 3USES 1YMUA 2ENUA 4BGEA 2XMBA 2Y6VA 4HQFA 1CQWA 4G0QA 3OOWA 4K6OA 4TV9B 1PZFA 2WIGA 5D01A 3C24A 3T1OA 2CV0A 3A9VA 5AR1A 1US8A 2EHJA 4Y2GA 3SZOA 4F9EA 4O3FA 4Z7OB 1YDFA 3ZWOA 4WAUA 4O3MA 2PEYA 3VXKA 3FFXA 3TIXB 2ZIXB 5K4GA 1DJOA 4B6EA 1F06A 4Q34A 4U1RA 4UU1A 1UH5A 5EZQA 2CE2X 4LTMA 5EXPA 4RSMA 3ZXIA 1O57A 2EATA 3FPCA 2GCEA 2VDVE 2QNIA 5THXA 3GAFA 5I9TA 2YJNA 2E37A 2NSLA 3R9KA 1P33A 3Q3GE 4MVWA 1OPRA 3KQKA 5HJ7A 1Z8DA 2QUAA 1K6XA 1ACJA 2H4XA 1T0HB 4J0GA 4G0VA 2C1EA 1Z2NX 4Q6BA 4NG4A 3GZJA 1CUVA 2IBTA 3GEIA 4DG5A 3OSZA 1MOSA 1NP7A 5ILGA 4GKJB 3CF2A 3RUIA 4Y6SA 2GS9A 4TUYB 5KQRA 3JWHA 5EIAA 2ADOA 3T1YB 3O4VA 2ZBVA 1NY5A 2J5BA 1DDOA 2PBLA 3FNIA 3MWFA 2D2IA 3U3RA 4GE3A 2XDQB 3O6VA 3R5SA 4NX2A 4Y6QA 2MMCA 4PSKA 4N9WA 1YK1A 3WKDA 4YFYA 5LXTF 4UAUA 4EYKA 1MA3A 5CEJA 1WDTA 1MR3F 1RWBA 3DEZA 1FVFA 1LTHR 4WK4B 5BWOA 5KCZA 3HKDA 4C08A 3FCAA 4MV6A 4NU0A 3WYEA 3W04A 5CM9C 2FB9A 4YAGA 2Z3VA 2GHQA 2H4WA 4DYVA 1ZLXA 4LEIA 1I2AA 1U3CA 1QR2A 3WLFA 1NSTA 5JY1A 4C5CA 3W2IA 4U7HA 2ZCUA 2NOAA 2D7JA 4RZ3A 4LIPD 3NHPA 3QNUA 4KYTA 5JALA 4GPBA 1N6LA 1GQRA 1YI8A 1G6Q1 1TJNA 2VF5X 3PSHA 2AFRA 3D1LA 3TNFA 4KV7A 1BEUB 3AUSA 1FYEA 1SHLA 4JVLA 5DHSA 5FP0A 3H1PA 4NZOA 3UK2A 1UADA 3TIIA 2ORIA 1QBGA 4R69A 4UJ5A 2ZRBA 3B7GA 3CZCA 3HY4A 2FYTA 3NOOA 4LRYA 5D6NA 4QLOA 3ZCPA 4DT1B 3EPKA 3KQQA 5K0JA 1S02A 2H1FA 1GPAA 1WXGA 3R3JA 2ZSUA 4WOBA 4TN5A 3TL3A 3W4IA 2QRPA 1OLSB 1OFIA 2WSSA 4BMOB 3G2LA 2DEUA 3X1XA 1T3ZA 1X7WA 2V5VA 3I01A 3N2LA 1N8SA 2RB5A 4L3VA 5EHZA 4RVNA 1X9HA 3EC1A 1XZGA 4MQFA 4HQOA 3U9LA 4BB5A 2FUKA 3ASZA 2CHEA 3HI4A 3MJDA 4UEQA 1Z6AA 1QANA 1ZEJA 3MINB 4E22A 1GSIA 1MHTA 1J0AA 4L72A 2ZB2A 5IM5A 3G0IA 3GLKA 4TVSA 2HGZA 1H93A 2OXTA 2ZR9A 3WNVA 1SBCA 1KSJA 3QXCA 3LW8A 4XGNA 2NX2A 3UJ6A 2XCSB 3L43A 5K01A 2C5SA 4GM1A 1H1TA 1OGYA 2E4WA 4B87A 1AN9A 3NGXA 5AVJA 1FY2A 3WL8A 3PA8A 1TYZA 2YIVX 5JXJA 1VBNA 5FAXA 2V3VA 3IRVA 1P74A 5MGBA 1KIAA 5DYNA 1V3TA 1SUSA 1DJNA 3FSEA 3ZC3A 2P9ZA 2G67A 3MS2A 4LY3A 2Q7DA 4ERNA 1LNQA 3ZDDA 2FPMA 3OPXA 4LWOA 4H59A 5ALKA 1PL7A 1QIDA 2P7HA 3IIKA 3UF0A 1TYAE 2HIGA 3M4NA 4J1TC 2NQ2C 3D3WA 4HAIA 4RPHA 5BYAA 1FMCA 2OCIA 3D6TB 3ZE0B 1RQLA 3O4RA 3TOSA 4GMDA 1MU0A 4ZVOA 2WHQA 2W6NA 4M1ZA 3D3QA 4AROA 2O05A 5LQKA 1NJ1A 4FFWA 3EWSA 2I2AA 4CEHB 2WT8A 2O7NA 3JAKA 4D8XA 1ISPA 3KSAC 1JPNA 1O97C 1Z29A 1T8SA 3LCVB 4JLUA 5DT2A 2XNJA 5FOXA 3TR5A 5C1BA 2IU3A 1QRRA 2CBGA 3S7ZA 4DUPA 2VAVA 1E8NA 5CDGA 1G5IA 3HRIA 2G83A 5LN1A 1H3NA 1ZN8A 5AXCA 2XRYA 3GEPA 3H0KA 2EC5A 2PYDA 4UBLA 1NJSA 3DZ8A 1M7GA 3PB3A 3ICQB 1V4NA 2PTGA 1Z8FA 2XTZA 3NTLA 3R3XA 4HNGA 3N5KA 4O8CA 4RKWA 4WXHA 1T1EA 2BFFA 1W4RA 1WZNA 3N53A 3FPFA 3NBQA 4IRUB 3ICWA 2XZTA