3V2GA

Crystal structure of a dehydrogenase/reductase from sinorhizobium meliloti 1021
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
252
structure length
252
Chain Sequence
FQSMMTSISLAGKTAFVTGGSRGIGAAIAKRLALEGAAVALTYVNAAERAQAVVSEIEQAGGRAVAIRADNRDAEAIEQAIRETVEALGGLDILVNSAGIWHSAPLEETTVADFDEVMAVNFRAPFVAIRSASRHLGDGGRIITIGSNLAELVPWPGISLYSASKAALAGLTKGLARDLGPRGITVNIVHPGSTDTDMNPADGDHAEAQRERIATGSYGEPQDIAGLVAWLAGPQGKFVTGASLTIDGGANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dehydrogenase/reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 81
structure length 252
sequence length 252
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2gA00
1OC4A 2VHVA 5I9LA 1I3MA 1HZZA 3IIEA 2YV1A 2PK3A 5JSFA 1NFRA 1ZVMA 1X0VA 5CEJA 4GX5A 3QSGA 4FC6A 4U0KA 5JCJD 2RBEA 5CPBA 4IJUA 2O3UA 4AJLA 2VHYA 3JD3A 1XU9A 1IZ9A 1YOVB 3JQCA 3BYZA 3CTMA 3W4KA 2HO5A 3ZWPA 4YJHB 5HTOA 3BTUA 4ZQEA 1Y8RA 2HCTA 1AXGA 4ZVVA 5G0VA 1YBMA 3WYEA 4A0SA 4M55A 4G2NA 2DU8A 4RVDA 1H6BA 5JLAA 2D1YA 5G2OA 4JN6B 1LDNA 5AXAA 1NFQA 1D1SA 3VZRA 1O94A 3KLMX 3G3EA 4I5GA 4IXTA 4L4XA 1NXQA 3KZVA 5TGDA 3GPDG 4NZ9A 5G0SA 3PJFA 3NGXA 4QTZA 3WFIA 5JBIA 2NSDA 3P5SA 4PIVA 3E18A 4CMKA 3AY7A 1Q7CA 3CIFA 5KJ1A 3K30A 4XGKA 4GPD1 4GVXA 1WLYA 1YBVA 3L4BC 4PN3A 2AQKA 4WASA 4YR9A 3QQPA 5KVQA 2J5RA 2CSUA 2VT2A 1KY5A 4YJDA 4QXMA 5TX7A 2X22A 4XKJA 2CDBA 2Q99A 5JYEA 4IIUA 2I3AA 3UUWA 3LC1O 4J49A 4J91A 3NT2A 2SCUA 2W2KB 1JKJA 1SOVA 4F45A 2BELA 2IXAA 3ZV4A 4DLLA 4WK6A 2UAGA 1YQGA 1I5RA 1VPDA 4YJGA 1DHRA 1EFKA 2WE7A 1DIGA 2R00A 4IMRA 1WNTA 2ZCUA 1DIHA 1WPQA 2C0CA 3DTYA 1M75A 4CPDA 3ZV3A 1YBAA 1KYQA 3BZUA 4N18A 5JMWA 3ITDA 4MOWA 2I99A 1PJBA 4ROSA 2O4UX 5K9ZA 5TIIA 3B6ZA 3PZRA 3DMTC 1TVEA 1DFHA 3LLSA 1YL5A 3NX4A 4RDIA 4BOYA 4E31A 1Z75A 3WJ7A 4DQXA 1K6IA 2HUNA 4OH1A 2C2XA 2VNAA 5AXDA 5ICMA 4KUHA 2GPTA 2YUTA 2CVOA 4BB6A 3U09A 5C7OO 2OGUA 1U7HA 5I9MA 3H5RA 3GG9A 1C0KA 1N9GB 1ARZA 3MTJA 4E4YA 1V8BA 1Z7BA 4IQGA 4J7XA 1K0UA 7MDHA 2DKNA 2DFVA 3IKVA 4WLEA 2JFGA 3HG7A 1QLHA 3L6OO 3HDYA 1GAEO 5DCYA 4NJOA 2GERA 4BNWA 4CLRA 4HX5A 4IBOA 5BSHA 3D4NA 2DLDA 4YRDA 2JCXA 3ZU5A 5F1PA 3JQBC 1X1TA 2O2SA 3PJEA 3FTPA 4W6ZA 1DEHA 4XEHA 4ALLA 2QYSA 3RKUA 3LK7A 5HA5A 3QY9A 3EVNA 1BVRA 4QFCA 4YCAA 1P77A 3AUTA 1MG0A 1EEHA 1K6XA 2JAPA 4LK3A 3H9JA 4CM4B 4XGNA 3MJCA 4ZU3A 4B3JA 4R69A 4U6SA 1CF2O 4DQUA 4BO6A 3GNQA 1EE9A 4J16A 1GD1O 3RFXA 3DHYA 3QVOA 4ESOA 2Q50A 3LQFA 2ZYGA 5FEUA 2Q4BA 4PFJA 4Q3AA 5IN4A 4BO0A 4OSOA 4BNJA 1TT5B 1E6WA 2VTDA 4J0EA 1FDTA 2H9IA 2X6TA 1UXHA 2RHCA 4CQMB 1LSSA 2HQ1A 3AM4A 4KWHA 1XKQA 2E49A 3EZLA 4ZGWA 1ULUA 2CZCA 2WYUA 4F3YA 3LYLA 5B4TA 1NPYA 1Q0QA 1EBFA 2ZJ1A 5ITWA 4OXNA 5JS6A 1ZNQO 4BNMA 4DLAA 3E9NA 4CL3A 4PLZA 5IJZA 5LDGA 1NVTA 3W8EA 1B7GO 1TLTA 3RU7A 1ZMOA 3ZW9A 3OHSX 4FR5A 2UDPA 5JCXA 3CSDA 2X9NA 4OOFA 4BNZA 3R1IA 3KSUA 4M86A 2Q1TA 1GADO 4J9VA 4QT0A 1K89A 2QRJA 2AHRA 1QSGA 1VL0A 4C7KA 3FWNA 4R5MA 1D1TA 3WG9A 1AE1A 1I32A 3O9ZA 2VRBA 1X7HA 3ITKA 3PK0A 2QRKA 2EV9A 4EEXA 1U3WA 3ADOA 5A03A 1U8FO 2ZQZA 3GA0A 2FHSA 3UH1A 5IZ4A 5JY6A 3QRWA 4NJMA 1PJLA 2EWMA 3GVCA 4RL6A 3DEYX 2GZ1A 3U5TA 3GMDA 2P4HX 3UCXA 4J7UA 4UEKA 1CRWG 4CLXA 4D41A 2QW8A 4RORA 4D43A 2HU2A 2O23A 4JIGA 1SEPA 1U3VA 2C29D 4J43A 3UVEA 5CAEA 1WMAA 3VHRA 1BGVA 4WLOA 2VZ0A 3X2FA 3NT5A 3RUEA 1ONOA 2NQTA 3D3WA 4IDFA 4J4HA 5DOZA 5EN4A 3WGYA 3OBBA 1YVEI 5FYDA 3T7CA 1BMDA 4WCFB 4IS2A 5H81A 1BDBA 1FDSA 4TVOA 5G0UA 5A3VA 5KCZA 1OC2A 4CM9D 5CDTA 3JQ9A 5L40A 4A5OA 4I9UA 5MGBA 3GNTA 5B12A 1LC3A 2IXBA 3FHLA 1DAPA 4YAEA 3TFQA 5C7IO 1W4ZA 3WDSA 2B5WA 1SOWA 4CQMD 1HE2A 1ORRA 2BGKA 2DM6A 3FPLA 3JQGA 3RUHA 3KBOA 3SEFA 2HMSA 3T4XA 4BNGA 2NWQA 3D64A 2V65A 2WD7A 1U2GA 2DQ4A 1WAMA 1PQPA 3GUCA 3UW3A 4BGUA 3VPFA 1LLDA 2OFPA 4DYVA 4YT8A 1GYPA 4XIYA 4RLHA 4ZRNA 4KQXA 3V2HA 1ZK1A 2PV7A 1ENOA 2YW9A 3E9MA 4DVJA 1OBFO 3OP4A 1LU9A 4E5NA 3DHNA 3WXBA 4OM8A 4BO5A 3ZI0A 1ZSYA 3HDHA 1H9BA 3CH6A 4LRTB 1HYHA 3ZV5A 5A9SB 1U3TA 3W8FA 1A71A 1QORA 1T4BA 3U9LA 1E6EA 1KVUA 4BNYA 3GZ4A 1LA2A 2GGSA 1F17A 4RPJA 2V6FA 4L4RA 2IZ0A 4DLBA 4O1MA 3WYCA 1K3TA 1LSOA 3G1UA 1Y5RA 4EUHA 4OAQA 5G4KB 5TQVA 5ICSA 1VJ0A 1LXCA 4Y98A 5KTKA 1C0LA 2FR8A 1PJ4A 3GMSA 5KIAA 4H15A 1AUPA 2LDBA 5IDWA 2HSDA 3JSAA 4R54A 2W2LD 1IPEA 4WEOA 3W1VA 1CETA 1L7DA 1LRLA 3H65A 1K2WA 3V1YA 1KBZA 3U4DA 1W0CA 3I5MA 3EC7A 2VN8A 4RPGA 3KB6A 1TEHA 4FJ0A 2VCYA 4BL5A 2E82A 5CG1A 1JVSA 4R9SA 4QO7A 4GX0A 4IZHA 2ZB7A 3ZNPA 5CDYA 2ZCVA 2I5PO 4E32A 3F1KA 3LDHA 4RQUA 2C7VA 3ABIA 3V2UA 2IZZA 3V1UA 1X1EA 2Y0CA 3TDKA 4GQAA 2NNLD 4MINA 2VQ3A 2VYNA 4HWKA 4ZQFA 2G76A 4BGVA 4U5QA 1EVYA 4AJKA 1RPNA 3WR5A 4B4OA 4FIZA 4DBZA 4NFSA 2RHRA 4AJ4A 1Q7BA 4MPDA 3I3OA 4CLOB 4D3SA 3KSZO 5ER9A 1X0XA 2HMUA 2I3GA 4XR4A 4B4WA 2FN7A 3G17A 3MOGA 1IULA 1DC4A 2HJRA 1ZEMA 1R66A 4J0FA 4NBVA 1JA9A 1I2ZA 2BFPA 2QIOA 3A1NA 4BKOA 1LTHR 1BXGB 1P1IA 3D5QA 4ZQHA 1J5PA 1LDBA 4IDGA 3TRIA 4F6LA 4UAGA 6LDHA 1P3DA 1NVMB 5A1TA 4RF3A 1RJWA 4OOEA 1PL6A 1QYCA 1UJMA 4MIOA 2X0JA 2NTJA 4D45A 3QP9A 3VDRA 2NLOA 1XEAA 2GO1A 3BMQB 4JGBA 4JBIA 3SC6A 4AJHA 2AA3A 3WBBA 1PWXA 1BXKA 3GG2A 4JJIA 5IZCC 3QA9A 4ZN6A 2AQ8A 3PWZA 2Q3EA 3GT0A 1PQWA 3AU8A 4BNKA 2EP5A 2VRCA 1N9GA 3S1LA 1ISJA 3PHJA 1KY4A 1J0XO 3RU9A 2VRCD 1E6UA 1VKNA 1PL7A 4IS3A 3FNEA 1SZJG 2B35A 1E7WA 2PH3A 5T8KC 1N7HA 4KQWA 5T5QA 1NTOA 1JAXA 2GZ3A 3Q9UA 4Y9DA 5F5NA 1PJ3A 1Y9EA 4W9NC 2BFAA 4I5DA 2PKQO 4BHTA 4DQVA 3JQAB 3SVTA 4LCJA 3M2PA 1T2FA 1B3RA 1L1FA 1T25A 1C1DB 4UULA 3WGGA 4D46A 4CUKA 2GN9A 1HDXA 3FNGA 3VH3A 4GMGA 4MP6A 4PLPA 1N92A 4NU5A 2HK8A 3KLPX 1U1IA 2CFCA 1CQIA 1KVSA 4FFLA 3CZRA 1BSVA 4J1NA 4FBGA 3GOHA 3L9WA 3S55A 3F47A 3IQDB 5ILGA 4S1VA 5I7EA 3OQ6A 3OIFA 1KEWA 2DPHA 4CMAA 5DF1A 2EHDA 3NJ8A 5KVCA 1A9YA 3JQGB 3OFSA 1NP3A 3EUWA 1WP4A 4EYEA 4BMVA 5EJ2A 1N7GA 2YQ4A 3CZMA 1MXFA 3AK4A 1NPTO 2BMAA 2X5KO 1QXSA 2VOEA 3AFNA 3PYMA 4LN1A 4Z0TA 5ENDA 1DRWA 4W99A 3OJ0A 2J3JA 3WGQA 3VZPA 1A4IA 1E3IA 4GI2A 1RWBA 4ND1A 2P2SA 3PWSA 2VYND 4AJPA 2VYVD 4FQ8A 1YO6A 3OM9A 1V3TA 4CM4A 3SBOA 1QMGA 2GUGA 1H6CA 2P91A 3U4HA 5U9CA 4J90A 5THQA 2CMDA 3VAZA 3KM0A 1E7SA 4CODB 1EBUA 1HYEA 5A3JA 3ZHZA 4ZD6A 4BO1A 1T2CA 1I3NA 2P68A 1I2BA 3ANMA 4IUYA 5JDCC 3WTBA 2XXJA 1LDYA 5DBIA 3FNFA 3ZH2A 1KERA 3MJTA 4B3HA 1Z73A 4D42A 3H2SA 4DUPA 4E12A 2UV8A 8LDHA 2IEDA 4TMFA 4L73A 5T57A 1A27A 1SB9A 1UH5A 1WZEA 2DUWA 4AJJA 5CG2A 5I7FA 1M6WA 3PDUA 2HMWA 4CMCA 2PZJA 5TRTA 4M54A 2PFGA 4MVJE 1IYZA 3V5NA 1VE9A 4OO3A 1GEGA 1YB1A 3B1JA 4Y8VA 3JQ8A 3K9QO 4RV9A 1ISGA 2B4RO 1PJ2A 4R41A 5EMHA 4E2ZA 3GGOA 5G0WA 4L8VA 4OXKA 4QO8A 1VSUA 3OH8A 4WUVA 4B7XA 1VLLA 4E5MA 1AN9A 1GDHA 5ITVA 2I67A 5U1PA 3W4JA 3IJRA 1ZJZA 2WWRA 1KIFA 4TZTA 5I9NA 4XRGA 2AE2A 5F1KA 5EQDA 1ZSNA 5JAMA 4LISA 3I9OA 4TRMA 1DDOA 3JQ6A 4QFDA 1RKXA 2ZB8A 4FFPA 1BWSA 3GVIA 1O0SA 2DFDA 4PG5A 1BDMA 2HMVA 4PLCA 1GFSA 1SMKA 2XPCA 2YFQA 1HWYA 3DOJA 1I8TA 1MFPA 4O6VA 3GNSA 4KUGA 3PHHA 5DOVA 1E7MA 1ZJYA 3MJ4A 5AVOA 1Q1NA 1BG6A 3C24A 3QVTA 4PLTA 4WLUA 3UFXA 3EZYA 4UVEA 4DREA 3TF5A 1PX0A 3LC2O 1R12A 1EK6A 4CUJA 3O26A 2JJYA 1JWAB 2E4AA 1R37A 1A9ZA 3RFVA 4B79A 5JO9A 1IB6A 1Y9AA 3R0IA 2YYYA 2BLLA 3IAHA 3ZWXA 2C82A 1GUFA 2XAAA 1KEPA 4GX1A 3A14A 3I4CA 4H7PA 3PEFA 4MVJG 5JAIA 5T64A 1BHSA 2HJSA 4J1SA 4RVFA 3RCBA 4CLRB 1GEEA 3AY3A 1LNQA 4UUNA 1X7DA 2O3SA 2Z5LA 3BA1A 1MB4A 1X7GA 3KYCA 1XSEA 2G17A 4Z9FA 2BD0A 2H63A 3ULKA 5K6AC 1YXMA 4TKLA 2O2YA 1LLCA 2VUTA 3KXDA 1P0CA 4E5PA 1PJSA 5KKAA 3S2FA 1V35A 1FJHA 3GY0A 1G1AA 1J49A 3OICA 5L4NA 2ET6A 3GN1A 3VH2A 1WDKA 3GEMA 3SXPA 1IUKA 2NVBA 2OP1A 5H83A 3VPSA 2FPGA 3CMCO 1PGPA 5TJ9A 4UEJA 1MC5A 4XRRA 2OHXA 4BGEA 3TZKA 1W73A 3HB4X 4FCCA 1UP6A 4Q3BA 5BNFA 2Y1GA 1NR7A 2B4QA 1S7CA 3KSDO 4DYDA 2NU9A 4YQZA 5DCUA 1VM6A 1HEUA 1I3LA 5LC1A 5A05A 1UZMA 5CDSA 3LF1A 1OZAA 3FR8A 2PGDA 3IKTA 4L4SA 1ISMA 1T2DA 5ER6A 1U4OA 3ZN2A 3T4EA 4E13A 3KEOA 1V6AA 2X0NA 2X9GA 3RJ9A 4JROA 4K6CA 1GV1A 5TS3A 1HDRA 2V6GA 3JV7A 3QE3A 1SPXA 4BVAA 1JN0A 3IOYA 2ZB3A 1GUYA 1UDBA 5ENVA 2W98A 4XQEA 4GGOA 2J3IA 3OJFA 4HADA 2Y68A 1ZW1A 2ZTVA 2POQX 2O3QA 4P4GA 5C37A 4BMNA 1QV6A 4R68A 3VC7A 1XCBA 3H5NA 4ALNA 1GPDG 1ZH8A 1ZCJA 4YJFA 2RAFA 4AL4A 2J6IA 3D5TA 5IDQA 3JQ9C 3AUUA 5DCWA 4ND2A 4XQ9A 2V6BA 2YV2A 1ISFA 3DBHB 1BXGA 4JNKA 1N1GA 1HDOA 3ICCA 3BMNA 3WQQA 4DGSA 4FSHA 1YDWA 3M1LA 1PS0A 1PZFA 4NDNE 1DBVO 4CLEA 5A02A 2EGHA 4B7UA 1K6JA 4AJOA 2WYVA 3MEQA 4EW6A 4XB2A 4HFJA 3HQ4O 4NBRA 4N54A 1IHYA 1SCUA 1Y8QA 8ADHA 1EUCA 2VHZA 3FNHA 4RF4A 3CMMA 3CEAA 3F46A 3LF2A 1BW9B 3CKYA 3V1TC 1JDJA 2JKVA 2UVDA 3GDOA 1I01A 1LQUA 3DONA 1E77A 3HN7A 4MVJH 2UUOA 4WE3A 4HBGA 4Q3CA 3MZ0A 4O0LA 5HS6A 2Q46A 5T67A 1R0KA 1V3VA 3HB5X 2YHIB 1HE4A 3TZQA 3K2EA 4O5OA 4Q39A 3UOGA 1LBEA 4GBJA 3LC7O 1PJCA 4R16A 3DBLA 3L4BA 1AGNA 2E48A 3GAFA 3PHGA 2EF1A 4BO2A 1PEDA 3ON5A 4R3WA 1DC5A 2B0JA 4UREA 1PZGA 4IDDA 1WMBA 3ZWOA 3IC5A 4PZDA 4RPHA 2D3TA 2ZIZA 3QVXA 3V2GA 1M66A 4I9NA 3RC9A 3SLGA 3JQ7B 4CQLB 5CDUA 3DBRA 1GQQA 1MLDA 3PVZA 3PHIA 2LDXA 4XCVA 3GK3A 2WEKA 3ROQA 5FI3A 3RROA 3UN1A 1VRWA 3I9NA 4TZKA 4XQGA 3H3JA 1N2SA 2X0RA 5JMPA 1RM4A 2C2YA 1E92A 3ZWVA 3GQVA 5IF3A 3ONEA 4MKXA 2PD3A 3DFZA 3VH1A 4GWGA 1JAYA 3PWKA 4E3ZA 3PYXA 5JW6A 4CL8A 5HM8A 1B8PA 2P9CA 2D5CA 5AOVA 3G1TA 3DZIA 1R15A 2Y1FA 1I36A 5F5LA 5EIOA 1F8FA 1UR5A 2O48X 4GSLA 5JDIA 1PS9A 3GH3A 4F46A 1BRMA 3UHAA 5DP1A 1ZXLA 3X2EA 3H3FA 2FMUA 3AOEC 2RH8A 1NQAO 4J7CA 5L3ZA 5B4VA 4ND5A 5FWNA 4GAEA 5FFFA 4ILKA 1E3JA 1T2EA 4XX0A 3GF4A 3ROMA 1DIAA 4I5FA 1P9LA 2PTGA 5KKCA 2E6UX 3WTCA 5KVSA 4RF5A 4CLOA 1YJQA 1XLTA 1P33A 5FI5A 2VZ9A 1HXHA 3RI3A 1U5AA 4II3A 2CDAA 9LDTA 1NHWA 2I6TA 4QQRA 2UUPA 1NASA 2X0IA 3DWFA 4PRLA 3JYLA 3GVHA 3RUAA 5THKA 1PZEA 1HL3A 2D0IA 2EGGA 1Y8RB 1JTVA 3AU9A 3PXXA 4OXYA 4UVGA 4ALMA 1DFGA 1NBOA 3S2GA 4TROA 4BNTA 2CVQA 4U8GA 1MFZA 3AFMA 4FJ1A 1NWHA 2GN4A 3PFFA 4YA6A 2ZTUA 5JO0A 4PG6A 1SB8A 4BKQA 2Z1NA 1QP8A 3LLVA 5B37A 3M6IA 4P38A 4BNVA 4EDFA 1E0DA 2ZYAA 2WD8A 1PR9A 1B14A 2WSBA 3QWAA 2R6JA 4AFNA 5L7YA 4OQYA 3WS7A 5KOIA 1DXYA 5BSEA 2PNFA 2BH9A 4OGWA 3TNLA 3PZBA 4IJWA 5T6BA 3DZGA 2G0TA 1MXHA 2X4GA 4CM3A 2EJVA 4D79A 3R3JA 1VSVA 1YL7A 1KC3A 4XYGA 3WGZA 3ZGYA 4R1TA 3VKUA 5G4LA 1DRUA 3U49A 4HFRA 5DN9A 3RUFA 2HK7A 5GY7A 4PLVA 3E8XA 2YQ5A 2AQHA 2Q49A 3C7AA 2ZYDA 1G0NA 4CM8A 5L53A 2ILTA 4XA8A 4LW8A 3GC6A 4GX2A 1VL8A 3BTSA 2AW5A 3OJLA 3PQEA 4WLNA 4PG7A 3VTFA 2DBQA 3K96A 1HTBA 2OXIA 3S8MA 3WBFA 4BO9A 4K1LA 2VWHA 5L7WA 2PGJA 4NMHA 4DC0A 5I8ZA 4NBWA 1R4NA 4HY3A 1KOLA 3D7LA 1UZLA 2WM3A 1I10A 4L74A 3QHAA 2PZMA 1T2AA 1JW9B 1TA4A 4JJGA 3TQHA 2A94A 3QWHA 1EFLA 4E2WA 2HDHA 3ETDA 2B37A 4AJNA 3IUSA 2NU8A 4L0QA 4BV9A 3RC1A 3JD1A 2ZQYA 3AUSA 4H16A 3F1LA 1RM0A 3E82A 1O9BA 4ID9A 2JD0A 2XOXA 3UICA 1QYVA 4GVLA 1HETA 4EJ0A 2EIHA 5BSGA 1GR0A 4RCVA 4YDRA 3WLEA 2X5OA 5JFOA 3I9KA 3WOHA 3WWYA 4CLDA 1L7EA 3NTOA 2GYYA 3LT0A 3IDSA 1LSUA 2WE8A 1EVJA 3C8MA 4NQZA 2CDCA 1TB4A 4D44A 4FJ2A 4MJLA 3D0OA 3DZHA 2EJWA 4PLGA 1EUZA 3DZKA 3UCFA 4K26A 1R16A 1YDEA 1ID1A 3CUKA 1YOVA 2GD1O 2OBNA 4TRJA 4J4BA 4E5YA 4WEQA 3NJ4A 3B1KA 4QECA 1N8KA 3C85A 4G65A 3MJEA 1FXSA 3HFSA 1NAIA 3WMXA 1PGOA 2H5LA 5DBFA 4WCFC 5C7LO 2NU6A 2B69A 3AOEA 4CR7A 4J2OA 3E1KA 3GVXA 1LC0A 3OEYA 4FPXA 3B20A 1XR3A 4YAKA 4IJVA 4HP8A 2NTNA 1E3WB 4EEZA 5K6AA 4FN4A 4BO8A 2VUSA 1SO8A 1JKFA 3INGA 4MIEA 4ZJUA 2WDZA 1GCUA 4XGIA 4F6CA 4J9UE 3U62A 4YBZA 5FF9A 5GMOA 3A06A 2GNAA 3MCVA 2I66A 4XDZA 1OFGA 1HDYA 4M8SA 2OOSA 3ADPA 4IQ0A 4OL9A 4CMEA 2AE1A 3OQ1A 3DQPA 3JQDA 3O03A 4JK3A 3AW9A 4LGVA 3FSRA 3SC4A 4IIVA 2HMTA 1CIVA 3PQFA 1NQOA 3KETA 3LVFO 2JD1A 3ETGA 3BIOA 3TSCA 1DLIA 3NTRA 1X13A 2NV6A 3H9UA 1LRKA 1NNUA 3PTZA 4L76A 1FDUA 2AXQA 3FD8A 3GZNB 3I4FA 3Q3CA 1G6KA 2O50A 3C1TA 3ENKA 3HHPA 4BIIA 1YJ8A 1XU7A 1I33A 4NBTA 1IPFA 3O4RA 4CM9A 1VC2A 3GVPA 4WOJA 4BB5A 2Q2VA 4IGEA 2PKQP 3MWEB 3KYDB 1ZEJA 4A10A 4IDBA 2PWZA 2PLAA 5COAA 3GDFA 2FP4A 1RM3A 1QV7A 3OETA 1VKOA 1D3AA 4XWYA 4YYZA 3ZWBA 3TL2A 3DBLB 3NT4A 2JHFA 4IPTA 1PGNA 4U0JA 3K31A 1HE3A 3DXFA 4HKTA 5HBRA 2IEBA 2EP7A 5IN5A 1JKIA 1CYDA 4YB8A 4PCVA 3WNVA 3COSA 3BHJA 2EEZA 3KV3O 1ZKMA 3B1FA 5L4SA 1ISHA 2X86A 2W90A 3I6QA 3ZU2A 4CV2A 3H9QA 3CXRA 1I3KA 3HUDA 1TI7A 5J23A 4A2CA 3C1OA 3A28A 2P5YA 1WXDA 1ISIA 2Y67A 2PR2A 4TVBA 4CV1A 3RKRA 1F8GA 4EUEA 4RPLA 3M1AA 1EK5A 1F12A 3RUIA 2W2LA 4HXYA 3HE3A 1HDZA 4BKUA 1H93A 4EGFA 3K92A 5JY1A 5JNLA 3OEWA 4JLWA 3DTTA 4KDEA 1MV8A 1U5CA 4GMFA 3PIDA 1C1XA 4GWKA 4Q3DA 1LRJA 1R0SA 2DUUA 4CMIB 1DPGA 1DIBA 4JP2A 3VTZA 2NU7A 4ZRMA 3ZNOA 4MVJI 5DP2A 4DXHA 3JD4A 1YWGO 4NHEA 3RD5A 1P45A 3PQDA 4NBUA 3FN4A 4RQTA 3GR6A 5TLSA 4LVUA 3SJ7A 1KVRA 1DLJA 2Y1EA 3GAZA 3ANLA 4DPKA 3PPIA 4FOSA 3DAFA 3ZHYA 4HFMA 1ADGA 3Q1LA 1UDAA 2GSDA 4B3IA 4YPOA 2ZKLA 1PS8A 3IUPA 3PRJA 1PQUA 3FCOA 4M1QA 4A7PA 4BUCA 2CNBA 1VJ1A 4XYBA 1NHGA 3WQRA 2PKRA 3JQFC 3WNQA 4CQMA 2DBVO 4XR9A 4IGFA 4D0SA 1M76A 3ZNNA 2FWMX 5JXWA 4NFYA 4UVDA 4B7CA 2JD2A 4YT4A 4N7RA 1QG6A 4A73A 3AWDA 2V6MA 3BMOA 3FR7A 4PLYA 4TRNA 4NNJA 5KJEA 3RFTA 4N5NA 1YONA 3WQSB 3BHMA 1GZ4A 3GHYA 3IP1A 2NADA 4ZA2A 3HSKA 2IRWA 2JAHA 4UVHA 3KEQA 1E5LA 3FRJA 5F21A 1ZO8A 3TN7A 2O7SA 9LDBA 4GH5A 1I0ZA 5IZCA 4YTEA 3P19A 2PZKA 2Q1SA 3BHIA 3H9GA 2XXBA 4I8XA 4RF2A 1HLPA 1E3LA 2O3JA 3QJ5A 4O59O 2A35A 2I9PA 4NK4A 4MVJM 4Z9YA 2EERA 4L9RA 4Y6PA 5DBGA 1Y81A 3UKOA 4AJEA 1D4FA 4PLWA 2ZTMA 4FC7A 4CMGA 2OUIA 1XIVA 4JXKA 3U4IA 5EINA 3ZWWA 4DRYA 1M67A 2VOJA 1ENPA 4CUZA 3SLKA 4HV4A 2P9EA 4WOKA 5GZ3A 2VUUA 4U6QA 2VNSA 4KOAA 4P8RA 4R51A 3L77A 1GQYA 2AMFA 4BO3A 3NDJA 3PHLA 1KEUA 1ULSA 4XQCA 4AG3A 2DBRA 2VT3A 3DFUA 1XELA 3I6IA 3ZZNA 4PRKA 2A4KA 1F14A 1ADCA 4Q3NA 4QSMA 1MX3A 4J2HA 3WMWA 3JYOA 4CLHA 1TT5A 4NG5A 1CWUA 1ZZEA 1XG5A 4RVHA 3KTDA 1CERA 1LDGA 1NFFA 3ENNA 3K2BA 4IDCA 1O6ZA 3NDRA 1PJQA 2D2IA 3QVWA 4MP8A 3H9EO 4EI2A 4W7IA 3SJUA 4D3FA 2ZTLA 5JPIA 3ONFA 4WNIA 2X5JO 4OKNA 5F1OA 4EUFA 2FSSA 3QV1A 1EMDA 1JQBA 3PGJA 4PG4A 4TSKA 3OMLA 4FFNA 3TL3A 1Y7TA 1NAHA 1UXIA 2J3KA 2FSVA 5AYVA 2NUAA 1A4UA 1NPDA 2WJPA 4E2XA 1P1RA 2FY8A 3BTOA 4FW8A 1B16A 4R5HA 4R1UA 4EJ6A 3QW2A 4YWJA 2NACA 2BI8A 3Q11A 4OSPA 2QZZA 1SAYA 1C1XB 4RLSA 4GKBA 1T4DA 5JCJA 3EW7A 5IAAA 4DIFA 5IXSA 5L51A 1JVBA 3N58A 5IDXA 1FMCA 5JE8A 5K0ZA 1P0FA 4N5LA 2CF5A 2QQ5A 1LDMA 1NVGA 1SNYA 1E3EA 2YDYA 3WYBA 1ADBA 1XWFA 4OJNA 4FS3A 3E9QA 3G79A 1KS9A 2W2KA 1PTJA 1U28A 2CY0A 4DTIA 3E5RA 1CEQA 3VOSA 4GL4A 3DZFA 2PZLA 4YJGB 5JAZA 4XB1A 5A9TA 2Z95A 4J1QA 4B4VA 2VTEA 4R1NA 1ZK4A 1CJCA 1ZK2A 3AI3A 3JTMA 3INRA 3NRCA 4TRRA 5C5IA 4PLHA 3L6DA 4DPLA 3HNPA 4RDHA 3GZNA 3WWZA 3DC2A 2QRLA 3PJDA 1C0IA 3C7DB 4WJZA 4AICA 2C59A 4H3VA 4ZICA 4Z6KA 3RJ5A 1GZ3A 3C7CB 3RBZA 4E0BA 3GRPA 5CDGA 2G82A 1WWKA 3KYDA 2OBYA 2VZ8A 1IHXA 4ND3A 2UYYA 2RIRA 3H7AA 3ZHBA 1D7OA 4OKIA 1H2BA 1PGJA 2GDZA 3DMYA 4K28A 2W8ZA 2PY6A 3QWFA 2Y1CA 3JQAD 2J8ZA 1E5QA 3E48A 4I1IA 3RSHA 5T8KA 5AQ1A 2P4QA 4M89A 1LLQA 3QWBA 5CFZA 4IY1A 2AG5A 2OZPA 3GFBA 3PYLA 2QYTA 1DRVA 3NEPX 1SC6A 2JL1A 5CEFA 2JFFA 4ND4A 5L7TA 3JD0A 3MWDB 4E5KA 3TJRA 3VPXA 2ZATA 3EAGA 2DBZA 4OYRA 4YVFA 1HSZA 2D8AA 4CM7A 5U4QA 4G5HA 4AJ1A 4OQZA 3KOUA 3AI1A 2B4TO 4URFA 1UAGA 3LT2A 3CE6A 4S3MA 4W82A 5JC8A 3LZ6A 4BGIA 5ILOA 4MVJF 1UUFA 1IE3A 3MOIA 5GZ1A 1EVIA 1NQTA 1DC6A 2X9VA 1ZIDA 4Z0HO 2Y93A 1IOLA 1GPJA 4PVDA 4FB5A 3EGOA 3C3XA 4PZEA 2X23A 1T1RA 4DMMA 5G0TA 4DL9A 2G1UA 3RC2A 4XYLA 2QZ9A 2O3TA 4BNHA 1VJTA 1GV0A 5AXCA 4WNCA 3PFWO 3QIVA 1H6AA 1EDZA 2VYVA 3GEDA 5TF4A 3VPGA 4HNGA 2BRUA 4NH4A 1C1DA 3RWBA 2FZEA 3LU1A 4J1TA 4G81A 1CQJA 3E5MA 2YFHA 2OO5A 2OORA 2AEJA 4R1SA 3W6ZA 1V3UA 4XD2A 4A03A 1Y5MA 4R4JA 2JHGA 3EVTA 4IQ8A 3FPCA 3ZCXA 3H6KA 2Z1MA 3UF0A 2BGLA 3E03A 2PD6A 5A5EA 1H9AA 2YHUA 4DIBA 1U8XX 3LT1A 3K8ZA 3BXXA 1R4MB 1YRLA 3EMKA 3STHA 1PJTA 1MGOA 3O8QA 2FRDA 1Q0LA 2A92A 2Q4EA 4MO2A 1KVTA 4ALKA 1U2DA 2C54A 1Z6ZA 3ZDFA 4E21A 3P2YA 5A06A 4XZ3A 3WX0A 2RCYA 4CR8A 4DBVO 5ES3A 1TT7A 5DNAA 2DT5A 4P4NA 3EY4A 4B8WA 3QLJA 2FPPA 3R6DA 2X1HA 3VZSA 1SBYA 2FR0A 4TKMA 4BMSA 4OIMA 1A7AA 4E30A 3BTVA 1NYTA 1K5HA 3INTA 2H6EA 1U9JA 4XDYA 3WGHA 4GGPA 4Y6RA 4JJFA 4HNHA 5KNLA 1NR1A 1Q0HA 3UGKA 3GN2A 2C7GA 3R3SA 4I08A 3GLQA 4DC1A 1HDCA 1YS4A 2IYPA 2P9GA 4XJTA 1PIWA 1XYGA 2CVZA 3GGPA 1EQ2A 3BMQA 1ML3A 3UCEA 1IZ0A 4TWRA 4JBHA 2O7QA 5KJFA 2HLPA 1JWBB 1O8CA 3IJPA 3KUXA 4BNNA 3DMTA 3F3SA 1DO8A 2CD9A 1KVQA 2TMGA 2I76A 4QX6A 3W8DA 2OMEA 1AHHA 2VHWA 2O4CA 3BAZA 1NM5A 3GDGA 4XIJA 4R01A 1B2LA 1WZIA 1YL6A 3EK2A 3GEGA 3ST7A 1Y8QB 5TJHA 2BHLA 3F4BA 2QX7A 4CM1A 4J4TA 1QKIA 2J3HA 3JQAA 4ZHSA 1EQUA 1ZXBA 1MG5A 1GYRA 5CHEA 3NYWA 1WDLA 1XA0A 1V9LA 1EZ4A 3RBVA 2JCVA 5BQFA 2B36A 3PIIA 5TSDA 4IZIA 4MKRA 4Z3KA 2EKQA 2E37A 4RZHA 4BNXA 1E7YA 1YB4A 1YGYA 1ZSVA 2D4AA 3F5QA 4PZCA 1MC4A 2HRBA 3MJVA 1FK8A 1UAYA 3U0BA 1OAAA 4KMSA 1ENZA 2Y99A 1DOHA 3QWIA 3M2TA 1J4AA 1WDMA 4CMIA 4RZIA 3DAPA 3TZ6A 4TQGA 4A26A 1XHLA 3TZCA 3EYWA 3TWOA 2Y66A 4C7JA 3I52A 3Q6IA 3O38A 3S2IA 3CINA 2GZ2A 2DC1A 3A4VA 3WGTA 5F3RA 4EBFA 1DC3A 2O3RA 3HDJA 1OI7A 2BFOA 3L07A 1Q7GA 4IDEA 2H1SA 1GY8A 7ADHA 1LSJA 4MDHA 4U7WA 2Y1DA 3GUYA 2TMDA 2FZWA 4KTVE 1I2CA 3WB9A 4DMLA 5L4LA 3ZWCA 3OIGA 3BMCB 3EDMA 3WIDA 2OL4A 4MVJA 4WKGA 4YT2A 5LDHA 2PH5A 2YJZA 3KRTA 3H8VA 1LJ8A 1VI2A 2Y0DA 5KWEA 3ZU3A 4YXFA 3N74A 1H2HA 2NTVA 1YH3A 4FDAA 3ZW8A 4EZBA 1E1KA 3WFJA 4HUJA 4INAA 2WYWA 5CEEA 5TT1A 3JQEA 4MIYA 1B15A 3VDQA 3BMOB 3Q0EA 3UAGA 2DVMA 5JYDA 1O89A 2OP0A 3D4OA 4L75A 5HRUA 4RVGA 4BS9A 1DSSG 1QRRA 4ALIA 1ENYA 5ADHA 1N1EA 1E1NA 2HAEA 2GN8A 3OSUA 4I5EA 4JX8A 1VL6A 1S6YA 2YZ7A 3GFGA 3H5AA 5TC4A 3OECA 5BNTA 1RYEA 1P1FA 3FBTA 5IXYA 2ZB4A 1E1MA 5CP8A 1ZBQA 2EKLA 4YJFB 1HYGA 1IY8A 2P5UA 1DAOA 2NVUB 3T7EA 2GRAA 1EDOA 1MUUA 4YAIA 1QR6A 3K73O 3JYNA 3NKLA 2EKPA 2Q2WA 5IFLA 4ALJA 3JQBA 1T24A 1UDCA 1GCOA 1UXGA 3BMNB 3IP3A 3ETEA 1YKFA 3FI9A 4YAGA 5JDIC 6ADHA 3IS3A 3VH4A 3D4PA 3WICA 1DHTA 4QEDA 5AXBA 1P1KA 3DB2A 1OOEA 1T26A 5TNXA 4II2A 1U3UA 4ZQGA 4Q9NA 4CR6A 4YRBA 3DBHA 1XQ6A 1E1LA 5BNIA 1HRDA 1PL8A 4R9RA 4C4OA 3RC7A 3RUCA 3FBGA 4KUEA 2FPIA 5GZ6A 1PR3A 4IJKA 4UVIA 3SX2A 1AXEA 1BVUA 5COBA 2DTDA 4E33A 1PU2A 1KETA 4MVJP 5IG2A 1SEVA 2CUKA 5MDHA 4KZPA 2R2GA 2B83A 4X54A 3RBXA 2ZK7A 1P31A 4AJ2A 1R0LA 3G49A 5EERA 5I7VA 1Z45A 4UUOA 3KYCB 4BNFA 3HDQA 4WLFA 1X14A 3U3XA 4NR0A 3HZZA 4DWVA 1IL0A 5IDYA 5DDIP 3Q9NA 4JCOA 4ONEA 1B3BA 1DIRA 2EG9A 4YRAA 1LQTA 3JQ7A 3PLNA 3DBRB 2D5AA 1UXJA 2VHXA 3FTNA 3HWRA 4JQCA 5A9SA 2X58A 4FFRA 1C14A 4Z0PA 5H82A 4NK5A 1U7TA 3DZJA 5A9RA 4YQYA 4NPCA 3A9WA 4D7AA 5L45A 1H94A 4Y6SA 4DIOA 3U4CA 1E7QA 5EPOA 3ZV6A 2BF7A 1D8AA 4BV8A 4FOOA 4LVCA 5KJCA 3KO8A 3VZQA 1LLUA 2JCYA 3ZWMA 4YJHA 4CQLA 1BTOA 1ZFNA 2DAPA 3QVSA 4UEOA 1O5IA 4JBGA 2Q1UA 1Y6JA 1A7KA 1V0JA 1JLLA 4LRSB 3WIEA 3I9JA 3UXYA 2GF2A 3KHUA 4RPKA 3AM5A 4DPMA 3AJRA 3I83A 2C5AA 5I8WA 1XDWA 2BGMA 1Z82A 3DO5A 4YACA 1RM5A 4AJIA 1FDWA 3ZNQA 1B0AA 1Z7EA 3JQFA 4BKPA 4KP7A 5JAQA 5COQA 3JQ8B 3Q2KA 2X7HA 3F6YA 3VKVA 1HZJA 1R4MA 5BT9A 1H5QA 1PSDA 2PD4A 3LT4A 2C5EA 4PG8A 1Y1PA 3ASUA 3EHEA 3TOXA 1FF9A 3DBVO 2HRZA 3VVCA 2B5VA 2QHXA 3JYQA 2AEFA 3PJGA 2EW2A 1NWCA 4CMEC 4AVYA 3WLFA 1M2WA 4N5MA 4KTTE 2IDZA 3PP8A 3NTQA 5BSFA 2BI7A 1WW8A 3DOOA 4GLLA 2EW8A 4ZQBA 1YQXA 3IMFA 4KDFA 4B8ZA 4EITA 1Z74A 2F00A 3WJAA 2PGLA 4CM6A 5B4UA 5I7SA 4CV3A 4MP3A 1H0KA 2GN6A 3GRKA 2IODA 3FWZA 1Q2XA 1P1HA 1U4SA 3RUDA 2RH4A 2HKIA 4HFNA 3KVOA 2EXXA 3DDNA 4WLVA 4Z9XA 4J6FA 3AY6A 4PGFA 3GGGA 1W6UA 3DR3A 1B26A 1AHIA 2YHIA 2NVUA 4M49A 1NQ5A 4RVUA 1GZ6A 5L9AA 4K6FA 1R6DA 4A27A 3KYBA 3G0OA 1TXGA 3CPSA 4GLOA 3DZBA 3WGOA 4CJXA 3I23A 3NUGA 1LI4A 5A04A 1KEVA 2IE0A 4RVSA 5LCXA 3D3EA 3E6AA 3PI7A 2WMDA 2VWQA 4JP3A 3ZU4A 3L0DA 4B4UA 4P22A 1B8VA 3PGXA 4FFMA 4O63O 3NGLA 3AUAA 3L9XA 2A9FA 2J5KA 2BFMA 3P2OA 1YQDA 1GTMA 1ZK3A 3N7UA 2JFHA 3OJEA 4XYMA 2R00C 4BNIA 4WCDA 3AOGA 1J6UA 2AEMA 3DOCA 3HADA 1I24A 4YT5A 1P1JA 4QUKA 1A72A 1ONPA 2CF6A 4WCFA 1H6DA 1DB3A 2YY7A 1LDEA 1F0YA 1FDVA 2IYOA 2VWPA 4GSKA 4J3FA 4M87A 3DL2A 2GLXA 5L95A 4PVCA 3P7MA 4WECA 4Y67A 4CMJA 2F1KA 2QG4A 3F4LA 1PGQA 4YAJA 4FFOA 1HF3A 4GKVA 4CM5A 4FD3A 4P4LA 3DHEA 3WGIA 4E6PA 2DTXA 3LSYA 3O8QB 4BQPA 4IDAA 4PLFA 1DJQA 5KVVA 1R4NB 3ROPA 3F5SA 2AQIA 2Q45A 4MVJD 1I30A 1ZK0A 3HN2A 2PA3A 4MKZA 3ZWNA 3VVBA 5KJ6A 3K6JA 4D3DA 4RO0A 3OJOA 4W9NA 1HT0A 3L4SO 4BNLA 1EUDA 1ADFA 2D59A 3JCZA 3HJAA 1O95A 4LCEA 4BNUA 3NV9A 4OHUA 3TOZA 2Q2QA 1P44A 1UP4A 3GHHA 3PLRA 1ZUD1 3AM3A 2W4QA 3RIHA 1EVZA 2GR9A 4FGSA 1E3SA 1HKUA 4LMPA 1QYWA 4CMBA 4CMHA 2BKAA 1KC1A 2X8LA 5C3MA 5EESA 4NIMA 1QYDA 4IXWA 3S2EA 3TZHA 1P74A 1YE3A 3K5PA 3ZWYA 3I1JA 1UZNA 4LSWA 1LEHA 3W4IA 1HSOA 3D1LA 5TT0A 4KWIA 4RGBA 2NVWA 1DFIA 1C0PA 5HWSA 1E7RA 3RQSA 1W8DA 1LX6A 4FGWA 4I9HA 4LSMA 4BO4A 4IM7A 1X15A 4R3NA 3OQBA 1YB5A 3ICPA 1G0OA 2V7PA 2XF8A 3ROKA 2AG8A 1T1SA 3MTGA 5DT9A 1LUAA 3V8BA 1C3VA 1PZHA 1N5DA 2GCGA 2J5QA 5JDCA 1BW9A 3W6UA 1XGKA 4NJMB 3H2ZA 5EQFA 1JU9A 4WPGA 1B8UA 3PDJA 4NFHA 4RJTA 3MJSA 4LMRA 4W4TA 4EJMA 3AI2A 3Q2IA 4NI5A 1HE5A 2VWGA 4ITUA 5CPFA 4IINA 1E3WA 2GASA 1MA0A 3ANNA 3F9IA 4UUPA 1BXZA 3JYPA 2FOIA 1GUZA 3WSWA 1ONNA 4OMUA 3ORFA 4Q3EA 3TPCA 5JC1A 3I9LA 1NX6A 4BQRA 4CM8B 1PWZA 2Y1OA 4CV0A 1HLDA 1HDGO 3GPIA 4BO7A 3H4VA 4XJSA 1M6HA 1UXKA 5BR7A 1DJNA 1RYDA 4K9DA 4E2YA 2C07A 1GU7A 3JD2A 1F06A 3D3WB 2NM0A 2Q1WA 3OIDA 5EL0A 3ONDA 1QYXA 3OA0A 4WGGA 1GL3A 2FR1A 2YV3A 1UP7A 5B1YA 5DZSA 2YDXA 2C20A 3RAJA 2NQ8A 3RVDA 3TFOA 4W7HA 4D0RA 3DAGA 3FF4A 4DA9A 3C1AA 2IZ1A 2G5CA 5A5FA 3B70A 4NU6A 3WSVA 3ZHXA 3OA2A 3HFGA 4XYEA 4YEDA 4BKRA 1XQ1A 1CDOA 1ZMTA 2DTEA 5DULA 2WD7B 3VPHA 3BMCA 1GQ2A 3NDIA 1GYQA 3NAQA 2Y05A 1A5ZA 1MP0A 5HS4A 2ZJ0A 4Z3DA 3OF2A 3I9MA 3IL2A 2WTBA 3L6EA 5A4DA 3ASVA 2Y0EA 1OMOA 3RASA 1QLJA 5G4KA 1EE2A 4UUMA 2HK9A 2I65A 4IMPA 2DPGA 1WVGA 3ZWAA
chains in the Genus database with same CATH superfamily
1OC4A 1JH8A 1XLTC 1I3MA 2FEKA 2NTYC 2V7UA 2WV9A 2XCQA 1T5SA 3F6EX 5E1DA 5E2AA 5JSFA 1X0VA 1ISSA 4GX5A 4QYSA 1HH4A 4LZPA 5JCJD 4O1HA 4UU8A 2WTEA 4EHFA 1HG1A 1W5EA 3JAMA 2Q1XA 2BBOA 1NF2A 2VVTA 1GZ7A 2QSYA 3JD3A 5HZMA 1IZ9A 1U65A 2QORA 4MWOA 4UCFA 3IPCA 1HZZC 1BX3A 2F3SA 2HO5A 3CGGA 4NTZA 3BTUA 4YJHB 1C8VB 2VEDA 1YBMA 2BN4A 1TYBE 2JGFA 4TTVA 2NYVA 2VHQA 3ONWA 3COJA 2VXOA 2DU8A 4G2NA 4KKVA 4RJLA 3CX3A 3S70A 3DL7A 1H6BA 3TNYA 4HDKA 1J2RA 3LQ2A 2DWUA 3RTDA 5K2OA 5AXAA 2GARA 2HBZA 3MUNA 3B7GA 3H0EA 1R10A 4L15A 1OLXB 1XCOA 2B2XA 1JNYA 3QG1A 4E2FA 2ICAA 3QVLA 4QIHA 3GPDG 4MSUA 1PYGA 3PC6A 3SPXA 5CJPA 3WFIA 4A92A 4YRJA 2JJ1A 1XMVA 3Q88A 3P5SA 3KKKA 4PIVA 4JLMA 5T4FA 4MO9A 2G6BA 1GG9A 5C0OE 4KYIB 1UKYA 2BY4A 5CK4A 2WWFA 3IOEA 3IEIA 3K30A 4XGKA 5K6RA 3AT1A 3L4BC 3I42A 3MUEA 3ZZMA 3AEXA 5JIBA 3QQPA 3VR5D 3DLAA 3P71T 4TT3A 4BWVA 3OT5A 4KH0A 1H85A 1H1LA 1WZCA 4KU4A 5TX7A 3OM0A 2Q5LA 4NC9A 2RI0A 4XKJA 5EJ4A 5JYEA 5IKOA 1UM9A 3IBYA 1HEYA 2YCBA 1ZA2A 5EEGA 2I3AA 4J49A 1RXEA 3HR4A 3N86A 2W2KB 1JKJA 1SOVA 5NULA 4F45A 2BELA 4GVPA 4QL3A 4DQLA 2WHPA 4GZ3A 4OQXA 1I5RA 5CYGA 3KQSA 2RIPA 1CK4A 3IXLA 1Q20A 1DHRA 1JAIA 3EIWA 2R1TA 2R00A 1AO3A 3M9LA 4D4MA 1WNTA 4XLZA 1DIHA 4MRAA 1IHOA 2HBQA 2C8JA 4H3KB 3HDVA 3KPVA 5ALOA 1CJBA 1Y3DE 2CHFA 2C99A 3OJXA 3ROXA 2QD5A 2Q21A 2DLNA 4H35A 4ROSA 3E7XA 3WK6A 5TIIA 1TM1E 1Z15A 1D03A 1GHTA 3LLSA 3PZRA 1YL5A 5GGYA 1FRZA 2IQ5A 3P2JA 1FYFA 1Z75A 2JLYA 1Y4ZA 4NOKA 1P8JA 1K6IA 2HUNA 5A4KA 2AG1A 4ARSA 1X80A 4YALA 1BCSA 2LE0A 4KUHA 2CVOA 3LXMA 2FUNB 3U09A 2VJKA 5B36A 1G3IA 3B48A 4R0MA 2EQ5A 1Z4MA 5FR2A 3GG9A 5DW3A 5AOBA 5KUTA 1ARZA 3GUUA 2H4XA 4REOA 2FU5C 1Z7BA 2BKXA 2CHUA 4X1IA 1D6NA 2M6RA 1RRGA 1E3QA 4LXIA 3P0HA 2V97A 4HDRA 4OV6B 2AUNA 4A23A 2GERA 1C9JA 4CLRA 4NE2A 2DLDA 1F0KA 1OCEA 3ADKA 5KDOA 3RHTA 1X1TA 3GGSA 3PJEA 5L3RA 1N2IA 3FTPA 4ALLA 1QMPA 3RKUA 1BVHA 2PJDA 2A67A 3D6VA 1I7PA 3VR6D 2MHCA 5B3LA 1N3BA 1Q11A 2G8LA 2WJ6A 2BZGA 3AUTA 3EMVA 3NM4A 3OT1A 4CM4B 3UJDA 4EPRA 1GG5A 2PX8A 4V38A 4NYIR 2HYIC 1XZDA 4JVNA 4ZU3A 1GVHA 4R69A 4U6SA 4YRNA 4JOQA 1ANKA 1C4WA 4J16A 5L3SA 2Y0PA 1GD1O 3KQMA 2PZEA 3QKTA 2ZUVA 3DHYA 4ESOA 3WK7A 2OT3B 2Q50A 4CG2A 1QPZA 3X1JA 1CQWA 4GBGA 3WYDA 1A2BA 3HFJA 4HK4A 5K3FB 5EZ5A 5IN4A 1E6WA 3G0CA 3IHWA 1F5SA 1UBJS 5AKLA 1W9HA 1FDTA 1JRLA 1DADA 2FP3A 2C8KA 4IEFB 1Y8ZA 4V0NA 2IITA 4CGYA 2K4MA 4KWHA 4ZOLA 4Q15A 3RSQA 1ESNA 1CRLA 2GBFA 2QJRA 3GCWA 1HL7A 3HPRA 1HO3A 4ZGWA 4BEWA 3DWEX 1NPYA 3FH0A 4Q9AA 1U0FA 1EBFA 1FFWA 2EQAA 1I1NA 1VRVA 4JD5A 1IBRA 2DQYA 4Q9IA 4ZIRA 1YZYA 5ITWA 5E3IA 4QXPA 5JS6A 2J0QA 1XZAA 1ECGA 4U4AA 1SC9A 2CL0X 2QTCA 3M4ZA 4H6WA 4BPBA 3A6PC 2FPSA 4C2UA 2B1JA 2CXQA 2FCRA 3E9NA 1J8QA 4FE3A 1GCGA 4W5JA 5FOUA 3OQOA 1II8A 1KK0A 5JJCA 4OMDA 2M1ZA 3ZJUA 1B7GO 1TLTA 5CLIA 5KHLB 4GIBA 3RU7A 3ZW9A 4C0BA 2CLCX 1U11A 2GBGA 2M6KA 5JCXA 5D1HA 5FADA 4D99A 2R44A 2X9NA 5K3AA 2CV2A 1ZD5A 4R6XA 4XD7A 4OGGA 1SVWA 2B94A 3LL7A 2FV8A 3R1IA 4M86A 3SC3A 2Q1TA 4HWTA 1SUSA 3OD5A 1Y0BA 2POCA 5LYJA 2COEA 4TXJA 4QT0A 1K89A 2QRJA 4DQDA 2CCKA 3H42B 3IV6A 3FWNA 4IVPA 1JDZA 2ODBA 1Q1GA 3MTAA 1D1TA 1QS0B 2VKQA 4R9VA 3O9ZA 4L4YA 5SZIA 2ON6A 3PK0A 1OX4B 4IGKA 3NHFA 4V0MA 5BRAA 2VL7A 1FNBA 1X7WA 4FXOA 1U8FO 1JFTA 2JLBA 2X6QA 3PGKA 1L4BA 4F4JA 4NJMA 4MRSA 2FN8A 1E2LA 3P45A 4RL6A 4C7XA 1L7AA 4OJYA 1A69A 4TKZA 3D6MA 1BQ3A 1SKAA 1E2JA 2PQMA 3GMDA 3MGGA 4FVTA 4RCZA 4C14A 1FMJA 1ECCA 3EUFA 1E6CA 4MQ6A 2P9BA 2XOEA 1IZ8A 3NEAA 2FK7A 1R18A 4B0PA 3I92A 4KPUA 1SEPA 4J43A 3LM8A 1ODLA 4NQRA 3U3KA 5CAEA 4RVNA 2V7TA 1U2EA 3X2FA 1P62B 3RUEA 1DQYA 1IOVA 1EFVA 1H1LB 2K6GA 1Y3BE 2NQTA 2BFEB 3D3WA 3KJQA 4U7PB 3OBBA 2ZQ5A 5D3MB 3ZZUA 1NQVA 1YVEI 3IBTA 4EFMA 2WU1A 1ABBA 1UM9B 1Z2EA 1GPMA 2EFCB 1NOJA 2AFIE 3QMMA 2JFQA 4NV3A 4MS3A 3HCOA 1O57A 4YAWA 4UE6A 4HQ0A 5KC9A 1UK9A 4A5OA 3F3KA 2EX1A 2NO1A 4AP9A 4F91B 4YIHA 2MSCB 5B12A 5LXTB 2NSLA 1PYDA 5DT2A 3FYUC 5C7IO 3EGXB 2XITA 3WDSA 1LTQA 1HE2A 1ORRA 2DM6A 2EW1A 3FM9A 1W85A 1C3LA 2CLIB 2WILA 3C6QA 3JQGA 3Q7IA 3SEFA 1U0HC 2NWQA 3D64A 5A2QA 4LHYA 1U2GA 2B7LA 3K20A 3AVXA 2PL9A 2G5GX 2IY9A 3GUCA 3Q87B 1PK8A 1QH8A 2Z83A 4WK2B 3IQEA 4DLXA 4HUTA 3HCFA 1V7QA 1CB7A 1TUGA 4RLHA 5HIKA 5C8ZA 1F8UA 4IHQA 2ZSKA 3GAMA 3QEJA 4DVJA 3OP4A 4Y1FA 3H2YA 2A5FA 4E5NA 1N6RA 2Q3DA 2H31A 4OM8A 5CFMA 3N8KA 4X65B 3LQ4A 2ECPA 3Q9LA 3BHNA 3OPYI 4YCJA 3ANYB 2FSIA 4KPFC 4LRTB 3ZV5A 3DHVA 3QKRA 3W8FA 4Y2JA 1AQLA 1QORA 1T4BA 4UU1A 1SCDA 3UATA 2D0DA 3U9LA 1E6EA 4CYMA 1F2TB 1MQSA 1LA2A 1Q1QA 1Z0JA 2JLVA 5FPPA 3D6HA 5HKOA 4YV1A 2BW0A 2IA5A 3QJGA 3WYCA 5F73A 4C0LA 3TW0A 2BT4A 1L7PA 3WWCA 3Q98A 5CGQB 3OIYA 4OAQA 5K3EA 5ICSA 5I3CA 1N8TA 1VJ0A 2YH2A 2GJ4A 5KTKA 1C0LA 5A5DA 2BH2A 3CHYA 4GM0A 2DB3A 2LDBA 2ZWMA 4PO3X 2CHQA 5EP1A 4IDNA 4UDXX 2F3QA 2RGWA 3FSGA 4WEOA 4R2HA 1Q0TA 2JIMA 1CETA 1L7DA 1N5LA 1LRLA 3R5HA 3O74A 3V1YA 4UOEA 4AS1A 2G04A 3EC7A 4UEWA 4M0UA 4QT4A 2VN8A 5AW7A 5F64A 4FJ0A 1ZOPA 1O95C 3JWJA 4ZOLF 4I4TB 4HB0A 3QUQA 4R9SA 1XP8A 2Q5FA 2X4LA 1BA3A 2GHIA 3BRSA 4GX0A 2ZB7A 2VSNA 3GZJA 4IZHA 4CCSA 5CA1B 3ZNPA 3IOCA 5CDYA 1CUUA 3FF1A 2JFYA 2ZCVA 4O33A 2AF3C 2JS7A 4JXXA 3OCYA 4G0OA 4WA7A 1KMQA 4LXYA 3KCQA 2MSEB 3QXHA 1IBMB 4P5EA 5EE1A 3TDKA 2NNLD 3DULA 2QTNA 1V8ZA 2ZSDA 3HP1A 4AJKA 5EJ6A 1PRYA 2CNKA 4LQDA 3KZOA 4RZSA 2NSHA 3ZG6A 3F8TA 4B4OA 1VGVA 4EL5A 4PHTA 1GRCA 1N8NA 2QVGA 2ZYHA 1JA0A 1XZMA 3BXOA 3GB9A 3I3OA 2HY7A 2WIAA 4LFBB 1E0JA 4D3SA 3KSZO 1DEKA 1RLIA 2GLUA 1Q83A 3NBKA 4B4WA 3G17A 5LLTA 1XDSA 1TFUA 3K9CA 3HKCA 1K3FA 2I91A 1IULA 1YHZA 3JRWA 4AKHA 4WKBA 3GJ3A 1LTHR 4CWAA 1HYBA 1OU4A 3U16A 4DJJA 4TTJA 4ZQHA 3I3SR 1J5PA 1PDOA 2CLDX 3FUUA 4IOLA 4F6LA 3UK2A 4P36A 3OLVA 1N5IA 4K81B 2II6A 1Z18A 2YJ5A 5A1TA 1JEAA 3ODGA 1RT9A 4WERA 4AY6A 1PL6A 3QBTA 2XUKA 1UJMA 4GU5A 1YMVA 2BEWB 2EJCA 2G4CA 2NTJA 2X0JA 2YWBA 1SCUB 2Z8YA 2MR6A 3KD3A 5E8JA 4P7GA 1RZVA 2NLOA 5EUCA 2XHEA 3FCYA 3A6EA 2HSJA 2OV2A 2VXBA 1GSIA 1S7GA 4JGBA 1JSRA 2D2FA 4NEGA 1UADA 4H7KA 1Y4UA 4QGAA 3SC6A 4AJHA 5IZCC 3ZOKA 4JJIA 3T61A 1OIVA 2BBTA 3EXIB 5AVUA 1SC3A 3OCUA 1MJFA 2K87A 1W19A 1C9EA 4Z54A 3AU8A 4KR3A 1BRTA 1N9GA 1TEZA 5ALQA 3IBCA 1K7EB 1GXSA 1YF3A 4X7BA 1HMYA 3EEIA 1I4OA 2QRNA 4ML3A 5EJ9A 1ZW6A 2X0DA 4FXPA 1EFUA 1AF4A 4ECEA 1YTLA 2HPHA 4EG8A 1JAXA 1AZLA 1NN0A 1XZHA 2NUTB 2RBKA 1Y9EA 3HV2A 1XL1A 1T6XA 2BFAA 4I5DA 4Y9DA 5F5NA 2PKQO 4C0AC 5ITSA 3CG0A 3JQAB 3SVTA 4LCJA 5C5DA 2AHOA 2Z6QA 1T2FA 1B3RA 3CUEF 3EJWA 2PYIA 2BFEA 1C1DB 2C03A 1K8YB 5KMGA 1HDXA 3BILA 3OX4A 1DS6A 2WWTA 4MP6A 5KTMA 1HDIA 2CEKA 5BT8A 1WETA 1TZKA 2X0FA 1N36B 1IXSB 2P4SA 4TWIA 3HK2A 4XI9A 3GOHA 3JRXA 1YTUA 3S55A 3F47A 4I4TF 1DT5A 1PV2A 1SBQA 3ZBUA 2B21A 4HZUB 3DA8A 1YQUA 5DM60 4YMHA 1E4OA 5KVCA 1S0UA 3JQGB 1B0ZA 1WP4A 4UAJA 4BRWA 3CF4A 1V25A 5EJ2A 2J7PD 5HCIA 3CZMA 2X5KO 2BMAA 1QXSA 3D7KA 1N2BA 2J67A 3M4NA 5CT4A 2AI3A 2NV2B 3OPQA 4ZVKA 5J40A 4GOLD 2AWOA 4DY6A 5GONA 1THZA 4ND1A 1TW2A 2X2FA 4XE5A 4LI0A 5TB5A 1K97A 3D0RA 4P53A 4NMWA 1WU7A 4FQ8A 4KODA 4AJPA 1MB0A 5E9AA 3SBOA 3ICWA 1H6CA 1GPYA 2FG6C 4FDTA 4FNGA 1YI8A 4C6RA 4A8HA 5THQA 5U9CA 3VAZA 1FUEA 1IG0A 3EUAA 4OU5A 3WMRA 1ZR2A 1XJ0A 3GJTA 3GRAA 5FHQA 5JALA 1YRHA 1OFHA 2P2DA 3KUCA 4E15A 4F9TA 3K9NA 2FR8C 3N76A 5KWVA 1HYEA 3KVRA 2V74B 4X6LA 1X92A 3B7PA 3V4PB 4ZT4A 4C2TA 3HXOA 1XEWY 5KINB 3LKBA 4PINA 3K0FB 1XRMA 4HGOA 4EK9A 2WKQA 4FBLA 4MUBA 3ANMA 2WIFA 1X9HA 3DQZA 3JAKA 3OZDA 5EQJB 4YDQA 3WTBA 5JSHA 4AIRA 3AEKA 4P0TA 4G0PA 2B78A 1EX1A 2XGOA 4OQMA 4BFZA 2ZYVX 2X3FA 3FNFA 4OD0A 3ZH2A 1Z5UA 4X61A 2BGJA 2QP9X 1RPAA 1WG8A 1Z73A 3FRHA 4ZXPA 1YQTA 2XB6A 4DUPA 2C2ZA 1SXPA 1W87A 2UV8A 8LDHA 2FH5B 4X60A 1CSEE 4L73A 1BN6A 4JR1A 1A27A 2BUCA 2DUWA 2P3LA 2Q2OA 4C0QC 3RYCA 1W2GA 1IVYA 5I7FA 1DZ3A 3PDUA 1S9HA 2OWDA 3HXLA 4HWSA 2PZJA 2X8WA 3DPIA 4GHWA 5TRTA 1VDZA 2PFGA 2ZSBA 5UKDA 2XMBA 2FPUA 4OO3A 3VPHA 3U5ZB 4CEJA 1E2GA 3AFOA 3LP5A 3IXMA 2XNJA 1M8GA 4GKAA 4OHCA 4BFXA 5BQOA 4HGQA 3AEZA 4L8VA 1J1IA 4PZ9A 4XPIA 5IM4A 5LQNA 2AJBA 3PQCA 4KEAA 4WUVA 1VLLA 4Y9RA 2ATIA 3IESA 4B2PA 1ZYUA 1QTIA 1ZCBA 1VQ1A 5FORA 5ALWA 5T4EA 3UAXA 3W4JA 5K99A 2YMLA 1L4FA 2XBLA 4S0XA 1T13A 1IVSA 2NO9A 5F1KA 3V34A 5EQDA 1CR1A 4MPPA 2WHXA 2ZKIA 3EFOA 1COZA 3GRYA 1DKRA 2CWDA 3I9OA 1DDOA 2HNBA 3AHCA 1LK7A 1PZMA 1RKXA 2ZB8A 4TRMA 3Q7QA 3LTEA 1FTGA 4FHGA 2GMWA 1QQTA 5DBOA 5JS2A 3U7EB 3WL6A 1KORA 4D9HA 5T3YA 3E81A 4GLJA 1AU9A 1GFSA 1PO7A 3LQKA 4IV8A 4MW9A 1HWYA 3PUYA 3K0HA 2XUHA 3HCPA 1YZVA 3UT0A 1MFPA 1SOAA 2P2CA 5HQTA 1ZJYA 2XVAA 3AF2A 3ASZA 2YWDA 4TMWA 3ZJYA 1IRIA 4H0FA 3QVTA 1RJ9B 1FFBA 4GI7A 2ESRA 2OCKA 1EINA 1JFFB 1SPBS 1PX0A 3NHLA 1R12A 1EK6A 1QHYA 4NZYA 2HMYB 3B6KA 5D3MA 1A5AB 1ESEA 1XNJA 4BX0A 2QN7A 7ABPA 1Z22A 1MQAA 3ABQB 3H2JA 1L5HA 3VV2A 1SH7A 5JO9A 3TOCA 4B79A 4D4LA 1UKEA 2CL7X 3AI7A 4IUCS 1VOTA 4Q19A 4EQZA 4B46A 4MGZR 5A7HA 3UB2A 3UMRA 2C5HA 2PFSA 2QQGA 1P7ZA 5JSQA 5LZ5A 1V1MB 3P0FA 4WT7A 1KEPA 3A14A 5JAIA 4MVJG 3GPBA 1E5DA 2JBAB 4B43A 3LQRA 3RCBA 3PC8C 2OCLA 1LS6A 4CLRB 1FMTA 1GEEA 3AY3A 5DHTA 4DBLE 4QG3A 4XWGA 1R50A 4IIDA 2AD5A 5EJ5A 1X7GA 5AW5A 3OE7D 1KY2A 5K6AC 3FIUA 1O8BA 1X9GA 3T3GA 5GV8A 3CNQS 1JHDA 2DKOA 5G53C 4ZTBA 1U2DC 1ZUNA 3PICA 2P67A 1N6OA 1WDWB 2BZ0A 4Q02A 3GY0A 3J7TA 5KWSA 3VH2A 1WDKA 1OQAA 3T7RA 2K7FA 4RVOA 1MW8X 3U1VA 1CY8A 4BEBA 3TKAA 2DHQA 4XRRA 2OHXA 5ALYA 3QW4B 3PEUA 3TZKA 2PJUA 1JA1A 1PVVA 2H5JA 3R5KA 1W73A 4IO1A 4IIEA 1FU4A 1CQPA 4M0DA 4N6GA 5BNFA 5CBPA 1VZ3A 2JI9A 2NZXA 2JKZA 1YU9A 2Y1GA 3KSDO 4UMDA 4YLGA 1DKNA 4YQZA 4D4KA 1I3LA 2MMGA 1L7NA 3RIXA 1VXRA 1BIFA 3N2GB 1U0LA 3PC2A 2EC5A 1N2CB 3FR8A 2XBMA 2PGDA 5CA0F 5KTSA 1PT8A 3TQSA 4L4SA 1T2DA 2QK4A 3PUHA 2C4KA 1U4OA 4ICIA 1QPGA 4E13A 1V6AA 2X9GA 2ZI4A 2WBLC 4YP9A 3RJ9A 4K6CA 4IWNA 1DRKA 3RVPA 1DVRA 3UXEA 2O6HA 1SPXA 2VO1A 4PXSA 3RYHB 5DI3B 1QO7A 3I5YA 2HIGA 1GUYA 4OVKA 3I58A 2C8LA 3A70A 3DMGA 1XPUA 4HNUA 1Y6GA 4GGOA 5LBUA 3OJFA 4OK3A 1EZZA 3HRHA 4PWZA 3WAKA 4F2DA 2WSIA 4KG7A 2RB4A 2ZTVA 4EY3A 4C08A 3O4JA 3OTQA 4JIMA 3QNWA 1ABEA 2NXJA 3RVMA 4U9IS 3Q3JB 1M9NA 4H27A 4TUYA 2ECQA 3VAYA 1GDTA 1YE5A 1AQ6A 4CF7A 1ZH8A 1CFZA 3D7SA 2RAFA 1FL9A 4YJFA 4RWZA 5A7GA 4WINA 1PX2A 1U9ZA 1N2OA 2HJ9A 2VJBA 4YXWA 2IV7A 4DLKA 2G72A 5K0CA 4RK5A 2RBGA 3R9XB 3L4KA 2V6BA 3FSEA 1SU6A 2YV2A 3ND9A 1U1CA 1T8TA 1SY7A 1R0RE 2A0FA 2FWBA 1C29B 2X2EA 4HS9A 3OUZA 1X7WB 4PNZA 1BFDA 1TYDE 4GMXA 4MPTA 4YMTA 3KE9A 5AW8A 5ECYA 3I30X 2O7NA 3GRUA 3BWEA 3PD1A 4A3SA 1PZFA 1DBVO 3D0QA 1XEFA 5EXXA 1CW2B 1UJBA 2COUA 2EGHA 2OYSA 2X0KA 1PEKE 3AP1A 3PXUA 1KHTA 1PTKA 2CKDA 2D62A 3C5EA 1Y8QA 3HQ4O 4CIWA 3HI4A 2DMRA 3SF0A 5B57C 1E8NA 1MT0A 2EJTA 3TGPA 3CEAA 4BEVA 5H7XA 1QFXA 4PEVA 2IUFA 1KR5A 3V1TC 3LPNA 4BP8A 1V8OA 2JKVA 4WI1A 4B6SA 5FWYA 2WHRA 3CJRA 3GROA 3RANA 5KYXB 1M54A 1UMCA 1XK6A 1YKSA 4ND8A 4E1VA 5JAUA 4O0LA 3F98A 2PWPA 5ELLA 3SEAA 1W7AA 1JHAA 3CZCA 4BC0A 1W93A 1HE4A 3KUKA 3K0EA 1NA5A 3LRTA 5AJVB 3C3AA 4NY1A 3EOAI 3DMNA 3QEKA 4O5OA 4FINA 3LC7O 2YN0A 3ROTA 4FONA 4RKFA 1FFXB 5HFNA 4RD3A 2QQEA 3PUIA 1FX0A 5CYPA 3PHGA 3FE2A 3GAFA 5ELXA 4B3RB 2B1QA 1I4EB 1Z0SA 4YDSA 1DUSA 5D00A 4Y18A 1PEDA 1W85B 4IMJB 4WNAA 3CF4G 3ON5A 4F2WA 3JQQA 5H8WA 4NZOA 3MMSA 1G3QA 3RTBA 1IN5A 4O3MA 1FC0A 4O2AB 1X39A 4MZXA 2ZJYA 3IC5A 3ZWOA 3NUQA 4PZDA 2YRFA 2NYRA 4YCMA 4QQ8A 1LBSA 2C9ZA 5JWOA 2ZIZA 1QOQB 1SIBE 1V26A 1VE6A 1M66A 1WCWA 2DR0A 4I9NA 4JR2A 3V2GA 3ZBTA 1ETHA 3LA6A 2UZIR 4Q4DA 4A1OA 3KQQA 4CQLB 4V1CB 5M34A 2ZSEA 1W6RA 2OSBA 2BHRA 5LIRA 1T91A 3SE0A 3KQWA 3PHIA 5JH7B 3GK3A 5DYIA 5FI3A 4P2GA 2QMEA 2QL7A 3HV0A 1JHXA 3I9NA 4XQGA 4RTMA 4K03A 1N2SA 2X0RA 3DW1X 2NZJA 4I55B 2GFQA 4P5DA 4HVCA 2REBA 3G2JA 1RM4A 1NW5A 4IUBS 4I3HA 1T9HA 3SJZA 4QM7A 2NT4A 2VPTA 2F67A 4PHGA 3ONEA 1BE1A 2JARA 2QP3A 4MKXA 2FPLA 2EEPA 2ANCA 1AKRA 1U2SA 2FLVA 1R0BA 2QW0X 3W5JA 3DKRA 3FKQA 3SJBA 3O9VA 4BFTA 3AX6A 2IH2A 1NLFA 1V4BA 5HSGA 5AKGA 2J3QA 3KQLA 2JVJA 4MQEB 2E4YA 4G0WA 3DZIA 3HA5A 1WX1A 4JUAA 1M2VA 4Y0AA 5F5LA 2O8EB 3SM9A 3N6VA 1UR5A 3C7TA 1QF9A 5JDIA 2IZ5A 2RSLA 3GH3A 1IUPA 4F46A 1P7YA 2OWEA 2XUZA 2F59A 1BEEA 2F4VB 3IBSA 3OQIB 1NXPA 2YWEA 1H4TA 2ODAA 3AOEC 3WIVA 6YASA 2YR0A 2I2BA 1Y3FE 1JDUA 2OGTA 4RHTA 1QX3A 3IMEA 1E3JA 1T2EA 4D96A 5EJ8A 3FJ1A 4I5FA 3QXJA 2F1JA 5J9FA 3PFBA 4KIGA 5KKCA 1H4VB 5J2UF 2FMXA 4RF5A 3HZOA 3MS7A 1RKVA 4QOIA 5E3JA 4B47A 1ELOA 4JKOA 3RI3A 1U5AA 1VBFA 1X7YA 9LDTA 3CO5A 4QKQA 1PJ8A 2I6TA 3GLFE 1YA8A 2UUPA 3AZPA 3PR1A 5JXGA 2X0IA 2ES4A 3TIVA 2GJAA 4MQFB 2IYFA 1IRXA 1OAKA 1M1XB 3JWHA 1RQXA 4Q6BA 3BS4A 3GVHA 5THKA 1PZEA 3EVGA 1AQIA 2V4UA 3AU9A 1HFEL 2WB4A 4NG4A 1FRQA 1R8XA 2QT9A 2IF0A 1YJAA 3HI6A 2ZIUB 1AX9A 4O8ZA 3EUEA 1GLNA 3PVCA 1PUIA 4NCIA 4OXYA 1WMEA 3BX1A 4CXMA 4ALMA 1QGAA 3ZVKA 4OQFA 1Y6RA 1DFGA 1NBOA 1QIEA 4US0R 3KQKA 4ZDIA 1JDTA 4BNTA 2FFBA 4U8GA 1WCXA 4IUDS 5FBZA 2ZUEA 4L6AA 4TLBA 8OHMA 2QUJA 3UG7A 4PZ0A 1SQ5A 5JO0A 4LF7B 5D84A 1SB8A 2PT6A 3IO5A 3LLVA 4NH0A 3GXOA 4TXNA 3CF2A 3GBSA 2CJXA 3M6IA 5IAGA 1ZINA 1RWKA 3SGLA 3TXXA 1U2RA 3EIOA 3PNLA 4L0CA 1GXSB 10MHA 4KXFB 4AFNA 3WS7A 1RVDA 1UBFA 1I2AA 1ZNWA 2IGBA 3H6GA 1DXYA 1J8YF 3ZHRA 4Z7QB 4WKNA 2BH9A 4IMIB 3GLGA 2G4LA 2GJ8A 1NG9A 1GCAA 3CNHA 4AY5A 1VGQA 4OXIA 3R3JA 2D1TA 4Q1VA 4EO4A 3VJLA 4B34A 5LZ9A 4QSHA 4FDMA 3JARB 1K8RA 2XWSA 3LIIA 4R1TA 3RT9A 3BXFA 3O6VA 3U49A 3DS8A 2K2QB 3BGOS 1CUYA 2HK7A 3QELB 1NVEA 4IIFA 4QGHA 5P8WA 3WQBA 3J80A 5DHAA 3JSXA 4AT1A 4QDKA 1N2GA 3C3WA 1HC7A 3ZE9A 4M9QA 1AQUA 3ZWQA 1QP4A 2AQHA 1G0NA 1T8WA 1BO6A 1V1MA 5K3CA 2JEYA 3I28A 4IHJA 1RYYA 1VL8A 3LFUA 3OJLA 1UBCA 3DYIA 3EQ2A 1V45E 2P27A 3BAFA 5EHXA 2CK3A 3TLCA 1XDDA 3LJKA 2IYNA 2OXIA 3NUZA 3S8MA 2JIPA 2HNAA 4BO9A 4BLVA 4EZIA 2QRMA 5KYXA 1SZPA 2VWHA 5EHGA 3MRXA 1RJEA 1SCKA 3QTBA 4YP7A 2Z2KA 3ET5A 1GUAA 4DC0A 1KDTA 3LGAA 3L7MA 4JHXA 3T1TA 3N75A 3NC0C 1ECFA 3D7LA 1U3CA 2PU7A 4IRXA 4MUAA 4WJKB 1VLZA 5FWDA 5HE8A 4YPFA 4C4AA 2WM3A 4JEHA 1XRSB 1N3IA 1A95A 2IS2A 1ZLXA 2QTHA 1O97C 2PZMA 1SQSA 1CUAA 2PUCA 1AGYA 2A94A 4EQ6B 3A3KA 2XVMA 1IEQA 1M2EA 1Z3IX 3ETDA 4JUCA 4AJNA 4DV3B 1LBQA 3AZQA 2JANA 1Z06A 2FN4A 4LI3X 4PXYA 4GPEA 3ZDZB 3H1AA 2I29A 2HA7A 2WSSD 4NZPA 1GFIA 1UK6A 1Q0PA 3AUSA 3F1LA 1V4NA 4LRUA 3E82A 3OM1A 1CEEA 3CX6A 3GH1A 2XOXA 4ID9A 4U02A 2Z0MA 4AF7A 4Y6LA 4RCVA 2BMDA 4YDRA 4RH1A 5JFOA 4N76A 3I9KA 3I1YA 3WWYA 2W8BB 4ZT5A 4OHFA 1BJTA 4CLDA 3MWJA 4ZTZB 4UE3S 4R7TA 4PR3A 4M4SA 1BE6A 3FMGA 2F1OA 3LT0A 1LSUA 4W1PA 1P3JA 1EVJA 1G8GA 2HH9A 2CDCA 2RGNA 2WE8A 1TB4A 3GEBA 3IV9A 3BK1A 3RSOA 4ER7A 4N47A 2O52A 2W6OA 4E03A 5IJ9A 3D0OA 2VP2A 1YCDA 2AFRA 2SECE 4MW0A 5REQA 3UCFA 1WOMA 1KP9A 4ZZ0A 1WABA 2J7PA 1R16A 1YDEA 1P4SA 3HKBB 3F9RA 3U37A 3TLYA 1WY5A 3ISVA 3E2PA 2W2MA 3F90A 4J4BA 4CEJB 3R09A 2E7ZA 1LI5A 4QECA 1NUSA 2B3DA 4QBTA 4PZYA 3MJEA 2GCNA 4OSEA 4DR7B 5CXXA 1ZBDA 4BBZA 1BKYA 2H5LA 1BCRB 1B1CA 4X3PA 4WCFC 4M9SA 4A2QA 1JJFA 1UK7A 3GVXA 1LC0A 1XR3A 4Y1RA 1F4PA 3O47A 4YAKA 2ZUFA 4HP8A 2NTNA 3S99A 2VUSA 1JKFA 4ZJUA 4A6EA 4H3SA 2OK8A 1Z6TA 3EZXA 4D9BA 5AW2A 4PQEA 5M5BA 4QDZA 1ODSA 2HLDA 4F6CA 1K06A 3HYCA 4YCBA 3T5BA 4JENA 4NMLA 4ASUD 4MUMA 4DQKA 2REXB 4K7JA 4Q1AA 4YBZA 5J59A 4I81A 5BUZA 4D2IA 4BZXA 4JI4B 4XDZA 1OFGA 1W30A 3EODA 2DR3A 4OL9A 3WZ2A 4CMEA 1Z2OX 1ODIA 5JFGA 1G38A 1ZA1A 3CPHA 4D9JA 1PFVA 4QJ5A 4KLAA 5IVHA 3A7EA 1JFFA 1K92A 3NYQA 4P6VF 4P83A 3SC4A 4PONA 3L1IA 1XNHA 2BEKA 3KETA 1N0WA 1RYMA 3LKZA 1FFAA 1JLSA 6CHYA 3EFBA 3Q7SA 4OFBA 3C3JA 3WADA 1C7FA 1HBJA 2PGNA 4DUGD 1A5TA 1LRKA 2OZLB 2SCUB 4H31A 5J4YA 4GKKB 3ET4A 3PTZA 1OV6A 4L76A 1OZGA 2I54A 2JFVA 3KEGA 2C4WA 3AESA 4U9HS 1NBMA 4QULA 4IKPA 3HHPA 1TK3A 1RJ9A 3HSSA 5E6SA 5G40A 1VHWA 4LQLA 3UQYS 1XU7A 3MVEA 2GBCA 3TLBA 1C7QA 2GQ0A 4JBYA 1ZHOA 1L5NA 1MABB 3MWEB 3IP5A 3TUZC 5JNSA 2OZVA 3GLVA 3A3OA 3PPXA 4CEHB 4IDBA 3NOQA 3C16C 2PWZA 2HX1A 1R8QA 1A3CA 1VIMA 3X3HA 1ZONA 1JQLB 4GDFA 1EUYA 4L2IB 2VYQA 4B82A 1RXSA 4DCMA 2OHFA 3TINA 4KMMA 1EFTA 2FW7A 2PBZA 3VMMA 4ZYVA 5FX2A 3IMCA 4YYZA 2F4NA 3DBLB 5AM0A 2JASA 5E7QA 5BPFA 3HM9A 4IPTA 3R4CA 4L5YA 2XODA 4OPMA 4U0JA 1YU6A 1B0PA 2VXYA 2XUPA 4HKTA 1NVDA 4HTFB 1TCCA 2B82A 1JKXA 5HBRA 2EP7A 4MHTA 1DKLA 3DT9A 4E07A 4HBZA 4YB8A 4LJ5A 3SYMA 1QRTA 5JNTA 2RG1A 1HYQA 3UJ8A 3VV3A 3KV3O 3B1FA 3CM0A 1QO9A 1JIKA 1U6IA 1ISHA 2J6CA 5L4SA 2GFHA 2R79A 1KOFA 1TF5A 2GK6A 2X14A 4B80A 5HYVA 3FCAA 1I3KA 3S6JA 1TI7A 2XW6A 5J23A 4B1FA 4KNVA 1TGYA 3C1OA 2J9YB 2HWKA 3A28A 4GDMA 4KMOA 1PLJA 2P5YA 4AX8A 4MIKA 2EL7A 2PR2A 3OJWA 4TVBA 3WOVA 4CV1A 4DV4B 1RQ2A 3HJBA 4LV6A 1LGYA 1JF8A 4RPLA 3LY7A 2OFOA 3M1AA 1EK5A 2V7GA 2GAOA 3JASB 4HXYA 4XVRA 2C84A 3S2ZA 2RJ3A 2WJWA 1D0SA 3GFTA 1C0EA 3OIUA 4Q4HB 1XWWA 1B41A 3K92A 3ZXYA 1TC2A 4BMXA 5CCDA 4MR8B 4CKEB 2R1UA 4KDEA 1MV8A 1UT5A 3ZCQA 4YGYA 5BYJA 2CNOA 3JAWB 4IAOA 3RYIA 3GLIA 4CMIB 2QL6A 4DMHA 4GECA 3ZZ1A 4UEQA 3KR1A 4D97A 3LBIA 2WHYA 4JFAA 4JP2A 4M7WA 5A0FA 2P30A 3KZKA 3O92A 4A8TA 5LMUB 3LZCA 4R8LA 4M7PA 5CD1A 2ACKA 3IIIA 4PX3A 3REGA 1XTQA 4PTLA 4ZC1A 2AKEA 5KOHB 3ZYZA 4F85A 4BATA 2O19A 1W5BA 1NY6A 3LW8A 4DT1B 5F98A 2V59A 3JD4A 3P4XA 4NHEA 4YP1A 1V3QE 1ZY2A 4QDOA 3RD5A 3U7RA 3V4SA 4D9FA 5BN5A 3PQDA 2B2NA 3AVPA 4JVLA 2KSQA 3LUJA 5I7RA 4HUQA 1J33A 3H1BA 5EIBC 5AHKA 4LHZA 1FS5A 1GP2A 2CHGA 2C04A 2Y1EA 5EFOA 1JZQA 1EWYA 3EXHA 4FKMA 3DAFA 4O2BF 2PMBA 1IBLB 4DWOA 3OFND 5KU7A 1ZJJA 4UARA 3QBDA 1Q16A 2GYVA 4C1NA 1R5BA 3AQ4A 2C2HA 3ES9A 4BP1A 1ORDA 4PIPA 5A71A 3QFCA 4UHJA 3LCUA 4M1QA 1M8FA 3O1HB 3HWSA 4N6OA 4INJA 1DCKA 4A7PA 3ZBPA 2HF8A 1P7VA 2CNBA 1QDLB 4M2LA 1PI3A 2R4TA 3TB4A 3S4YA 1JLMA 1YZHA 4D0LB 2GEUA 3CG4A 3CZPA 5ALTA 6Q21A 3TBKA 2FWMX 3HP7A 5JXWA 5EP2A 4ERNA 1N78A 1RI1A 2OCXA 2WC1A 2JD2A 4WCVA 5JUWA 3CVVA 3AO0B 1JDPA 3JR7A 3ZTTA 5B3KA 1L8LA 3NP9A 2DFLA 3AWDA 1H66A 3ZTWA 3SR3A 2UKDA 2FSFA 4JX9A 1VSBA 2PG3A 1T6ZA 5FUBA 3ZE1B 1W35A 3MSXA 1YASA 4RHYA 1QS0A 5JMOA 2O2XA 3L93A 4Q1FA 3AUJB 3D02A 4N5NA 4L6IA 5E4YA 5KU1A 5DRTA 4B31A 5KYVA 3WQSB 4M1MA 3DTVD 3G9UA 1ST3A 1RWOA 2QLBA 3GRZA 3IEKA 3P97A 4HQ6A 5DV9A 3HSKA 4ZA2A 1B42A 1HLFA 1M74A 3R7LA 4RXUA 1E5LA 3E3AA 3FRJA 3EG9A 5F21A 3KJFA 1ZO8A 1PFUA 1W94A 2O7SA 2XYRA 4KIJA 3OZFA 3PNBA 5KNDD 3KOMA 5IZCA 1ZM2A 2F1IA 3DE4X 4PCLA 1ZJWA 4Z7NB 4C0XA 4N8DA 2PZKA 2I2DA 2Q1SA 2AJCA 3BHIA 4KE8A 1GA6A 1Y8CA 3ZDQA 3U7GA 2XXBA 3M5WA 5EJ7A 4GPAA 1E3LA 4O59O 2VQFB 4MVJM 3C3EA 4RETA 4EPYA 3DMFA 4NARA 4Q03A 1V6CA 2PMDA 4F3RA 1D4FA 1NLUA 1FUYB 4PLWA 5ALEA 2XZPA 4FC7A 3HLTA 3I04M 4WDQA 5KTYA 1EHCA 3IQWA 4JXKA 5EINA 3L6BA 1HQKA 4L3OA 2CLEB 3O1IC 4CUZA 3SLKA 3QFSA 2P9EA 4WOKA 1D1PA 1IWBB 1OA1A 1ZXXA 4A91A 4ZVTA 3HC7A 3MHPA 1I7QB 1T4CA 3TCKA 4QEZA 2GEDA 3O7WA 3V4OA 2WM2A 5KPDA 4WKPA 4OGFA 2H1WA 2CZQA 2ZWVA 3LWNA 4EF5A 1BC5A 1JIIA 1GQYA 1JYEA 3SNHA 5KYTA 4XQCA 1KEUA 2DBRA 2G7MC 4AURA 3DFUA 1UMDA 2G67A 4PRKA 1F14A 2R65A 4MS3B 4Q3NA 2FP4B 2YJ4A 4XCXA 3RTGA 4J2HA 1DEOA 1V2GA 2WJJA 3WMWA 4JI0B 3WL4A 1Y6QA 1MOPA 1PJAA 2CVHA 1Z4PX 4FD2A 3KTDA 1YHYA 5H4HA 2HW8A 4H7FA 1U2TA 1Z12A 3K2BA 2ZJZA 1F1BA 1KPHA 1RWQA 2P2YA 3EQ7A 4K9QA 1P1BA 1W4LA 4PGGA 3MF4A 4W7IA 5K6TA 2HADA 4Z49A 1MRZA 1QH8B 3H0KA 1F1JA 4KQ1A 5F1OA 5T4BA 4EUFA 5JAHA 1FSFA 1R88A 2FSSA 3PNOA 1XV5A 1EMDA 2IEIA 3TW8A 3OZWA 2NOAA 1D6SA 3CH4B 1E9CA 3L7DA 3TL3A 3U39A 2J3KA 1Z07A 3L8HA 4R2JA 3A9CA 2FSVA 3LS2A 4KQEA 4WZ6A 1PFQA 2HXGA 2HF7A 2NUAA 4CIBA 3AFHA 2B7CA 3VNSA 4X20B 2IH5A 4GZMA 4E2XA 1P1RA 8ABPA 1G5QA 1T1GA 4R31A 4R1UA 1YCGA 2W2PA 1U2PA 4MRVA 2VHJA 1KI4A 2QGFA 4OB6A 5B1SA 4YWJA 3L7YA 2BI8A