3V2HA

The crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
232
Chain Sequence
b'SMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-beta-hydroxybutyrate dehydrogenase
publication title The crystal structure of D-beta-hydroxybutyrate dehydrogenase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 73
structure length 232
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2hA00
2FR8A 4Y9DA 1HYEA 4GSKA 5U1PA 4JP3A 2W4QA 2D8AA 1XR3A 4IDAA 1CDOA 1UXKA 4O59O 4R5MA 1I10A 1ZMTA 5DBFA 4B7XA 5L45A 1NR7A 4QT0A 2XOXA 4L74A 3LC1O 2HMSA 4R41A 1D1SA 2WE8A 1DHRA 2JHGA 3EGOA 1P1RA 1Q7CA 3H2ZA 3HDJA 4TSKA 5HS6A 3ZV6A 1RM3A 2ILTA 1MX3A 3KSUA 4M89A 4KDFA 2AW5A 3CE6A 3QVOA 5DCWA 1H6CA 3PVZA 4UVGA 4XRRA 1FDWA 4P8RA 1EQUA 1VL8A 4UREA 1XQ1A 3KTDA 5HRUA 3ITDA 4RPGA 2E49A 5EINA 3V5NA 3HFSA 4C4OA 4D42A 4JX8A 4R01A 3JYQA 1C0IA 2OGUA 3IDSA 2UDPA 1LU9A 4B4OA 3NAQA 1MXHA 5T6BA 1HTBA 1NQAO 2B4RO 3H2SA 1PJQA 3GHYA 3NDRA 3GFGA 2Y1CA 4XRGA 3P7MA 5TIIA 1DIHA 4RL6A 5DBGA 3H4VA 4U7WA 5T8KC 3H5AA 3K2EA 1K2WA 2J3IA 4HADA 5CG2A 1XG5A 4JK3A 3HB5X 3QIVA 2GD1O 5GZ6A 1PJ2A 3I9KA 1I0ZA 2NVBA 4BKPA 2GASA 4W4TA 3R0IA 4D46A 2DTEA 4R68A 3FCOA 1XELA 1SMKA 1O8CA 2ZB3A 5CDSA 3MOGA 4YJGB 3FF4A 1M75A 1ZH8A 3IIEA 3QW2A 1LTHR 3JQ8A 3WQSB 1LDMA 4BNWA 5CP8A 1VL0A 4XGKA 3D5TA 4CLDA 4J2OA 2HK9A 2JCXA 3TOZA 3D3EA 3ON5A 1Y9AA 1KEVA 4AJEA 4I08A 1NFQA 5JY6A 2DLDA 3PJDA 1DAPA 3GHHA 3OMLA 4IUYA 5KKCA 3W4KA 5I7FA 3Q9UA 2AA3A 4LN1A 3F1LA 5JMPA 4QFCA 1QYCA 4FIZA 1DO8A 2DC1A 4Y67A 4EUHA 3T4XA 1ONOA 3G49A 4IDEA 3JYOA 1ZXLA 4BNGA 1ZCJA 5B1YA 2YQ4A 4UUNA 2GO1A 1KVQA 3HADA 2C82A 5TT0A 4BKRA 4ZQBA 1ZIDA 1O95A 2B69A 3C7CB 2POQX 1MG0A 4J9VA 4K6CA 2FZEA 3DHNA 4DL9A 3EAGA 3MCVA 3IKTA 2OP1A 1LBEA 3AI2A 4MKXA 4CM9A 3D3WB 4XKJA 3NT2A 1Z6ZA 4R3WA 1EUDA 4YJDA 4MKRA 1GZ3A 2IEBA 2BD0A 5A9SA 3OECA 4I1IA 2DKNA 4Y6RA 1DFIA 4E2ZA 3WMWA 3TN7A 5K6AA 2DQ4A 4N5MA 4FPXA 3QY9A 4ND5A 4BNJA 2IYOA 7MDHA 1P31A 4KUHA 3PJGA 1I30A 3CIFA 4IDGA 3GEMA 2ZB8A 2YUTA 2JFGA 4HV4A 1LDBA 3UKOA 4O6VA 4QECA 5EIOA 4XYLA 2E6UX 3OIFA 4AJ2A 4GL4A 1LLCA 3F5SA 3I9OA 2I76A 1SCUA 3RAJA 2YJZA 4PLGA 1EK5A 5JCJA 4CQLA 4ZQGA 5JBIA 4ILKA 5JAMA 3TFQA 1DIAA 1YB5A 4R16A 1B26A 1W0CA 3WDSA 1B8PA 4UUOA 2WSBA 1ZK4A 4J7CA 3ZWCA 4EYEA 3OJ0A 2VYND 2C29D 3RIHA 1GYPA 1Q7BA 4Z0PA 1RPNA 3WIEA 3OICA 3ZI0A 4CMAA 4DXHA 2ZTVA 1MLDA 2GN4A 1DDOA 3H7AA 1XSEA 5JYEA 5I7SA 2C7VA 4NFHA 2AE1A 1U4OA 2CMDA 5THKA 2V65A 1YO6A 4I9HA 1NWHA 2SCUA 1HSZA 4DYDA 3DL2A 1JWBB 2JCVA 3C1TA 1KY4A 4GLLA 2VHZA 1JWAB 5KKAA 2NLOA 1GTMA 3H9GA 4A5OA 1O9BA 2VWQA 3HJAA 4PZCA 1NQOA 1E7SA 3L07A 3JD2A 1ADGA 3GMDA 1LSUA 4JROA 4CMEA 4WCFC 4CV0A 1KS9A 4GPD1 1PWXA 3DONA 1QXSA 3RUAA 4AJOA 1U9JA 2XPCA 3OJLA 1F14A 1T1RA 5G0WA 4ZA2A 5AXDA 5THQA 3VPSA 1BVUA 3ANNA 1M67A 3NT4A 1NXQA 4RVSA 2GUGA 5C5IA 4FR5A 5EJ2A 1IHYA 4URFA 5DCYA 1U3TA 1WPQA 3KRTA 4PN3A 2G82A 2XF8A 4QO8A 1EVZA 3WGTA 1S7CA 1TLTA 4CMIB 1LLDA 3V1YA 4AJKA 4CM9D 1EDOA 3A14A 2Z95A 1IOLA 2Q3EA 2NU6A 1U3UA 1EZ4A 2CDBA 4I5GA 4CV1A 4LCJA 5C7IO 1NVMB 3ITKA 3BAZA 3GG9A 1BMDA 1ZBQA 5GZ3A 3JQCA 2D2IA 3RKUA 2C7GA 1LA2A 5JMWA 5B4VA 3KETA 2ZQYA 1EVJA 5DBIA 5C7LO 1D3AA 1HLPA 3B1JA 2DTDA 3L4BA 4J1SA 5JFOA 3C85A 4DPLA 1WDMA 1EUZA 3I9MA 3IMFA 2Y66A 3NV9A 1PQPA 3H65A 4IQ8A 5JCJD 2ZTMA 4GGPA 3GH3A 4DIBA 3Q11A 4CLOB 4YYZA 3NT5A 2G76A 2Q1WA 3DAPA 1HZJA 5FWNA 4FD3A 4AVYA 2Q45A 2NADA 6LDHA 1XYGA 4DVJA 4CLRA 1UJMA 3PRJA 4KP7A 3RJ5A 4Y98A 3SBOA 2RIRA 4PLHA 5IDXA 4YAEA 2PTGA 2XAAA 1G0NA 2IODA 4WLUA 3VDQA 3PHLA 4LISA 1U3VA 1E92A 1XEAA 3R3SA 4N5NA 5KTKA 5IDWA 1U5CA 3GVIA 4PG8A 3LQFA 4NG5A 5IN5A 1Y81A 2C5AA 3K6JA 4S3MA 3ZZNA 2R00C 1XU7A 4BNFA 4CUJA 4PLPA 4DLLA 1UAYA 4IQ0A 1ENZA 3BMCB 3UXYA 4F46A 4IXWA 3BMNB 1SO8A 1N7GA 1VJ1A 3U5TA 3OSUA 5JE8A 2FOIA 4AJHA 2Y0CA 3I6QA 1WP4A 2QHXA 2VHYA 1GV0A 2ZKLA 2PK3A 4NBRA 4E13A 3LT4A 3RD5A 3HN7A 5KVCA 3D1LA 4QXMA 1FDVA 3D4NA 4BKUA 5KJ6A 1C14A 2BI8A 3CTMA 4YJGA 1VL6A 5EQDA 4LRTB 1DPGA 1W4ZA 4R9RA 3SXPA 4BGEA 1AHIA 3PWZA 2HJSA 3E9MA 5AVOA 3DHYA 1N8KA 4UAGA 1OFGA 2BH9A 2P68A 4GAEA 5TGDA 3ZWWA 1J5PA 1E7RA 1GADO 3ANLA 4DC1A 3M2TA 3R1IA 3ZGYA 4ND3A 1XKQA 5ITWA 4NMHA 4NZ9A 1GEEA 2NUAA 4A0SA 1SBYA 1J6UA 4JJIA 2VHWA 3WTCA 3TNLA 4FJ2A 2JL1A 2FR1A 5L3ZA 3GDFA 5FF9A 1HLDA 1H0KA 1UP7A 1FK8A 3W6ZA 4CM8B 5ILGA 1NQTA 4HBGA 4HFMA 3I1JA 5JDIA 1PGJA 5TJHA 3BXXA 3ZV5A 2PKQO 1RYEA 3AY7A 3PHJA 1GCUA 2YY7A 4LVUA 1YJ8A 3UHAA 2B4TO 2P9GA 3KHUA 1GYRA 1GDHA 1U28A 1ID1A 3UUWA 1LRLA 2BFOA 4ZD6A 3D3WA 4NQZA 1XCBA 1MUUA 3FBTA 5A3JA 2R6JA 1C0PA 3TRIA 1HDXA 2W90A 4NHEA 3SX2A 2PGLA 1WMAA 4G81A 2FR0A 4MINA 4BO0A 3CKYA 4FOSA 4U0JA 1Q2XA 3QLJA 3RUCA 3D4PA 1WW8A 4KQXA 5FEUA 3BMOB 3SVTA 4IJVA 3ASUA 3G79A 3WNVA 4II2A 4W9NA 2E48A 2GLXA 3H5RA 3FD8A 4WPGA 1WDLA 1U4SA 4B8WA 4I5FA 4J49A 3PGJA 5TSDA 2OBNA 4F6LA 4EBFA 1YVEI 4E2WA 1E3WB 3GZNB 1GZ4A 2HMUA 4HX5A 3RI3A 1Y1PA 5L4NA 4LVCA 4PG7A 3WG9A 4KUGA 1V3UA 3ZW8A 1YE3A 1GEGA 2NTNA 2A94A 1T4BA 4TQGA 1SOWA 1EK6A 1YWGO 3OP4A 3TSCA 1TB4A 4WLEA 3ZH2A 4YRAA 2QX7A 3WIDA 1KC1A 3AWDA 2D5CA 3GAFA 3MJ4A 5T67A 2Y1GA 1Q0HA 4BO8A 1X0XA 4TWRA 4D3FA 5L4LA 1E7MA 1EE9A 1NAHA 2BFMA 4Z3KA 4XJTA 3INTA 4EI2A 4FW8A 1QYVA 4H15A 1PJLA 3E82A 1MFZA 4BKOA 2GRAA 3WSWA 1XA0A 1Y8QB 1F12A 2EG9A 3N74A 1IYZA 4BHTA 2PZJA 2IZ0A 1NM5A 4WEOA 1KC3A 4HNGA 4JXKA 1DRVA 3VC7A 3AI1A 1J49A 1GZ6A 4C7KA 1UP6A 1Z7EA 3QVXA 3L9XA 1NNUA 4RF3A 5JYDA 3PYMA 4FFNA 3LT1A 3D7LA 3F4BA 1HRDA 1HSOA 2V6FA 1TEHA 3DBLB 4H3VA 4XB1A 3RBZA 1ISMA 4J0FA 3G1TA 1Q7GA 1TA4A 4CMIA 2HRBA 2EF1A 4ITUA 5IJZA 1M6HA 4LMRA 1C1XB 3ZNNA 1FXSA 2JD1A 4MVJP 3STHA 3UH1A 3WICA 1YJQA 1ARZA 3WLEA 4IJWA 4AJNA 4R9SA 3DMTA 1KOLA 3I4FA 2ZTLA 4GWKA 4OO3A 3QHAA 5L95A 5JCXA 2PLAA 3TZCA 4TZKA 1LUAA 2WEKA 3EZLA 3RUHA 5H81A 1ZK3A 4WASA 5JLAA 3NTOA 1PQUA 1TT7A 3MZ0A 3DOCA 1NAIA 4NPCA 5KJ1A 1A7KA 1PZGA 4R69A 2AG5A 1H9BA 5DDIP 2X58A 1EFLA 3RU9A 3K92A 1X7DA 4J1QA 4CLOA 2YV1A 3PP8A 2CSUA 3B1KA 1UXGA 3H9UA 5HTOA 4B8ZA 4KTTE 1P33A 2VNSA 2EIHA 3WQRA 3WGIA 2ET6A 3WQQA 4R4JA 4HUJA 1X7HA 2C5EA 4L76A 3EY4A 2AMFA 1KBZA 2ZCVA 3JQEA 4NJOA 3FHLA 3FTNA 1IY8A 2Q2VA 3CZMA 5KJEA 1GQYA 4MIEA 2F00A 4MVJH 5BSHA 3DXFA 3PDUA 2WD7B 3GVHA 2YZ7A 4BQRA 4XB2A 3PHHA 4J3FA 4CV2A 4I5DA 3OA0A 2WM3A 2IZ1A 3O38A 4GQAA 5A3VA 2DT5A 1VC2A 2I66A 2WD8A 3DDNA 5AXAA 5BT9A 3WBBA 4Z6KA 4LSWA 4GMFA 4WEQA 1QMGA 3BMCA 2ZTUA 3BMNA 2Q99A 2Q46A 1E1NA 1JN0A 2Q2QA 3WGOA 3ZNOA 4E5NA 3Q2KA 3CINA 2CFCA 3VH3A 2EP7A 1PJSA 5ER6A 3KBOA 1D4FA 4XD2A 5FI5A 5K6AC 3AUSA 4Y6PA 4RPLA 3CMCO 3P5SA 1R0LA 1XU9A 4XZ3A 4CM5A 5JDCA 1Z74A 4Z9YA 2O4UX 4XDZA 3JQ9C 2EW8A 3NX4A 1Z75A 1GPDG 3OJEA 1NTOA 1N1EA 3JD3A 5KJFA 1E7YA 1LDEA 1KVRA 2GZ2A 1N92A 4NFSA 3JQFC 4P4GA 3GQVA 1Y6JA 2RH8A 4RORA 1YH3A 3IUSA 4WE3A 2DUUA 3ZCXA 5A03A 1P9LA 1H5QA 2EKQA 1E77A 1E1MA 2OP0A 2RHCA 3TF5A 1A9YA 1Q0QA 3B20A 4GX2A 4HFJA 5G2OA 1ULUA 4ONEA 4TRNA 1QLJA 3X2FA 5EESA 3M2PA 3QRWA 2X9NA 3TFOA 2EEZA 4EEXA 2GCGA 1YL7A 1LNQA 5CPFA 1PIWA 4JLWA 2HK7A 4XCVA 3ZWVA 3LSYA 3FNFA 4YAJA 4EUFA 3FRJA 3O4RA 1XWFA 3L6EA 4NBUA 3IS3A 3NEPX 4CMEC 1BDMA 3AUTA 4RPJA 4BB6A 4R3NA 3TZQA 1E7QA 5KOIA 2C0CA 3VDRA 2VHVA 4NIMA 4MVJE 4E6PA 4Q9NA 2X23A 2NU9A 4FFMA 3ROQA 4G5HA 3LF2A 4HFNA 3HDHA 5ENDA 4J7UA 3I83A 4OXYA 5DP2A 1LC0A 2VRBA 3ONEA 1K6XA 1MFPA 2J8ZA 4BOYA 2ZB7A 4M8SA 3ENNA 2VWHA 5CEEA 4BMVA 4IQGA 2JD2A 3ICCA 1TVEA 5HM8A 3T7CA 3BMOA 1M76A 3RCBA 3ORFA 5EL0A 3JQAB 5DT9A 2TMGA 4BMNA 3G3EA 4CLRB 2HKIA 3C1AA 3T4EA 1MB4A 4LK3A 4GKVA 2Y1FA 2W2LA 3UOGA 2A9FA 2EKLA 1LDNA 1AN9A 3AFNA 4YAGA 2WMDA 1E3WA 3GZNA 4B4VA 4NU6A 5AXCA 5TQVA 3LC7O 4BGUA 4CLXA 3JCZA 4TZTA 3Q6IA 2AEJA 4MVJM 1XIVA 5JY1A 4HNHA 3HB4X 1YL6A 4WNIA 4RZIA 3GRPA 1SOVA 3LT0A 4J43A 4CM4B 2PR2A 3L4BC 1FF9A 4W82A 2C2YA 2UV8A 3U4DA 1HYGA 4ALKA 3ANMA 3HDQA 2WJPA 3ZWNA 3DTYA 3JYPA 4GX0A 2HSDA 3NRCA 3LC2O 2GPTA 4JBHA 1ML3A 1F8FA 4BMSA 2W8ZA 4OM8A 1UAGA 2OO5A 2YHUA 4MIYA 4YR9A 5ILOA 3WGQA 2FSVA 1Y8QA 1HT0A 4LRSB 4CUZA 1DRWA 4XYBA 5FI3A 2V6BA 4MVJA 1HDZA 1RWBA 1E0DA 2VT3A 1KYQA 2EP5A 2VRCA 1R4NB 1X13A 2HJRA 2Z1NA 4DPMA 1DFGA 1R15A 4XIJA 1ENOA 1UXHA 2YW9A 3KSZO 3Q0EA 3DBLA 2CZCA 3GGOA 4D3SA 4FDAA 1F17A 3RBXA 3RUIA 4ZN6A 3AW9A 4K28A 4XA8A 2ZJ1A 1QV7A 4WUVA 1PL7A 1MP0A 1C1XA 2VZ0A 1L1FA 3OF2A 1YB4A 5I8ZA 4L9RA 5IN4A 2RAFA 1UP4A 3BYZA 4AG3A 1NPDA 2A92A 5TS3A 2X0NA 4BNMA 1ZZEA 1Q0LA 3SC6A 1ZK1A 2CNBA 2HMWA 3QA9A 3GG2A 2NQ8A 2W2LD 2BGLA 3FNGA 3IOYA 2CD9A 1X1TA 2Y67A 1CQIA 2G1UA 3N58A 1PZHA 3KEOA 1Q1NA 1HEUA 1KY5A 1GCOA 4JGBA 5T5QA 4CJXA 2H63A 2CVZA 1LI4A 4FCCA 4P22A 4Q3BA 3WX0A 4B4WA 3I9JA 3K8ZA 3RWBA 2AQIA 1LEHA 4YXFA 4BIIA 4YT4A 1I8TA 4J6FA 2E37A 8LDHA 1P1HA 3PHGA 3DZJA 1VJTA 1NP3A 2O3TA 2AE2A 1UXIA 4W7HA 4F45A 2Y0DA 4R1NA 5G4KB 2WTBA 1PEDA 2OBYA 4WOKA 3UVEA 4D44A 2I3AA 4GMGA 3L9WA 3WGGA 1PJBA 4JCOA 4QTZA 2ZATA 5EPOA 4BNIA 3GMSA 3BHMA 2B36A 4Z0TA 2WD7A 4Y8VA 5JDIC 2B5VA 3CUKA 4BL5A 4E5PA 1MGOA 1QYWA 2GN6A 1K89A 4WNCA 1JKIA 3PGXA 1J0XO 2X0JA 3GVCA 3VOSA 5JNLA 2X7HA 5I7VA 3ETGA 3O03A 2IE0A 4AICA 4FGSA 5A04A 1YB1A 2VRCD 3GN1A 2ZCUA 4DPKA 4WLOA 4YT8A 4R5HA 4RVGA 1PQWA 3EC7A 3H9JA 1IPFA 1W8DA 3DBVO 5CDUA 1WZIA 2Y1EA 3BTOA 1RM0A 3PLNA 2FPGA 1E3SA 2NTVA 1MC5A 2NM0A 3P19A 4XJSA 4D3DA 3JQ6A 3VKUA 4GSLA 3I9LA 3GZ4A 3PPIA 1N2SA 2Q4BA 1LSOA 4NBVA 3U49A 1R12A 1Y7TA 2YV3A 3NGLA 4W9NC 1UDBA 1U1IA 4QUKA 3U3XA 4N54A 3VPGA 2HRZA 4FGWA 3U0BA 4MO2A 3AK4A 5K0ZA 3U9LA 4A73A 4OGWA 1YGYA 1VM6A 4A10A 4YBZA 2CDCA 3ZU4A 4TRMA 2G17A 2Q1TA 2X5OA 4J7XA 3EDMA 4WLFA 4BO4A 3OEWA 4B4UA 1R66A 4QO7A 4XEHA 4L75A 3I4CA 1TT5A 2NQTA 2Q1SA 3GUYA 2ZYAA 1IUKA 1ISJA 1YXMA 1ZSYA 2Y68A 2GSDA 4D7AA 3ROKA 3IL2A 2AHRA 5L9AA 1X7GA 4IBOA 1A71A 4YVFA 3SJUA 4IJUA 4NBWA 4QEDA 1ZW1A 5EMHA 4WCDA 4HWKA 1LX6A 4J90A 4O5OA 4BNNA 2EV9A 4YCAA 1FJHA 4FC6A 1P0CA 4OQZA 3VZPA 4IZHA 1KIFA 4PFJA 1FDSA 2X6TA 1EQ2A 1W6UA 4ZRMA 1BXZA 3DZKA 3EYWA 5F1KA 3CMMA 3TZHA 1PJTA 4ALJA 3DZBA 3UN1A 2DBZA 2OOSA 4UEKA 1WZEA 1B16A 3GF4A 2VCYA 4J4HA 1U7HA 2VQ3A 3JD1A 2VNAA 1TI7A 5L4SA 1KEPA 3ETEA 3NJ8A 2H6EA 3PIIA 4BGVA 4D0RA 3NKLA 3ZWOA 1PS9A 4XQEA 4CMGA 4Q3AA 5TRTA 2YFHA 1QKIA 5C3MA 3JQAA 3K9QO 1C0LA 3A9WA 3DZHA 3DZGA 4NR0A 4UUPA 4L4RA 4XQ9A 3KUXA 3C3XA 3RROA 1GYQA 4GI2A 1CERA 3VPHA 4MP6A 4CM1A 3GPIA 1JLLA 4OH1A 3PFWO 4R1TA 3F46A 3DMTC 4PLTA 3DR3A 3RSHA 4E31A 1DBVO 4NDNE 3UCXA 5HS4A 4RF2A 4QQRA 2LDBA 2YYYA 2Z5LA 4PLYA 4PIVA 2J5KA 1GQQA 1QORA 1BWSA 3AUAA 5FYDA 5IG2A 5EQFA 3DHEA 1WVGA 1HDOA 2Q50A 4NH4A 4WOJA 3KYDA 4CM4A 3E5MA 3QWHA 3AM3A 4CR8A 3WYBA 2O4CA 1JDJA 3Q3CA 4RVDA 4LW8A 4CM6A 1N9GB 3U4IA 4BNKA 4ND2A 5IAAA 3JD0A 1JKFA 2P4HX 3GEDA 3AOEA 1GU7A 2FHSA 5C7OO 1HE4A 3B6ZA 1V6AA 3AU8A 4DBVO 1DOHA 3INGA 1JW9B 3W4JA 1HDGO 4BNXA 3EHEA 1T2CA 1AXEA 2EJWA 4OAQA 4LCEA 4PRKA 2IRWA 4WECA 4CMJA 2CVOA 1BVRA 3S8MA 3HDYA 4K9DA 3UGKA 2AEMA 3RASA 3V2UA 2CF6A 4YT2A 3PZRA 2DBQA 1EEHA 3PLRA 2B0JA 4KWHA 4L73A 4B7UA 4FFLA 3OH8A 4YQZA 5A4DA 1R4NA 4ID9A 5L7WA 3AI3A 2JHFA 3CPSA 1ENYA 1O6ZA 4INAA 1PL8A 1QLHA 3GGGA 1VKNA 5CPBA 3KYBA 5DN9A 1RYDA 4H7PA 1DXYA 1ONPA 3ZWPA 4FFPA 4ALMA 1YBAA 3S2GA 1XDWA 2D1YA 1LSJA 3GEGA 5BR7A 1I3MA 3EK2A 3K5PA 3JTMA 3WFJA 5CEFA 3UFXA 1EBUA 1GAEO 2EKPA 4RF4A 1EUCA 4Z3DA 1KVTA 4BVAA 4FJ1A 4GWGA 3KLPX 1XQ6A 4DBZA 3NDJA 3JQAD 2RBEA 1KERA 1MXFA 3AOGA 4XGNA 3KOUA 2PV7A 3IQDB 4L8VA 5JDCC 2X0IA 2Q4EA 5DF1A 4FFOA 1AGNA 1O89A 3PEFA 4HFRA 3U4HA 1E3LA 1LRKA 1MG5A 1P1JA 5TC4A 4YTEA 2TMDA 1QYXA 1K3TA 5BSGA 1H93A 1HYHA 3RC1A 4DIFA 3IAHA 1R16A 4M86A 2X1HA 3A28A 4EJ0A 4ZQHA 3ROMA 4RPKA 1XGKA 3P2OA 1AXGA 3UICA 3T7EA 1ISGA 3HWRA 1OI7A 1NFRA 3ZU3A 5G4KA 2QIOA 3L6DA 4M55A 5LDGA 4CM3A 1JU9A 1U5AA 1CRWG 1Z45A 3PQDA 4YACA 4BNHA 3WYCA 4Z9XA 1UDCA 1HETA 2P9CA 4YB8A 3I52A 1ZEJA 3PHIA 3RC7A 2O3JA 3LK7A 5CG1A 4FN4A 3U09A 4WK6A 3ICPA 4DC0A 2Z1MA 2PD3A 1SAYA 1RM5A 1ZVMA 3C8MA 3I23A 4J2HA 3FTPA 4U5QA 3VH1A 2Y99A 1KEWA 1NR1A 3Q1LA 1M66A 4EDFA 4XYMA 1GV1A 1HE2A 1K5HA 3VTFA 4NNJA 1KEUA 4YT5A 3I9NA 4JJFA 2O7QA 3VPXA 1ZKMA 2VOJA 4KZPA 2O3QA 4P4NA 1YKFA 2PWZA 3QWFA 2OMEA 5AOVA 2GN9A 3IUPA 3M1LA 2X9GA 3SC4A 2GR9A 3X2EA 4PGFA 1LLUA 5CDGA 3E1KA 4RPHA 1PTJA 2PGJA 3GRKA 4TRRA 3ROPA 3RU7A 2FN7A 4BNLA 1ZJZA 5U4QA 1YL5A 3LVFO 3WLFA 1K0UA 4E0BA 3V2HA 2I99A 3RQSA 3K2BA 5BNFA 3VAZA 4DMMA 5IXSA 3ENKA 3E9NA 1H94A 3MJVA 3CZRA 1PGNA 1B2LA 3NJ4A 4BO5A 3F1KA 3ZHBA 3IP3A 2X8LA 1NBOA 4YJHB 2P5YA 2H9IA 3HUDA 1DRUA 5L51A 4B3JA 1H9AA 4J4TA 2QZ9A 4IDCA 1SEVA 3H9EO 2YDYA 3SJ7A 3HFGA 2V6GA 1T24A 1A5ZA 2YQ5A 3AUUA 1V0JA 2OORA 1VRWA 3CEAA 1GQ2A 4KOAA 1ZUD1 3PZBA 2WDZA 1D8AA 2HMVA 4ESOA 4MOWA 2BLLA 1B3BA 1EVIA 1E6EA 4ZICA 2LDXA 4KUEA 3D4OA 3TDKA 1DLIA 2GDZA 2C20A 2HAEA 3HG7A 4WLVA 4CLHA 5A06A 4DLAA 3E03A 2PZKA 3LLVA 4TRJA 2H5LA 4LMPA 2E82A 4TVBA 4ND4A 2BRUA 2O2YA 4R51A 1ORRA 5GMOA 5JAQA 1GFSA 2B83A 2CDAA 5HWSA 4EUEA 5A1TA 3E6AA 1I2BA 1A72A 1XLTA 3M6IA 2OXIA 3PWKA 1YBMA 2YV2A 4AL4A 3TZ6A 2VZ8A 3MOIA 4Q39A 3W6UA 4GGOA 2VZ9A 1Z82A 2B37A 4YQYA 4DWVA 4Q3CA 3O26A 3ZDFA 4YPOA 1EFKA 1BXGA 4JP2A 5IZ4A 4H16A 1KETA 1N5DA 4J9UE 1P1KA 4DIOA 1ZEMA 4EW6A 1CF2O 4XX0A 4J4BA 2D0IA 4KTVE 1LC3A 3H9QA 3HHPA 5KVQA 3WWZA 9LDTA 2IEDA 1VLLA 3E18A 3LYLA 4J16A 3HQ4O 3DEYX 3DOOA 4GH5A 4XR9A 3GDGA 2PFGA 5L53A 1IB6A 4FC7A 4CPDA 3ZU2A 2WYVA 3D0OA 4RF5A 4CMCA 5HBRA 1IPEA 1SZJG 3AY6A 2G5CA 5GZ1A 4DUPA 4Q3EA 2OUIA 1JAXA 4YAKA 1WDKA 4OKNA 1LSSA 3KXDA 3WMXA 4GLOA 2O50A 3A06A 4M54A 1PWZA 3JV7A 3PQEA 3ST7A 3WGZA 1N9GA 1C0KA 3DFZA 1DIGA 4JBGA 3GNSA 4DQXA 2GERA 3F6YA 3R3JA 2OFPA 2RCYA 1PS0A 4WLNA 4D79A 3WSVA 3JQBA 3WYEA 3KV3O 4OL9A 4CMHA 4ZGWA 4RZHA 1FDTA 1E6UA 3NUGA 4ZVVA 4MP3A 5MDHA 1DLJA 5CDYA 3FI9A 2P91A 3RUFA 5U9CA 4N18A 5AQ1A 1I2CA 3AM5A 2AEFA 1NHWA 3U4CA 3G0OA 1BRMA 2CF5A 3ZWMA 2OZPA 1B7GO 3SEFA 3VZQA 1NPTO 1E6WA 5G0SA 2GZ3A 3GLQA 1DC5A 4B3IA 1UZMA 4PVDA 2PA3A 4RVHA 1TT5B 3BTVA 4E21A 4PLZA 4ZHSA 4E12A 3MJSA 2C2XA 4JIGA 2OHXA 3ZWXA 5DOZA 1B14A 2UAGA 2Y0EA 1AHHA 2HCTA 3E8XA 2X0RA 1UUFA 3DWFA 4OYRA 1WLYA 3UAGA 4CQMB 1ADCA 1O0SA 2G0TA 5KWEA 2WYUA 4IZIA 2D5AA 3MJEA 4BNVA 1WXDA 3BTUA 4JBIA 4N7RA 2FSSA 1GY8A 5A9TA 1D1TA 1I32A 3FPLA 1P74A 4II3A 5F3RA 4TKLA 2P4QA 1YBVA 3TQHA 3RC9A 2QQ5A 4FB5A 3PTZA 4OXKA 3NGXA 4BNUA 3RFXA 3CH6A 3GGPA 4DLBA 4KQWA 2VUTA 4ZRNA 5CFZA 1QV6A 1B8UA 2C07A 2O3SA 1ZNQO 2D3TA 1U2DA 1UXJA 3ADPA 3I6IA 2UYYA 1U8FO 1CETA 3MWEB 4QSMA 3WB9A 4W7IA 5BSFA 2EGHA 4OSOA 5TF4A 3VH4A 3LT2A 2VTEA 2EERA 3OBBA 2HDHA 3DAFA 5JC8A 3JYNA 2BI7A 2IXBA 3KB6A 3WXBA 3ZNPA 2VWGA 3S2IA 3EZYA 1ZO8A 5KIAA 5JSFA 1LQTA 1F0YA 3QWBA 4DQUA 1YQXA 4U8GA 1IHXA 4OJNA 1A4IA 3ZU5A 3DFUA 3DQPA 3OETA 2PH3A 2QRKA 1KVSA 5BNIA 5COAA 4YRBA 4PLVA 1O5IA 3N7UA 3O8QB 4BO1A 3ZV4A 4EJ6A 5J23A 1NPYA 1LJ8A 2P9EA 3KYDB 4NFYA 1DEHA 1NVTA 3DBHB 1DJQA 4DQVA 3BIOA 3F4LA 4E32A 3E9QA 2PY6A 5ITVA 1BW9A 1J4AA 5B4UA 1H6AA 2FMUA 2B4QA 1DC4A 4BV8A 4R1SA 5B12A 1T25A 4AJIA 5C37A 4JN6B 1V9LA 2H1SA 3EW7A 1E3IA 3JSAA 4DA9A 3WFIA 2HMTA 1JAYA 4ALNA 1PGPA 4KDEA 2VUSA 1M6WA 1NX6A 1P1IA 4MKZA 1UR5A 2EWMA 1NYTA 1Y5MA 3HN2A 5IDYA 2PZMA 4NI5A 7ADHA 3KEQA 4U6QA 2D59A 4I8XA 4JQCA 3L4SO 5I9MA 3TZKA 5B37A 1C1DB 4Z9FA 4YJHA 1ZJYA 4J0EA 4NK4A 5G4LA 3MTJA 1U2GA 4FS3A 3LU1A 3ZV3A 4C7JA 1K6IA 3GVXA 4M87A 2VOEA 3EVTA 2QG4A 5F5LA 2VHXA 2ZYDA 3E48A 4OIMA 4YAIA 2BGMA 3GC6A 4UEOA 2QZZA 4G2NA 1HDRA 2VYNA 3AOEC 1F06A 1RJWA 1P0FA 2VT2A 4HKTA 1CEQA 1V3TA 3AY3A 4IM7A 4ALLA 2ZJ0A 1SB9A 2DPGA 4OXNA 3WNQA 4P38A 1QP8A 2O23A 4D41A 2B5WA 2JCYA 4MJLA 4RDHA 5TJ9A 1T2AA 4RO0A 5F21A 1PJ4A 3K30A 4RGBA 3WGYA 4B7CA 4BKQA 2NVWA 1ISFA 4XQCA 2YHIB 2BFPA 5I7EA 1IZ9A 2PKQP 1VPDA 1P3DA 2C59A 3QJ5A 5A5EA 4RJTA 2AQKA 5HA5A 4AJ4A 3VHRA 3PFFA 4BB5A 2NTJA 5JO0A 4E33A 1LLQA 2I6TA 4XYGA 3EVNA 4D45A 1NASA 1NHGA 4FQ8A 3JQGB 2V6MA 2X4GA 1PX0A 2CUKA 3DOJA 4Y6SA 3VPFA 1F8GA 1P44A 5COBA 2IYPA 1EVYA 5A5FA 5IZCA 2JFHA 1VE9A 2E4AA 3W4IA 4XIYA 1PZEA 2GF2A 5CEJA 4IJKA 1C3VA 2AQHA 2DFVA 3EMKA 1YQGA 5IF3A 3MJCA 4CMBA 1OC2A 1YONA 1CQJA 1GUYA 2JKVA 3CSDA 3GN2A 1PR3A 1H2BA 3RBVA 4OQYA 4MVJD 1OBFO 2GN8A 4FJ0A 5IDQA 1P77A 1Y8RA 4XQGA 2FRDA 1QR6A 3GR6A 4IINA 3JQ9A 3GY0A 3FWZA 4WCFB 5B4TA 3COSA 5ENVA 1LQUA 1I33A 4PZEA 3C7AA 4HP8A 3PYLA 1UDAA 1V8BA 2J3JA 1PGOA 1T2EA 2W98A 4B79A 4IGEA 3LLSA 1YOVB 2I65A 3JQFA 1Y9EA 4GBJA 4W99A 3A4VA 3DC2A 4HY3A 4PLFA 5EERA 3PWSA 1A7AA 1Z73A 3NTQA 4J91A 3RJ9A 3ONDA 1UZLA 3ZW9A 1ONNA 4UUMA 4I5EA 5IXYA 3IJPA 4LSMA 4A27A 5L40A 3ZHYA 2EW2A 4DYVA 5GY7A 3V2GA 2O2SA 2BKAA 5TT1A 1HE3A 2DBVO 3WOHA 3GNTA 1MA0A 1DIBA 4E5YA 3FNEA 3GVPA 3ULKA 3E5RA 4IMRA 4O0LA 2JD0A 3Q9NA 4TVOA 1JVBA 5TNXA 2AXQA 1R0KA 3JYLA 3O9ZA 4E3ZA 1KVUA 1Z7BA 2JAHA 5G0TA 1PL6A 3M1AA 3GPDG 1R0SA 1S6YA 3GT0A 3QVSA 2I67A 2FP4A 3RKRA 1XHLA 4CQMA 3RUEA 4PRLA 2J5QA 3DO5A 3HSKA 3PI7A 5LC1A 1NFFA 3FPCA 4CR6A 3GK3A 2NNLD 4DMLA 5G0VA 3ADOA 4BNZA 1I3NA 3H3FA 4E5KA 1E7WA 4CM7A 4O63O 1JA9A 3RFTA 3DBRB 3TL2A 1TXGA 2O3UA 1X15A 4NU5A 3MEQA 2O48X 4W6ZA 5I9LA 1CJCA 4YJFA 2BELA 2BHLA 1VI2A 4ROSA 1PU2A 5A02A 4A03A 5KCZA 2R2GA 4XGIA 4MPDA 2PZLA 5DULA 4JNKA 2PD6A 4BO3A 4EZBA 1E3EA 1OC4A 2Q1UA 5CAEA 1I5RA 1I3LA 4OMUA 4TROA 5L7TA 1SNYA 3BA1A 4RLSA 4OKIA 3SLKA 4E2XA 4D43A 1LDGA 2DUWA 2I5PO 2HU2A 3DZFA 1GPJA 1ADBA 4E5MA 1U8XX 3S1LA 4E2YA 3UCFA 3KM0A 3MWDB 3PIDA 1UZNA 2J3HA 3ZHZA 1BXGB 5JS6A 3FR7A 1PJ3A 4IPTA 4OHUA 2PGDA 4U6SA 4AJPA 1ENPA 1HWYA 1ISIA 2IDZA 1YDEA 3NDIA 2Y1OA 2NU8A 4EGFA 5TLSA 1DAOA 5DP1A 1VKOA 1LDYA 5ER9A 5T8KA 1JKJA 1ZMOA 4QX6A 3PJEA 2PD4A 2ZYGA 3WR5A 2W2KB 2Q49A 4PLCA 2I3GA 4DREA 4P4LA 2ZB4A 2DTXA 3O8QA 5EN4A 1RKXA 1N7HA 2DVMA 3DBHA 3RUDA 3RVDA 4NK5A 5DNAA 5L7YA 2RHRA 1ZSNA 1DC3A 3QP9A 3H6KA 1R37A 4Q3DA 4TKMA 4A26A 4PVCA 3OHSX 4XR4A 1DJNA 4TMFA 4XWYA 1YS4A 5I9NA 1DSSG 1HF3A 3DZIA 1H6BA 4I9UA 2AG8A 3FNHA 3VH2A 1VJ0A 4DGSA 5MGBA 3L0DA 4CV3A 3FWNA 4CQMD 1HXHA 3QWIA 1UH5A 4FBGA 4IS2A 1W73A 4RDIA 1EMDA 4L4XA 3QSGA 5JXWA 5AYVA 1BDBA 2BFAA 1OAAA 3WTBA 1E1KA 1ZFNA 1B0AA 2VYVA 1C1DA 1ZXBA 1CYDA 2UVDA 1I2ZA 3A1NA 5T57A 2X86A 1JVSA 2NSDA 3OFSA 2JJYA 1EDZA 3KYCB 4RVFA 2NVUB 3KVOA 3SLGA 2O3RA 1P45A 3FR8A 1T1SA 4NJMB 2P2SA 1L7EA 1R4MB 3OEYA 1G0OA 3VTZA 3JD4A 1NWCA 1HZZA 3OQ1A 2DU8A 4J1NA 5H83A 1DIRA 3DB2A 3WWYA 4CL3A 3C1OA 4O1MA 5KVSA 3INRA 3WJAA 3ABIA 4L4SA 5IFLA 4LGVA 1GR0A 2J3KA 3F9IA 4MVJF 4L0QA 4Z0HO 3JQBC 4JJGA 1JTVA 1QRRA 3S2EA 5COQA 2AQ8A 3S55A 3GUCA 2EJVA 3ONFA 2D4AA 5K9ZA 5LDHA 1G6KA 4MVJI 2YHIA 2CVQA 3BMQB 2JAPA 2QW8A 3UCEA 4YRDA 4IXTA 3D64A 4IMPA 1WMBA 4RQTA 1V3VA 3L77A 5LCXA 3JQ7B 2Q2WA 2DAPA 2YFQA 3UF0A 1OOEA 4AFNA 4CMKA 1A27A 2FZWA 3G1UA 4MIOA 4PCVA 1U7TA 2BMAA 4KMSA 2GYYA 3JQGA 3ZWBA 3AU9A 3FN4A 3VVBA 1MV8A 5JPIA 2NWQA 3RC2A 5BQFA 4G65A 1HE5A 4IDBA 2EXXA 1K6JA 5A05A 4E30A 4E4YA 1DFHA 1DC6A 3TL3A 3WS7A 1V35A 3LDHA 4GX1A 4PG4A 3C7DB 3QWAA 4ZQFA 2I9PA 2IXAA 2QYSA 2QRLA 3MTGA 1T26A 2F1KA 4QFDA 4BO7A 3BTSA 2VWPA 1R6DA 1EBFA 2WWRA 1YQDA 4RLHA 2X5KO 1DB3A 4OOFA 3TOXA 3F47A 1E5QA 1T4DA 4IIVA 2DFDA 2EHDA 3V1UA 2EGGA 4IGFA 3S2FA 4WCFA 4PLWA 2VYVD 4BUCA 4YEDA 3V8BA 5ICSA 3H8VA 4DTIA 1IULA 1YOVA 1BW9B 3KSDO 4BNYA 3OJFA 4IDFA 4R54A 4R1UA 3W8FA 3UW3A 5I8WA 5CHEA 3TWOA 3TJRA 4Q3NA 3VKVA 4K26A 4MVJG 3DAGA 1FDUA 1GL3A 3B70A 3HZZA 4U0KA 1B15A 3AM4A 4CLEA 8ADHA 3I3OA 3I5MA 1QG6A 1HDYA 2DBRA 3BZUA 3IP1A 3LZ6A 3ZNQA 1JQBA 1O94A 2UUOA 1X0VA 2PKRA 1CWUA 4XYEA 4K1LA 5DOVA 3H3JA 1WNTA 3F3SA 1E5LA 4FSHA 3W1VA 4UULA 2NACA 4BS9A 3C24A 2HK8A 2QRJA 5BSEA 2GGSA 3PDJA 5JAIA 3JQ8B 1ULSA 3PJFA 1ADFA 3IKVA 3L6OO 3AFMA 5CDTA 2HQ1A 3KO8A 1GUFA 2O7SA 1VSVA 5F5NA 4IY1A 1PSDA 2IZZA 1PGQA 1SPXA 1WAMA 5DCUA 1RM4A 2VUUA 3DBRA 2BGKA 1P1FA 2OL4A 3FSRA 1YDWA 1N1GA 1SC6A 4ZU3A 4IIUA 3R6DA 3NYWA 4BV9A 2B35A 4GVLA 4EITA 1H2HA 2C54A 1BXKA 3P2YA 5H82A 5TX7A 1CIVA 3GOHA 3VVCA 3W8EA 4XDYA 1VSUA 3IC5A 4RVUA 4D0SA 4AJ1A 5FFFA 1IL0A 2DPHA 2HUNA 1G1AA 3GA0A 5DZSA 3HE3A 1OMOA 5KJCA 4RQUA 4OSPA 5JAZA 3WJ7A 9LDBA 1T2FA 1LRJA 4GKBA 4FOOA 4BGIA 3B1FA 2ZQZA 1BGVA 2R00A 2WYWA 3FBGA 4CL8A 2FPPA 1EE2A 4RCVA 4A2CA 1ISHA 3GFBA 3VZSA 5KNLA 2P5UA 2ZK7A 4CODB 4UVIA 4I9NA 3GAZA 2HLPA 2GNAA 4F6CA 5JC1A 1HKUA 1LXCA 1YRLA 1PR9A 2PNFA 5JO9A 3ZWYA 1PJCA 2JFFA 1PZFA 4ND1A 4RV9A 5A9SB 2V7PA 2W2KA 1AE1A 5ICMA 1M2WA 1I01A 4ZJUA 3HNPA 1NQ5A 1Y8RB 3BHIA 4M1QA 4EEZA 4M49A 4CUKA 4DRYA 1U3WA 3ZHXA 5A9RA 1D7OA 4X54A 4IS3A 2YDXA 1MC4A 5G0UA 3KZVA 4BO2A 3ZWAA 4WJZA 2CY0A 1ZK0A 4IDDA 1BTOA 1QYDA 1A4UA 5T64A 3U62A 4BQPA 4WKGA 1I3KA 3EUWA 3PQFA 4UVEA 4CQLB 2GZ1A 2NV6A 3K73O 4ZQEA 2X22A 4F3YA 4UVHA 2Y1DA 1Y5RA 3CXRA 4OOEA 3DTTA 4MDHA 6ADHA 5IZCC 3ZN2A 3PYXA 3LF1A 1WWKA 2A35A 4YA6A 5F1PA 1PS8A 3BHJA 1ZK2A 1IZ0A 3W8DA 4J1TA 2QYTA 2VN8A 3VZRA 3G17A 2J5RA 3OM9A 4A7PA 1OZAA 2VTDA 2XXBA 4KWIA 4S1VA 4UVDA 2RH4A 2WE7A 1BHSA 2NVUA 3KYCA 1H6DA 4FFRA 3V1TC 1SB8A 2X5JO 4PZDA 3WGHA 4EJMA 3QVWA 4MP8A 3K31A 2HO5A 2ZIZA 4NJMA 2BF7A 4PG6A 1R4MA 2J6IA 1B8VA 1NVGA 3IJRA 4CR7A 3H5NA 2A4KA 5F1OA 4YWJA 1HL3A 3ASVA 3GDOA 4BO9A 2Y93A 3QV1A 1BG6A 3QQPA 4K6FA 4AJJA 2X9VA 2DM6A 2NU7A 2UUPA 2XXJA 4AJLA 3QE3A 5AXBA 3RFVA 2FPIA 2FY8A 3OIGA 1ZSVA 1AUPA 3GNQA 4YDRA 1B3RA 1HDCA 4YJFB 4PG5A 5JW6A 1GD1O 1IE3A 4HXYA 4UEJA 1DHTA 4GX5A 4NBTA 1X14A 2FWMX 3TPCA 3K96A 3OIDA 3BMQA 1E3JA 1E1LA 3F5QA 5ES3A 5KVVA 4BNTA 1GUZA 4CM8A 3QVTA 3JQ7A 1QSGA 4GVXA 1I36A 1L7DA 1A9ZA 3JQDA 1SEPA 2Y05A 3PK0A 3OJOA 1X1EA 1FMCA 3KLMX 3DMYA 4B3HA 3NTRA 3MJTA 4ALIA 3D5QA 3AJRA 3PXXA 4N5LA 5BNTA 5ADHA 1I24A 3WBFA 2PH5A 1BSVA 3ETDA 1T2DA 3OQBA 4WGGA 3OA2A 3OQ6A 4BO6A 3Q2IA
chains in the Genus database with same CATH superfamily
4Y9DA 1BE0A 2Q2NA 3UY4A 2YIJA 2ZJFA 4HB3A 1BEEA 3CQ9A 1XA4A 1GPYA 3K1JA 2ZIAA 2HRRA 1XR3A 4LNHA 2DWQA 3S4YA 4FCTA 3HACA 4GE3A 4R5MA 3MSCA 5JSZB 4JI3B 3AB3A 3LP8A 3RVSA 3O3MB 3LC1O 2WR8A 3A36A 2HMSA 4R41A 4QBIA 3SICE 2V5AA 3TNDA 2V7GA 4FLEA 4YQFA 1CDDA 1UJNA 3QXHA 4GMHA 4W1QA 1RM3A 2ZXFA 1MX3A 3KSUA 2O8FA 4KDFA 5FTJA 5DM0A 1ZM4A 1H6CA 1I9GA 2UZ0A 3QITA 1U9IA 7YASA 4F8YA 3KJQA 3TUIC 3KTDA 4WKCA 1TGVA 2HEGA 3ITDA 4QHTA 2ZUBA 3AEKB 3ICQB 1X2EA 2AN1A 1G2OA 2HTEA 3ZXSA 5EINA 3T5GA 2I6GA 3V5NA 1JDUA 2X3YA 1OU4A 5IWCA 1V7ZA 1O96B 3M89A 3IEPA 5IABA 4QYMA 2X0FA 2O8DA 3RJTA 2HDNB 2ONZA 5LXTF 3I37X 4B4OA 1F38A 4ARUA 2XQJA 5T6BA 1II9A 3MMXA 2BMFA 3H2SA 3GHYA 2J0UB 3BWVA 4KN6A 3P7MA 1CZKA 1DIHA 5TIIA 2VTKA 4OBEA 1HFKA 1OJLA 5G1NA 3K2EA 2J3IA 6PFKA 1NVKA 5FUXA 4HADA 2P5TB 3RU2A 4QUAA 4W8GA 1RYYA 2FEMA 5GZ6A 5TARA 1T5OA 2PS9A 4LYAA 4CL3A 4XWOA 4V1CB 2NVBA 5J2UB 2GASA 2QQFA 2DTEA 2QSZA 1YU9A 1K8XB 3U61B 3FCOA 4XDGA 2WG1A 2ZB3A 3IQZA 3OWOA 4DIUA 4R81A 3FCCA 3AVWA 3IIEA 5FADA 4ZCSA 2JATA 5JCOA 4E51A 5DHPA 1UKCA 1C9DB 2WUFA 4EY8A 2QRQA 3WNDA 3ZD9A 3NWEA 4Q1AA 4CLDA 2GSWA 5HMLA 5J5VA 1SUAA 4PWYA 4BIMA 1TPYA 3P26A 2YASA 4YP5A 1SC4A 5CVJA 4NCKA 2C4MA 3FTCA 1V6CA 3FTDA 3V3TA 4MROA 3D3EA 3ON5A 4AJEA 4JI5B 2GEUA 4DR2B 1XCJA 4AN0A 5FP0A 5H7XA 2DLDA 3C98A 2XGMA 2P11A 3O8BA 1DAPA 5WRFA 1NZJA 1QYRA 1OWLA 1U3FA 3QPVA 3OMLA 1TO1E 2JIBA 1JJAA 1TO2E 4NBNA 4HYTA 4QSHA 3TAXA 1LNSA 2AA3A 3AKEA 2LE0A 4V0MA 4Q9HA 3UGJA 5JMPA 1OXVA 3EARA 4QFCA 1QYCA 4GXTA 2DC1A 4Y67A 5LP6A 3CUWA 3T4XA 1JL3A 3OLVA 4X0EA 3G49A 3SMQA 2OHVA 4BLWA 1JHMA 1ZXLA 4BNGA 1ZCJA 5B1YA 2VP9A 3CX4A 2G1KA 1T0IA 2Q0SA 3GEIA 1DKQA 1HEIA 1GGNA 2GO1A 2JLCA 5CW1A 5CYPA 4JXZA 1Y7LA 1O95A 1Q16A 1ZIDA 4QFBA 3R3VA 3R9KA 1U7XA 2POQX 1L1EA 1MO5A 3UUFA 2Q4RA 2V5UA 3QPCA 5AM0A 1RXSA 1E58A 2EX4A 2IXDA 3H17A 4K6CA 3ZQ6A 1FJGB 5DHUA 2VPQA 2IHJA 3TEJA 4GG1A 3LBNA 1YI1A 2HMYB 3H7IA 4IAOA 3MCVA 3IKTA 1ODLA 2CDRA 4HGPA 4KMOA 2VBGA 4RNDB 3DDHA 4KKXB 1W34A 1KWKA 1N32B 3NT2A 1Z6ZA 4FEGA 1ZOLA 3SKXA 1OBOA 1CK4A 4ZVQA 4HEJA 1CZRA 1JSCA 2PMBA 2RAVA 4N7JA 1JQ3A 3EXFA 5GJWC 3G68A 3FPHA 2EX1A 1DFIA 2VDPB 3LX6A 2QP9X 3W9BA 7REQA 2DQ4A 3AHGA 4NONA 3PRKE 4QOGA 3DHWC 4TMKA 5DMXA 1RZUA 1Z3CA 2A7QA 2QTLA 4CF7A 4GYYA 1CEXA 3SYRA 1U0NA 4MZDA 4RE5A 1WNFA 2ZI9A 3L8CA 1OXSC 3TKLA 4HV4A 3K4PA 4XYLA 4U7JA 4TS4A 3OIFA 4GL4A 2W7TA 1DC8A 1LLCA 1ZJJA 5K3BA 4GE0A 3SQXA 4BFZA 2YJZA 1O6GA 4D4KA 2ZSAA 4B2IA 1RQPA 3G02A 2W2TA 1SCNE 2Q0QA 3M7IA 1U8ZA 5EZYB 1DIAA 3TFQA 4DJEC 4RJKA 4EKEA 4EL0A 1XALA 5BWCA 2XUQA 3G2HA 3MELA 1ZK4A 2N1BA 3ZWCA 1OX6A 4NMLA 2NXWA 3OJ0A 2VYND 4OV6B 2AC7A 4JBNA 5GQSA 3RIHA 1Q7BA 1QHSA 3WIEA 2ZT8A 1H0RA 4M9UA 2ZTVA 5T7BA 2Q1XA 1ZLYA 4D0NA 3C87A 3RRBA 2IS1A 3K0CA 1Z25A 2BEWA 4YLYA 4F84A 5HKBA 5C1BA 2QUAA 4DEVA 4HUTA 5JYEA 2C8JA 4OI0A 4HJXA 3CFYA 2WIFA 3D4BA 3Q8MA 3G85A 1OYWA 2V65A 2XVAA 3AL2A 1NN5A 2JCVA 3C1TA 1ZH0A 3E3OA 1E5TA 5AVJA 3EF1A 4FK8A 1O9BA 1RRFA 5FBHA 4A5OA 3HJAA 4DV3B 2CCKA 2EZ8A 3V8MA 5BPHA 1U99A 3F67A 1TVCA 1KZ9A 4PAGA 4TTTS 3VMFA 1KXJA 4CMEA 1LSUA 2FMTA 3FHCB 1CY2A 3WGKA 1MR3F 3HXQA 1KS9A 1NJ2A 1LS1A 1TU3A 2WQZA 1KAOA 4HH1A 4G8DA 4US2R 4EVSA 1QNLA 1F14A 1T1RA 4O4JB 5AXDA 5A5VA 2HJVA 3EMVA 1W88B 3LCUA 2PUEA 2I87A 3NT4A 4JWTA 3ZHQA 5C5IA 1TC2A 3GZTB 2HQRA 2A57A 3N2YA 1N7JA 3IFSA 1US8A 2OESA 4IH1A 5BSVA 1CNFA 1Z4QA 2IE8A 1EDOA 3C5WP 3GJRA 3A14A 4NZOA 4CKWB 3HCBA 3OT5A 1X9HA 3ECAA 2NU6A 2BZ1A 1U3UA 2CDBA 2C9YA 1LV7A 2PQ0A 4QOSA 4CKZA 4CV1A 1AKYA 3PSHA 1Q44A 3RC8A 2WFLA 3MXOA 5HKOA 3ITKA 2GJSA 3GG9A 5KNBH 3IE1A 4MRRA 5JASA 4OF4A 4DJFC 2D2IA 3VX3A 4P93A 3ZDQA 1CUBA 4MS3A 5J5CA 1LA2A 2A86A 4JYZA 5JMWA 5B4VA 3R74A 2WWIA 1EVJA 4P4SA 1A5TA 3I6MA 3OO1A 1KGDA 3O9MA 2Z2YA 2DTDA 5CD1A 4ARCA 2YS7A 3B2EA 1XN1A 4R84A 1WDMA 2QTNA 2OBMA 1T4CB 3I9MA 3U7FB 3MRSA 4N0DA 1BX3A 1HOXA 5A7HA 3IDAA 3QKRA 3R7WB 2VO1A 2P78A 2OGWA 4DIBA 3Q11A 4CLOB 4I19A 4YYZA 5ICFA 2IY8A 2HFKA 3ROTA 1Y7PA 2X2OA 3DAPA 3DKRA 3O3NB 4H6VA 4DNOA 2ZSBA 1NVWQ 2Q45A 1D07A 2NADA 3AERB 3LOUA 4RIHA 1XYGA 5DBOA 3I9V1 4DVJA 1QTQA 3PRJA 1CUSA 2OSVA 4YCJA 4FDUA 3I73A 3ZHCA 1U7DA 3OT1A 1P9WA 3GNLA 3JZDA 3NNSA 4O29A 4PLHA 4PO1A 4Q4AB 2ANBA 3ZK8A 3U80A 3T1HB 3E05A 5JG7A 1Y80A 4IHKA 4B48A 2P41A 3PHLA 1NJ1A 4M0KA 2GB4A 1MO2A 1U3VA 2B2XA 3DS8A 2QPTA 2H5JA 2XRYA 3IV6A 5J63A 3VNAA 1XEAA 4BX8A 1I14A 5GV7A 2P2LA 3OCUA 3ZI7A 3GVIA 1ISPA 2RJOA 2QNIA 4NG5A 3TGWA 1AU9A 5A4AA 1Y81A 2QE7A 2C5AA 4Q34A 4C2AA 3IX7A 4MHTA 1VLJA 4KE9A 1ZNZA 4UHFA 1U0GA 4HB2A 4G8BA 1FFYA 4C76A 8GPBA 2E2WA 2ZRPA 3V8QA 2VA9A 3G5UA 1N7GA 4GPTA 3AVXA 1HC7A 3OSUA 1KK1A 1NVAA 5JE8A 4K6KA 2FOIA 2R8EA 1TM3E 5CVDA 5FHQA 3UO8B 4AJHA 1H4QA 1XCGB 1FPMA 4AF6A 4ZDKA 2O5EA 2QHXA 2ZKLA 3TOCA 2PK3A 4YMIA 3I0ZA 3LT4A 4IKOA 4MV3A 5KVCA 4TUYF 4QXMA 4Q24A 5FR2A 1MJHA 1C14A 2WAXA 4U7HA 5CB4A 1OE0A 1SC9A 3I53A 3MRXA 4KLNA 5BV7A 1CR1A 1J07A 4IVNA 2JBAA 2JPDA 1W4ZA 1Y8CA 4LRTB 4IHJF 3TTYA 4BMPB 3WLHA 4FCVA 1KK3A 4GMKA 2GQ0A 2AN9A 3I6ZA 3EWIA 4MK4A 3ZWWA 1SOAA 2GKSA 5F7JA 2YWCA 3CTPA 2BE9A 1SCDA 1RBMA 1KPHA 4CIVA 3ANLA 4DC1A 1G6Q1 5C1IA 3R1IA 2UXBB 4Q1VA 4WZAE 1XKQA 4NZ9A 4XVCA 1GEEA 2NUAA 4A0SA 2P8SA 2JRLA 3BILA 3QG1A 5EGSA 3QKWA 4F9TA 3RU3A 1XCPA 3LBFA 5DX0A 3FETA 4Z9AA 2JC3A 2JL1A 1V5WA 4NENA 2PWBA 3V4SA 1UBKS 3E0XA 3LQYA 1IBSA 3FCEA 3Q41A 3WK4A 2CSXA 2QR2A 2ZDGA 5GVRA 1FK8A 3MM4A 5HGJA 4A2PA 2ACKA 1JJ7A 4CM8B 5K8UA 3BF7A 3EAFA 3L7AA 3HUEA 4QUIA 2B82A 2JJQA 1EFVB 3KP1A 1PGJA 3F71A 3ZV5A 4LOJA 1CRPA 1L8QA 4R8VA 2IY9A 2OV2A 2JW5A 1F0NA 1GCUA 4G1BA 3GJ4A 1VP3A 4LVUA 3BSSA 2P9GA 3PT9A 3P2JA 3WRYA 3TK1A 1ID1A 3A1VA 2C2MA 2NU9B 3RV4A 2HIMA 3ZZ0A 2V7UA 4KQCA 4RQAA 1U2PA 4NQZA 3EMDA 1J9ZA 5CR9A 2PFSA 1JBQA 2FZ4A 1Q0RA 2PGLA 1VBNA 1VG1A 1WMAA 2FR0A 2W90A 3QFHA 4OG2A 1W75A 5D3MA 1Q2XA 3RUCA 3SDZA 4EHFA 2FGJA 1WW8A 4A8TA 1MJ5A 3KTAB 3BMOB 4IJVA 1IBKB 2CV0A 2FCAA 1ECLA 2DMRA 5CFMA 3ZGVA 4D81A 1N2BA 2OBXA 4Y6OA 1KNXA 3TLYA 1Z56C 3WNVA 4EY6A 3KVNA 1U7ZA 3T9CA 3DO8A 3A2MA 3LA8A 1YK1A 1VBKA 3E70C 1U4NA 2CVFA 1LJUA 4TV9B 2QN8A 2FRXA 1DJMA 1USIA 3UB4A 2P9JA 4HOYA 5EPUA 3S2ZA 5KQRA 1GZ4A 1Z8DA 1RVDA 2XWBF 4HX5A 5HIJA 3RI3A 5JZBA 3H6HA 1L9XA 4LVCA 4PG7A 3WG9A 3ZW8A 4NAHA 1BN7A 4BRUA 2OAEA 4TV8B 5LU9A 5CYGA 2PT6A 5DTRA 2J1LA 3AFOA 3ISVA 5KX5A 5IT9A 2ZS7A 2O8DB 3OP4A 1A8UA 3TSCA 2QX7A 4MW1A 4FX5A 1J8MF 3E3LA 2OM6A 5C7YA 1E96A 1L6IA 1UKYA 3BX1A 4F8JA 2H59A 3V33A 4IOKA 1RWMA 3AF0A 4B6EA 2SECE 1J5XA 4S05A 1JVNA 1SCBA 3LZCA 1N6LA 3LRXA 3VR4A 1NI4A 2XWPA 3U7QA 2F90A 3BN3A 5E3JA 3WSWA 1Y8QB 1F12A 4MULA 1C3EA 4MYRA 4KQFA 5DN6A 1P9NA 3T7TA 1IYZA 1L2TA 3OFVA 2PZJA 5H4GA 4Q1DA 5SZHB 4EAAA 5KDLA 3UC5A 1NSYA 2J41A 2C7OA 3K15A 2GWHA 3AUJB 3CW2A 4G85A 3TB6A 1J49A 4AZ0A 1VL5A 3ND7A 3TI9A 4BEWA 3P9YA 4HD8A 1IOWA 2NUPB 3PYMA 2A14A 1KEKA 4ENTA 1H0SA 8AT1A 3D7LA 2WNSA 1IWPB 1J33A 1HRDA 4YCDA 5EXDA 1G42A 4PSKA 4UM9B 1TEHA 4EKNB 3DBLB 3BCHA 4K9KA 4MS4B 3TRFA 5GJVC 3PQ3A 3RBZA 1G5IA 5LVAA 2ECKA 5JSYA 1XZQA 3FPFA 1T0UA 2R7AA 1TA4A 3G1TA 3OTWA 4MYDA 5DM1A 3K4HA 3KYJB 4DDUA 1Z6TA 1G2QA 1VLMA 5IJZA 3OURA 1M6HA 2GPSA 4JODA 3GLIB 1ONBA 2XE8A 1C1XB 5IFKA 1FXSA 4MVJP 5E3IA 1NF2A 4KBFA 3JALB 1KSJA 2QG9A 4HDCA 3UH1A 3DP9A 5IPFA 3MUOA 3M6FA 1ARZA 3MWFA 4DJDC 2P1DA 4IJWA 4L78A 4KNYA 3M1IA 1BZYA 5ELXA 4WXHA 4ZYZA 3I4FA 1EXMA 2C8LA 2ZJZA 4GWKA 1QZXA 1T6YA 2PLAA 4JV5B 1RQRA 3U44B 4X7PA 4LJRA 2G1PA 3RRZA 4LIPD 1BRTA 2CYCA 2Y4NA 1SH7A 1PQUA 2P3SA 3AF3A 2QVBA 1JNXX 3T9FA 4AKTA 1TT7A 4M99A 4Y1RA 1CQIB 2JAOA 2MU1A 3K9WA 4JLAA 3THYA 4IW3B 1NN0A 2HWUA 5DDIP 1V1RB 1ZWKA 1AK2A 3HNOA 1NJ6A 2GA8A 3PFNA 4KAXA 4QBKA 2P9FA 5AOBA 1M8KA 2YIDA 5H3HA 4OJTA 1N5JA 2WV9A 4ERNA 1PW5A 4MH0R 2QN3A 1CZNA 4F91B 2CSUA 2P2CA 4GZ6A 2C9BA 4FZRA 3H9UA 3S81A 1HDIA 5DGXA 2Q6LA 2I8CA 1YR7A 2O5VA 2GAAA 3QVMA 4GYKA 3WGIA 2ET6A 2D2EA 2VJPA 2CLMB 4QBTA 1VCOA 1EX7A 2RK4A 5FLYA 1Q91A 1N5IA 1FP6A 3IKMB 2UVQA 5KSOA 1KBZA 2ZCVA 1TUBA 4KQIA 3FTNA 1QIHA 5BUSA 4IG4A 4P86A 3ESDA 3L8YA 4P33A 4MLDA 2FG6C 2VT7A 1FSFA 2BSXA 2P4UA 1JMYA 2WD7B 1EYZA 1TCAA 5B3AA 1PV2A 1OILA 4R9NA 4JT4A 2DY0A 4DR6B 3LHKA 4J3FA 3ZDRA 3NP9A 5EXSA 4DJ5X 4I5DA 3PD1A 3S5JA 2F3UA 4UNRA 2CUNA 4F38A 2RGNC 3TMKA 5JATA 2O2JA 2DT5A 1VC2A 5BT9A 1R8JA 4OJKA 4BP8A 2G9RA 3CNOA 3WBBA 4N6NA 3C7KA 4NMXB 3IO5A 1JAZA 1OTXA 1QMGA 3BMCA 4PYNA 2ZTUA 4LXYA 1M6YA 1Y5LA 4E5NA 3Q2KA 4MYUA 4RHCA 1QU3A 2PSEA 1IAVA 2AXNA 3BK7A 3VH3A 2CMFA 4V39A 1D4FA 1NYLA 5FI5A 3ZD8A 1YU6A 2GD0A 2X7XA 2ODAA 1QH0A 3CMCO 4N76A 3P5SA 4JY7A 3K53A 4XZ3A 1U8TA 1R0ZA 2W93A 4DE5A 2JASA 2X9LA 1Z74A 2ZRDA 4I6EA 1SQ0A 4EPRA 2B5OA 2G9ZA 3JQ9C 1M0WA 1JAHA 2EW8A 1WEKA 3CZPA 3NX4A 4FYXA 2F1JA 5MN5A 1AO0A 2FMFA 3FWYA 3LYUA 2LCQA 3GLHA 3W9UA 3PJRA 2GBLC 3BJZA 4P2GA 5H9VA 1N1EA 4R2KA 3OF5A 5DISB 1I7LA 2GZ2A 3RS7A 3MNFA 4NFSA 3KCQA 1XZBA 3JQFC 4P4GA 3KOYA 1SVMA 2FE4A 2RH8A 4BLTA 3RQIA 5CCEA 3OC6A 1GA6A 1L4NA 1T34A 1YH3A 2B4YA 3BCRA 1P9LA 3ZCXA 1G7CA 3T7JA 4YR7A 4DQLA 5C5DA 3A2KA 2A1UA 3SM3A 1E2QA 2I7TA 1A9YA 1Q0QA 2J45A 1JR3A 2TYSB 1T3ZA 2I2WA 1ULUA 3B20A 4ONEA 5EWMA 2FSIA 4XSHA 1BCRB 1Q5PA 1G5TA 4GOOD 3X2FA 1A69A 5EESA 3M2PA 2VPPA 2PLNA 3FKSA 1K3UB 5TQ0B 2C1ZA 2NU6B 5HKKD 1E94E 2XMDA 3GV0A 3B1XA 1YL7A 3IT0A 3P9IA 4CF6A 5J2UF 3A4MA 2J08A 4ND6A 4JLWA 5D1HA 1PVOA 2EBUA 4P5PA 5IUNC 3SQLA 2B25A 2QPLA 5ALSA 2ZSIA 4Q12A 2EWWA 3O4RA 4NULA 1NF9A 4LI0A 4BLSA 2YY5A 5B1IA 3DCIA 3IS3A 1M6NA 3O1IC 4MS3B 1JMKC 4LQCA 4D96A 3EPJA 1AG9A 4PXSA 3EVZA 3FW1A 1BDMA 4C5BA 5KOIA 1HL7A 4R3NA 2QJWA 3TZQA 1R0BA 1P3Y1 2C0CA 4P4SB 4Q21A 3VDRA 4BEBA 1IJKA 2ATIA 4E6PA 5DI3A 4Q16A 2JNWA 4F4UA 4DAEA 5CDGA 4K87A 1R00A 1VJCA 1NLFA 2NZJA 3LF2A 3BWMA 1NONA 4ZO8A 4J7UA 1QIJA 4OXYA 1QVWA 5DRTA 1E8DA 2ZE7A 3ONEA 2GZSA 3WNZA 3UAOA 1UBGA 1U65A 1TCBA 1T9HA 2J3LA 5LKRA 2GCOA 3C6QA 2FCRA 2VWHA 4GR9A 4DCSA 1ODJA 2AFVA 3QE0A 3WBJA 5LQNA 3G0HA 3HKEA 2J87A 4RSMA 4GECA 1JKXA 2GAIA 2G9VA 1Z2OX 3ORFA 3ZE8A 4G5GA 4OQNA 2ZVDA 2WZQA 1EH5A 4UHKA 3G3EA 3A2LA 3K7EA 5K3DA 2QUKA 5DHRA 1MQSA 1MABA 2ZE8A 2Y1FA 4BE9A 3V4RA 1DGQA 3GRUA 2HSEA 3KQTA 4I55A 1JAIA 2A9FA 2LWIA 3COVA 4GBMA 4O2LA 1LDNA 2BBWA 4WK0B 1Z5UA 4L8GA 5C18A 1JFRA 3BERA 3AR3A 2BR3A 3LSTA 4G1FA 1YB6A 2WMDA 3I9V6 3VU0A 1E3WA 2RIPA 3GZNA 4YAGA 3NBQA 1AK9A 3IVXA 4RGVA 5LL6P 5LZ4A 1ZGJA 3LX8A 4FKBA 3JCZA 4TZTA 2I71A 4MVJM 4KVGA 3QOYA 3OIYA 1XZLA 2HLDA 3CJRA 1OY1A 5EJ9A 4WNIA 2CCJA 3I12A 3DFMA 3HVJA 1KSGA 1R64A 4IO1A 1BIFA 4CM4B 1W1IA 2Z3WA 3ZC3A 5K45A 1QAOA 1GPKA 2ZJBA 3LM8A 4W82A 4AYWA 5BUZA 1L7MA 3ANMA 3AW8A 2O6HA 4GF5A 2WJPA 2C7BA 5B6IA 2JFXA 1DBPA 2C95A 2WTAA 1ZN8A 2HSDA 2P75A 3C8UA 2GPTA 4MAFA 1IM2A 5EGNA 1F8FA 3TAHA 2LTAA 4P3XA 3O82A 1E69A 1XZCA 1JDPA 2XRFA 2FSVA 1UKEA 2JLXA 1C4OA 3KNZA 3PCRB 1HT0A 3BSYA 3ZOKA 1K5PA 2PPLA 4CUZA 2FPSA 4NCIA 4DNFA 2EBHX 1TW2A 2P7HA 4HC4A 2V6BA 4MQBA 5BW5A 2JBAB 4IDOA 1SZCA 1LK0A 4F21A 1YR1A 4GI1A 4PX3A 5C53B 4MW9A 2XNJA 1YZYA 3IR7A 4P3KA 3ZHUA 4RDCA 1RAIA 4U02A 2Q3BA 1IY0A 1M1YA 1R4NB 5EZYF 3U3DA 4DADA 2AXEA 1AGRA 1TQDA 1J20A 1DFGA 2IZ7A 4BFXA 1KAGA 1R15A 4A0HA 2XKAA 2G63A 1ENOA 4DABA 2RC6A 4N48A 1C81A 3Q0EA 3VO1A 4D3SA 4KG7A 2Q7OE 2IEZA 4G3XA 2PO5A 4UKDA 2DRIA 3HCCA 3RBXA 4MZXA 3UENA 3MPUA 2NUAB 1XDSA 4K28A 5P21A 3ZK7A 1PL7A 2MCFA 1E20A 4M76B 4MX8A 4FFWA 3ETLA 1K8ZB 2NIPA 5IC5A 1KQOA 3Q7PA 4C0QC 2HN9A 3H1FA 4BXOA 1QDEA 1SK8A 5ESWA 3QVVA 4B2LA 4M0MA 2QZPA 3UWPA 3TQSA 3DMHA 3P0IA 1ZNWA 4E5UA 5A62A 4UM8B 4HMQA 3WNCA 2X0NA 3NDBB 2BMJA 2WWVD 3SC6A 1M34B 4HO1X 2G7MC 3TRDA 1ZK1A 3SYNA 4Q19A 4YCSA 3NATA 4O4JF 3GG2A 4UEQA 3CRZA 1WV0A 3DXXA 3JRWA 2OZLA 4EJSC 1Y4ZA 1G8JA 3KEOA 5BSWA 3NQ41 5J47A 3MHTA 1Q1NA 2CJXA 3CR3C 4C7OB 3BS4A 4X71A 4F7DA 4ZVNA 2QGFA 4RIFA 1WMSA 4MEAA 3A7DA 3KJXA 1KFEB 1NE2A 4Q00A 2PUTA 4V0LA 4WXRA 4DW8A 4EJFA 2CVZA 4P22A 1G1MA 4CKEA 5JSUA 3R8CA 4B76A 3I9JA 5CVCA 2DQKA 2R9VA 4CETA 1CE8B 3QXCA 4HQOA 1I8TA 4YT4A 3GELA 3ACBA 2E37A 4J6FA 8LDHA 3DZJA 1NSTA 1NBME 1CQWA 2VDVE 1C5KA 1XRLA 2XUIA 2O19A 2RHBA 4UMFA 3GLGA 2AR7A 4RPIA 4HRAA 3UVEA 3D59A 3L9WA 3M9WA 3DT8A 3WGGA 1PJBA 2FWIA 2O54A 3GFVA 4RK0A 3KKZA 1A88A 2FB9A 4YP1A 4WZ6A 2HY7A 2XT9A 2PYDA 4PU0A 1EXNA 2ZATA 2ZS8A 5E9JA 1IJFA 1V9SA 2B36A 3BHMA 3HKDA 1WXXA 1AKMA 1A82A 2QUIA 1RLOA 2R751 4OLAA 1JFFA 4E5PA 2LKDA 1SG9A 3SN6A 3PGXA 1L4KA 1J0XO 1U7WA 2V7BA 2A1TR 3GLSA 3N5CA 3A4TA 4HNQA 1F6DA 4I81A 4ZREA 5H4HA 3VOSA 3WKCA 3WQHA 4B7ZA 1IN5A 5G3YA 5JNLA 1TMGE 3ZV7A 5ABPA 1U28C 1FVXA 1F5NA 1V7QA 2BTOA 3ZDDA 4YMLA 4ZEWA 4D92A 1PZXA 4R5HA 3DEHA 1GFWA 3NBKA 2HSZA 3L6UA 1C7QA 1QFSA 2PU5A 1I5OA 4OMFG 2WWYA 1W8DA 3DBVO 1AC5A 1Q1QA 1Z6AA 3IBCA 4KWEA 4ZO6A 3TZBA 1CRZA 3LWDA 4L16A 4C6SA 3FHJA 5HZMA 2JI6A 1AMUA 1XEWY 4MR7B 3SQWA 2F43B 4QLOA 2NTVA 3RTAA 2Q3LA 3TR0A 3QUSA 2B78A 3B36A 4UU1A 1SUFA 2PBZA 3RHSA 3WWEA 3JQ6A 1RKVA 5LMNB 3EIOA 4L5AA 3B7GA 1LSOA 1MRZA 3I2KA 4HMOA 3U49A 3KB1A 2GHRA 4DIMA 4I50A 1P6XA 4LBVA 1KDZA 3VPGA 4YO8A 5JU6A 5E2IA 1JH8A 2HRZA 3RS8A 2FRVA 2OG1A 5HMMA 4KBGA 1CU1A 4RVOA 3I30X 5K0ZA 3K1AB 3S44A 5TDHA 4QGHA 5DM60 5ADWA 1YGYA 5HZKA 2NN3C 1AQNA 2CDCA 4ACAA 2G17A 2Q1TA 2X5OA 1JHZA 3N0VA 1CB7A 3IVAA 1NIJA 3OEWA 2F7SA 1M1UA 4ZV4A 2V55B 4Z4EA 3BE8A 4QO7A 2F4NA 2WLTA 2Z43A 2DKFA 3GIDA 2B3TA 4KNVA 4G84A 2NQTA 2Q1SA 3GUYA 3VR2D 2I1WA 3U4HA 1YXMA 1T5HX 1ZSYA 4AJ9A 3DF9A 2GSDA 2IKSA 2VJAA 3TRJA 4MQFA 3H2IA 5KKNB 2V9ZA 2N0SA 5L9AA 4KAFA 1I0LA 2LP4Y 2WTUA 5FHRA 2EZ9A 4Y2GA 1RZRA 1ZW1A 4DNXA 4H7FA 4Q0MA 1BNCA 3TZLA 2E3JA 2WJYA 1QGUB 2QE6A 5KQLA 2OAP1 4BNNA 4EWLA 3HXOA 3ZIAA 2QVZX 2SKEA 2DR2A 2XOEA 1FJHA 1VMDA 1O94C 1WIWA 3O92A 4IWXA 3WLPA 3BD7A 5J2TB 1P2GA 3VHQA 2O8NA 3D7KA 4JMLA 1PWEA 3OWHA 1LPMA 3OUZA 4KXVA 1M2GA 1OTHA 1N5RA 3HBJA 5F1KA 4AF7A 1L7PA 3ETJA 4NV1A 3TZHA 4FW9A 3V97A 4ZCMA 3FPJA 4JJ7A 3CWZA 2OOSA 4TXMA 5K51A 3ENWA 3NKVA 2NUBA 1KRHA 4B85A 1B16A 1BXRB 4J4HA 4WAUA 2P3LA 2VQ3A 3JD1A 3UGQA 4CG0A 5IWAB 1TI7A 1O6BA 4KYUA 2ZWAA 4MHSA 4DG8A 2I9KA 2GZMA 4N3AA 4S35A 2BTEA 1BHJA 3DMFA 3LS2A 3O95A 4P58A 4D0RA 3TG2A 4CMGA 4IDQA 2JCBA 4UHHA 4Q3AA 1Y89A 4R1LA 5I9IA 1KMHB 5EQJB 3TBKA 1JHVA 1QKIA 5BUQA 4B40A 1Y4AE 5JCOC 3K9QO 3VOTA 1GP2A 1PAUA 5KTYA 3M49A 1GYQA 4GI2A 3DC7A 4LHSA 5TPZD 3V8EA 1P81A 4C3VA 3GPIA 3UQYS 3DVQX 4I7EA 4R1TA 5EPEA 1SBHA 1R5JA 2PJZA 5ALDA 3CHYA 3B38A 3AG5A 2JIPA 5KWVA 1FFEA 4RF2A 4EPYA 2VJNA 5EJ7A 2CLSA 4ZVUA 5CW2A 1A9OA 2FP3A 4LWZA 4V3CA 5FPPA 4PLYA 4C3UA 1A9SA 2WFMA 3V32A 5C8XA 4EFNA 4OX9B 2JA2A 3A6DA 3F98A 1QORA 1J1UA 1BWSA 5FYDA 4WOBA 5IG2A 3EZGA 5B55A 2FN3A 5EQFA 4ED9A 2IH5A 1YRAA 4CR8A 3GFTA 2O4CA 2XGOA 3FDZB 2BCEA 2ZYUX 3Q7SA 1OWNA 3BUSA 3H87A 4D9BA 4I0WB 2P6PA 4FGLA 3RT1A 1E89A 3JD0A 1JKFA 2J7KA 1CS4C 2JJMA 3AOEA 4OEHA 1M33A 4FD2A 1Z83A 1CJSA 3KE9A 4AKEA 4EH1A 4WBNA 5C7OO 1P60A 4R98A 4PYIA 2HW8A 1ZIOA 2BHTA 1EA7A 2PX4A 3K16A 5AHRA 1CHNA 2YNMD 2HNBA 4C0HA 3TM4A 3VU3A 1MC8A 5FQNA 4OAQA 3KZMA 4LCEA 1K5GA 5LZ2A 4Q4JA 2NO4A 4TV9F 5E7MA 2P2GA 4ARBA 5INTA 4OB8A 2AEMA 2M6RA 3JZFA 4C0BA 3C3MA 1E62A 2OCGA 4MV6A 4Z53A 1EEHA 2AOVA 2B0JA 2H4YA 3PUYA 3Q8LA 3GLHB 1QU2A 2OD7A 3OH8A 2W6IA 1DQRA 3OFJA 1PFVA 4PRZA 1CUJA 3AI3A 2I8AA 4KV7A 2YH2A 4TV8F 2EFEB 2VF7A 1NVBA 1XEFA 1ZS9A 2ZWIA 1QLHA 1M2KA 5BV0A 1VKNA 4TS1A 3KYBA 1YV9A 4QAQA 5DK6A 5DN9A 1MB2A 1I1NA 4ALMA 1ONPA 5DGTA 4FFPA 3ZWPA 2DQYA 3OWXA 1XDWA 2DFTA 4OSEA 1B4DA 2A1TS 1NATA 3FLAA 5BR7A 1YVRA 9MHTA 5F33A 4MCJA 3QVJA 1WE2A 2NV2B 3WFJA 3D6AA 3HJCA 5CEFA 5KOHA 1DU4A 2J3EA 1H69A 1C3OB 4ZVSA 3OBIA 4FE7A 5ITSA 5JISA 5J3JA 4BQOA 2BSQA 1FYEA 1PBNA 1JXMA 1N5OX 5HOEA 3JQAD 3H5VA 2F9LA 4JHLA 1Z0IA 3IAXA 5BYJA 2JLRA 1AT1A 1TZKA 3OU2A 4FN5A 2EL9A 2FPRA 3IQDB 4L8VA 1V5EA 1NNI1 2J6CA 2Q4EA 3IA2A 2X42A 5JDCC 2WINI 1ZCAA 2RB4A 1WXGA 3KQUA 3SIRA 2GCNA 5B3KA 1E3LA 1LRKA 1MG5A 1P1JA 1UK9A 3NNNA 2JFUA 3ETHA 2J30A 4N6OA 4Z0NA 4D82A 4H31A 1ZHOA 1Z0FA 4O5AA 5BSGA 3Q85A 3LPDA 1K63A 1Z0KA 2Q9BA 2REOA 3N76A 4RD1A 2M6LA 2QJRA 5ED0A 5EXXA 1IXSB 2H4JA 1RPAA 1I4WA 1V41E 1GKLA 2GCOB 1X80A 1A9QA 1FQOA 3HWX1 1V96A 3NTVA 4ZQHA 5KVSA 3ROMA 5I7HA 3I64A 1AXGA 2QX4A 2VJOA 3V1MA 1NFRA 3ZU3A 4NCBA 1P61B 1XK7A 4CTKA 1U5AA 1CS0B 1J8VA 2C3UA 1G20E 4YACA 4I55B 1VMEA 2DWCA 1JE1A 3ZZUA 3MWKA 2BH2A 3I52A 1ZEJA 2J9XB 1B41A 2B92A 2O3JA 3BCUA 5CG1A 2W2XA 5E7JA 4FN4A 2K2QB 3PFGA 1TQHA 3NNDA 4MMZB 1QO0A 3ICPA 3VR6H 3AKZA 1QYIA 3MERA 3QX9A 3AIOA 1LPSA 1RM5A 1XT6A 2ZP1A 4WFJA 3RYIA 1HO3A 1RHKA 1SC1A 4B8YA 2Y99A 1NR1A 2B94A 2IX9A 4FU0A 4EENA 4RTQA 1VJRA 2ZBGA 4FFVA 2B99A 1JIQA 1GV1A 3KU4A 3P9RA 3ABQB 1WD5A 4YT5A 4BBJA 3I9NA 1RP1A 1L7AA 2CN1A 4MGEA 1TAGA 4F4IA 4P4NA 1EBBA 1G4HA 3MGBA 1TM5E 3DXYA 3T7IA 2H7CA 2ISSD 4DR7B 4FHDA 3TLAA 3B6JA 4X94A 4X24A 3G9UA 4OK5A 4DTCA 5NULA 4XIFA 4EG0A 3FBWA 5DI9A 3E1KA 1B0ZA 1PTJA 3GRKA 4PQEA 4TRRA 5TQJA 3ROPA 3EVAA 4P0QB 3RU7A 2DEUA 4B3FX 2I2BA 4R6WA 2FU5C 3LVFO 5K0NA 1N57A 2CNWD 4NS1A 3V2HA 3U17A 1CVLA 5TEVA 1M1YB 3CU5A 2V74B 3P9ZA 3SC3A 4PTZA 3W5BA 1H94A 1RD4A 1P19A 1UFOA 5JSKA 3ZQJA 5LU8A 2YXPX 2Z0MA 3NJ4A 3V8PA 3IP3A 4TMVA 3PQ4A 3DV9A 4YJHB 5DH9A 1EI9A 2FN8A 3HUDA 3BVPA 3SQNA 2Z6QA 5SYMA 4P98A 5B1DA 3DCJA 4B3JA 4TKVB 1N3LA 2XMBA 3SJ7A 2YDYA 2V6GA 4MAAA 1T24A 2AK2A 3ZJUA 2NZUG 1MOSA 3D02A 1GQ2A 2ZVPX 4KOAA 4TOIA 2R86A 3WMRA 1HFJA 4BXOB 2VATA 2QNRA 3AT1A 1GUAA 2WD9A 2X76A 3C6YA 5IUJC 3WHLA 1P9OA 2HGZA 1T5BA 1K9VF 1XRJA 2OHHA 4QGAA 5LN1A 2NP6A 2LDXA 1R0CA 1NBEA 4GZMA 3REGA 1K97A 3D4OA 4OB6A 1DLIA 2IYRA 1Z88A 3CT4A 3HG7A 1SVOA 2A8YA 1SZDA 3LDUA 4CLHA 5A06A 4DCMA 4DLAA 5HXAA 3IV7A 2W6OA 1ML4A 3E03A 2PZKA 5KNBD 3IMKA 5KAPA 1PDWA 2OCAA 3FOWA 1FVOA 5BMVB 5FDFA 3TX2A 4DUGD 1G21B 2XYRA 3PQ2A 4TVBA 3HYRA 5DX8A 1J7JA 5HCIA 2HSWA 3RBAA 3ZBUA 1Q21A 2AMYA 4R51A 5JECA 3GUVA 3J7AC 2ONCA 3ZHVA 1GFSA 2CDAA 2B83A 2F1OA 1ZGCA 2IEYA 3JWHA 5SYNA 3E6AA 3EYAA 4FZJA 4IX9A 4EUEA 1I2BA 3CO5A 3L4KA 4LC9A 2OXIA 4BMZA 3R5XA 1KQ3A 1YBMA 2P65A 1OFUA 1E18A 4TSFD 5AI8A 5GM2A 4ENRA 1G59A 1AV6A 4TN5A 1IQPA 3OTGA 1KR2A 5KOJB 1M72A 1RI4A 2DSNA 4AKHA 1OA1A 4DWVA 2VF4X 5LD2C 4H59A 1GL9B 1GA4A 4LKRA 1PLLA 4FYVA 3QVUA 1BXGA 4R8KA 5BW6B 4CIYA 2G4VA 4FYYA 5DX1A 5IZ4A 1UDRA 5ALEA 5F2KA 4OQMA 5BQPA 4RYLA 1ZEMA 4EW6A 4XX0A 4JR1A 4TLDA 4KTVE 1N0UA 4WZBE 3AIMA 3E18A 3R4CA 1NXTA 3DEYX 4GH5A 4Q9IA 3GDGA 3R7LA 1DCMA 2PFGA 1BYIA 5L53A 4Z99A 2PZBA 1Y3IA 3D0OA 4RF5A 5FBZA 3ZGLA 4CMCA 5F9FA 4ARZB 1P39A 1NYQA 1G9SA 2G04A 2G5CA 3AY6A 3DXZA 5GZ1A 4ZV7A 4Y2PA 1MB0A 4YAKA 1RXEA 2QPAA 1Z4KA 2PANA 3PXEA 4GLOA 4B83A 1KAMA 2AK3A 4HH3C 4P83A 1TD1A 2EJTA 1U7OA 3JV7A 3PQEA 3WGZA 4ZMBA 1C0KA 1LK5A 4Z4FA 1DIGA 2OFWA 2GYUA 4PAWA 5LYJB 3IOCA 1R6VA 4X60A 1Z0UA 1PF7E 4G23A 4PBTA 4DQXA 1M83A 4J7AA 5J4KA 2YQZA 3PX2A 1HA3A 1SIOA 3NEAA 3U60B 3CVYA 2V58A 3L5KA 5DV9A 2IHZA 4D79A 3QXXA 3FCAA 4OL9A 3E2PA 2PRYA 4ZGWA 1Z5NA 1FDTA 1E6UA 1DELA 2A5YB 2R84A 4RZHA 3ZDEA 3CSSA 2HXYA 3VC2A 5IT0A 3KHKA 3EF3A 4FQ5A 4HZUA 4MJ7A 1TNDA 3DMDA 3BFXA 4B3CA 4TS3A 2IYFA 4AUKA 1S5PA 1AZLA 2OZPA 2UXDB 1B7GO 1Z12A 3VZQA 2GI4A 3PNLA 5G0SA 1NUSA 1EFHA 1NV9A 2GZ3A 2BGUA 1AZTA 2CFSA 5L3SB 1DC5A 4B3IA 4PAOA 4B43A 3NS7A 4PAQA 6YASA 3Q7RA 2XTMA 4O25A 1DOZA 2XWQA 4X3OA 2X7JA 4A8JC 2OHXA 1VJDA 1Y34E 1LWOA 1AF4A 1EWRA 3DDCA 2WG2A 2UAGA 3VDMA 4YAWA 1AHHA 2HCTA 2O2DA 1XZIA 2IK8A 2W8BB 3FWHA 4PHTA 5A2GA 2X4DA 4OYRA 1ADCA 4HGRA 1KZGB 3P27A 2C84A 3OLCX 1FRQA 1YQEA 2ZULA 3TLKA 1YK0A 2E1RA 2W5UA 4MWZA 4BVKA 3BTUA 3M6VA 3LY9A 1RAGA 3KJIA 4FXPA 1GITA 1GY8A 3WL8A 4NE9A 2Z5GA 4LSZA