3V2HA

The crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
232
Chain Sequence
SMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-beta-hydroxybutyrate dehydrogenase
publication title The crystal structure of D-beta-hydroxybutyrate dehydrogenase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 73
structure length 232
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2hA00
2OP1A 1NPYA 2Q1TA 4XIYA 2YDYA 4YCAA 3WOHA 1NWHA 1BMDA 3WYEA 2Y93A 3CPSA 4XDYA 1YO6A 4WE3A 3GT0A 1AN9A 3GAZA 1GZ6A 1DLJA 5ER6A 3HNPA 4PZEA 5IFLA 2WE8A 4C4OA 3QIVA 1HE5A 3LU1A 4CM7A 3ZCXA 1LJ8A 2VWGA 1GTMA 4YQZA 4LGVA 4NNJA 1V3VA 4ZJUA 3AOGA 1E3WA 1HXHA 3OIDA 2D3TA 3CSDA 4JJGA 4RO0A 4AJHA 2I6TA 2ZB4A 4HFMA 2GGSA 3FI9A 2C5EA 2FPPA 4F45A 4LK3A 3IJRA 2PZMA 4GQAA 3M1LA 3OJEA 4Y98A 5I9NA 3GZ4A 1F0YA 1SAYA 3CMMA 1ZEJA 2NQ8A 4FC7A 2ZTMA 4RVUA 3VPGA 4EITA 2YFQA 4H16A 2J6IA 4PLTA 3KM0A 2PD3A 2Q45A 1Y8QB 4RDHA 5JPIA 1GD1O 2IODA 2EF1A 2NVUA 3ZNNA 4N18A 1VC2A 2VHZA 3A14A 3OF2A 1GDHA 3NRCA 3TZHA 4A7PA 3ZWYA 1HF3A 1VL8A 1KERA 2QG4A 4NPCA 5C37A 3OSUA 2AQHA 1GZ4A 3AOEC 3H65A 4MVJP 3DHYA 1GQYA 1UDAA 1U4SA 1DIHA 2O3QA 3KOUA 4JBHA 4QT0A 1TXGA 2O3JA 3ROPA 4CR7A 4AJ1A 2NU9A 3GDOA 3F47A 4QQRA 4B3JA 1E0DA 1VL0A 1T1SA 3JQAA 3KHUA 3ZWNA 3I23A 3E9NA 4I1IA 1HE2A 3TN7A 3GOHA 1GYRA 2J8ZA 4M54A 1YS4A 2WYVA 3SLGA 5IJZA 1PR9A 4DPLA 3ZDFA 3A06A 3KXDA 2YDXA 4PVDA 1O6ZA 1NR7A 1P1FA 2ZATA 5TS3A 1LSSA 3KTDA 3DZGA 4NJMB 2X7HA 1C3VA 4RJTA 2B4QA 2J3JA 1U9JA 4OH1A 4BNGA 3MJTA 6ADHA 2GN6A 3BYZA 2BHLA 4RPJA 1F17A 3HFSA 3JTMA 4RF4A 1CWUA 3UVEA 1DFGA 2ZTUA 4W7HA 5JAMA 4NIMA 3AM3A 3JQGB 3TFQA 4IZIA 3NEPX 4AFNA 5G0VA 1ZK4A 4W9NA 5DCYA 2PD4A 3F5SA 4OYRA 4D43A 2YHIB 5L9AA 3QY9A 2V65A 4CMIB 3KLPX 1XWFA 3N7UA 3VAZA 4KUHA 2NUAA 2NV6A 1HSOA 2GN4A 4YB8A 4WGGA 3WX0A 1Q0HA 1JWAB 1IUKA 4NR0A 1WWKA 3LSYA 1I01A 1X7GA 2GLXA 1NPTO 3KV3O 5HBRA 4E3ZA 1U2DA 1UZNA 2PNFA 3LQFA 4FN4A 4IS2A 4DQUA 2VYND 2Y99A 3HSKA 3JYPA 3FR7A 4OQZA 5JCJD 1H0KA 2JHGA 3C1OA 1KY4A 1WNTA 2VHVA 3HUDA 2X5OA 2H63A 1PQWA 5L7YA 4CM4B 1RJWA 5A9SA 1NPDA 5IDXA 4N5LA 3P2YA 4WLEA 3UUWA 1HYGA 1T2DA 2VHWA 3PHLA 4EUEA 3S2IA 1LLUA 3PZBA 1OC2A 5IN4A 5JDCA 1OOEA 1E92A 3ZWMA 1G6KA 1UZLA 3FR8A 2E6UX 2VZ8A 1PWXA 4GX0A 2BRUA 2BD0A 3T4EA 3LC2O 1XHLA 1EVYA 4BHTA 1E6WA 4ALJA 3AI1A 1MGOA 3LLVA 4J7XA 3NKLA 3SC4A 1C0PA 1L1FA 1DBVO 2CMDA 4KQXA 4CQMA 3W6UA 2Q50A 2J5RA 5A05A 4ND5A 4LCJA 1PQPA 4BQRA 2GDZA 3TFOA 4OXYA 1RM3A 4BNWA 3TQHA 4CM8B 2FR8A 1HKUA 3QSGA 5I7VA 2IZ1A 3H9GA 2W90A 4J3FA 1TA4A 3FSRA 1Z82A 3D4NA 2YQ5A 4BVAA 2ZCVA 1OC4A 4DIFA 3GHYA 5IXSA 5AXAA 3C3XA 3QRWA 1G1AA 2Q2VA 4CLEA 4WLNA 1B8UA 1KEUA 3VOSA 1LRKA 3ZWVA 1JTVA 3H3FA 4MVJI 2YY7A 5IDYA 4HV4A 3L4BC 1VI2A 1XCBA 2Z95A 1HRDA 5ENDA 5H83A 1ORRA 3GVPA 3ABIA 7ADHA 4FIZA 2Z1MA 5HA5A 3RC1A 3JSAA 1YQDA 1ISHA 2CSUA 5U4QA 5EJ2A 2D5AA 3G17A 1RM5A 2C7GA 4RORA 4DXHA 1FF9A 1KVTA 1ISJA 1HDOA 4RF5A 1R37A 5A9TA 2D4AA 2OMEA 4LVUA 4DPKA 4BNTA 1RM0A 3EZYA 2PTGA 4Z9YA 2JD0A 1YOVB 3I83A 4FFOA 3KYCB 1BGVA 3F1LA 3GMSA 5A3VA 2YYYA 3NGLA 5J23A 4CMAA 3K2BA 1J49A 2YV2A 1A71A 3NTRA 2X58A 4R01A 3FD8A 3LZ6A 3WGZA 1R4NB 1U3VA 4E6PA 2YV3A 2ZB7A 2NNLD 2C2XA 4J4BA 1LX6A 1MFZA 2GNAA 1Z74A 2Q1UA 3JD1A 5C7OO 2VYVA 1KS9A 5G4LA 1E7RA 1M2WA 2I5PO 1E3LA 1NWCA 4A5OA 1OAAA 3KUXA 4QO8A 2PLAA 5BQFA 3L77A 3IMFA 2Q99A 1U7HA 2HMUA 3LT1A 4CR6A 1NHGA 1XYGA 3PLNA 1EUCA 3S8MA 3MJCA 3C24A 3P2OA 3QVWA 3WGHA 3N58A 4L4SA 5EN4A 3SJ7A 4R3WA 4ZD6A 2GYYA 4E2XA 4WPGA 1SB9A 1XU9A 2EWMA 5EIOA 4PZDA 4JQCA 3W4IA 3UCEA 3BMNA 1K0UA 4GX5A 1P1IA 4CMBA 2B83A 2CUKA 3NDRA 3PHGA 3I5MA 2CZCA 4UVGA 2E4AA 5DBIA 5MDHA 3Q11A 4J0EA 2AEFA 1GQQA 3NAQA 3D64A 4NJOA 4WOJA 1UXGA 3JYNA 4QECA 5IZ4A 2RIRA 4YRDA 5EL0A 3UAGA 2R2GA 4ESOA 1Y8RB 4B4VA 5H82A 4CJXA 1A72A 4TRJA 1Y6JA 4IJKA 4YJFB 1FDSA 3MJSA 5DF1A 3S1LA 5L45A 4JGBA 3DDNA 4QTZA 1RKXA 1PL8A 4WCFA 1ZXLA 4NG5A 2PGJA 3EGOA 4GI2A 4BIIA 5ADHA 2HMSA 3GVXA 2J3IA 2PKQO 3Q3CA 1H6CA 2BLLA 3FNEA 3MTJA 4DGSA 3MJ4A 3RJ5A 3BMCB 3U09A 3P7MA 5EPOA 5CPBA 5G0SA 3BZUA 3EZLA 4XYLA 2Y0DA 4HNHA 2VTDA 3WGIA 2J5KA 5T64A 2DUUA 3WBFA 3VVBA 3F4BA 1HL3A 4OXKA 5JW6A 2VRBA 4E13A 2VRCD 3O03A 4ZQFA 3T7CA 4K9DA 1N7HA 3GGPA 1A4IA 3CXRA 2PZJA 3FWZA 4MP6A 1Q2XA 1ZFNA 2I67A 3H9UA 4J2OA 4PG7A 1KOLA 4YPOA 2W2LA 4L0QA 1SNYA 1UP7A 3JQBA 4A03A 2OFPA 4J91A 4UUPA 4XDZA 3V1YA 3EDMA 4JJFA 3H4VA 4NBTA 5HS4A 2G76A 2DUWA 2TMGA 3U4DA 3U5TA 2OO5A 2VCYA 4U0KA 1HLPA 2GERA 4UVEA 1HYHA 2AEMA 3DL2A 4U6QA 1LSJA 2X9NA 1YE3A 4AL4A 1QV7A 4D3DA 1E3JA 1NVGA 3FPLA 4N5MA 4YXFA 5GZ6A 3KZVA 4FOSA 1K6IA 1M76A 1WZEA 4UVIA 5DCUA 3HDHA 1DO8A 5KJFA 4CM6A 3GLQA 3RBVA 5KVSA 1PJCA 4BV9A 3I9NA 1KVSA 1ZK2A 1ENOA 3DMYA 4I5GA 4CLOB 2DU8A 4UUNA 5KTKA 1B14A 3U49A 4II3A 3B6ZA 3KO8A 3IKTA 3C85A 5A04A 1OFGA 2X22A 2E49A 1V9LA 4KDFA 3DHNA 3JQ7A 3B1KA 1WMBA 1Y5RA 4ND2A 2NU8A 5IG2A 1YRLA 3AUAA 3PJGA 4R1NA 1ADGA 4ALLA 1P33A 3L0DA 3F5QA 5KJCA 1E3WB 4GWKA 3RUFA 3JQEA 1Z75A 3F9IA 1R6DA 2VYVD 4H15A 5DULA 4W4TA 5HS6A 2A9FA 5THQA 1NP3A 5A5FA 1V35A 4EUFA 3GN2A 3HB4X 1EE2A 5T57A 2UUPA 4BO4A 4E2ZA 3Q9UA 1PR3A 1T2CA 3CZMA 2G0TA 1DLIA 1SB8A 2PWZA 1NTOA 1DIAA 1IY8A 3ZU2A 1B0AA 2X4GA 3I1JA 3PYXA 3SBOA 2J5QA 3ETDA 4RQTA 4F6LA 3DTTA 1O95A 4W6ZA 5KCZA 4YJHB 3JQ6A 4I5DA 2H9IA 4S1VA 4KOAA 3TL3A 1WMAA 3E82A 2NVUB 2GZ1A 3GUCA 3PIIA 1VSUA 2DBVO 4E5PA 1HDCA 1ZSNA 5I8ZA 4F46A 3LC1O 2CF6A 1DHRA 1YXMA 3PLRA 5AXDA 2FR1A 1N92A 3P19A 4LSWA 3NT2A 2DKNA 3WJ7A 2XOXA 1U3UA 1W6UA 1EMDA 5CEJA 1RYDA 4J90A 3NX4A 2HK8A 4PG5A 2Y0EA 4TVBA 2A4KA 1EVIA 1HTBA 2QZZA 3DZKA 1L7EA 2B37A 3JQAB 3RFXA 3PGXA 3TDKA 4CLRA 1DAPA 1I3NA 2JCYA 1JVSA 3PP8A 3PRJA 1CIVA 1QRRA 2X0JA 4B4UA 1EFLA 4QO7A 4CLXA 1UDCA 3DEYX 3HADA 1R0LA 1N7GA 2FHSA 4B4OA 1M6WA 5C5IA 2GRAA 3INGA 2WYUA 5JS6A 1QYVA 1ZK3A 1SEVA 1ZUD1 4HX5A 1JKJA 1SCUA 1Q1NA 3PWSA 2E48A 3HDJA 3GHHA 4CMEA 1DSSG 1MG0A 4PLHA 5TJHA 3WTBA 2CVQA 5DOVA 4WUVA 5IN5A 4CL3A 2Q46A 3OHSX 2VTEA 3G49A 1G0NA 3BIOA 4EI2A 5MGBA 1VLLA 4K26A 3IKVA 3TSCA 1LRJA 2PR2A 5CP8A 3NTQA 4GSLA 3PJDA 4FD3A 4F6CA 3TNLA 1C14A 2BI8A 4ND3A 4TVOA 1E3EA 4JXKA 3S2GA 3WQQA 1ADFA 3ZWBA 3WLFA 3JD2A 4BGEA 3AUUA 3TWOA 4QSMA 3LK7A 4CM1A 4AJ4A 1X15A 4AICA 3PDJA 4URFA 1CQJA 2IRWA 4LISA 4GKVA 4WJZA 5A9SB 3HDQA 2RHCA 3RUDA 1PZEA 1WVGA 2PK3A 4YAKA 4MP8A 2P5UA 2Q49A 4R41A 1PJLA 1NFFA 1YBMA 5JMPA 5K6AC 4IY1A 4OKIA 2Q3EA 4JBGA 4A2CA 5KOIA 1E1LA 2GN8A 1CYDA 3ROQA 4XJSA 4J16A 4BNIA 4NK5A 3GAFA 3TZCA 1FMCA 3NTOA 4WLVA 4XEHA 2X9GA 2GCGA 5A02A 3IUSA 5COQA 4DMLA 1OMOA 3MOIA 5ER9A 4YT8A 5IZCC 5AYVA 2C5AA 3E5MA 4FSHA 4J4HA 4ZQBA 5L40A 1PQUA 4A27A 4XRRA 1K5HA 4UAGA 4CQMB 4IGEA 3VPXA 1TB4A 4R9RA 3GGGA 1XR3A 5CHEA 4YDRA 2Y05A 2X8LA 1A9ZA 3WR5A 3N74A 1U5CA 1LDNA 4INAA 4XQCA 4YR9A 2BFAA 3S2EA 3WLEA 1U28A 1WDKA 2OGUA 3GH3A 1E7WA 5DDIP 5JY1A 1FDVA 2GZ3A 3PHHA 2DQ4A 3JQ9C 3JD3A 4Y8VA 1K2WA 1VJ0A 3MJEA 2X86A 1EK5A 5H81A 4DIBA 5L4NA 2AHRA 1T2FA 3AUTA 1P1JA 3I9JA 4TZKA 4YJGA 5HWSA 2C7VA 4XZ3A 5EINA 3RVDA 5L7WA 3O8QA 1VPDA 1T2AA 4P22A 1ZW1A 4CV3A 1LDYA 3LDHA 1DC4A 1ZVMA 4ZRNA 1E1KA 4MINA 1JVBA 2G5CA 2HU2A 4XQGA 3OJLA 1ISIA 1N9GB 4I5EA 5KJ6A 3I4FA 1AE1A 1A27A 5ENVA 4UEOA 8ADHA 5I8WA 1ISFA 1T24A 3U3XA 5A03A 5CDYA 4M87A 3ROKA 1D8AA 3HG7A 1CQIA 1JN0A 4XQ9A 5B1YA 5KNLA 4RV9A 1B3RA 1I33A 3VDRA 4BB6A 1QYCA 3BHIA 4IDEA 3VDQA 1ZZEA 4J43A 4E5YA 1LXCA 2PD6A 4MVJF 3RUCA 2Y67A 4AJIA 4Q9NA 5BSFA 4MVJH 1LC0A 2BKAA 2WTBA 3I9MA 3AJRA 4K6FA 3ANLA 3QVTA 5JY6A 1O94A 1U4OA 2NADA 5G0WA 5CEFA 1IB6A 3F6YA 3H7AA 1DIRA 4MVJA 4PVCA 2W2KB 3GNQA 4DQXA 3PHJA 2FPGA 4WNCA 5F5NA 4D3FA 2VUSA 2PY6A 3I9OA 1VSVA 1YL7A 4YEDA 1UAGA 3T4XA 1I0ZA 1N2SA 3HQ4O 4RZIA 4EUHA 1U8XX 3X2EA 3GDGA 2DAPA 4Z3KA 2AW5A 3OICA 3OM9A 3BMNB 1QKIA 4PLPA 1EBUA 2OORA 4FR5A 4DPMA 3HN2A 1ZXBA 4GLLA 4GKBA 2AE1A 2O48X 3OQ1A 3S2FA 5CDGA 1ZH8A 1I2ZA 3ZHYA 4PLCA 2WD8A 1KVRA 3PI7A 2GASA 4MKXA 1XELA 3WDSA 3GQVA 4L4RA 4MPDA 1PZGA 3VKVA 5DP2A 4TQGA 3ENKA 4R5HA 3EAGA 3D4OA 2HO5A 5KKAA 1EFKA 4ILKA 1ZKMA 5L7TA 3GPIA 4BGIA 1ZSVA 1H5QA 3PWKA 2FP4A 4WCFB 4UVDA 3JD4A 2NWQA 4XYMA 1RPNA 3DTYA 1LTHR 2IYPA 5BNFA 3ZNOA 2VUTA 1H93A 3KB6A 3ONFA 1U3WA 4RPGA 3DONA 4IDGA 1UZMA 3ANMA 1LDBA 3QE3A 2EKQA 4L74A 4FS3A 2QRJA 3B1JA 4BO1A 1S7CA 1E77A 3R3SA 1ADCA 3GC6A 2QRKA 4IDDA 1HDGO 1JU9A 2D8AA 1PZFA 1R66A 3GY0A 4IIUA 1ARZA 1Q7GA 1UP6A 4CQLB 2PKRA 1JAXA 3GK3A 5JAIA 2OUIA 5FFFA 1ONOA 1GYQA 3JQFC 4PN3A 2C54A 5TF4A 4S3MA 2RHRA 1AXEA 5JAZA 2IXAA 3AK4A 1NFQA 3GZNA 3I9LA 4PLGA 1GPDG 4BO7A 3NV9A 4YRAA 4C7JA 2D59A 2JL1A 1FDTA 4YAJA 3GEDA 2FRDA 2FMUA 5C3MA 3LLSA 1AUPA 2P9CA 3L4BA 1YQGA 3RSHA 3B1FA 2VN8A 1HDYA 4IDCA 5AXBA 4BNLA 2WM3A 1KEPA 3KBOA 5DNAA 4ZA2A 1BXKA 3RC7A 1DXYA 4I5FA 3UCFA 4I9HA 4CM9A 3QVXA 4IS3A 2UUOA 4LW8A 3L9WA 5A1TA 2JJYA 4EJMA 4CV1A 1ISMA 3QVSA 4DBZA 1NBOA 1DRWA 3WWZA 4BGVA 1B26A 4FCCA 5A4DA 4M55A 1E1MA 1DC5A 2ZQYA 1T4BA 2Q4EA 3VZQA 5AOVA 3RASA 2A35A 4MIEA 4KTTE 3INRA 2DBZA 4BQPA 2UV8A 4J49A 4JP3A 5IDQA 3K92A 1YB1A 1ENYA 3GPDG 3FWNA 2PZLA 2A92A 3ASUA 1DFIA 3IUPA 3JQ7B 2AEJA 5TC4A 4IJVA 1T4DA 2HUNA 4D45A 4DIOA 3UH1A 2YJZA 2JD1A 1SZJG 4E5NA 3BMOB 2FSVA 3OA2A 1D1TA 3U9LA 4XB2A 3E5RA 1YWGO 3MCVA 1BWSA 4OSPA 3VTFA 4WLOA 1XU7A 1QYWA 1BXGA 3M1AA 1OBFO 2NVWA 4JK3A 3NDJA 1QV6A 2PGLA 4XYGA 2BELA 3DAPA 4O63O 5BSGA 4D79A 2NU6A 5T6BA 3V1TC 4MVJD 3G1UA 5JE8A 2VRCA 3G3EA 2V6MA 2X5KO 2P2SA 3ZZNA 2EIHA 1IZ9A 2UAGA 3VZPA 4IXWA 1Z6ZA 1F12A 5G2OA 1YGYA 4WNIA 3IS3A 4BNUA 3E18A 5EQFA 4BNVA 3HFGA 4FJ0A 3WNVA 3W8DA 1LA2A 1KC3A 1VJ1A 3C1AA 5LDHA 4KP7A 2Y1GA 5F1PA 1BDBA 1XG5A 2XF8A 1UXKA 3DC2A 5KVVA 4Y9DA 3ZWCA 3OQBA 4R51A 4XA8A 1NYTA 2HK7A 2W8ZA 1PGJA 1LEHA 1V3TA 3DMTA 1LDEA 1Y1PA 1IOLA 4GAEA 3OETA 1H2BA 5CPFA 3ZWWA 5GY7A 1P45A 3PK0A 3RU7A 3VZSA 5THKA 5G4KB 4JCOA 4OHUA 1EEHA 2HJSA 3ETGA 1QYDA 3FNGA 5I7FA 1AHHA 1EVZA 1I5RA 1BTOA 3R1IA 2GZ2A 4GLOA 3V8BA 4CLRB 2HMVA 3DZFA 2G17A 1R0SA 4BKOA 4CODB 3DBRA 1PJ3A 4EBFA 1V0JA 5EQDA 3LYLA 2PH3A 5CDTA 5I7SA 1TT5A 2V6BA 4HXYA 1X1TA 3DB2A 2NTNA 4MJLA 4J7CA 4CMGA 5U9CA 3TPCA 3WG9A 3JQCA 3WFIA 1G0OA 4W7IA 2X0NA 3FHLA 4LVCA 1FK8A 4L76A 3WIDA 1LDMA 3WGOA 4BNYA 3GNTA 4EJ0A 1PJQA 4YAIA 4KQWA 2WEKA 5L53A 1B2LA 1YDWA 1TEHA 2VT3A 5L4SA 4NH4A 4AJPA 2NTVA 2X1HA 2BGLA 3ZWXA 4FFLA 1QSGA 1O89A 5JC1A 3AWDA 2Y0CA 4DC1A 4PG8A 3B70A 1X0VA 1GY8A 1KETA 2Y1DA 5JFOA 4L4XA 4ZVVA 4NFYA 4BMSA 5HTOA 3PZRA 1DRVA 1UXJA 3ZI0A 4BO0A 2QYSA 4PG6A 4QXMA 2FSSA 3ZN2A 1X0XA 1U5AA 3OMLA 2EGGA 1GQ2A 2PA3A 5FEUA 4BNFA 2BGKA 3RBZA 2X0IA 1M75A 4KWHA 1Z7BA 4CM9D 5BNTA 4EDFA 1V8BA 3PTZA 1W0CA 1V3UA 3A9WA 5T8KA 4PLFA 2ZTVA 4UEKA 2Y1FA 4E5MA 3LF1A 3AI3A 4O6VA 3BTUA 3GFGA 3PDUA 3RKRA 3DR3A 1JKFA 3KYDB 4XRGA 5TGDA 1PGOA 3JQ8A 4UUOA 1ZMOA 1VKNA 3QQPA 4IMPA 4R4JA 5B4UA 1WW8A 4HFJA 4RVSA 4GGPA 2B5VA 3A28A 4J9VA 3WGGA 4M1QA 3DAFA 1P77A 1BSVA 2OBYA 4YTEA 2DTXA 2VNAA 1WDLA 3CIFA 3EVNA 4P4GA 3EUWA 4NU5A 1YQXA 2WSBA 5K9ZA 5CEEA 4JLWA 1A5ZA 3K9QO 3WICA 1HT0A 1NNUA 2OP0A 5KKCA 2QW8A 3VC7A 1YBVA 2SCUA 2FPIA 4YJGB 4IDAA 4FGWA 2C82A 5F1OA 2AQIA 2C07A 1PWZA 4XX0A 3O8QB 3AFNA 4DMMA 3WGYA 1EUZA 3HE3A 1O5IA 4MO2A 1IE3A 3OJFA 1TLTA 2HCTA 2PZKA 3OFSA 4LRSB 4EEZA 4BKQA 1I3MA 4Y6SA 1E3IA 3OBBA 2GO1A 4E33A 1K6XA 4NBWA 1IHXA 2HMWA 3IP1A 4OOFA 4YAGA 3O26A 4BS9A 3K8ZA 3VPHA 2OOSA 4DL9A 4XB1A 2VWHA 4R1SA 3IAHA 4M86A 4Q3NA 5ICSA 4U5QA 4B7XA 4FBGA 3QLJA 2WD7A 3I52A 1WZIA 3BMQA 3PVZA 3RJ9A 3ONDA 2ZIZA 4XJTA 2HDHA 1PS9A 4HY3A 3D5QA 1SMKA 2BF7A 5FYDA 2X5JO 1XQ6A 1YL5A 4AVYA 3BTSA 1N5DA 4IDFA 3G0OA 3TL2A 3ZW8A 4PRLA 3PEFA 3QWHA 2DPHA 4Q3BA 3WQRA 3CE6A 2Z5LA 4PLVA 1E7QA 3DOCA 2O4CA 2XAAA 1E5LA 4B3HA 4EW6A 1NHWA 3H9JA 2XXJA 1DJNA 1RWBA 1BDMA 4Y6RA 4IJWA 4ND4A 4E12A 2DVMA 3UW3A 1PJ4A 1GL3A 1SEPA 4HFRA 4QUKA 4Z9FA 5I7EA 3PJFA 1BVRA 2RCYA 3L9XA 4IIVA 3IOYA 3RUHA 4CV0A 3EC7A 4TRMA 3ZU3A 2DBRA 4XYEA 4N7RA 3E03A 1JWBB 1KVQA 2C29D 5TT1A 3L6DA 3GMDA 4B7UA 4JIGA 4R1UA 1EDOA 1MV8A 3L6EA 1QG6A 2YHIA 3QA9A 5ITVA 4R5MA 1EZ4A 4XGKA 1KYQA 1T25A 4BO5A 4CMCA 2GSDA 1J0XO 3A4VA 4NBVA 3KLMX 4GX2A 5TLSA 4JROA 4Z0PA 3KSZO 5L51A 4LCEA 1CERA 2ET6A 1XKQA 5LDGA 1MP0A 1JQBA 1GV1A 3GEMA 3SVTA 1XQ1A 1UH5A 4CM3A 4Z6KA 4B8ZA 1YVEI 1NM5A 3AW9A 1UJMA 2VWQA 2EW2A 1FDUA 1UUFA 4CM4A 4XCVA 2EP7A 1Y7TA 2DFDA 2I76A 3GG9A 1NQOA 5B4VA 3LT0A 4JN6B 1LQUA 1GPJA 2IEBA 2WJPA 3WSWA 5TT0A 4GGOA 1V6AA 3MTGA 1R0KA 3SEFA 5K6AA 1R12A 1QP8A 2YUTA 3UKOA 4BNZA 1ZJYA 2FY8A 1YL6A 2C2YA 4RQUA 2CY0A 1E7MA 3CZRA 4W82A 2P4HX 3AY6A 5I9LA 1P0FA 5IZCA 3BAZA 1SO8A 2OBNA 3DWFA 3EY4A 3WBBA 2ZK7A 2IDZA 4MDHA 2VOJA 3UF0A 4B79A 4LN1A 2D1YA 5TJ9A 2AG8A 2PH5A 5BSEA 4IGFA 3EHEA 2IYOA 4I8XA 4D7AA 4CM8A 1SBYA 1E7SA 2YQ4A 4MVJE 1PZHA 5BR7A 3GZNB 1UXIA 3BTOA 1MC4A 4J1TA 3DBHA 4GH5A 4BMVA 1K89A 4TKMA 1K3TA 3ZU4A 2Y1CA 5DBFA 2Q2WA 5EERA 6LDHA 2NACA 3H2ZA 1X7DA 3PPIA 3R3JA 4YVFA 4WEQA 2O50A 1ONNA 3FRJA 3WMXA 1H6BA 4OKNA 3T7EA 3AFMA 3QWIA 4M8SA 3DFZA 4X54A 3KYCA 1F06A 1DIBA 4MKRA 2HLPA 1H6AA 3VH3A 3EVTA 3W8EA 4P4NA 2BFOA 3DZHA 3I9KA 1L7DA 1GUZA 1XSEA 2DC1A 2DFVA 1PGNA 4MP3A 2HK9A 2NM0A 1UP4A 2O3TA 4B3IA 3VH2A 3DOOA 3G1TA 1M6HA 1GV0A 3CINA 4DA9A 3VKUA 4EGFA 4A10A 2H6EA 2JFHA 4KUEA 1WXDA 3VZRA 3I3OA 4CPDA 3W8FA 1BHSA 4CMJA 3KEQA 3PHIA 3O38A 3ZNQA 2EKLA 4RVFA 4E4YA 1P1HA 4L9RA 1GUYA 3H5RA 1JKIA 1NVTA 2DBQA 4TRNA 3CTMA 4BB5A 1ZJZA 3NGXA 4AJJA 1UXHA 4RVDA 4TRRA 1QXSA 3FCOA 1YDEA 4O5OA 4NU6A 5A5EA 1QLHA 4G81A 5B37A 1H2HA 4JNKA 1EBFA 1ZIDA 3K6JA 1HWYA 3VTZA 1C0KA 2E37A 3HJAA 1YH3A 3PYMA 2GF2A 2IXBA 4NQZA 3H6KA 1MXHA 2EG9A 1NXQA 3LVFO 4J1NA 4J1QA 5C7LO 5JBIA 1K6JA 2B4RO 4AJOA 4NMHA 1LLQA 1CRWG 3DBLA 1WAMA 4I08A 3AM4A 3E8XA 3E6AA 5DBGA 5DP1A 3WS7A 3CUKA 2Z1NA 4RF3A 3M2TA 2HJRA 4BOYA 3V2HA 1HSZA 4CMKA 1LDGA 3ANNA 1HZJA 2UYYA 1A4UA 4GVXA 2AG5A 3RUIA 3E1KA 1ZO8A 4CV2A 2C20A 3PQFA 1N8KA 2ZCUA 3LT4A 5AVOA 3ADOA 1FXSA 1F8FA 1P44A 4RVGA 3CMCO 3HDYA 1I30A 3NYWA 1VL6A 4MIOA 4ALNA 4CL8A 3ITKA 2Q4BA 2XXBA 3DZJA 3MZ0A 5G0TA 1KC1A 1HDRA 1LRLA 5F1KA 1PGPA 3VH1A 2VNSA 4YYZA 3AU8A 5JNLA 4DUPA 3AOEA 3TZ6A 1JW9B 3GDFA 3RU9A 2H1SA 1GU7A 3GVCA 3OA0A 3EK2A 2DPGA 2O2YA 3F46A 4BNXA 4N5NA 2P91A 3JQFA 4ITUA 3ZH2A 3UCXA 5CFZA 1PL7A 1T1RA 4B4WA 3GUYA 5IXYA 1B8VA 1BXZA 1M67A 4R1TA 1WLYA 2Q1SA 4HKTA 4D3SA 4P38A 3MJVA 3W4JA 1P0CA 5JDIC 4G65A 5JC8A 1FJHA 5ILOA 3HWRA 5C7IO 3NJ4A 2DTEA 3D5TA 3RBXA 4XYBA 1CETA 2D5CA 2JCVA 4NFSA 1DRUA 5EMHA 3BXXA 1DC6A 4WLFA 3WJAA 3ZGYA 3RIHA 2B35A 4E2WA 2Y1OA 3OJOA 3PGJA 4CLOA 4J1SA 4G2NA 3EW7A 4JX8A 3RKUA 3LT2A 4PGFA 3DOJA 4IZHA 2OL4A 1Q0QA 1GCUA 1H9BA 3RROA 3KVOA 3NDIA 3D3WA 3WSVA 4HFNA 3RQSA 4IBOA 2JKVA 5DZSA 1Q7CA 1VKOA 5G0UA 1LNQA 1PJBA 3UXYA 3UFXA 1VM6A 8LDHA 3IQDB 4DYVA 4GSKA 1EUDA 1FDWA 3OP4A 4IUYA 2W4QA 3BHJA 5TIIA 3WB9A 1UR5A 1JLLA 3M6IA 3JQ8B 3RUAA 2XPCA 3GVHA 3K31A 3Q9NA 4YBZA 2O3SA 1MX3A 4ND1A 2HQ1A 4RLHA 5F21A 2EHDA 2I3GA 3WGQA 4XD2A 1U8FO 4XQEA 2LDXA 4NI5A 2EERA 1EVJA 3ULKA 4UULA 1VRWA 4OL9A 2O7SA 3ETEA 3D0OA 3PXXA 2I3AA 3AY3A 3FF4A 4L8VA 4DREA 3TOZA 1LLDA 1J6UA 1YONA 2E82A 3ASVA 2DLDA 3CEAA 1GCOA 4GPD1 4HP8A 5FI3A 4BGUA 3C1TA 3KSDO 1R4MA 2I66A 3QHAA 1ZCJA 3GR6A 1S6YA 1BW9A 4YJHA 2BFPA 2ZJ1A 2VHYA 4J4TA 4DLAA 1JA9A 1Y9EA 3OECA 3H9QA 2NQTA 4IDBA 1NR1A 1ZBQA 3O9ZA 5FI5A 1ENZA 4DLBA 1PJSA 4E0BA 4AG3A 5EESA 2P4QA 4ZU3A 4O0LA 2R00C 4NHEA 3SX2A 2FWMX 1QMGA 3WIEA 3U4IA 5LCXA 4DYDA 2O23A 2WD7B 3ZWPA 1SPXA 3BMQB 1XDWA 2QQ5A 1H6DA 1KBZA 4P4LA 2OHXA 3WXBA 3VPSA 3PYLA 3NT5A 1M66A 3AY7A 2YV1A 4DRYA 4M89A 4KZPA 3E9MA 3DHEA 3JQDA 4FC6A 2YW9A 3I6QA 3D4PA 2JHFA 4RF2A 5JSFA 4RCVA 4PLWA 4YA6A 4BKPA 4QEDA 4IINA 4BNJA 4ZN6A 5BNIA 1MG5A 4PLZA 1IULA 4E21A 1DC3A 2CVZA 2FOIA 1IYZA 3IIEA 4FFNA 1WPQA 2CDCA 1I8TA 2A94A 3K2EA 1Y9AA 3CH6A 2O3UA 4IQGA 4YT2A 1A7KA 4G5HA 2DT5A 1D3AA 3L07A 5ES3A 4CUKA 1IZ0A 4OQYA 3JYQA 3NUGA 3GRPA 3BTVA 1AGNA 1ZK0A 1Y81A 2HKIA 3KYBA 5JAQA 1E3SA 3DAGA 4BO3A 5CG1A 3INTA 4CUZA 1LBEA 2O4UX 1OZAA 2VWPA 4PZCA 3ENNA 3PFFA 1GAEO 2Y1EA 4U7WA 3RI3A 2ZKLA 2ZB3A 4DTIA 4GMFA 3ITDA 1W73A 3H5NA 3MWDB 2V6GA 3FTPA 4U6SA 4RDIA 2EKPA 4FW8A 1GR0A 3GF4A 2P5YA 3U0BA 4J7UA 4ALMA 5JYDA 3FBTA 5B4TA 4XKJA 1OI7A 1NFRA 3OEWA 4P8RA 5T5QA 4IJUA 1XIVA 5I9MA 5IAAA 4OXNA 4Q39A 1BVUA 1GUFA 3QW2A 4II2A 2UVDA 3TZQA 3IJPA 1P1RA 5AXCA 3WWYA 1MC5A 2FN7A 4IXTA 4HBGA 3MOGA 4CM5A 4ZRMA 1SOVA 1CJCA 2IE0A 2VZ0A 1PTJA 3JYOA 4NBRA 3U62A 2WE7A 4GBJA 2O7QA 1GYPA 3ADPA 2J3KA 3K30A 2ZTLA 1GEGA 4NDNE 3UGKA 1P31A 1YB4A 4WEOA 4ZICA 3TF5A 2OZPA 3H9EO 2B4TO 4PG4A 1YJ8A 3O4RA 2LDBA 4FJ1A 4H3VA 3KRTA 3IL2A 3WGTA 4BKRA 2F00A 4DBVO 4HUJA 4MKZA 4ZHSA 1DPGA 1DIGA 4DLLA 1PS0A 4FQ8A 4ZGWA 1B15A 4BO2A 4J0FA 4A73A 2V7PA 1I24A 9LDBA 3RUEA 3DBHB 3DZIA 4Y67A 4YJDA 3L6OO 4LRTB 3M2PA 3L4SO 2O2SA 2B69A 1JDJA 4I9UA 1N9GA 3ZNPA 2NLOA 3VPFA 3OEYA 1C1DA 4WECA 1CEQA 4KMSA 2C59A 3OJ0A 1KVUA 2AE2A 3COSA 4W9NC 3TZKA 4BUCA 4D41A 5A9RA 1C1XA 2QIOA 4UVHA 1MUUA 4ALIA 4C7KA 3DBVO 4A0SA 4CR8A 1GADO 4BMNA 4NZ9A 4XWYA 1I2BA 4L75A 1RM4A 4RPKA 2VUUA 3D1LA 3TRIA 3V5NA 5ILGA 5L95A 3GVIA 4HADA 1IPEA 5AQ1A 4K1LA 3S55A 3BA1A 3CKYA 2QZ9A 1PIWA 5KVQA 4RL6A 4BKUA 9LDTA 4BV8A 1Z45A 3ZHXA 4AJ2A 5HM8A 3FBGA 1NAIA 4XIJA 4AJKA 1TVEA 4J9UE 3W4KA 4WKGA 2HRBA 2CFCA 1HYEA 3GNSA 3OQ6A 1LU9A 1ZSYA 2EP5A 2VOEA 3JQAD 3U4CA 3IDSA 2RBEA 4ZQEA 4GX1A 1J4AA 1ULSA 2W2KA 4FPXA 1LLCA 2CDBA 4D46A 2EJWA 3AM5A 1JAYA 3ZWAA 5JDCC 3AI2A 1ISGA 1PU2A 1PJTA 2WMDA 3Q6IA 2ZYDA 3QP9A 4R68A 5JCXA 4O59O 4WLUA 4K6CA 3VVCA 1PSDA 3RWBA 1MB4A 2GUGA 2VQ3A 1N1GA 2PGDA 2PV7A 2Y66A 1PGQA 5GMOA 5B12A 3W6ZA 1ONPA 4EZBA 1QYXA 3ZV4A 1DHTA 2HAEA 3PWZA 1NQTA 2ZYAA 4OSOA 4E2YA 4IMRA 2NVBA 1CDOA 3DO5A 2CF5A 4ZQHA 2D0IA 1ML3A 4TKLA 5CG2A 2NU7A 1DFHA 1HDZA 4N54A 3VH4A 4D42A 1BRMA 3C8MA 4B8WA 3DBLB 4NBUA 4TMFA 1NQAO 1Q7BA 3Q2IA 5KIAA 3H8VA 1CF2O 3ZV5A 2IZ0A 1X14A 2G1UA 2IZZA 3HN7A 3JD0A 3LF2A 2R6JA 1HLDA 4B7CA 4MVJM 4TZTA 3SLKA 2WYWA 2EJVA 5U1PA 3JV7A 1KIFA 7MDHA 5TSDA 2ZJ0A 4LSMA 1ULUA 3GEGA 2X6TA 1MA0A 2F1KA 2NSDA 3DMTC 4K28A 2RH4A 4I9NA 5T67A 2AA3A 2CVOA 2O3RA 3DFUA 4Z9XA 1Y8QA 4U8GA 1I32A 1PS8A 4OO3A 1E5QA 4Q3DA 3ROMA 1RYEA 3QJ5A 4IPTA 1D1SA 1F14A 2PFGA 2PKQP 3PQDA 2FZEA 1ADBA 4QFDA 3ZWOA 5A3JA 2OXIA 1DOHA 4XGNA 4WASA 4R69A 3B20A 1T26A 3KSUA 2VT2A 2D2IA 1AHIA 2GN9A 4CQLA 3BHMA 1BG6A 1U2GA 1MFPA 2G82A 1D4FA 3ONEA 4MIYA 1DJQA 1YBAA 3WFJA 5HRUA 3HZZA 3ZV3A 3WTCA 5JXWA 4OJNA 5JYEA 5JLAA 3ZW9A 4CQMD 3H5AA 5ITWA 2J3HA 5KJ1A 5K0ZA 2BMAA 1TI7A 3H3JA 2WWRA 3WYBA 1F8GA 5TNXA 3C7CB 3V2UA 1H94A 1DB3A 4NJMA 3TOXA 4YT4A 2X23A 3U4HA 5DCWA 1O0SA 4YWJA 1H9AA 3KETA 3ZHBA 2YZ7A 3WNQA 3QWAA 2AQKA 3C7AA 3JQGA 1DDOA 3QWBA 2VHXA 4GL4A 3RCBA 3UOGA 5F5LA 4J6FA 4AJNA 5ICMA 4ROSA 4XR4A 3FNFA 4KDEA 1P74A 5KJEA 1P3DA 1EQ2A 4AJLA 4CMIA 1SOWA 2ZQZA 3STHA 1QR6A 4GMGA 2P68A 2BI7A 1LI4A 5T8KC 3D3WB 2ZB8A 3FPCA 2HMTA 5DOZA 4KWIA 5DT9A 2VZ9A 3NJ8A 3A1NA 1N1EA 3ICCA 4YACA 2CNBA 1O8CA 1EDZA 1GFSA 3P5SA 4OIMA 5TX7A 1P1KA 3LC7O 3ZHZA 2EXXA 1AXGA 2NTJA 3H2SA 4ONEA 3W1VA 1R15A 3BMOA 5CDSA 1X1EA 4WCFC 3ZU5A 3C7DB 4Z3DA 4ID9A 4TROA 2Y68A 4PFJA 1C0IA 4UREA 3QVOA 4AJEA 4D0RA 1O9BA 1A7AA 4IQ0A 3TJRA 1MXFA 1X13A 4FJ2A 3IP3A 2JFGA 1NAHA 1NASA 1E7YA 4HWKA 4YRBA 1GZ3A 3KEOA 5L3ZA 5IF3A 1E1NA 1PEDA 4UEJA 3SJUA 1WDMA 4BO9A 3X2FA 1XA0A 1EE9A 1R4MB 1PL6A 1EQUA 3E9QA 3OIFA 4Z0HO 4PRKA 4RPHA 3OH8A 1HEUA 4FDAA 1BW9B 4OOEA 5F3RA 2C0CA 1Y5MA 3GFBA 4FGSA 1IPFA 1U1IA 1QORA 4IM7A 2AQ8A 3JQ9A 3JQBC 5TQVA 5GZ1A 1C0LA 2UDPA 3DZBA 3RC9A 4FFRA 4R54A 4A26A 5CDUA 4QFCA 1YJQA 3AUSA 3FTNA 1D7OA 4DWVA 2GD1O 5G4KA 4CLHA 3QV1A 2QYTA 3UICA 3RC2A 2Q1WA 3K96A 1B3BA 3UN1A 5IDWA 4Q3EA 5COAA 4Y6PA 1PX0A 2P9GA 3RFVA 5FF9A 3V2GA 2GPTA 1NQ5A 4OAQA 4Q3AA 1T2EA 4NK4A 2P9EA 4E32A 4ALKA 1ZK1A 4PIVA 4CMHA 3ST7A 2Q2QA 3GGOA 4RLSA 2POQX 5A06A 1SC6A 1KEWA 1TT7A 2CD9A 2GR9A 2AXQA 4Z0TA 1YOVA 1I3KA 3RFTA 3F3SA 2AMFA 3HB5X 2B36A 3WYCA 1DAOA 3PIDA 2V6FA 4J2HA 3GA0A 4RPLA 3WQSB 5BSHA 1KEVA 4KUGA 3OIGA 4R9SA 1MLDA 4FOOA 2H5LA 3V1UA 1E6UA 3FN4A 3I6IA 4GWGA 4UUMA 1ZNQO 3PJEA 4EYEA 1R4NA 1XEAA 1GEEA 4JBIA 2QHXA 1NVMB 2X9VA 4PLYA 3QWFA 4WK6A 2I9PA 4BO8A 1XGKA 4M49A 2QX7A 2W2LD 3D7LA 5LC1A 5JDIA 3PQEA 3G79A 2HSDA 3FNHA 4LMRA 4U0JA 4LMPA 4BNNA 1BXGB 3F4LA 1UDBA 4WOKA 1B16A 3JYLA 1QLJA 1X7HA 2HRZA 4XR9A 2ILTA 2RH8A 2YHUA 5KWEA 5DN9A 1E6EA 2EW8A 1B8PA 1Z73A 4ZQGA 1I3LA 3IC5A 1HZZA 3SXPA 4DQVA 2RAFA 1R16A 2EV9A 4W99A 4Q3CA 4GVLA 1HDXA 4IQ8A 1VJTA 2BH9A 2QRLA 1A9YA 2WDZA 4BNKA 4DC0A 1I36A 2BFMA 2I99A 4MVJG 1LSUA 3EMKA 3K5PA 5COBA 3F1KA 2YFHA 3RAJA 5BT9A 1XLTA 3AU9A 4OM8A 4BNHA 4R3NA 1Q0LA 3DXFA 1Y8RA 2DTDA 3KYDA 1WP4A 2JCXA 3Q1LA 4YJFA 4YT5A 1U7TA 1UAYA 1HE3A 4OGWA 1ENPA 2B5WA 3JCZA 1LSOA 1P9LA 3ICPA 3GN1A 3MWEB 1W4ZA 4FB5A 4QX6A 4YAEA 1I2CA 2EGHA 3SC6A 5JMWA 2B0JA 4EEXA 1LUAA 3PFWO 4BO6A 2FR0A 3RD5A 3GRKA 3BMCA 4CUJA 4YQYA 3I4CA 4O1MA 3MEQA 4D44A 4WCDA 4EJ6A 1EK6A 4JJIA 3Q0EA 4FFPA 4JP2A 3WMWA 3VHRA 1J5PA 3E48A 5JO0A 3DBRB 3ZV6A 4E30A 2JD2A 1U3TA 1NX6A 1TT5B 4RGBA 1DEHA 4TWRA 1ZEMA 1W8DA 2W98A 1VE9A 3K73O 3ORFA 2DM6A 4CMEC 4KTVE 3R6DA 1KY5A 4F3YA 4E31A 4R16A 5L4LA 5GZ3A 1C1DB 4D0SA 4BNMA 3R0IA 1ID1A 2TMDA 2FZWA 1C1XB 2JAHA 3GG2A 4OMUA 4E5KA 4BL5A 2R00A 5JO9A 2I65A 1I10A 4FFMA 3D3EA 2CDAA 2VYNA 4RZHA 2ZYGA 1HETA 5JCJA 1LQTA 4PCVA 1B7GO 1IHYA 5TRTA 4NFHA 4CLDA 4TSKA 2X0RA 3HHPA 4DVJA 1YB5A 1HE4A 2JAPA 5FWNA 1Z7EA 2IEDA 4RVHA 4XGIA 3DQPA 2EEZA 3EYWA 3ON5A 4H7PA 1IL0A 4L73A 3UHAA 2JFFA 1PJ2A 4HNGA 1YKFA 5KVCA 3Q2KA 5CAEA 1ZMTA 4MOWA 1LC3A 2BGMA 3NT4A
chains in the Genus database with same CATH superfamily
4HXFB 2RHJA 2W6JD 1NWHA 4UM7A 1UDWA 1JQJC 3D59A 3GV0A 1NN1A 5E9WA 2NO5A 4YDHB 1XQ9A 2HO4A 1Z6AA 4XDYA 3I34X 3QYPA 4FUQA 4JLJA 1VKRA 3KELA 1TJ3A 1Q57A 1PFGA 3GT0A 3IQIX 4KQ2A 3ICOA 1DLJA 2XMBA 4M9CA 4HWTA 3AVWA 1MHTA 4TL6A 2A78A 2ADMA 4J16C 3E05A 3VU8A 2WE8A 4I0WB 4C4OA 3FZYA 1HE5A 3QUAA 3LU1A 4GI7A 1E5TA 4IGKA 5HE9A 4GZLA 4TZ6A 1HX7A 1J7JA 1BOFA 2OECA 2VHEA 3EY9A 4ZPJA 5DK4A 1EX7A 6REQB 1SA0B 4RTRA 1V3VA 4L4ZA 4ZJUA 2YTZA 1JB9A 3AOGA 3CSDA 5EKDA 2CK3A 1S1CA 2ORYA 5FA5A 1QO0D 3QKRA 1KH3A 4ND6A 3Q3HA 2CLLB 2AWNA 5MF6A 2YMPA 3NJRA 3IJRA 4LK3A 5SZIA 1E6KA 1IC6A 2F1HA 4WGFA 1U28C 3H04A 1U8UA 5TQ0A 4DLZA 1EXVA 3W8RA 3ZY6A 2QRNA 2VP5A 4GQAA 4EFNA 1FFHA 1A9XB 3CJQA 4Z7OB 1DV1A 1L0BA 3TLKA 4JLBA 1Z2CA 1B0PA 1HOXA 1RLUA 2NT4A 2X42A 3OM0A 4PHFA 3W90A 1CB0A 4L5YA 3DYBA 3UB2A 4EITA 3B12A 2YBDA 2WZBA 3TQCA 4PLTA 3KM0A 1Y8AA 3HCFA 2GBLA 3NIFB 4JLSA 4KSCA 3DA8A 3G2JA 4RDHA 2MR5A 5JPIA 4P98A 4MTLA 1JIJA 2EF1A 4PNPA 1QPZA 5E0OA 3ORSA 4AMZA 3OURA 1Y5LA 3C6XA 3OF2A 4H6VA 4DMHA 4AO8A 2FOXA 3FOCA 4DC9A 5P8WA 1AKYA 4NPCA 5EFOA 3HGTA 4Y9TA 5LQRA 4Q1BA 3FFAA 4G9BA 3GP5A 5HCNA 4EHLA 4JKOA 1GZ4A 1XEWY 4JKYA 1JYFA 4J0CA 3AL0C 2FQQA 2D62A 4KYVA 1II8A 3H65A 2B82A 3BXGA 1Y6FA 2R5WA 3GJ7A 1P0MA 2O8VA 3FFXA 4ZARA 4JBHA 1TXGA 3LWDA 2PYIA 4AJ1A 1SKBA 3GDOA 3GFPA 2O5VA 4N7MA 2FSHA 4QQRA 5GONB 4A2QA 5TMBA 2FKAA 3HJUA 4B2YA 1SWWA 3FLAA 3KHUA 5FEMA 3NBZC 1XTQA 3I23A 3ZWNA 2JEYA 2PA0A 4C04A 3E23A 3OPYI 4MTCA 2I1QA 5IC6A 4QPDA 3IEUA 2OYCA 3UV7A 4A8PA 1FUYB 2CN1A 5DTIA 3OZIA 5FUXA 4RIHA 5TEWA 2A57A 4LGMA 4LXXA 3KXDA 2I22A 2IDKA 1NR7A 1NE2A 1TA9A 5KNCD 2JRCA 1M2VB 1LSSA 4PX2A 1DTSA 5LZ9A 1TC1A 4NU0A 5LD2C 3AHHA 1C3VA 1GNVA 4OH1A 3C6MA 5JVDF 4WAUA 2BHLA 3ZIAD 4L28A 3HFSA 1EHYA 1MIHA 3R3XA 4MQ4A 4OHZA 2ZTUA 4PGHA 3CVWA 5BV7A 3TFQA 3NBMA 4IZIA 3FPEA 4NYIQ 3EXHB 2VTKA 2WVHA 4AFNA 4YONB 1U0RA 1OUMA 3ZCUA 5J1SB 3F5SA 1O87A 3VR5H 4LZPA 1CJKC 4UASA 3IDZA 3WOVA 1G64A 3I9V1 3PEUA 3PPVA 1NUUA 2FMXA 3B9QA 3O84A 1OU0A 4MRMB 2QYOA 1U0TA 1E59A 1UFVA 4CTKA 2X2OA 2ZUDA 4M0FA 2NV6A 3TDNA 3ZVKA 2SHKA 3HNOA 3OPVA 4FT2A 4HAIA 5BYKA 1OASA 1Q0HA 3E7WA 2ANBA 5C0OE 1GTG1 1WWKA 4O08A 1AKQA 2G04A 1I01A 1X7GA 2QSYA 4RD6A 2PU7A 4E3ZA 1PEAA 3WKBA 3OTWA 4ABYA 3HU1A 4NEHB 1N3IA 2JZOA 2GZRA 1GPUA 3ND8A 5AM5A 4OQZA 4L3WA 3ZGLA 3GJTA 5ALKA 5JCJD 2JHGA 1JHZA 1FS6A 5FL3A 2W2TA 5DN6D 4BQIA 3CF4A 1KZ1A 2OFWA 1HA3A 2H63A 2X5OA 2X7XA 4I2NA 5A9SA 2B7LA 1EVKA 1NPDA 2XA9A 3CX6A 3R5KA 4KPUB 5IDXA 4GM4A 3P2YA 2O7VA 4WLEA 3A6ZA 3UAOA 4DMCA 3GPBA 2YJ5A 3KUCA 4GWLA 4DDVA 1CG6A 2IH4A 1LLUA 3R40A 2YCBA 1J23A 4K6GA 4O2AA 3CLUC 5IN4A 5KC9A 3FR8A 1PR1A 2ZJ5A 1PWXA 4JUCA 2HD4A 1HURA 3MB5A 1E1DA 3TCNA 5LP1A 1L5YA 4IV0A 1G7TA 2ZUEA 4BHTA 4EQ6B 1E6WA 1XK6A 2X4LA 4H0NA 4PC7A 4R2IA 3AI1A 4B6PA 1HTTA 5J4VA 5JAPA 2BM8A 3ZXUB 4CW7A 1ODLA 4J7XA 3NKLA 3LOQA 4C5AA 1L1FA 2C78A 3ECAA 4NFLA 4AWAA 3RTBA 1E69A 4QYWA 3ZDZB 3KKOA 4KQXA 1M2FA 1QB8A 5JSZB 5A05A 2PLFA 3HL4A 1PQPA 3HZRA 3ROXA 5J43A 1KNQA 1RM3A 1ZESA 3A58B 4GOND 5B1HA 1YT5A 4CM8B 2R11A 3QSGA 4G0OA 3H9GA 1Z17A 4J3FA 1ANKA 3SR4A 3AW8A 2AN5A 1TA4A 4X63A 4RCYA 5GV7A 2XMPA 1XRQA 4F6RA 1K75A 2CK3D 1H0SA 2YS7A 4TTIA 4YAWA 2Q7DA 4BVAA 4DIFA 5IXSA 3KKNA 5K3SA 3C3XA 3E9DA 2YRWA 4WLNA 4B32A 1KEUA 1Z8HA 3VOSA 1JILA 1TM2A 1JTVA 4NBKA 1B1AA 4PS1A 2HA4A 3DZ8A 3H0CA 5EMLA 5IDYA 5B6PA 2UYCA 2W8BB 1HRDA 3BBLA 1SVOA 1E9FA 4JB2A 3PITA 1N3LA 1N6OA 3P71T 3JSAA 2XZDA 3ZNOA 5E4YA 2ICAA 3CW8X 1FRNA 3FTCA 3MPOA 3FLBA 4INOA 1RBMA 1RM5A 2C7GA 2JFZA 4RORA 3WLPA 2WJVA 1FF9A 2ZP1A 3NIWA 2J4DA 1N75A 3LI2A 5EMMA 5JZ9A 1MAUA 2G72A 1UPAA 2OMEA 5EKUA 4U9HS 4BNTA 1I9CA 3EZYA 4BKMA 2PTGA 4OLBA 1ZJ5A 2HA2A 1RHJA 1XCGB 3BXPA 2QN3A 3I83A 3KYCB 1GKLA 5AKEA 1CR2A 2RB4A 5BVHA 2ORVA 2CE7A 5A3VA 5J23A 2C61A 3ZBQA 1J49A 1ZXXA 1YV9A 3C6BA 1VPVA 4YRPA 4XVHA 4GT1A 3FD8A 1SU7A 1ZZGA 3GJSA 4CTMA 3F8SA 3MMXA 1BQEA 1GPMA 2VBGA 1RD4A 3FDIA 3NH6A 5FTMA 3MMNA 3RG8A 4LGCA 4R8VA 3VV3A 4ML3A 1QJ4A 4UUQA 3TINA 5HR5A 1MFZA 3HA7A 1Z74A 3JD1A 3MCUA 2DPMA 2R1ZA 3GLVA 5IKEA 3DE5X 3K4QA 2VPYA 3L6RA 3EVGA 1RI2A 1VDZA 3OZSA 1KBQA 3L77A 5BQFA 1EB8A 3ZTWA 4ZC8A 3AEKB 2WJHA 3MGGA 1A77A 3L0BA 3KOOA 3LY5A 1XYGA 1Q92A 2WWVD 3F2VA 1TMOA 3S8MA 5LVAA 4FFDA 5KUTA 2C2BA 2I2AA 3N58A 3OU6A 5EN4A 4MR8A 3IUNA 2QMHA 3WGVA 3H5VA 3Q5EA 4C89A 2J48A 4WPGA 4P34A 1XU9A 3H2BA 2H3HA 3W4IA 2GK7A 4URZR 1N6IA 1C9MA 3LIPA 5ALOA 3EEQA 3RS0A 1VCMA 1FJXA 4BU1A 1AKTA 2B83A 5C53B 2YUIA 3PHGA 1EWKA 3KZKA 3V8PA 5A6SA 4CIYA 1TUBB 5DBIA 1XMPA 2EW1A 2PMBA 3W9UA 3G23A 3LHSA 3RUPA 3ZI7A 4CG1A 1EA7A 5FORA 4IHJA 3WLNA 3SFZA 3JYNA 4QECA 4QOHA 3IEKA 3UAGA 3K0FB 2R2GA 2YMQA 3DV9A 4ESOA 1QZ3A 5FWYB 3IPYA 2Q3FA 3MXTA 5H59A 4FLMA 3OHMA 4ABTA 1RKUA 4FMDB 1ZH4A 2Q8PA 4CJXA 4URXR 1H0HA 4QKQA 1KSJA 3ZVMA 1FLNA 4NV3A 3S1LA 1DE0A 4KVFA 5IBCA 2A7QA 1RKXA 3MIZA 2HOQA 2Y2VA 3NCHA 1K8ZB 5DGCA 3SXUB 5FQOA 4WCFA 4AS3A 1KO4A 4EOGA 1HE1C 1ZXLA 1TRHA 3KE9A 1CUJA 3W5IA 2A9QA 5ADHA 2HMSA 1WEHA 4I99A 1U63A 3VNUA 2QX4A 1QOQB 2PKQO 1X7ZA 2WVJA 4MWOA 4YY3B 3HR8A 1FTYA 3FNEA 3OQJA 4I6GA 3UENA 5JNSA 1QP4A 1ZN8A 2B2NA 3I76A 4UBOA 2V1UA 2O2HA 5BP7A 4AY5A 1CIPA 4G1UC 3BZUA 4JV5B 3SQNA 4ZK6A 2DWCA 1P9WA 2VTDA 4ZDWA 5UKDA 3WGIA 3U4MA 2ID7A 3H83A 2PJDA 3LECA 3SYTA 1N3YA 3F4BA 3VVBA 5BW4A 1OE0A 3E0QA 4E46A 5CJJA 5JCOA 5JW6A 1GM5A 2VRBA 3FFTA 4JVMA 1G21A 4E13A 2GN2A 2VRCD 3O5AA 1NATA 3AYXB 2IHTA 4ZQFA 2A5JA 4KXFB 1ZVJA 5A1TA 4IR7A 1KO7A 1RPJA 4PG7A 4JOCA 4PYQA 2AXEA 4N03A 4L0QA 2VJKA 2ZSDA 3CF0A 1GGEA 1L9XA 2JARA 3JQBA 4MEJA 5J2TB 1PKEA 4JVSB 4MQUA 4XDZA 1K5DA 1KYVA 3OCCA 4YCDA 5CA0F 3H4VA 4NBTA 1ZLYA 4KSBA 5AW2A 4YXWA 2B4KA 1VE5A 2TMGA 4K9SA 3U5TA 4KNWA 4NABA 1XZMA 2OO5A 5H8WA 3PJRA 3STXA 5KQSA 1XZDA 4EIWA 3EZNA 1MVOA 1HYHA 2AEMA 1E94E 2WM2A 4JS0A 3RSQA 1NVGA 1P6QA 2HCRA 4DCVA 4AKEA 3EGCA 3STVA 3GCGA 3I2FA 4WX2B 5GZ6A 4FOSA 3CXUA 4ER5A 2WFLB 2Z2IA 2FWIA 2CLEB 3CWCA 3GLQA 4WFJA 2V54A 3L8ZA 2GZSA 1RWVA 2Z2YA 5G1OA 2P9ZA 1ZK2A 5EP2A 4R81A 3K0BA 4FOPA 3PX3A 4TLDA 4MRAA 5LU8A 3NM6B 1ESZA 1A69A 1B14A 2GHQA 2YNMC 4ZEXA 3T3PB 3TO5A 3VISA 3KKKA 2JLUA 3QKSB 4F91B 3QFFA 3BD8A 4Q00A 3EFEA 3I8OA 2OV1A 1VB5A 5JFGA 3DL7A 3N6XA 1FX0A 4D9FA 1CZNA 2C58A 3R0VA 2BMVA 2C2ZA 2X22A 5A04A 4KDFA 3OWHA 4WWHA 2I9KA 3DHNA 1Z25A 2IP1A 3B1KA 3JQ7A 4TN5A 1DNPA 1JL3A 4B6GA 3LVQE 2NU8A 3LA8A 3JAWA 4IDOA 3OWXA 3ED1A 3AUAA 4WESA 1F6BA 4IHKA 1QRSA 1Y80A 1X87A 3U7EB 4IDNA 4UHBA 3OTHA 3FOAA 3OZ7A 4RZQA 3R8XA 3FTFA 5KJCA 1QHSA 1PF7E 2IP2A 1SUIA 2ZRJA 3LBYA 2GEVA 2JVKA 1A3CA 3RUFA 1Z75A 2XCTB 1SC1A 3F9IA 4KFCA 5THQA 5HF8A 4V03A 1G2OA 4E07A 3HB4X 2FX2A 1TF5A 1EX6A 2ORED 1EE2A 4MQBA 4QELA 4X20A 3SZOA 4BO4A 3CZMA 1U2PA 4C2UA 3G9TA 3QOFA 1SB8A 1P7VA 4URVR 4P6VF 1H23A 2PWZA 2HZ7A 1NULA 4TTRA 2X4GA 1R8YA 4RQTA 1C2YA 1FLAA 3UPDA 5KYXB 4W6ZA 4GOMD 3AP3A 3C7KA 3BG5A 3D7RA 1DRJA 2H1HA 2QX8A 2Z4SA 3OZFA 2AR9A 1F2VA 1WMAA 2W2VA 4S1VA 2NVUB 1QQTA 2GZ1A 1C3LA 4LJYA 4F4JA 1VCNA 4ZFNA 1EX1A 2DBVO 4E5PA 3DJFA 4F5EA 2A5YB 3S2ZA 2IU6A 3W5HA 4F4FA 1GPWB 3O3MB 2A9RA 4WBNF 2VYQA 4NL4H 4M9XA 2CF6A 5E8JA 3UWPA 1J06A 1EHIA 3CA8A 1BFDA 2ZT5A 3H13A 4FYHA 4LV5B 2J9FB 4Q3LA 3ES9A 5IDVA 2FR1A 1N92A 3P19A 3BFVA 2BFWA 4LSWA 3AR5A 4G85A 2AL7A 2C4VA 3NM4A 3UA4A 2IW1A 2B3DA 5E9AA 2RGBA 3ONWA 4TVBA 3HMKA 2A4KA 1EVIA 3O94A 5AI6A 2NU9B 1F3OA 3L04A 3LQRA 5EZ6B 3WI7A 2QMZA 2B37A 1N2OA 3JQAB 3H5LA 3TDKA 1U7WA 4KLRA 2AMYA 3FOBA 4CLRA 3NIBA 2UUBB 4QO7A 3ZWDA 4BQOA 3D8BA 2OHGA 1MAHA 3DEYX 4LJ8A 4FHGA 2H9AA 4YDSA 3RYHA 4BZZA 4LY6A 2FHSA 2ZQ5A 1M6WA 4D57A 2P6PA 4Z4EA 4C0KA 2F9MA 4LS3A 5C5IA 4K87A 5I01A 2WWIA 2GO7A 3KDAA 5CVJA 1GN8A 1OZGA 1SCUA 4HAWA 1Q1NA 4ZEWA 3OO0A 3T1VA 2B98A 3HDJA 2GLTA 4Q66C 3L40A 4HAVA 4RZ3A 3TR6A 2GBFA 3AESB 3ZR4B 1V8FA 2Q46A 3OHSX 2VTEA 1GTL1 1ZY2A 4ZVRA 1E4YA 1G0NA 3D6HA 3BIOA 4EI2A 4F96A 1XCLA 5AW5A 4OREX 1L5OA 3RVQA 2K2QB 5FAKA 5MGBA 3F7TA 3HC7A 1VLLA 3K6SB 1EH5A 1M8FA 4TV8B 3IKVA 3DULA 1S8FA 2PR2A 5CP8A 1FTWA 4QOIA 5JH7A 4AKGA 3VU0A 1PX2A 4RTMA 1VI6A 3EPPA 1ZC3A 5F51A 1MJ5A 3U44B 4LOIA 4O4IA 3WL5A 3ZDRA 3BH6A 4EHNA 4TVOA 4IDHA 4ND3A 4F6CA 3Q72A 1EUQA 3F4KA 4MYUA 3NHKA 3ZWBA 5H9VA 2C4KA 2FRVA 3IBCA 3JZIA 4POAA 1C8VB 1DBIA 5FBLB 4YXWD 1EJ6A 1QGDA 4K2AA 2FEAA 2ZE5A 4QSMA 3LK7A 1NBEA 1I3CA 1BJRE 1NM5C 4YO8A 4URFA 1CQJA 1PD1A 3BD6A 3BX1A 2EZ4A 2J87A 3EJWA 1RQXA 3P32A 4HH3C 3U31A 1VFNA 2V7EA 5AM3A 3HDQA 1HM5A 2RHCA 3AJEA 1HBJA 4I1PA 1GCAA 1Y63A 3RUDA 4V0SA 1WVGA 1TQ6A 4A6EA 4ER7A 4GP6A 4XASA 5CA1A 1RI4A 2HC9A 4MP8A 2YZGA 1KMCA 1XTUA 4QPPA 1NFFA 2F2TA 5JMPA 4UOZA 2H85A 2PBLA 1E1RD 1SIWA 1LVGA 1PWEA 2NXCA 2PXXA 4ZO9A 5DMHA 4HNSA 5DSXA 5IEBA 4HNTA 2LGJA 1ZOSA 5KOIA 1CYDA 3UMYA 4BNIA 3TNDA 3GAFA 4RTOA 2G1PA 3NTOA 1RJGA 4KOEC 4KE6A 2QDXA 2VJBA 2TSYB 4CNBA 4GI3A 3LS2A 1OMOA 4QDJA 2C5AA 2AIRA 4J4HA 1XPOA 4ETIA 3BQ9A 3SMQA 2GJ4A 1SBCA 3G2MA 4XRRA 3UMFA 3NFRA 4UAGA 3QTBA 4RSRA 4FHCA 2XNDA 4R9RA 3GGGA 3KP1A 2KBEA 5K3BA 3HXMA 4RH1A 4PGMA 1LFDB 1U5CA 2V3VA 4INAA 1O9GA 3HCBA 5IMSA 3LTNC 2EP8A 1KMHA 2NO4A 1QQ5A 3JWHA 4BB9A 3DPUA 4MW1A 3VVLA 1EK5A 1SCAA 1G2QA 4DIBA 3F2IA 1JG4A 1QZTA 1T2FA 3DE4X 2BN4A 3F6BX 3NONA 1A9PA 4EO7A 3VKHA 5E4TA 2GCOA 2QTVB 5EAIA 1OYWA 1Q7RA 2WHPA 3A6PC 3UAYA 3J7AC 2RI6A 4CV3A 3H2GA 3WRXA 1KPGA 2XH8A 1Z4PX 2BMFA 1JVBA 2Q5HA 3G2KA 4PXSA 4D26A 1ISIA 2QUHA 5EI5A 5IAGA 5KJ6A 4XCQA 3DE7X 3S8YA 4K9RA 4LK2A 3JTEA 3KAJA 2ZBEA 3IUJA 3HO1A 1L7QA 1QHHB 2WVGA 4ER3A 5M34A 4MULA 3GFFA 2HTEA 2JCGA 3D3NA 5AJZA 2FLKA 2GHTA 1YI8A 3PNYA 5CDYA 3ROKA 3JXEA 4CKCB 3HDGA 5DHPA 1JLMA 1CQIA 1JN0A 2WSLA 4GXRA 2H29A 3C4JA 3DNMA 1EI9A 1A9SA 1Z7WA 4EKGA 1AZSC 3KR9A 4EG1A 3QJYA 3B3GA 4BB6A 2F1IA 2VHQA 2VJMB 4C0XA 3M33A 1ZZEA 4HDMA 1ZGHA 2YN4A 3R5JA 5D5PA 5ALFA 4B71A 5A5GA 3RUCA 2EHJA 5LIPA 1J09A 1P80A 3HUUA 3R6WA 5CFMA 2FE1A 3QF7A 5AKKA 2FW0A 5BSFA 2NMVA 1LC0A 1K63A 4PAQA 4CF5A 4DIDA 4BBZA 3U7IA 2WKWA 1FU4A 5BWMA 5PNTA 4DQKA 2XUFA 1O94A 2YHAA 1Z6XA 3EQ6A 3L8YA 3BAFA 1IB6A 5HRCA 2WZDA 2ERYA 4P93A 3CPHA 4MVJA 3TSYA 4C4AA 2ZCJA 1VP9A 1SUDA 4LVOA 1EE1A 3N8HA 1VSVA 1YL7A 2G09A 2R47A 3IALA 1T3LA 5FI0B 1BYUA 1Z0AA 3HQ4O 3L6CA 5FBKA 1XLVA 2XEXA 2BLNA 3OICA 3N2ZB 1GSIA 3COZA 3AQ4A 3VHXA 5LXTA 2BMDA 3KEMA 1Y1SA 2WA2A 4DPMA 2O8EB 4FR5A 1QJCA 2P0AA 3JWIA 3QLUA 3IQFA 4TKZA 4ESVA 1ZXBA 4IICA 2E5WA 2O48X 3M8KA 1ZAKA 3HBMA 1NLZA 2NZ2A 3W3AA 3V4LA 4AMGA 3S2FA 5DGDA 4AS1A 2ZZMA 3IP5A 1ZH8A 4B43A 1I2ZA 2AZMA 1JALA 1NDHA 1KVRA 1TM3E 1URPA 3DM5A 3H8WA 4MKXA 1TL7C 2C9OA 1XELA 4PWYA 3GQVA 4L4RA 2QBYB 3N8DA 2PTHA 3VKVA 3K05A 4DT1A 5DP2A 1WIWA 3ENKA 2C2HA 2AN9A 3G7NA 3EAGA 3QX9A 4R5HA 1V11B 4AIIA 5E8RA 2WB4A 3JX9A 2QI9C 5L7TA 2DB3A 4JT2A 4BGIA 5BN5A 3SOZA 1DEAA 2HXSA 3SQLA 1HQYE 2NSJA 1T8SA 3ILHA 3PWKA 4LDNA 2AOUB 4RDXA 2DHCA 1R6BX 4QOFA 5TF0A 1XXLA 4RK4A 5EJIA 1NVAA 2NWQA 1N2HA 3DTYA 4B46A 4L6AA 4PYRA 1G8FA 3DQQA 1GFIA 1ODJA 1OYYA 2NPIA 1U3WA 1RXSA 3SWWA 1ORVA 3CX8A 2Z8XA 3DONA 5FI5A 4F2PA 3ZY5A 3DEFA 1AK1A 4UZSA 4JI3B 1QGUA 4K3UA 4WMLA 1Q74A 2PBRA 4RKFA 2XJ9A 2QRJA 1Z5WA 1S7CA 3P9XA 4UM5A 1ADCA 1QB7A 5WRFA 4P7KA 1SULA 2BGGA 2QRKA 4FHZA 4R2XA 1HDGO 1BQ3A 4PINA 5HJ7A 4WJKB 1WXQA 4IIUA 4LHZA 1CKEA 1ARZA 3VAYA 3B13B 5MGNA 3N39C 3E3NA 3GFQA 4I66A 5FTNA 1O6BA 4HZUA 2ODBA 5HF6A 4IRUB 1RYMA 3GK3A 5JAIA 2ZR9A 2OUIA 3MNFA 3SBEA 4HYTA 1QH8B 2Z83A 1RE1A 4MAMA 4PN3A 1IIBA 4J0HA 1FBNA 3TOSA 1ZI6A 3HWSA 2EWVA 1T10A 4WKNA 5ITZA 2Q1XA 3SICE 3P0HA 2E5LB 1HI9A 1UMKA 3BSWA 3D6UA 4HEJA 5JAZA 4NXMB 2XNKA 2XNDD 1KGSA 4PLGA 3V46A 2F17A 1G38A 3FRHA 4BO7A 5HE8A 2C99A 4L7VA 3CISA 4QG3A 2J6BA 4PY2A 5LA6B 3I6ZA 3GQBA 1U4NA 2FMUA 1AUPA 4MV6A 2EX1A 3RSHA 2BZGA 1PT9A 2QVLA 3G82C 4IDCA 4ZHQF 4BNLA 4HB4A 4LC9A 2OLJA 5E1MA 3V4VB 1G3MA 3QGMA 4LXTA 3UCFA 5KPDA 5JJLA 2PJUA 2UUOA 2JS7A 4LW8A 3VVMA 3W2HA 1DBRA 2JJYA 3H5TA 4EJMA 4FB4A 1ZUHA 1JSLA 1ODCA 3P20A 1MX5A 3ZQJA 4HX9A 3PQ7A 5T3UA 5JQGA 2A1UA 1B26A 4BGVA 4FCCA 1USKA 4M55A 1DC5A 2ZRQA 2B1JA 3AGQA 1T4BA 2Q4EA 4RHFA 5EOVA 4YV0A 5KSOA 5INTA 1LF5A 4RS4A 1Z4KA 3A7DA 4MEAA 4CRWB 2DBZA 4U4AA 2UV8A 2BL4A 5BURA 5K4AA 5HZMA 2VUIB 3P26A 4ZKEA 1ENYA 4N01A 4AG5A 1OAOA 1KXZA 1TEZA 4BEJA 2A92A 2APJA 2VK4A 4L16A 4O4LA 2B20A 2ECQA 1U8CB 1QIFA 5TC4A 1MDFA 4P5EA 2HLDD 2HUNA 2OM6A 3KVRA 3UH1A 3BWDD 2IGTA 1RZUA 2JD1A 5K8JB 4TQUS 3F7OA 5B3KA 4B4KA 5I6DA 2IOYA 4B3MB 3OA2A 1D1TA 1T6XA 1TW2A 3U9LA 4XB2A 4ZT7A 3MCVA 1BWSA 1JIXA 1NXTA 3G0DA 4BBJA 4L5BA 2VPIA 1D6JA 3CWZA 3OKAA 1N6LA 1REQB 4RX1A 3VTFA 4B7AA 3PXGA 1EIWA 3M1AA 1OBFO 2NVWA 3DZDA 4UCQA 1UDRA 1W0KA 2WAOA 1DCTA 4AIRA 1O94D 3JYHA 4EMTA 2BELA 4UCXA 4O63O 1G21E 1PR6A 2WJWA 2NU6A 3C70A 2W70A 4MVJD 3RTAA 1Y6RA 5JE8A 1YTUA 4MUBA 2O2ZA 3BN3A 4BQSA 2V6MA 2X5KO 4OBWA 5HZGA 1UK8A 2YVKA 2L42A 2P2SA 4EF4A 4JDPA 1MZPA 4BE4A 2CLKB 2EIHA 1IZ9A 2BDEA 1QF7A 1MJGA 3PKIA 1N2BA 1KR5A 2EFCB 1XT6A 1FMJA 4NS1A 4C88A 4IXWA 4LJRA 1WPGA 2PQ0A 2IITA 1YGYA 3DT8A 2D54A 2ZITA 4WXEA 3IS3A 4BNUA 3E18A 2GBLC 4BNVA 4OSEA 3WNVA 3LUJA 1JFLA 4IGIA 1VJ1A 1VL2A 3NWJA 3LA6A 4Y9UA 4HQ0A 5LDHA 4KP7A 5F1PA 5D7NA 1BDBA 5KVVA 5EHZA 1U9CA 1XJ5A 2CE2X 1EKXA 1UMCB 2WIJA 2Z2XA 4QNNA 1D4ZA 3W5BA 3L7LA 3W3AD 3W5DA 1NBAA 1DO2A 1X7WB 1Z8DA 3IA7A 4IXDA 3OLZA 2JBAA 2HJVA 1PZXA 2O52A 1VGVA 3QE2A 4H59A 5HFAA 1PGJA 1LDEA 3X44A 4OF4A 4UDOA 2J59A 1IOLA 3AQIA 4RA6A 4BQFA 2JGLA 3ZWWA 3F73A 1GILA 1UK7A 4TX1A 1VJDA 4YFYA 2WHRA 2XMGA 5THKA 3RU7A 3RU2A 1KTIA 4UKDA 1RJ9A 1HORA 5DYYA 3RVSA 1FP1D 3KCQA 3HYTA 3M3HA 4DV0B 5I7FA 4ZZ2A 3V8BA 4ZYWA 1RE0A 2YKGA 3QLVA 2GZ2A 1XZHA 3VOAA 3OEHD 3S99A 1G5TA 2H54A 3GP3A 1JFSA 2LWIA 4BKOA 1VCIA 2HWUA 2VH2A 4CODB 4Q5IA 1FFXB 3USCS 1KQFA 4MA0A 2P2NA 1U5BA 4JT9A 5IP5A 2D7DA 5EQDA 3LYLA 2QN1A 2V6BA 3IIJA 3QPCA 3VNVA 2YWRA 3CO0S 2WUEA 4MWEA 1DDIA 4CDMA 2AJDA 3JARA 4LQ4A 4Q7EA 1VYVA 1RQLA 2AUTA 4EI9A 3T41A 1FYEA 3LLMA 1VYTA 3U7GA 1N7JA 2FCAA 2RJNA 3KPVA 4W7IA 5BWBA 2X6RA 1OZ0A 4NENA 4ERXA 2GBCA 3FHLA 3ZY4A 3BM5A 3H4TA 3E9RA 1LDMA 2QLLA 4M1KA 3LYHA 4M9SA 4AI6A 2H2FA 2X3UA 3IIMA 3JAKA 1YS9A 2E4UA 4KQWA 1TK2A 2EYUA 1HNXB 5L4SA 5IYZB 2Q4RA 1E4EA 1KS2A 2QXUA 1U0LA 3MIIA 1H1DA 1P7YA 1ABFA 2NTVA 1SVKA 2X1HA 5KOJB 3I45A 1O89A 3DWIA 2UYGA 1M0SA 3GJRA 2Y0CA 3C3AA 2FMIA 4WSOA 4DC1A 4G41A 4QGSA 2IUYA 2XZOA 3BXZA 3W7AA 3QA3E 1KETA 1OXSC 4GXQA 1DZIA 4L4XA 4ZVVA 1FRFS 4BMSA 2QZPA 1G9XA 4MAAA 4NECA 3RAGA 1DRVA 3GT7A 1JA0A 4B3BA 3PC4A 1Y1RA 2QYSA 1EIZA 1P17A 2KBFA 1X0XA 5AIAA 3T9FA 2EGGA 1U0SY 2JGJA 2J4CA 3MJHA 3UB4A 4BNFA 3RBZA 1Z7BA 3AB7A 3LV8A 1JG6A 1M1UA 4JI1B 1SIUA 1ZOIA 2DKOA 2ZTVA 1FNCA 3AVTA 1R6XA 1DXHA 1VG8A 4IKOA 3MGCA 3LWZA 4E5MA 5JXHA 3LF1A 1Z08A 3AI3A 3GUVA 3VMMA 2OD2A 3HZHA 2BMJA 1P5FA 1SVWA 2HNBA 2XGOA 3GFGA 3PDUA 4C2BA 2A5LA 1N0HA 4GKAA 3V7FA 4HGQA 3RODA 2PGNA 3JQ8A 1MH1A 1A95A 3OMXA 3K5WA 2ILVA 4KIJA 1TMYA 5B4UA 4HFJA 2BY4A 3A28A 4J9VA 4RD2A 1EPUA 2CNKA 2FWAA 2XW6A 3OCYA 3JATA 4M1QA 3MBOA 4EY4A 4YTEA 4DEYA 5EHXA 4Y1RA 2VNAA 3BWYA 2X5XA 3RTDA 1QQBA 3BB1A 1AK9A 3K5HA 5AKYA 2XT0A 2H3EA 1I4LD 4JLWA 5JZVA 4ISBA 1O0BA 3CC8A 3K9QO 3T1TA 5CLIA 2A0WA 4DCTA 4ZOLA 4JYZA 1TVKA 1QGAA 2P6RA 3K0AA 1XD9A 5LQJA 4OP3A 3EVZA 3VC7A 5K4HA 4PQEA 4RLFA 3HM2A 3OCWA 1PNTA 1L9KA 4UMDA 3ADDA 1W0KD 5A0FA 4IDAA 2ID4A 2Z9BA 2C84A 2AQIA 3O2SB 3MTAA 1SVSA 2AI3A 4NBSA 5F1OA 1PWZA 4XX0A 3O8QB 4R05A 1UXOA 3ORYA 1C50A 2IUFA 2QVGA 1EUZA 1EWVA 2VSNA 3F78A 1IE3A 3RWMB 3OJFA 1JJBA 3OOJA 3VFDA 1VJGA 1Z3IX 2BTQA 2PZKA 4LRSB 3MCAA 4X6UA 4BKQA 1L7AA 3IE1A 4Y0AA 1E3IA 3RK1A 4BTVA 3VTZA 4PAGA 1I5EA 3EXFB 4NBWA 5ICCA 5AUQA 4DMFA 4HTAA 1W6RA 5GONF 4JB3A 2OTCA 4OOFA 5J40A 3R77A 3G0GA 2VF7A 2QZJA 3GJ0A 3VPHA 2PX0A 3LP8A 4DL9A 1W85B 1RWQA 1ZMBA 4R1SA 4F56A 1SC9A 1A9RA 4QRDA 4RIIA 3TEJA 3GJ5A 1HGXA 1KYZA 1G17A 2QRHA 4KMMA 3MELA 3QLJA 3I52A 5CVTA 4P58A 1E9EA 2OV8A 5IVIA 3RJ9A 3SIXA 2DFPA 2HDHA 5BWNA 1B1CA 4HY3A 3R7SA 3LHKA 2GFIA 4NMLA 1QANA 3HY6A 1XQ6A 3QPAA 1N4DA 4I3HA 3BTSA 2XRYA 1KYIA 3AEZA 4IDFA 1LPAB 1TFUA 1AGRA 3WLQA 2JGIA 1MX9A 1MEOA 4Z9BA 1SCQA 2BH2A 3SQXA 1H8HA 1WCV1 2OHVA 2YZNA 4EW1A 5GINE 1IZ8A 2R7KA 4BV3A 4OLFA 4EW6A 2FNAA 1XMQB 3B3JA 2C95A 4FONA 4JU8A 1TM4E 2JBWA 2OO7A 5KYUB 1PLJA 4IJWA 4V0NA 2F1JA 3T0IA 1N6RA 1SEPA 1YBHA 4N47A 3IVCA 1WVMA 4J29A 1NNI1 2DKFA 4IIVA 4LHVA 4HT3B 1JFFA 4H3KB 5B55A 5FKJA 2WU8A 4X0EA 4CV0A 3LKVA 3TTTA 1K4KA 1XO1A 1AKNA 1E4VA 2VXBA 2MYPA 3JQPA 1JWBB 2FN8A 4N7RA 2C29D 5GIOE 4B7UA 1MORA 2AFVA 2Z57A 1UMBB 4R1UA 1EDOA 1JUDA 4J7AA 4ARZA 3SVZA 1Q0SA 4BVKA 1AB5A 4DR5B 4MCJA 2YHIA 5ITVA 3DUFB 4X90A 4M53A 4XGKA 1TKCA 2B8EA 1F2UA 4DGQA 5F4BA 4C6SA 2PKEA 4YPVA 3A4VA 4F9EA 4Z0PA 4IEFB 3KSMA 2X0FA 3RSCA 3T94A 2ET6A 3U3MA 1MIOA 1XKQA 4OGKA 2ORIA 2XKKA 1PYGA 1KDZA 2P67A 4PX9A 3FWYA 3CVJA 3KQQA 4AZ0B 3KZOA 1CEXA 3R4VA 1GV1A 4G5RA 5SZKB 4RJLA 1VDMA 4Z4HA 1WCXA 4C7OA 1BVHA 2IUSA 2BZ0A 2J7KA 4ENSA 1XQ1A 2XB8A 3SVTA 4GC5A 2IYZA 4IF4A 4KXQA 4UHCA 1KO8A 5E2BA 1E1YA 4Z6KA 4B8ZA 2GPNA 1DQZA 2EW2A 2VJQA 5FH9A 4BJ5A 1RZVA 3AUJB 4JT8A 3V6MA 3BORA 1Y7TA 2QYHA 5KTOA 2I76A 3GG9A 5K7SA 3LT0A 3I2IA 3F71A 1YQWA 1GPJA 1SXJB 5FBZA 2HGZA 2Q5FA 2GZMA 1PVDA 5MN5A 1MJFA 1YKSA 2WJPA 3O9VA 1GNQA 2V7QA 1HFKA 3FVWA 3ZVLA 4RULA 1HNZB 2K6GA 3SEFA 3E61A 1QP8A 5I7UA 2G5GX 4BNZA 5I7RA 5KSPA 3KFVA 4AB1A 3GDHA 1LNZA 4RQUA 1ETUA 1RWOA 1W5AA 3I5AA 5AKHA 4Y2UA 2IEAA 3KJQA 3ZD6A 2P4HX 1Z33A 3SZLA 5IZCA 3BAZA 2N42A 4IILA 2ZUVA 2ZIEA 3LXXA 3W9SA 3DUWA 3R6TA 3E58A 1S01A 4LE1A 1W52X 1JYEA 1CUGA 2CNOA 3PPYA 4N7BA 3RBAA 3A1SA 4NONA 3RVMA 4P2GA 4E2FA 4IGFA 1ZM7A 4BMCA 2HQSA 4I8XA 4D7AA 1IN8A 2RI0A 1XHEA 1XB2A 3QVKA 4MB6A 2YQ4A 1HV8A 3ZE6A 4MVJE 3RVPA 1W2HA 1PZHA 4M0EA 3F8TA 4TM8A 2H0RA 3UUEA 3AR7A 1PZMA 1P73A 5H3CA 5BR7A 3GLFA 3M6XA 5HVNA 1T5BA 2Z30A 1WHTA 3BFJA 3L82B 2EZ9A 1IB0A 4ESHA 4F38A 1MC4A 2RC5A 4G56A 4J1TA 4MQMA 4F4CA 4BMVA 1K89A 1F8XA 3TQTA 1JQAA 2XTAA 1W5EA 1EZZA 3PCRB 4ZEMA 3ER9A 1OSNA 3ENVA 2C5HA 4F5DA 2XCQA 1YIDA 2Z3VA 2WNHA 1LPOA 2UZAA 3JZFA 2FW8A 3D9QX 2NACA 3H1GA 4PNZA 2VPPA 1Q17A 3WWCA 1M2KA 1YIOA 2G5TA 4EW2A 3OD5A 1XTZA 3OLVA 1NJ1A 2ESRA 4AT1A 2Q3CA 3FRJA 2MSDB 3AONB 3RV4A 1UBNA 1H66A 2P2CA 1ULTA 4B31A 2O2XA 4X54A 2WSIA 1CP3A 4MKRA 1DIBA 3DG9A 1X1BA 5KO2A 2HLPA 3BRCA 2HDWA 3AEYA 3NHSA 5AVSA 1JYSA 2J46A 3ECSA 2J9XB 3SPXA 4D9HA 2BFOA 3DZHA 3KAPA 3DLIA 1QIKA 4COKA 2IU0A 3I9KA 1GUZA 2CUTA 1IH8A 3HJNA 3M6AA 5FOQA 1UP4A 2O3TA 3WV5A 1YI1A 1U02A 4CBVA 4X1KB 1Z83A 1ZM3A 2XUDA 1WE2A 4Z1OA 1GV0A 1RWKA 5GAJA 4BQNA 2JFWA 1WL8A 4H7FA 3W1WA 2PE5A 4PBRA 4PGAA 4KUEA 1WXDA 1DKNA 4RANA 4RY9A 5GP1A 3VZRA 3TTXA 3PNMA 3W8FA 3BGVA 4XWGA 4CMJA 1GAQA 2C3YA 2OOKA 3ZNQA 1NJGA 2FUNB 1ZUNB 1CUDA 4KB5A 1YB6A 1GUYA 1T6ZA 1F0KA 2AWOA 4O2AB 1KAEA 2B6HA 2V7BA 4DF3A 3FUVA 5AH0A 4ZTBA 3FUUA 3NOOA 4AJJA 1UXHA 3FAZA 5FB3A 2Q9UA 3IT1A 5JI3E 1XPJA 1BROA 2ZJYA 4IMJB 3SSAA 5A5EA 5ARBA 1Y42X 1D5WA 2P5TB 3IO3A 2Q3HA 4YC7A 3QVUA 5B37A 3T5TA 2XOKA 1KHTA 1Y6QA 4QSHA 4DLSA 3IT0A 2DQSA 4Y6OA 1ESDA 1DJOA 1Q12A 1YMQA 2GF2A 3GGCA 1FC0A 2IXBA 4IOMA 4OG2A 5DX0A 4KVGA 4N4AA 3HDTA 5FT9A 1MXHA 3UT5B 5IHPA 2QL9A 1T2NA 2EGUA 1XALA 1DKMA 1XU4A 1ZGGA 4AG6A 1P2VA 3X1ZA 2WLSA 2ZWPA 3DBLA 4I08A 4JUDX 4KJZA 2X41A 3E6AA 2C3UA 3W1EA 2CVFA 1G8PA 3OZXA 2ZJAA 3CUKA 4KX3A 2IYUA 4TKUB 2Z1NA 4RF3A 4UJ5A 4BVJA 2ZBFA 1UKAA 1HSZA 4I1SA 4UTOA 3V2HA 4F6RB 2R6R1 1NW8A 3H11A 1A4UA 2R8XA 4GVXA 1RVV1 1ZO8A 2C2WA 4K40A 2XMZA 1RLOA 4WN3A 4CV2A 3H6GA 4D8TA 4EF6A 1EM8B 4RK5A 5AVYA 3OX2A 2YZ2A 3LT4A 3I01M 1WOYA 1AZTA