3V2HA

The crystal structure of d-beta-hydroxybutyrate dehydrogenase from sinorhizobium meliloti
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
260
structure length
232
Chain Sequence
SMMTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPADMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTIRGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNSICPGYVLTGQPTKKFITVEQVASLALYLAGDDAAQITGTHVSMDGGWTAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of D-beta-hydroxybutyrate dehydrogenase from Sinorhizobium meliloti
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
molecule keywords D-beta-hydroxybutyrate dehydrogenase
total genus 73
structure length 232
sequence length 260
chains with identical sequence B
ec nomenclature ec 1.1.1.30: 3-hydroxybutyrate dehydrogenase.
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3v2hA00
4XZ3A 2UDPA 2JCYA 2WYUA 4CQMB 2D2IA 1JKFA 4BMNA 4B4VA 4MKRA 4WUVA 1ISMA 1E1MA 3BTUA 5I7FA 2BKAA 3LQFA 1PGPA 2EKPA 1M6HA 3PJEA 5G0TA 2AE2A 1ISIA 4BL5A 5A9RA 5IDQA 2W2LD 3TZCA 2C5EA 1MFPA 3PQDA 1QKIA 1MC4A 4OQYA 3A06A 1TLTA 5LCXA 4CM9D 4CM3A 2WYVA 4HWKA 3TF5A 1Q7GA 1KEVA 5FFFA 3KSZO 3INGA 1XG5A 4BKUA 5T64A 2UYYA 3G17A 4YYZA 5B4UA 5JE8A 1LTHR 4GH5A 4K9DA 4EGFA 2GUGA 4CV0A 4ZN6A 3DEYX 4QSMA 4YPOA 4TKLA 4FFOA 1NPDA 4BO7A 4XYGA 3QVTA 1YBMA 2CVOA 2WTBA 3ASUA 4CLRB 4AG3A 4BB5A 1V9LA 1WXDA 3SVTA 2J3IA 2TMDA 4QTZA 5IN5A 2OP0A 3NTOA 1LRKA 2VYND 1T2DA 2WEKA 1ZIDA 3GGPA 3MJSA 1GR0A 4J0EA 2EJWA 2PV7A 4YT4A 4CR7A 2GO1A 2W2LA 3NT4A 3V2UA 3W6UA 3FRJA 3KEOA 3UCXA 3L4BC 3ZWVA 1Z45A 3AOGA 4GX2A 1UAGA 4YQZA 4B7CA 1U8XX 3O9ZA 1W0CA 1HKUA 1TEHA 1ZO8A 2VUUA 4F46A 1U28A 4CM9A 1B2LA 4GGOA 4J4HA 2GGSA 4YAGA 4JBIA 4IJKA 4I9UA 3RASA 1EUDA 1KVSA 4KWHA 5CG1A 1KETA 3FCOA 5AXCA 4CLDA 4C4OA 3ADOA 4R41A 4GGPA 4Q3BA 1DC3A 3V1YA 4NJMA 1UXIA 4RCVA 1AN9A 4LSWA 1ONNA 4NR0A 3LT4A 2C29D 1VI2A 4XYBA 2XOXA 3CXRA 4BGEA 4BNVA 4E32A 1WMAA 3JSAA 1WWKA 2X0IA 3HDJA 3HN2A 1HWYA 1MA0A 1BXGB 2GLXA 2YV2A 3D3EA 4PG7A 5T8KA 4A27A 1O95A 4O0LA 4ZVVA 1SO8A 3VTFA 4CMGA 2EHDA 5FYDA 1DC4A 3GMSA 4BGIA 3QLJA 4E12A 5JC8A 5EN4A 5KIAA 5JAIA 1EDOA 1YB5A 3R1IA 2E82A 5EJ2A 4RVHA 2BI7A 3DXFA 2CDBA 3NTRA 3RIHA 1UXKA 4IDBA 3GY0A 4XQGA 5ICMA 5KKAA 1DPGA 1GPJA 1IULA 3FN4A 3NDJA 1YOVB 3ZU5A 4A10A 5EL0A 2GSDA 2C54A 5EQFA 4B3HA 5BSFA 5CPFA 3F5SA 3NDIA 1QR6A 3ZDFA 2F00A 3KEQA 3C7CB 5H81A 4BKRA 2QX7A 3B6ZA 1P1JA 4OSPA 2PKRA 1NHWA 3H9QA 3GUCA 5ES3A 2E48A 1T26A 2CF5A 3MCVA 3ITDA 4PG5A 4HXYA 2B5WA 3JD3A 3TZ6A 1PGOA 1EFLA 1SBYA 3HDQA 4KWIA 1WP4A 4XYLA 1T24A 1E3IA 4I9NA 1TVEA 5EERA 4PIVA 2R6JA 2VRCA 4K28A 3ZU2A 2AW5A 4IXWA 4L8VA 4DC0A 3BMNB 1DAOA 1IUKA 1DIGA 1NASA 3E03A 5JC1A 1ZK2A 3PQEA 1Z75A 2OL4A 3STHA 4EBFA 2FY8A 1GYQA 2GRAA 5KCZA 5KOIA 4WCDA 2JFFA 2ZTVA 3CZMA 1YDEA 3TN7A 3U4HA 1XIVA 1IZ0A 2O7QA 4AICA 1ID1A 1EZ4A 1PL6A 1U4SA 3OFSA 1EQ2A 4UVEA 4CV2A 5DT9A 3MOIA 5L95A 1YXMA 2D5CA 3B1KA 3ZI0A 4MKXA 3BAZA 3ETEA 4NBRA 3H5NA 1NBOA 3OBBA 3PPIA 5A1TA 1HDYA 1C1DB 2AEJA 3AU8A 4EI2A 4NH4A 2VHZA 3VH1A 3IS3A 4HP8A 1GCUA 3SX2A 3UAGA 2VZ8A 4IZHA 4Y67A 3PFWO 3PYMA 4ZQGA 4BO2A 1Y1PA 1RM4A 4J90A 3ZWMA 4BV9A 2VN8A 4BKOA 3PVZA 1N7HA 1UZNA 4C7JA 4U7WA 1GY8A 1P77A 2VRCD 4E0BA 3EMKA 1I2BA 4J7CA 3BMQB 4J1SA 3PYXA 3G3EA 1H6CA 3PDJA 1CDOA 4J9UE 2NSDA 3PWKA 4J43A 4WNCA 5HS4A 1I36A 2OFPA 5DBFA 1XA0A 2FWMX 4GKBA 3T7EA 1Y81A 1YBAA 3H65A 1YH3A 2P4HX 4F3YA 5L45A 2CUKA 3GLQA 4UEKA 4M86A 1H2HA 5IDWA 4YDRA 2YHIA 4ALKA 4R54A 4MVJI 3ABIA 4R1NA 5DN9A 2IZ0A 2J6IA 1QSGA 2ZCVA 4CV3A 3ZNQA 4GWKA 3U09A 1LSJA 1R66A 5TSDA 4R1UA 3AI3A 3IUSA 2DT5A 4G65A 1UXHA 1HE3A 5CDGA 4D44A 1E7WA 3DQPA 3D7LA 5CDSA 1QMGA 2O3TA 5CHEA 1K6IA 3HNPA 2EW8A 3PJFA 4B7UA 4KTVE 1OFGA 4BS9A 1HDRA 1VE9A 2I66A 4YEDA 3GPIA 3BIOA 3PXXA 4GAEA 1I30A 2I3AA 3FBTA 3OA2A 1U7TA 4XWYA 1CIVA 1BVRA 3H3FA 3OECA 3NJ4A 1YL7A 5IF3A 1CYDA 3GNQA 3O4RA 4YT2A 4IJUA 2VZ9A 1YBVA 1SNYA 2NNLD 4OJNA 2GN9A 1BMDA 2PNFA 4LRTB 4NIMA 4FGWA 1P3DA 3QVSA 5I7SA 4FSHA 1Q2XA 3GPDG 2B4QA 2CZCA 1JKJA 3TDKA 3BHMA 3RROA 3EDMA 4EJMA 4BOYA 2DFDA 1ZK1A 4QFCA 2I99A 3OEYA 2X5OA 4CLOB 4D3DA 1WVGA 1Z6ZA 2QQ5A 1YWGO 4ZQFA 5L51A 2HMUA 1UZLA 1YVEI 5JYDA 3I52A 1PQPA 1N9GB 4PLFA 3T7CA 1VL0A 1CERA 1ZK3A 5FEUA 1KEWA 1KVUA 4II2A 1E1LA 2P2SA 2C82A 2ZCUA 5ITWA 1PS9A 3GRPA 2CSUA 3F6YA 3HB5X 3AK4A 1PTJA 4OOFA 3HADA 1I0ZA 1P74A 1O94A 1WDKA 3MJTA 3TSCA 2X0JA 3U3XA 3GF4A 4RGBA 5DOVA 1Y7TA 4CM8B 3C7AA 2DPHA 1R6DA 2Q4BA 3GRKA 1R0LA 3QHAA 4DYDA 2Z1MA 3AUUA 3IKVA 1YRLA 2I6TA 2OP1A 1I3NA 3WR5A 3ROPA 1PSDA 4PFJA 4RF3A 4TVOA 4Q3CA 3K6JA 3KZVA 5I9MA 2CFCA 4H16A 1F06A 1EQUA 1U8FO 3DB2A 1T2CA 3JQFA 3UKOA 4E21A 2YV1A 1ZBQA 5H83A 2O3SA 2JHGA 4N54A 4AVYA 2HRZA 4NJOA 1PJTA 1ISHA 1PJSA 2BGLA 1HDZA 1KVTA 3NV9A 5MDHA 4NFHA 4CM5A 3HDYA 2JD2A 4GVLA 4OHUA 5JAMA 2Q2VA 1E3WA 5U4QA 4CMKA 3C24A 3ANLA 3BXXA 1LA2A 2PGLA 1GADO 4LGVA 1BXGA 1RM0A 4E31A 2WE7A 2Y99A 1L7EA 4ND1A 1ISFA 3AOEC 3DZHA 2PR2A 3KM0A 3RWBA 2O2YA 3ST7A 1PJCA 3VHRA 3UHAA 4D46A 3VZSA 1B8VA 2VTDA 2DUWA 4WLEA 3JQ7A 3Q1LA 3WLEA 1CQIA 3IP1A 2Y1CA 3GDGA 4D3SA 1C0PA 1IPFA 4MDHA 3NUGA 4FJ2A 4AJPA 2QIOA 3UGKA 4ALJA 4BNYA 3ZCXA 1KVRA 1A9ZA 5COAA 3WYCA 1BW9A 2G0TA 5G0WA 3RUFA 3WIEA 2Y1OA 2FRDA 1NHGA 3FTPA 3NT2A 1ADGA 5THKA 1SCUA 1U3WA 1LDMA 2BGMA 2HU2A 3MTGA 1HL3A 4FDAA 4HBGA 3V2GA 3OJ0A 3VVCA 2DTDA 2AEMA 2VHXA 2O7SA 4PVDA 4D45A 1HE4A 1T4BA 4DLBA 1P1RA 4FN4A 2X6TA 3NT5A 3V8BA 4BNJA 1O0SA 1SPXA 3JD4A 5L7YA 3EVTA 5HWSA 5JBIA 5TS3A 4EEZA 4FR5A 3OJEA 3WJ7A 1ARZA 2I67A 4CMCA 1VPDA 2H5LA 3O38A 2DBVO 1H9BA 1TT7A 1XGKA 1XWFA 3LC7O 2B4RO 3ASVA 3H2SA 3NGLA 1ZK4A 1Z7EA 3RC7A 3MTJA 3DTTA 2VUSA 3G79A 4TSKA 1NVMB 3DHNA 3QP9A 3WGTA 2WJPA 2FPPA 3LK7A 2NVUA 4LMPA 2E49A 4U5QA 4L9RA 2X22A 3VKVA 3FBGA 3JQBC 3WOHA 3GHHA 1R4MB 3NJ8A 4BNXA 2NLOA 2ZTUA 1PWZA 3WGZA 3BTSA 3HG7A 4HNHA 3ZHYA 5CFZA 2Y05A 4WASA 1UP7A 4KDFA 4A26A 1GQYA 1U3TA 4ZJUA 1ENZA 2NU8A 4Z0TA 2Q45A 3VPHA 3S8MA 5L4LA 4URFA 3DTYA 4U6SA 1YQDA 1HE5A 3GAFA 4TROA 3I9MA 4E2WA 3FHLA 5AQ1A 1P1KA 1E6WA 1A27A 4CLRA 1NWHA 2NWQA 1RYEA 4R51A 5G0SA 2JCXA 1Y5MA 4IDGA 4BB6A 1C0LA 2PTGA 3QRWA 2Q3EA 1Z73A 1DLIA 1O5IA 1SOVA 1FDVA 2QZ9A 1TI7A 5A06A 1Z82A 3ZU3A 1YDWA 3A14A 3DOJA 3RBVA 4YJGB 3O26A 3KETA 1PWXA 1GUFA 3P7MA 3HZZA 5JYEA 2D0IA 3IMFA 3E9MA 4OXYA 1ZJYA 1WNTA 4XGKA 4ID9A 4A2CA 2JKVA 1HETA 1EMDA 1KY4A 2GZ1A 1IHXA 1EBUA 3Q9UA 2FP4A 4G5HA 3DZJA 4MVJG 3RU7A 1D1TA 1UAYA 5B12A 1JAXA 3PIDA 3QVXA 5IJZA 2WMDA 2LDBA 3K8ZA 4CM4B 2O3RA 4BKQA 5TNXA 2Y1FA 2ZYDA 4NFSA 1KVQA 1C1DA 2DBQA 3F1LA 2PH5A 2PK3A 5L9AA 4DREA 3DO5A 4WCFC 3AI2A 2EIHA 4DA9A 1UH5A 4A5OA 3NRCA 3OSUA 4RVFA 4NG5A 4TRMA 4ZRNA 1KEUA 1B15A 2B35A 3ENKA 4E5KA 4RZHA 1H6DA 2EGHA 4HFMA 4EUEA 4XD2A 4JGBA 3ROMA 3L6EA 1HYHA 3JD1A 4GSLA 1YOVA 3GNSA 3Q2IA 3ZWAA 1E1NA 3QVWA 3GUYA 1ISJA 4WJZA 3MWEB 4TZKA 7ADHA 1RM5A 3JQBA 1M6WA 4NBVA 3ZWWA 1PJ2A 1NQ5A 3AY6A 3E5RA 5G0UA 3Q9NA 1BWSA 1MG0A 4ZGWA 3RJ5A 1T4DA 2HQ1A 3JQGA 3VPSA 4ZD6A 4PG6A 5TJ9A 1NM5A 2GCGA 5DF1A 4IPTA 4FBGA 4WOKA 1DB3A 1PL8A 3RFVA 3NDRA 4CPDA 3JQ8A 1F14A 3OICA 1O9BA 3GH3A 4LRSB 1P0CA 4EUHA 1NQOA 4UAGA 3N7UA 4BO8A 3EUWA 4IIVA 1LDGA 4HFJA 3L0DA 5DBIA 3NEPX 1OC2A 1DXYA 2ZJ1A 3U4IA 5ENVA 4CL8A 3N58A 5A05A 1F0YA 3ZWYA 2C2YA 3WS7A 1PR3A 2XF8A 1WMBA 2O3UA 4XQ9A 3HJAA 2HAEA 3FNHA 3O8QB 1MG5A 1R12A 2WYWA 3JYNA 2VTEA 4P38A 3DHYA 1Q7CA 3W4JA 2JFHA 2VNSA 2WD8A 1U1IA 1F12A 3OIGA 2PFGA 2GDZA 4OL9A 1Q7BA 4IDCA 4BNNA 3JCZA 3QWFA 2JFGA 2PD3A 4IDEA 4YXFA 5KJ1A 3GGOA 1HLPA 4P22A 2JD1A 3FWZA 3SLGA 2CVQA 1XU7A 1AHHA 5GZ6A 2G5CA 3PHHA 1QLJA 5IZ4A 4N5MA 4R69A 1PGJA 4LN1A 3GFBA 4J6FA 3QQPA 5HTOA 2P5UA 3AM4A 1TT5B 4I5DA 3B70A 3PJDA 4YRDA 1K89A 3R3JA 3ZZNA 1HDOA 2ZIZA 4K6CA 3LT0A 5BSEA 1ZZEA 3GC6A 3H4VA 3WLFA 2Q2WA 4RVDA 2RAFA 2BFPA 3UCEA 3U5TA 1KYQA 3DZGA 2AXQA 2QW8A 5EMHA 3VTZA 1JW9B 3TQHA 1QYCA 4BNTA 2ZQYA 4FPXA 3UXYA 3AI1A 2EP5A 4DBVO 2O23A 4ZQHA 3WGQA 1UDCA 4ITUA 4QO7A 5I8ZA 9LDTA 3D5TA 4WCFA 3JV7A 1IE3A 1HT0A 3RFXA 3VC7A 2WWRA 1UDBA 3SJ7A 4XX0A 4BMSA 5HBRA 4R3NA 1YB1A 5G4KB 3H9GA 3PWSA 4YACA 3P2YA 3D5QA 1XYGA 1XDWA 2EEZA 1UP6A 3AJRA 5CEFA 1DIAA 1YO6A 3JYLA 2W2KA 1BDBA 1PZFA 2WDZA 2CMDA 1UZMA 4Q9NA 3NAQA 3G1TA 4RF2A 1UR5A 5A4DA 3HN7A 2BH9A 3RC9A 2HJSA 3W8DA 5ADHA 4ND4A 2DTEA 3K5PA 4AJ1A 1R0SA 3GVHA 4W99A 4XJTA 2H9IA 4Y6SA 4YT8A 2GF2A 4OO3A 4QECA 2Q46A 4EUFA 1C3VA 5JPIA 3S2GA 2HK7A 1E5QA 5CAEA 3DBLB 3PI7A 4J2HA 2B4TO 1NYTA 3AFNA 3O03A 3PFFA 2HSDA 3WFIA 4ALLA 4FCCA 4BNUA 2AQIA 3ZWPA 4Z3DA 4KQWA 3EYWA 3L9WA 3KVOA 1GPDG 3KBOA 2PZLA 4ND2A 5CDYA 1PR9A 3WGIA 4R9RA 4RZIA 2Q1WA 4YJFB 4DPLA 1W6UA 4GLOA 1YS4A 1UDAA 1ZEMA 4JBGA 4OSOA 1O89A 2WSBA 3U62A 1ADBA 1JVSA 1V8BA 1T2AA 2X9GA 2ZYAA 4JIGA 5JW6A 3DFZA 2Q4EA 3FPCA 3H2ZA 3Q11A 1KC1A 3P5SA 3S1LA 4ZQEA 4BGUA 5JCXA 1D1SA 1YKFA 3N74A 3AUAA 5JDCA 3BHJA 1SB8A 2IRWA 4UUNA 4ESOA 4PRKA 3KXDA 3M1LA 1PJQA 1XCBA 1LLUA 2B83A 2I5PO 4PCVA 3VVBA 4YT5A 2D59A 4RVGA 1HXHA 2HMWA 5GZ1A 1XHLA 1Q0LA 2Z95A 4PN3A 2YQ5A 3FNEA 3OEWA 4QXMA 3UUWA 5FI3A 2V7PA 4XQCA 5CEJA 4ALIA 2HCTA 3DBRA 4Q3AA 1L1FA 3JQ9A 1F17A 3RUHA 2FOIA 4B8ZA 4MVJP 4A03A 1LXCA 5EIOA 3V1UA 2RH4A 2V65A 4W82A 4CMJA 4CLHA 1K5HA 2UUPA 4HADA 1BW9B 1E5LA 3T4XA 4J16A 4DMLA 3RBXA 4GMGA 3BMCB 3I9OA 1K2WA 1X1TA 2Y1GA 4XDZA 4OXNA 3QV1A 6ADHA 1I8TA 4B4WA 4Z6KA 4TRJA 4ND3A 2VWGA 3F3SA 3TWOA 4WE3A 3ROQA 2IZZA 3GZNA 2ZATA 5T6BA 3ENNA 2EG9A 4JBHA 3RUEA 2VWQA 1ZFNA 3ORFA 4BNKA 3OJLA 2X58A 3OJOA 4WECA 1K6JA 4I5GA 5JO0A 1SEPA 4G81A 1TT5A 4ZU3A 1JU9A 3WTCA 1GFSA 3BYZA 5K0ZA 5C7LO 2ZK7A 3WGOA 1X1EA 4UVHA 4RO0A 1NFQA 1C0KA 1HYEA 2CDAA 4HFNA 3HSKA 1M67A 5ER9A 4CV1A 4E6PA 5K6AA 1LDEA 3TZHA 3WWZA 3EGOA 1TXGA 3OHSX 2E4AA 4CQLB 2YDYA 3EY4A 3QWHA 2R00C 5JNLA 1J0XO 1MV8A 5KKCA 4NHEA 5JO9A 1B3BA 4I9HA 4AJOA 5COBA 5TLSA 4TVBA 4I5EA 4MIEA 1LSSA 1E7YA 1NTOA 2Q99A 2HJRA 4TQGA 5JXWA 4U0JA 3ZHZA 3HUDA 4YQYA 2X1HA 2ZYGA 2BI8A 4GQAA 2DM6A 3V5NA 3TRIA 4CMHA 3ZW8A 2D5AA 4HNGA 4FJ1A 2C7GA 3WQSB 5JFOA 2AG8A 4TRRA 4FFNA 1DRUA 1OMOA 4Q3DA 5BNTA 3L77A 3ZHXA 2FN7A 3IOYA 3JYOA 2OUIA 4CODB 3PHLA 4DTIA 5JCJA 2ZJ0A 1DIHA 2O4UX 4IMRA 2V6FA 5DZSA 3JQ7B 9LDBA 1GCOA 1EDZA 2EGGA 4WEQA 4AJKA 3TL3A 1E7MA 3ZWOA 2QG4A 3RBZA 2VT2A 3W4IA 1FK8A 4AJLA 4KQXA 1IL0A 4PZDA 1P1FA 4R5HA 5JMPA 1H0KA 2JAHA 1C14A 1HDXA 2FSVA 1JA9A 4ILKA 1CRWG 1DFIA 2EF1A 4W9NA 1SZJG 4NI5A 5F3RA 1EVZA 1AUPA 1WDLA 4IJWA 5IZCC 3WQRA 4DUPA 3WG9A 5KJ6A 1JDJA 3CSDA 1XSEA 1B26A 3EZLA 4PLGA 3WX0A 1MC5A 1OAAA 1LRJA 3EC7A 4RPLA 4AJIA 2Y68A 5L53A 3MWDB 2QRKA 4XB1A 2IZ1A 5C7OO 1U2GA 1MP0A 3F4BA 3K30A 2V6GA 2YW9A 4QEDA 3DC2A 5I7VA 5JCJD 1PS8A 1CEQA 1FDWA 4BNMA 4BO1A 3KB6A 3QWIA 2DPGA 2Z5LA 4J7UA 1YONA 2JAPA 4Z0HO 1Y6JA 5AXBA 3PGJA 3VH2A 2A92A 3AUTA 4WGGA 5I7EA 5ICSA 1JLLA 3S2EA 4HV4A 5KVCA 4YAIA 3EZYA 3PLNA 3RUAA 2JHFA 3DONA 3FNGA 3GZ4A 4I5FA 3VPFA 4AJ2A 4YVFA 3EVNA 3NYWA 4OKNA 3GG2A 4MJLA 4ZA2A 5JY1A 3V2HA 4IGEA 1JWAB 3KSDO 4DIFA 4OM8A 1VM6A 4RVSA 1GUYA 4BUCA 4BNZA 3I23A 1AGNA 3LDHA 4OGWA 1KBZA 3DBVO 3FSRA 5AXAA 3DOOA 1U5AA 3LLVA 4PGFA 1CF2O 5L40A 5U1PA 1R16A 5L4SA 1NQTA 1N8KA 4R16A 1M76A 1BTOA 1P45A 2VHWA 3OA0A 3F1KA 4E5YA 4H7PA 1N1EA 1VL6A 3ZWXA 3IJRA 1SEVA 3PK0A 4M89A 4BO3A 1MXHA 1U3VA 4EJ0A 1PZGA 4DWVA 2AMFA 4P8RA 4W7HA 3U49A 4D7AA 3KV3O 4XRRA 5K9ZA 3C8MA 3W4KA 4R3WA 4OOEA 2NU6A 5JAZA 2LDXA 3K73O 3LLSA 1ZXLA 5JMWA 3CTMA 1NQAO 3E9QA 1ZUD1 3WDSA 1B8UA 3G1UA 4NDNE 4U6QA 3OETA 1P1HA 1A7AA 2HMSA 1RWBA 1X7DA 3GG9A 3IIEA 3ZU4A 4CQLA 2AA3A 4BO5A 4GSKA 1C0IA 2DQ4A 1NPYA 2AEFA 2V6MA 4MOWA 3UCFA 5CDTA 2EERA 1I24A 4AJNA 5IFLA 3QJ5A 4B4UA 3KTDA 2VZ0A 4B3IA 4FS3A 1EUCA 5G0VA 2C2XA 2JJYA 2X5JO 3RUDA 1KS9A 3GEMA 3WFJA 5IAAA 1JAYA 2J5KA 4IBOA 2XXBA 4PLCA 1WDMA 3DBHB 5KVVA 1G1AA 1SC6A 4UEOA 1DO8A 4YCAA 4JP3A 2C0CA 4AJHA 3ZV3A 4GX0A 4CLOA 3JD0A 2OBYA 3KRTA 4M54A 4P4LA 3FF4A 2X7HA 3R3SA 5A02A 1R4NB 3CEAA 5TGDA 5ER6A 3MJVA 2DBZA 4OH1A 1E77A 3KYCB 4DL9A 4BO4A 2FR8A 3WGYA 3H5RA 3GVCA 1ZMTA 4RLSA 5AOVA 1MLDA 1LJ8A 3WXBA 3E82A 1JQBA 2GASA 3FD8A 3CZRA 2C07A 1NX6A 2ZTLA 4PZCA 4WNIA 3PHGA 2GN8A 4IJVA 1H94A 1ZSVA 2GERA 1IOLA 4ZRMA 4DXHA 3C7DB 3CE6A 2OORA 1E3JA 1X0XA 5IG2A 1Y8QA 2YHIB 4XDYA 3SC6A 2WD7B 2W4QA 3ICCA 1O6ZA 3BA1A 3OF2A 4DRYA 3DMTC 3GNTA 4LSMA 3E48A 1E92A 4JN6B 4IQ8A 5B4TA 2W2KB 4FW8A 4OKIA 3NX4A 4XRGA 4YAKA 8ADHA 1GDHA 3FR8A 4EDFA 5BSHA 4PG4A 1T25A 8LDHA 2HUNA 1GV1A 5IZCA 2HMVA 4L73A 4IS3A 1MFZA 1HRDA 1XELA 1LSUA 1YL5A 3JQGB 2PWZA 5JAQA 4W4TA 1DSSG 1I2CA 3GMDA 1E3EA 3ZV6A 5L7WA 3KOUA 3TZQA 2BFOA 1U5CA 1YJ8A 1T2EA 4R4JA 5JLAA 4WLVA 1CJCA 2NQTA 1EVJA 1W8DA 2HRBA 3ADPA 4CMEC 4DLLA 1YL6A 2P68A 6LDHA 2AQ8A 3I6QA 3IAHA 3ZNNA 4DC1A 5GZ3A 5DBGA 4II3A 3QE3A 4HKTA 3WGHA 2P5YA 3GQVA 2X86A 5I9LA 2POQX 1PJ4A 2DFVA 2I76A 1ML3A 2YUTA 4FFMA 5JS6A 4TMFA 1UXGA 3S55A 1UXJA 3CH6A 4CR8A 4BVAA 3BHIA 2G17A 1LQUA 4Q3EA 4EEXA 3NGXA 1TB4A 5C37A 1QRRA 5A3JA 4CMAA 3ZH2A 3UF0A 2OGUA 1BXZA 3HE3A 3LU1A 1V6AA 4IS2A 3L4BA 3SLKA 3HDHA 4AL4A 2IXAA 3DDNA 2IE0A 4BHTA 2BD0A 2ZQZA 5HA5A 4IXTA 4CM4A 4NZ9A 3ONDA 3TJRA 4XIYA 1T1SA 3GEGA 5A3VA 4DQUA 2P91A 3PWZA 3GDFA 2E37A 3I9LA 3I9KA 1M2WA 1ONOA 1YJQA 3DL2A 1A9YA 1ZSNA 4R68A 4BIIA 4Y6RA 4H15A 4TWRA 3DOCA 2SCUA 4DIBA 3DAGA 1J5PA 4LCJA 2C5AA 5L3ZA 4XB2A 5TRTA 4HUJA 2XXJA 1D4FA 3K92A 1B3RA 2B37A 5JY6A 2UAGA 2VYVD 2D1YA 2PY6A 2QRLA 2DAPA 5C3MA 4DQXA 4XGIA 4PRLA 2TMGA 3BTOA 1ZK0A 4G2NA 4YBZA 3ICPA 3K9QO 1H93A 3I9NA 2NVUB 5C5IA 3MJCA 2IEBA 3ZNOA 4WLOA 3WMXA 3B1FA 1H2BA 1DC5A 4NBTA 4IM7A 1ZKMA 2A4KA 2GR9A 1A5ZA 3PTZA 4RPHA 1YE3A 4CR6A 3GZNB 5G4LA 4IUYA 3T4EA 3DWFA 4OYRA 2ZTMA 2IYOA 2RH8A 1XR3A 1DJNA 4JP2A 2CVZA 1LEHA 1FDUA 4N5LA 1VKOA 2I65A 3JQ6A 3UICA 5I8WA 2IXBA 3WTBA 4KMSA 3KLMX 2J5RA 4UEJA 4B3JA 2NVWA 1GEEA 2VYVA 2WE8A 3CMCO 5ENDA 4E30A 5CP8A 4BNGA 3QA9A 4RJTA 5FI5A 3GAZA 1S6YA 2A9FA 2HDHA 3RUCA 4FFLA 4UULA 4D0RA 3GEDA 2GD1O 2DC1A 1QV6A 3PRJA 4MIYA 4YAJA 3GVXA 3MJ4A 3CUKA 1CWUA 2FPGA 1OC4A 4GPD1 5A04A 3PP8A 1GEGA 3H9JA 4M8SA 2UUOA 3L9XA 4X54A 3L6OO 3UW3A 2BHLA 4GX1A 3GN1A 1O8CA 1JN0A 1ZH8A 1SMKA 2VCYA 4MVJH 3JQAD 4CUZA 4EZBA 1X14A 1BVUA 2OOSA 4MVJA 3H8VA 1CETA 1H5QA 4B4OA 1HZJA 1BDMA 1EEHA 1Q1NA 4Z9YA 4Z3KA 4S3MA 1HE2A 1GZ4A 3HHPA 4DVJA 2BGKA 2VYNA 3OIDA 4N18A 4FOSA 3EK2A 1H6BA 4YRBA 5A5EA 3PZRA 3PHIA 1PJBA 3D4NA 4XCVA 1FDTA 2H6EA 3QWBA 4BO9A 5FF9A 1R15A 3E6AA 4GBJA 4L75A 3KSUA 3NTQA 1PIWA 1LLCA 4INAA 4FD3A 2VQ3A 1B0AA 5G4KA 2V6BA 4DIOA 3H6KA 3VDQA 3IC5A 1Z7BA 4RQTA 1FDSA 1OOEA 3AM3A 4Q3NA 4YJHB 4CLXA 3JQAA 1QLHA 4MVJD 2GZ2A 1KC3A 5HRUA 4A7PA 1GD1O 5BR7A 4TZTA 2PZKA 4NU6A 4BNLA 1HF3A 3M1AA 1DEHA 4RDIA 4PG8A 1AHIA 3AM5A 2RCYA 5MGBA 1NPTO 4AJJA 3FPLA 2Y93A 4W6ZA 2HO5A 4FIZA 4BV8A 1PJLA 2HKIA 2F1KA 3WNQA 4PLHA 5JSFA 1GQ2A 3E1KA 3DHEA 3EAGA 1IYZA 3W6ZA 5BQFA 1DFGA 1G0OA 1I10A 3OH8A 3UVEA 3DBLA 1Y8RB 4MPDA 4J1NA 4U8GA 1GAEO 4J1QA 1G0NA 4Y9DA 1ADCA 5A9TA 4FOOA 3MEQA 4O5OA 2UV8A 3ZWNA 1LNQA 5T5QA 4RF4A 3ON5A 1BG6A 2PH3A 2FR1A 3VPXA 3GT0A 2GPTA 3S2IA 1FMCA 1LDNA 4J9VA 3UOGA 4OIMA 2AE1A 5K6AC 4BMVA 1QYVA 2G82A 2J3HA 2Q49A 4IINA 4R9SA 3JQ9C 3CMMA 5EINA 1LBEA 4UUMA 4CMIB 4YR9A 2FSSA 3H9UA 4J4BA 2VRBA 3I5MA 4AJEA 4AFNA 3OP4A 4FFPA 2GYYA 4JCOA 1GL3A 3M6IA 1LLDA 1B8PA 2DTXA 3G49A 2DKNA 5TJHA 4B79A 4F6LA 3C3XA 4GLLA 2BMAA 1E1KA 1G6KA 4BQPA 1IB6A 5A03A 1LSOA 3C1AA 3KO8A 1XQ6A 2BFMA 5F5NA 3GVIA 2DU8A 5T8KC 3KYCA 2QZZA 4IMPA 4MIOA 3BZUA 1P33A 5EPOA 4ZHSA 5B4VA 4CJXA 2A94A 3E8XA 4HX5A 3DAFA 1K6XA 3KYBA 1DHTA 1P0FA 3ANMA 2YFHA 4ZICA 1ADFA 4NBWA 1WZIA 4O6VA 5KJEA 3DZKA 1I3LA 2BELA 2X23A 2EV9A 1I01A 2HLPA 2P9GA 4PLTA 3CPSA 3GK3A 4E5MA 4RDHA 3WJAA 2BFAA 2X0RA 3QY9A 1PEDA 3IP3A 2OHXA 2OMEA 2DLDA 3Q6IA 3TFQA 4DGSA 4RQUA 3RQSA 1GQQA 1UUFA 4BNIA 1NP3A 2CD9A 1C1XA 1ZJZA 3OQ1A 2EP7A 4IIUA 5KWEA 4IDFA 4F45A 4CUKA 3GHYA 3TOXA 2NTNA 2QHXA 5F1KA 3ETDA 7MDHA 5T67A 1K3TA 4LVCA 4A73A 4IY1A 2EW2A 1PGNA 3L6DA 4QUKA 2D3TA 3WICA 2PZJA 3ZWBA 1IHYA 5IXSA 3PQFA 4PLZA 1J49A 3KYDA 1U2DA 3RD5A 1DJQA 2IDZA 2ET6A 2C59A 4E2YA 2Q50A 4K26A 1NVTA 3D1LA 4JJGA 2BF7A 4Q39A 2XAAA 3BMOB 1FXSA 1HSZA 2DVMA 3RVDA 1ZMOA 1B14A 4Y8VA 3U0BA 1EUZA 2D4AA 4IDAA 2C20A 4A0SA 1DIBA 5TC4A 1BGVA 3A28A 2I9PA 2Q1UA 2Q1TA 4KUHA 1GZ6A 2E6UX 3ONEA 1VKNA 3CIFA 4DYVA 2NVBA 2YV3A 2EWMA 1NAHA 1XLTA 2YZ7A 3AY3A 4CMEA 2Y0DA 3JD2A 3FR7A 3ANNA 4YJFA 3VH4A 3M2TA 4CM7A 1PQWA 5DOZA 5ILOA 1KIFA 2IODA 4XQEA 1EK5A 4I8XA 3TZKA 1BRMA 3JQAB 2OZPA 3HB4X 3D4OA 4JNKA 4CMBA 3ZV4A 1X15A 2NU7A 1NR1A 4QT0A 3UFXA 4O1MA 1KOLA 1GYPA 3EHEA 4QFDA 1F8GA 3K96A 2PA3A 1MUUA 3BTVA 1LU9A 1N9GA 4NMHA 1T2FA 4CQMA 5AVOA 2J8ZA 4PLVA 3UN1A 1AXEA 3WMWA 2GN4A 4R1SA 1VRWA 3D3WB 3JQ8B 4GVXA 4L4SA 4MP8A 3WBFA 1X7GA 1U4OA 2Y0EA 3W8EA 2G76A 3EW7A 4JROA 1ENPA 1VSUA 4MVJM 5CPBA 4L74A 4MP6A 3RKRA 4D3FA 2X8LA 1M66A 1RKXA 2YYYA 4WLUA 3W8FA 3PEFA 4K1LA 5TX7A 1V3UA 2JCVA 3P19A 1I32A 3WNVA 3OM9A 1DFHA 3BMOA 3RAJA 4ROSA 3E9NA 3Q3CA 4TKMA 3VZPA 3LC2O 3OQ6A 3PHJA 4J4TA 3NKLA 2O48X 4E4YA 5KVSA 1F8FA 2EKQA 4Y98A 2BRUA 1LUAA 3G0OA 4MVJF 5CEEA 4MKZA 1SOWA 4I1IA 4LMRA 2NADA 5FWNA 2OO5A 4I08A 4KP7A 4NFYA 1OBFO 4CQMD 3C1TA 1KERA 1N1GA 3FI9A 5F1OA 5GY7A 4OAQA 4BGVA 1WAMA 4JK3A 4NNJA 2O3JA 3OQBA 3TFOA 4L0QA 2PLAA 4XYEA 3I4FA 1IY8A 4RLHA 2NM0A 2PD4A 4R01A 1LC3A 1SAYA 2IYPA 3AFMA 4M1QA 1MB4A 1ONPA 3DMTA 4RF5A 2PKQO 3RJ9A 2JL1A 2AQHA 4YJDA 1HLDA 2D8AA 4IQ0A 2Z1NA 3E5MA 4K6FA 3Q0EA 2X5KO 3CINA 1RJWA 4MVJE 3I9JA 4R5MA 1U9JA 1T1RA 2Y0CA 1HTBA 1Q0QA 4NBUA 4BQRA 2PD6A 1HDCA 4XJSA 3PZBA 3ROKA 3VDRA 5JDIA 3JYQA 1D8AA 1VJ1A 3IL2A 1Q0HA 1AE1A 4XIJA 4KDEA 3RKUA 4NK5A 2HK8A 4D0SA 1C1XB 3WQQA 3JQCA 3E18A 2WD7A 2GZ3A 4IDDA 2YDXA 3JQDA 1J4AA 2ZB7A 3P2OA 4XEHA 2UVDA 1P9LA 3QVOA 4XGNA 2ZB4A 1PQUA 3V1TC 1P1IA 1ULUA 5COQA 5CG2A 1EE9A 1Z74A 4NK4A 3C1OA 1IPEA 5BNIA 4H3VA 2GN6A 1AXGA 2VWHA 2Q1SA 4JX8A 1N92A 2VHYA 5BSGA 2FZWA 3FTNA 3OMLA 4CL3A 4M55A 1H9AA 2VUTA 4W9NC 3ITKA 3RI3A 2VHVA 1TA4A 1LX6A 2ZB3A 1P44A 1V35A 1XEAA 1EFKA 3JQFC 4YAEA 2NTJA 2NU9A 4L4XA 4KTTE 3IJPA 3WIDA 5LDHA 3TNLA 3WYBA 4J7XA 2C7VA 4YA6A 4LISA 3SXPA 2YQ4A 2X4GA 3I6IA 4EJ6A 1D3AA 1DRWA 2IEDA 1YGYA 3ZN2A 1DAPA 1H6AA 4MO2A 3W1VA 1WPQA 3H5AA 1I5RA 3L07A 4TRNA 1ZCJA 1ENOA 1EBFA 5KTKA 3ZV5A 4Z9XA 4HFRA 1R4NA 4B8WA 3VZRA 1XQ1A 4BO0A 3PDUA 3HFSA 2VT3A 1FF9A 5DDIP 5BT9A 4Z9FA 4RPJA 3UH1A 1V0JA 1J6UA 4C7KA 3DBHA 1L7DA 1UP4A 4ALMA 4E2XA 3A4VA 4B7XA 4W7IA 3IUPA 3WGGA 1NAIA 5DCUA 3QSGA 4DBZA 3K2EA 1HYGA 4E13A 1PGQA 4XR4A 5IDXA 4RVUA 2ILTA 1DBVO 3ZHBA 1WZEA 3AWDA 1E7SA 2O2SA 4XKJA 2G1UA 4E5NA 4JXKA 3SBOA 1GYRA 2CY0A 1LDBA 1M75A 3KLPX 5A9SA 1D7OA 1MX3A 4XYMA 4OMUA 2O50A 3LF1A 5DULA 3KYDB 3U4DA 3ZNPA 1EK6A 4WLNA 4GI2A 4Z0PA 1ORRA 3AUSA 3BMQA 1KEPA 5A5FA 1GV0A 4J2OA 4RORA 4BNWA 3JTMA 4EITA 4XA8A 1HDGO 1ZVMA 2W98A 5TQVA 3RUIA 1PZHA 4LCEA 1VJ0A 2B36A 5HS6A 3WWYA 1A4IA 1YQGA 4E2ZA 1DHRA 4YRAA 3GVPA 2Q2QA 4CUJA 3CKYA 5LC1A 3QIVA 4CM1A 4L4RA 3B20A 1HEUA 1R0KA 2X9VA 1BHSA 1E3LA 1NR7A 1QG6A 1U7HA 4RV9A 2J3KA 2Y66A 2W8ZA 4YTEA 1NFRA 1E3SA 5DP2A 5LDGA 4F6CA 1PJ3A 4N5NA 4WK6A 5DCYA 1K0UA 1QP8A 1RPNA 3QWAA 4JJIA 4PLYA 1VC2A 2P9CA 4EW6A 1E3WB 4UUOA 3DFUA 3WSWA 2QYTA 1EE2A 4FGSA 5ILGA 1DDOA 3I4CA 2HK9A 3JYPA 1PX0A 1OZAA 2B5VA 1FJHA 1XKQA 4KZPA 1GTMA 3MJEA 4RL6A 4WCFB 2B0JA 2J5QA 4KUEA 1X13A 3GDOA 1NFFA 5AXDA 1Y5RA 1JWBB 1DIRA 4D43A 3WYEA 2NACA 4NPCA 1E6EA 5C7IO 3VZQA 2AQKA 4PVCA 1I2ZA 4NU5A 4IGFA 1JVBA 2RHRA 1ULSA 3I1JA 3DMYA 5KJFA 4CLEA 2H63A 4UVDA 4LVUA 3D3WA 4FJ0A 4GL4A 1ISGA 1E7RA 4PLPA 3COSA 1A71A 4FQ8A 5A9SB 4M49A 2OBNA 1NNUA 4UREA 3H9EO 2X9NA 1HZZA 1QV7A 4ALNA 3H7AA 2A35A 3BMNA 1N7GA 4P4NA 5HM8A 2YJZA 5DP1A 2AG5A 1KY5A 3DZIA 2H1SA 5TT1A 5T57A 5U9CA 1VSVA 2HMTA 4S1VA 3PGXA 4IZIA 1DOHA 3L4SO 1N2SA 2WM3A 3ZGYA 3F5QA 4DPKA 2PKQP 1XU9A 3AY7A 3LSYA 3OIFA 5AYVA 5EESA 5TIIA 4D79A 1B16A 3RC2A 1X7HA 2W90A 4BO6A 4RPGA 2O3QA 4EYEA 1MGOA 2I3GA 4WPGA 3K2BA 3VOSA 3B1JA 3LZ6A 1U3UA 2QYSA 3ZW9A 1ZEJA 3M2PA 3KUXA 4AJ4A 1JTVA 3PLRA 1VJTA 2R2GA 3VPGA 4L76A 4CM8A 3A1NA 1WLYA 3SC4A 1QYDA 5KVQA 4FB5A 3DR3A 1E0DA 2RIRA 5F1PA 2NV6A 5THQA 4DMMA 1S7CA 1RYDA 2DBRA 1E6UA 4NJMB 2P9EA 3I3OA 4IQGA 1QXSA 4J0FA 3DZFA 2QRJA 3D64A 1I3KA 1NVGA 5F5LA 3VAZA 3DZBA 3LYLA 4R1TA 1R4MA 2YFQA 3RU9A 2NUAA 2J3JA 1WW8A 1B7GO 4KOAA 3QW2A 2BLLA 2Y1DA 3F4LA 3GN2A 1R37A 1UJMA 5EQDA 1PL7A 5IN4A 1LDYA 1LRLA 4MINA 4UUPA 1YB4A 2RHCA 3MZ0A 3D0OA 4P4GA 1W4ZA 1MXFA 4OQZA 3FNFA 4E5PA 3H3JA 3F47A 2NTVA 4E3ZA 1LQTA 1N5DA 3AOEA 3DAPA 2GNAA 3U9LA 2R00A 2YHUA 3LF2A 1SB9A 4DLAA 4E33A 1E7QA 3GOHA 3IDSA 3X2FA 4PLWA 3TOZA 2Y1EA 2ZKLA 4BNHA 3WB9A 1X0VA 4QO8A 3SEFA 1NWCA 5TF4A 3AW9A 3FWNA 1NXQA 3LT2A 4DPMA 1CQJA 5GMOA 4KUGA 3F9IA 4ONEA 4BKPA 1Y9AA 1OI7A 3PIIA 1BSVA 3RFTA 3D4PA 3OJFA 5KJCA 5J23A 1IZ9A 5KNLA 5F21A 1PU2A 3IKTA 4N7RA 1QYXA 2VNAA 3TL2A 4WKGA 3ETGA 3WSVA 3KHUA 4J49A 1BXKA 4J1TA 4JQCA 3X2EA 3VKUA 3K31A 3GFGA 2YY7A 1DLJA 1GZ3A 5DNAA 5JDIC 2EKLA 4LK3A 1A7KA 4BNFA 3GR6A 3RC1A 2X0NA 4QQRA 4GMFA 2RBEA 5G2OA 5CDUA 3A9WA 4YJGA 3R6DA 1QORA 1ZW1A 3HFGA 1A4UA 3INRA 3INTA 3MOGA 4GWGA 2XPCA 4LW8A 4UVIA 3HWRA 3AU9A 1Y9EA 2CDCA 3GGGA 2VOEA 4YJHA 4NQZA 1W73A 5IXYA 2VWPA 2ZB8A 3U4CA 4J91A 1I33A 1Y8RA 3LC1O 4WEOA 1PZEA 5H82A 4O59O 1EVIA 2JD0A 4Y6PA 2FHSA 3SJUA 1VL8A 1GU7A 2FPIA 2PZMA 4QX6A 4DQVA 3ZWCA 3O8QA 4D41A 4FC6A 1YQXA 3DBRB 4O63O 4YB8A 3R0IA 3RCBA 5JDCC 1I3MA 2EXXA 3LT1A 1LC0A 1GUZA 3ONFA 5BNFA 4U0KA 1PS0A 1V3TA 1ZSYA 2B69A 3LVFO 3HQ4O 4FFRA 2CNBA 1A72A 5IDYA 2O4CA 5L7TA 5I9NA 4WOJA 5B1YA 1DC6A 4CM6A 4RPKA 4ZQBA 2FMUA 3I83A 3BMCA 4M87A 4JJFA 3S2FA 5ITVA 3Q2KA 1ZXBA 4D42A 4WLFA 2EJVA 3F46A 3VH3A 5DCWA 4GX5A 3WBBA 1LLQA 3IQDB 1HSOA 2NQ8A 2VOJA 1P31A 2OXIA 4ND5A 1V3VA 2CF6A 4J3FA 1DRVA 1JKIA 2AHRA 4PZEA 1Y8QB 4XR9A 4YWJA 5B37A 3GA0A 3PYLA 5TT0A 4GKVA 2PGDA 3PJGA 1EVYA 2FZEA 1RM3A 3C85A 4CMIA 2Y67A 1ZNQO 4MP3A 4UVGA 3JQEA 4OXKA 2DUUA 3TPCA 1VLLA 2P4QA 4JLWA 4FC7A 4HY3A 1ENYA 3RSHA 2PGJA 5L4NA 1QYWA 1LI4A 2FR0A 3ULKA
chains in the Genus database with same CATH superfamily
3SHQA 3H83A 2QVZX 5HIKA 1PW5A 3B6EA 1YRBA 2D5BA 1ECBA 4L15A 3UT5A 5DNUA 2UXCB 3MA0A 1ESCA 1JKFA 2D2IA 3TXXA 3VR2A 2WRZA 2XTZA 3WISA 1I7PA 1UF9A 2Z57A 4U9UA 2Z8YM 3H5VA 4DKXA 5EXPA 1M6HA 5B53A 5G0TA 3FOBA 4DLTA 3QG1A 3LRXA 1RQXA 4D9MA 1F8YA 2B2XA 5IKPA 1V2GA 4QOJA 3MJHA 1QKIA 4K40A 4D6YA 2PN1A 1OY1A 5CURA 5ITSA 2WYVA 4CF3A 5FPKA 4ZALA 4DJTA 4WIAA 5EXTA 4K05A 4DMFA 3PUKA 1C9JA 1QF6A 3HZOA 3U3OA 3PD0A 4J29A 4AN0A 4AURA 4QUEA 1WHSA 3A1DA 1X1CA 1USGA 5T64A 2FZ4A 3O8NA 4U4AA 5AQEA 5B4UA 4UZFA 1QIJA 4IRXA 4WMLA 2FG5A 3EC1A 1J21A 2EBUA 4RKYA 2ZVPX 2PSJA 4ZN6A 4TKLA 1CY8A 4XYGA 2B6HA 2CVOA 3ASUA 4FP9A 4AG3A 2Z4RA 2NV0A 5HE9A 3T3DA 4BB5A 2NV2B 4I4CA 3NWBA 5AVVA 1RC8A 1KXJA 2VYND 3QVUA 3EUAA 2BFBA 4KZKA 2WEKA 3RYHB 3ZWKA 5AW3A 1E3QA 3CEPB 4HUQA 3AEZA 4KSYA 4J0EA 2PV7A 2FUCA 4FD2A 3T9BA 4PBRA 3W6UA 1JG3A 4X1YB 3ZIDA 1BX3A 3OCJA 5BXYA 3AOGA 4GI7A 1UAGA 3D7KA 4GX2A 4KQFA 1D2MA 3I6ZA 1SQGA 5CNIA 2RJNA 4GE0A 3RTDA 1BE8A 1S2MA 1U8XX 1GU0A 2P1DA 1XTKA 1TEHA 2VJAA 2VUUA 1WXGA 4X7RA 1HI9A 1XXLA 5FUVA 3UKJA 4B34A 1U28A 1B2LA 4IOJA 4MW7A 4C5AA 3R6WA 2GGSA 4G5OA 4CT4B 4C7OA 1G21E 3E7FA 4BO2A 3THRA 1OU4A 4U02A 3IIJA 3TXYA 3UT0A 2GF9A 5BQXA 5C1OA 2RC5A 1UBUS 4B3TB 5AXCA 4XI9A 3R3HA 1TUIA 5AKZA 3ADOA 4M1KA 2VHCA 4R41A 3UMYA 3KAKA 2AXEA 1PR1A 4JJEA 4KO1S 1G4UR 1COWA 4MIKA 5E7JA 4NJMA 3NVMB 4RCVA 2PLWA 5LXTF 5DJ5A 4ENSA 2FFQA 1AQJA 3JZIA 5KYKA 4XYBA 4E32A 1B42A 3CXRA 3I37X 3E7PA 1V1RA 1Q91A 2G8NA 2GKSA 3NTVA 4TZ0A 2Y77A 1CR1A 3AF2A 1WWKA 2X0IA 2RK6A 2NU9B 1K0FA 3ZDQA 1HWYA 2WFMA 1BWPA 2ZFUA 3B2QA 3AR9A 1J20A 4BMDA 1Q12A 2PUAA 4PG7A 4A27A 1HLGA 3F6RA 3RNOA 5FYDA 4JLDA 3L8CA 4OIFA 2FN8A 2R25B 3DDUA 3M82A 3QLJA 2PX3A 2QX9A 3GFRA 4XD7A 4BLOA 5KIAA 3HVHA 3KLBA 4P08A 5H9WA 5JAIA 1YB5A 3DAPA 2CNDA 5B1EA 3RIHA 2IYZA 1U0HC 4B44A 2BGJA 1G5PA 3OWOA 2H4XA 3SDZA 3TG2A 1YQUA 2GSDA 2H0RA 3PXAA 3ESRA 4WN3A 4FYMA 5EKXA 2ZG6A 5CPFA 4BECA 2C99A 3HUFA 1PYOA 3DF7A 2O8BA 3KEQA 2PRKA 3S27A 4D9CA 2BKVA 1NP7A 2R44A 3SZOA 4KREA 2A5YB 1SXGA 5K0EA 3QXJA 4BKRA 2WILA 5IEBA 2QX7A 2VF5X 1UEXC 3B6ZA 3CH7A 2N42A 4G4IA 3ASZA 5C8ZA 4W9MC 1J9EA 1P1JA 2PKRA 4R7TA 5J2UA 3RC8A 3B38A 4F0JA 2Q3MA 3GUCA 1DDGA 2I80A 4QZVA 1QH9A 2LGJA 2B5WA 3NASA 3JD3A 2HSEA 2I1QA 5JS7A 3HDQA 4HYEA 1J1IA 4ZI2A 3M6FA 2YXDA 4MQLA 3S1SA 1EESA 1BN7A 4PIVA 5EERA 2VRCA 1TAQA 2ZBDA 4K28A 1WV1A 4DC0A 1USVA 2UVQA 3BMNB 1AGYA 1DAOA 3HBMA 2B9EA 1MB0A 3EVDA 1R8JA 3OU7A 4L9SA 2BZ0A 4LDPA 4Q1FA 1B6SA 3BSYA 5KCZA 5KOIA 5KNCA 1COZA 2JFFA 3A7DA 3SHTA 3UO8B 3IKJA 4UHCA 1E2LA 1XIVA 3O91A 5A3RA 4TWZA 5IJXA 1PL6A 5F9FA 2VQ6A 4DLVA 3KR1A 2QTCA 1DAKA 1RMTA 5JZOA 3BAZA 1NULA 4KIGA 3CUUA 3G85A 4MQFB 2YN0A 2BEKA 4MCHA 3H5NA 2ARKA 2NAPA 2C58A 3NBAA 3NHYA 4AT1A 2YIVX 1ZL2A 3DMDA 2JGJA 3IH5A 4I1VA 2VH1A 2UXDB 4M7PA 3ZWQA 4NOMA 2YJGA 2A1UA 1NOJA 3O90A 3Q15C 4EATA 1X3SA 2BR5A 3IS3A 1GCUA 2FDRA 2Z6VA 3A6GA 4Y67A 1O7JA 3NM6B 4ZQGA 5JU6A 1ZG3A 4HDOB 4MYRA 1PSZA 4GKAA 3UB2A 3ZWMA 4FBLA 3IT0A 4IO0A 4X8OA 3S7TA 2VN8A 2OHHA 4IV0A 3SHVA 3PVZA 1L4EA 5CVTA 2GM3A 4IG4A 4O4HB 2CXUA 4QLAA 2VRCD 4C7JA 2I1VB 5T4BA 5JSUA 3L7KA 1W2HA 4J1SA 4K2HA 2V7GA 2I3ZA 3RC3A 7YASA 4MQ5A 1WMSA 4NEGA 3PDJA 1CDOA 4X3PA 1Y7IA 3MGBA 3JWEA 4R1PA 4HQLA 1Z83A 4WNCA 1I36A 1G63A 1BX0A 2BN4A 1A04A 1V39A 3RWBA 2FWMX 1Q83A 4BQOA 4F3YA 5JISA 2JFNA 3TR0A 5L45A 3GLQA 2SCUB 4EKIA 1DBPA 2AJTA 3WB1A 4NPAA 4QTUB 1H2HA 2HYDA 5IDWA 2DSNA 2ADMA 3JQRA 2VP6A 3IQZA 3ITEA 5D51S 1YR6A 1U9IA 5DN9A 4ZDWA 3D54D 2J6IA 2PBRA 2A57A 3FVTA 3NPAA 3GJ4A 3DXZA 3H5TA 4Y7DA 1LSJA 5TSDA 1PDOA 2FP4B 1K8ZB 3I8XA 4MNTA 4R1UA 1TZKA 1HDEA 1NJSA 3IUSA 4BFCA 4BCCA 1GXSA 2QAJA 4G0VA 1HE3A 4M6WB 1AC5A 4TL6A 2AX3A 1XZ8A 4YUAA 5LPNA 1C9EA 3G9QA 3OZVA 2EW8A 1CUZA 1NVVQ 3IR5A 1N3IA 4RE6A 1EUDB 2QMHA 1SN7A 1L5HB 3PL1A 4GSYA 4L0CA 2I66A 1DWPA 2VNHA 3GPIA 4IAOA 3QEJA 1Q16A 4IKEA 3W2TA 4GAEA 3SSAA 4BMYA 5K45A 1A9XA 1R64A 4GOKA 2RHHA 5CBKA 2J3DA 1U8AA 1Z08A 5L8VA 4L7QA 3H3FA 4BFLA 2GAFA 2JZNA 1VJ5A 3LLUA 3OECA 4I55F 5IF3A 3L1IA 4BQFA 3ZC3A 4IJUA 2ZIVB 1MV5A 4RELA 3KSBC 2DX7A 2IYVA 1BMQA 2VZ9A 4HWOA 2IOFA 1CT9A 3OPYB 4A8TA 4MPJA 3WB0A 2O0LA 2FFBA 2BM9A 2YX1A 1DQPA 3V8NA 3IP9A 4BZQA 1THMA 3EFOB 2IL1A 2OZKA 3MRXA 3ZEAA 4ZZ1A 2YIDA 1E2NA 3GRFA 3RPEA 5I7SA 3AZQA 4FSHA 4OB8A 2R8RA 4UNIA 4Y2SA 3U7IA 1GDDA 5CFOA 2CZCA 2GBIA 5IWCA 1JKJA 1KO7A 3BHMA 3IQXA 2M6LA 3RROA 3EDMA 4RNDB 1BAPA 1H2YA 1AS0A 2ZROA 3OM1A 1A9QA 1V5EA 3QELA 4NTZA 2HADA 2QVGA 4QFCA 3TSOA 4D3DA 4FGJA 1Z6ZA 2UUBB 1JT9A 3RYCA 1WCIA 4PW0A 3RYFA 3NAMA 2JS7A 3C39A 1XQ9A 2HMUA 3BVPA 4U6NA 4LRWA 3CF0A 2BONA 1VL0A 1NW4A 1SU7A 3CKLA 4C1NA 1ZK3A 2QL5A 4OHKA 2C92A 4N3CA 4YC7A 3WIBA 4GOMD 1O87A 4YUXA 3FJ1A 2VYQA 5EPUA 2JLBA 1KVUA 4F3TA 2NO6A 2C4NA 2P2SA 2H7CA 4A2PA 2ZCUA 3OZSA 3C8DA 1HURA 1SBIA 2HBYA 1KZYC 2BFBB 3LUCA 2I4TA 4F1WA 3HADA 3TAXA 3ZWDA 2B7CA 2GN0A 521PA 1O94A 1Y3BE 4ZOAA 2E4WA 2IPLA 2OMKA 4P98A 5IAJA 4A5SA 4OFZA 2IJGX 1QONA 4DB2A 1Q14A 3C7AA 2QR5A 2QMQA 2EX0A 1R0LA 3EWIA 1ECFA 1JZQA 2G1KA 3NWOA 2Z1MA 4PAOA 4TLAA 3IKVA 1T8SA 1YRLA 2YJTD 3L0PA 1E6CA 2OP1A 1I3NA 3X1ZA 2CT8A 2JAWA 4PFJA 3ADBA 2VDNB 1NA5A 3PNOA 1Z9BA 1TM4E 3EZ9A 5A3QA 3QEMA 4N6NA 5LSAA 4B8YA 2VJBA 4KLZA 2CFCA 5B36A 1EHIA 4RIEA 1SQ6A 1U8FO 2Q4RA 3DB2A 3UKOA 4E21A 1RXSA 3UMBA 4EGQA 2YV1A 2PT9A 4LS3A 5H83A 2AR9A 4AVYA 4B3BA 2C3OA 4ER7A 5I9BA 3QY0A 4MI9A 4TN5A 3VJKA 1V4VA 4I55B 4KHPB 3NV9A 3HDYA 2IW1A 2IYNA 2JD2A 3WB2A 4BBZA 3DFKA 1B6RA 3N3AC 3ZOKA 1NF8A 4Q01A 1Z35A 2FSGA 2WJWA 2Y9MB 1BS1A 1RM0A 2R11A 5EAIA 1U31A 1BNCA 4PPNA 4E31A 2Y99A 3GNLA 4HDQB 4JOBA 4K6HA 1GNPA 1TKAA 4MS1B 1XA3A 5KX5F 4EB6B 4MQBA 4ZVNA 3C98A 3IXLA 3RVSA 1BMTA 1W4AA 2EFJA 5HPYB 1PJCA 3AONB 1Z68A 2QR3A 4D46A 2C3YA 2FX3A 3Q1LA 3VU1A 1D6SA 3HHEA 1ULBA 3IP1A 4CKWA 3GDGA 1G16A 2O5CA 1C0PA 1IPFA 3UK1A 3NUGA 4XOUA 5DLEA 1LD3A 3UGKA 4BNYA 3ZWOA 3FTEA 1YA6A 1QFJA 3IQGX 4GOJA 10MHA 2HPAA 4M1ZA 3T1OA 1SXJC 3WIEA 4WV3A 3RUFA 1U2QA 1VPLA 2WMNB 2QAIA 3FTPA 1P18A 3L49A 4IMJB 1LLFA 1JQDA 1SCUA 1IRXA 3NO4A 5K20A 1H4QA 2Q5HA 3V2GA 4CTJA 2CLHB 3VVCA 5IT9A 2VTVA 1SVSA 3HB9A 2DTDA 4RHUA 3DVLA 3IYLW 1HE4A 2CNKA 3FPKA 3MRSA 2CC2A 4FN4A 2X6TA 3JRWA 3FYDA 1V3QE 2RH9B 4D6PA 4D8UA 4O1IA 3DDZX 3A4NA 3JD4A 4WDRA 4CEJB 3QTTA 4GR4A 3E3AA 2FPOA 4Z3OA 2FRVA 3SSNA 3M1YA 3VYUB 1KMIY 1RI5A 2JFOA 4R1LA 1NT4A 1GNVA 3NC1C 1MKYA 1VKHA 2DBVO 1RT9A 5FBHA 1X2BA 1ZUWA 1TT7A 3PU6A 1D4ZA 1XWFA 3PGA1 5CGQB 1KSGA 3TUIC 4BLWA 4C6TB 4YMHA 1R74A 3JPYA 4JOSA 3ASVA 1CUUA 4MUBA 1ZK4A 2EVWX 2Q2OA 4UKDA 3DDWA 1VCNA 1I1QB 2CE7A 1SUCA 1QHXA 3IIIA 5H7XA 4CEHA 3BGSA 4TSKA 1EXMA 3DHNA 3QP9A 3A9TA 3F7NA 3NLLA 2SKEA 2NVUA 2QXUA 3BX1A 4X6UA 4MJ3A 2RGAA 4GNKA 2NZ8A 3CNHA 2VAMA 3PRHA 1F4PA 1HE1C 1II0A 3LDFA 3NHJA 1GRRA 3IEKA 3VNAA 3GPLA 4MW4A 2GBPA 2ZTUA 2Q1XA 1AY0A 4JT2A 3BTSA 1Z4KA 2QEQA 4C29A 4RTKA 3R24A 4QD3A 5DTEA 5KNBA 2YVAA 2XDQB 3MFYA 4X41A 3CW9A 1M7GA 3EVBA 4GMDA 2W43A 1IWBB 1U3TA 3X2SA 4P5PA 3ZGXA 4C0KA 4ZJUA 1KKMA 2NU8A 2FUG6 2C4KA 4L2IB 2Q45A 3S8MA 1T34A 1O08A 3DTYA 4IIJA 4URFA 4ZXPA 1HE5A 3NKVA 1Q17A 4HT3B 2P9FA 3I9MA 3OFKA 4Y6OA 3I8OA 3YASA 3ZY4A 1R0YA 1ZCFA 1JFFB 3FHLA 3PKIA 3RW9A 3LUGA 3ANXA 4QODA 4QU9A 5ITZB 4BB0A 1A27A 4S2EA 1KBOA 1NWHA 2ENWA 3A4YA 1ORIA 1RYEA 3FMPB 3P20A 2JCXA 3OWXA 5HGJA 2OYRA 4IDGA 4BB6A 3BIJA 5HQJA 1E2KA 1XJCA 1YQWA 2ZRKA 3GEIA 1W2WB 1RJ9A 1TO6A 3DVRX 4TLCA 5FPHA 3W90A 5FAKA 3MXOA 4LYGA 4TTQA 1SOVA 1P73A 2QGFA 1TI7A 3UJAA 1JR3D 5C5EA 1L5OA 1NUSA 1YDWA 1KP2A 4YUWA 2IXEA 4HN9A 3AY0A 3RBVA 4DA8A 3EZFA 1U0TA 3O26A 2LR0A 1A8PA 1RE0A 5ES4B 5IM4A 1CS4C 1LW7A 4JP8A 5H8WA 1QIEA 2D0IA 4PBSA 2GBFA 1XFDA 3QU9A 2IDMA 1WNTA 2FKAA 3MSCA 4NBSA 5GQSA 4P32A 1WVMA 1EMDA 2IUFA 2Q3JA 4ICIA 1KY4A 1RLUA 2BHTA 2VF7A 4EHLA 4C0BA 3QENA 5CLIA 2C4WA 4N3NA 2FP4A 4Z9AA 2WV9A 5FA6A 3DZJA 4R1OA 3D8SA 5J1TB 1MQ8B 3RU7A 5BNZA 1UAYA 1Y42X 4ZWNA 1E8NA 3RARA 2J0QA 4HHEA 3HYTA 2C9YA 5B12A 4DFDA 2Q0HA 3TTYA 4F06A 2CXPA 1TJPB 2QT0A 4CM4B 2O3RA 1OSNA 1JJIA 4UPEA 2FE1A 1NW7A 4IOMA 5ALPA 5ICGA 1X39A 4XUGB 2ZP1A 4L4ZA 2JJ1A 2PH5A 2PK3A 4L9WA 5GV7A 5JQGF 2WBLC 3C48A 3DO5A 3MWKA 4G4JA 4DREA 4JXXA 1I7SB 3NYRA 1E9BA 4L5IA 3BIFA 4Z7NB 4P3NA 1Y3IA 3M83A 4G37A 1G7CA 3DPIA 4ZRNA 3C3CA 3ENKA 4K6MA 4RZHA 1H6DA 3BXOA 5CA1B 5T7BA 2DCMA 5LZ5A 4BVLA 4BFTA 2GXUA 3R0VA 4H1VA 4NP6A 3JD1A 3KDSE 4G0WA 3L1UA 1UBTS 3RTAA 1KKUA 3UJ7A 1XA4A 3GUYA 1U7UA 4TZKA 4P2GA 5DNYB 4OXIA 4FHZA 1G66A 2XQFA 4BFYA 5CLQA 3AY6A 1YK1A 4EFNA 1Z6QA 4U2EA 5G0UA 3TI7A 3Q9NA 1BWSA 2IC5A 4DV7B 1L5NA 2IBMA 1GKKA 3KWLA 4EPXA 2FU5C 1UDRA 2R2AA 4IPTA 4FBGA 1DB3A 3OC0A 4MYSA 3FZGA 4YO8A 2JLZA 2IYRA 2JDID 1RKVA 1Z5OA 1DG1G 1SHZA 4NICA 4F21A 1KKLA 5DIZA 4JLMA 4TS4A 4MTCA 1V1RB 2F48A 3S99A 3OF3A 2NPOA 2QW1A 1U94A 1ULAA 2YVLA 1RE1A 4GECA 3TGWA 2NUTA 1BEZA 1Z5NA 4NKRA 1DUSA 3C6XA 1A9SA 2E55A 2W2OA 2YIMA 4MJXA 4IIVA 1LDGA 4Q4AA 1GPBA 2XUIA 6REQA 4LWOA 4DQ0A 1RHJA 3K9HA 5DBIA 2HHCA 4FILA 4Q7QA 4PS1A 1ZJWA 1DXYA 1NX9A 5LZ8A 3UV3A 1OV6A 4YXWD 2ZJ1A 1RAFA 4URWR 1U0RA 4ZYWA 1NATA 2NZVG 5A05A 4RFSB 1F0YA 3Q7SA 4B84A 1AKWA 4B0PA 1HFEL 2MSDB 4WA7A 3WS7A 3QVLA 6PFKA 1CXZA 1VP9A 3AG5A 1LQ2A 5J63A 4XQ9A 2OSVA 2HAEA 4QOHA 1FNMA 121PA 5JRZA 1USUA 2H2WA 2W6NA 4K0RA 2PQ6A 3BL8A 1MOSA 1OYWA 1T6ZA 2IY8A 1MG5A 1R12A 2QZJA 3CVJA 3IO3A 4MV5A 2R62A 2BE9A 4H3KB 2JFHA 2VNSA 2WD8A 5I4BA 1F12A 3ZTWA 3VU9B 4ER3A 3JCZA 2I62A 2OT3B 1Z2DA 4P22A 3L7YA 3WBKA 4C01A 3FGPA 1V5GA 5GZ6A 1LFDB 4I4TA 2G5CA 3GDWA 1FSGA 1L3CA 2PGOA 1DAHA 1KYVA 1KAQA 1QLJA 2PJZA 2XADA 4N5MA 5IZ4A 4JWKA 2FPKA 2H1OA 2PX6A 3ZR4B 5HTOA 2P5UA 3Q0IA 2PRYA 3P0JA 1VDZA 1CUCA 4I5DA 3B70A 5DK6A 4DMUB 1ODSA 5AVTA 3R3JA 2N0SA 2PS3A 1PG2A 3WNDA 3KV1A 5DGTA 4F3RA 2C0QA 2QV7A 3WO1A 4CFZA 1QE0A 4GQBA 2RAFA 2VAVA 4JP1A 2AXQA 1Z2CA 2QW8A 1CZKA 3VTZA 1EJ6A 5B6PA 4X1IB 3H1PA 2ZM5A 2OEPA 3QITA 4I19A 3AI1A 3D4LA 2EP5A 3KVNA 3M5PA 4H7HA 4R8RA 5FJIA 4DBVO 5ALRA 3UBTA 5EIBD 2QQFA 3ZYZA 1XALA 1AGXA 2NAFA 1R6TA 3EE6A 2XYVA 3UJHA 4Z51A 2MMGA 1NUHA 5DW0A 1A8HA 3JV7A 4MULA 2INGX 1I9CA 1UDBA 1XEXA 1Z56C 1TM5E 2ANBA 3E4DA 3HKBB 3L5OA 4R2IA 4X65B 4WBNA 3BMXA 4MEJA 1DBRA 3D2BA 3VOBA 2UZ1B 5A2QA 5JJCA 3AHGA 3D5QA 2X19A 3I28A 4PFQA 1VYTA 4S35A 2ZDHA 4JL8A 4ZI5A 4PYKA 4PYNA 4CIDA 2F4VB 1U0BB 5CYFA 4BAGA 4N76A 1T91A 3ZI7A 4BVHA 5A4DA 1L9XA 3G1TA 1UR5A 1YR7A 2GFQA 4DEVA 2CEAA 1T5TA 1NRXA 3RC9A 1N2BA 3W8DA 3BB4A 2GJ9A 1R6AA 3K5PA 3NXSA 1NF2A 2CUZA 3IDOA 4GHWA 3S7ZA 3FOEC 5MN6A 2C4TA 1DT3A 2PUFA 2H5IA 3HGQA 2Q2NA 2W83A 3ELBA 1RYZA 1CVRA 2K5UA 4ND8B 4IG9A 4LMBA 5KB3A 4QECA 3EZNA 2Q46A 2VEDA 2PMEA 1GPNA 5BYKA 3GT7A 1X1DA 1E5QA 2L17A 2ZI5A 4J2HA 2OO5C 1NVDA 3AFNA 4XVHA 1Q15A 4JJ4A 4Q5IA 5FWDA 3D3JA 3EXFB 2F43B 1FVXA 3TSWA 2AQIA 1CIJA 1C4KA 4BNUA 1JJFA 2QTNA 4EY6A 2YUIA 2I4NA 3FFWA 1EJBA 3I6MA 2H11A 1XNGA 4KQWA 4N0QA 3UPTA 4CT5A 4HGQA 2B92A 1ESEA 3BXZA 3CRMA 5FUYA 3DCNA 2HRQA 4ASUA 3OIWA 1P5RA 4D98A 2WKSA 3NBMA 5J47A 4YJFB 3KB1A 3UK0A 1UDAA 1ZEMA 3A11A 1ADBA 1JVSA 3B3FA 3SS8A 5A2GA 2ZYAA 4UJ5A 2X9GA 4JIGA 1X6VA 3DFZA 2QKYA 3D6JA 4WKOA 3N6XA 1R27A 1KC1A 5FTJA 1GGFA 4ZQEA 1CUIA 5JCXA 1J39A 5DVZA 4AP5A 3N74A 3AUAA 1E2GA 1IOZA 1SB8A 2A78A 1CNFA 1DXOA 2IRWA 3NANA 3OQJA 4UUNA 3H2GA 2QTGA 3KKLA 4ACAA 4DBLC 4QOGA 5LYJA 3ROEA 3IVXA 3VU9A 3QW4B 2FNAA 3VVBA 2D59A 2KLBA 3CRNA 3PUYA 5GZ1A 3RQIA 1GNQA 4QRHA 4X7MA 3U7RA 4GYKA 4PQFA 4O3FA 1VIMA 4YY3B 2SNIE 2MYPA 1C7ZA 3KUCA 1RXCA 2RONA 3FNEA 3OEWA 4K88A 4QXMA 5FI3A 3DDHA 3NEYA 5KTPA 5EVJA 4QOFA 1M1YB 3KLNA 4JQSA 2WA2A 1JIVA 2HCTA 5EA2A 2I6SA 3R5XA 1DTSA 2Q6KA 4IFIA 4AYXA 3RUHA 2GXAA 2FOIA 1AKNA 2ICAA 3INYA 4OMCA 5ALLA 3A1VA 2XNDD 4HK4A 4YMWA 4WFQA 4A03A 1OYYA 2YC2C 3A1FA 4OQNA 3CC8A 2PMDA 3J81A 3UATA 4AW9A 4FZJA 4S12A 5F4BA 1H23A 1S4QA 1XDUA 2LWIA 4I50A 1Y3HA 4KHZA 4KQHA 4NJEA 4RHTA 4AX8A 7REQA 2OZLB 3GBSA 2O20A 3K09A 4RVNA 2UUPA 4EB3A 3IE1A 2WHPA 4J16A 5E0OA 4KLNA 5FBLB 4M1SA 4DMLA 3RBXA 1OAOC 2QTFA 4PYMA 3UBMA 3G5AA 1C3XA 2X15A 1X1TA 5TPZD 2Y1GA 3U44B 3KDAA 4OXNA 2GK3A 3URMA 4ZV9A 1I8TA 1TMYA 5D3MA 5AP9A 3DWIA 1RQ2A 4DLUA 4ND3A 4A23A 2E5LB 2VWGA 2FEAA 1PN3A 1M2VA 3GZNA 2W6IA 1FL9A 2AFRA 3G9XA 1EX6A 4RQBA 5DHFA 3CQ9A 3G2MA 3QU7A 3VR2D 1ZD2P 4MA0A 4BAZA 4DSAA 4ZI7B 5B3KA 5JSQA 4OHYA 2BZ1A 3ZDXB 1PR6A 1R8QA 1G7SA 4WECA 1M7BA 1NSYA 1WLSA 2PH7A 4MUEA 5CXUA 3WTCA 1SELA 1JU9A 4YMGA 2XB6A 1LBHA 3GYGA 1XMOB 1W59A 3TAHA 4RO0A 2CDAA 1C0KA 2GOYA 1K7YA 4HFNA 3HSKA 4C07A 4C7VA 2W37A 1GNSA 3WWCA 1Z0KA 5I9TA 3LYHA 4NXMB 4LRUA 4OREX 1LDEA 3TZHA 2BSXA 2XGMA 2ZVJA 3EY4A 2R00C 4S05A 4HB0A 2QD1A 1DDIA 2GLUA 3MPOA 1E96A 1FP4B 5JO9A 4EG1A 4D99A 3K1AA 1WU7A 1SXIA 3H5LA 4OI0A 5HZKA 5ESXA 4JB8A 9ATCA 2ZJFA 3H6GA 2HSJA 5DGCA 5IMSA 2HQSA 2HJRA 2DECA 5JXWA 3ZHZA 4MPPA 1DKOA 1Y1SA 2BI8A 2ECQA 4UDXX 3TRIA 4WRRA 5B6IA 3PGVA 5KTTA 2TYSB 2ZUEA 1A69A 1QK3A 4R8KA 2MTBA 4LXYA 3KAJA 5JI3E 4D26A 4Q3DA 1G5QA 2FN7A 1GRNA 5JVDB 4REOA 3IAAA 1FB5A 1FS5A 4CODB 2WWHA 1DO2A 5MN4A 2H1WA 3HB7A 1CUDA 4DTIA 2ZJ0A 1YC2A 2A1TR 4G36A 1MEEA 2O4UX 4EHJA 2V6FA 2IYTA 3FIUA 3IDFA 4RWEA 4FCVA 1XZEA 3KJNA 3LGAA 1IQPA 1BZYA 1F3OA 1O03A 2N75A 3CB2A 1XTJA 2QG4A 1T1EA 4IV8A 2ODQA 4LXGA 5DM2A 3RBZA 3QPUA 4KQXA 3GLGB 4PZDA 3ZX4A 4DY6A 1P1FA 4LJSA 4BVFA 2ZCJA 2YNMA 1HDXA 3N5KA 3W9BA 3R8XA 4DDHA 3L1VA 1T36B 2G04A 1XMPA 1N8SA 1CRWG 4EI9A 3D4IA 1COWD 5LR6A 1XEWY 1EE1A 1Y63A 2J3LA 4NI5A 2PX2A 1WDLA 1AKEA 5TDHA 2M2IA 5E2IA 1KZ1A 3D0KA 2GD6A 1XZNA 1E2HA 4DUPA 3EF3A 5IANA 1MHTA 1JDJA 3LTNC 3CSDA 2JASA 1B26A 2PZEA 1YZVA 3EZLA 1DMRA 2NU6B 1GGNA 3HSYA 3SNHA 1M6NA 4JA2A 4UBKA 4B83A 3TVTA 1N4DA 1F3LA 1TX4B 2G07A 4J0IA 2QRKA 5L53A 1BGXT 1MP0A 3F4BA 5EUMA 2V6GA 3UUEA 3RADC 5JCJD 3N59A 1PS8A 4YLGA 3RVNA 2AUTA 3UUGA 4JYZA 4NENB 3LKBA 4GOOD 4YMIA 4AS3A 1QFYA 4BO1A 4PY2A 1RQLA 4A0HA 3IFSA 2VDWB 4EHBA 1JF8A 4R9VA 3D1VA 1EU1A 4IUCS 2Q6VA 4CKBA 3TW8B 2HXSA 5THXA 3A6EA 2HB6A 2VAXA 2V8OA 1P80A 1Z4QA 2BEVB 2D2XA 1Y6JA 5AXBA 3VH2A 5I7EA 2QMEA 2RK3A 1OXTA 2CNOA 2V1UA 2CV0A 4YAIA 4P35A 1RLJA 5K4GA 1VTKA 1DOAA 3PLNA 1OXVA 3VYTB 3VPFA 5DMXA 2XUZA 2VVTA 1TK9A 3BL5A 1K97A 3EVNA 5P8WA 1XFAA 1WTAA 1YB2A 2ZWVA 3BM5A 4JLAA 4YRJA 5JY1A 5KINB 4PSAA 2IHKA 3W9UA 2HM7A 1CUXA 4BTLA 3IT2A 1KGDA 4LTNA 4WFJA 2G9ZA 1KPIA 3ISTA 4BNZA 3I23A 3LDHA 3FSRA 1T2VA 4PNPA 1U5AA 1JDVA 3KT6A 3SBXA 3GLFE 2VQSA 5L40A 4B75A 1GZSA 3Q8KA 3GJXC 3QKSB 4EELA 4TL7A 2C8JA 4KLCA 3B3QA 3EVEA 3V8EA 2FPGB 4TMVA 1E2QA 3ZEIA 4QRIA 5IW8A 5C53B 4OUKX 4ECAA 1PZXA 1U7OA 2FMTA 3U3ZA 3LX5A 2I6GA 4DARA 1O5OA 2ZE6A 3HDTA 5E38A 1KEKA 4YIHA 1L7PA 1Q0UA 3KX2A 3HJFA 1CUEA 4TN1A 4O4LF 3ZX5A 4GZ6A 4CCAA 2Q07A 1QANA 3EIUA 1PZGA 1QH8B 2XIQA 4KPUB 3I30X 4RIFA 3NCTA 2NSYA 4G89A 4RZ3A 2AMFA 2NO0A 4HUQB 1ZW6A 4WKNA 5FT9A 4D7AA 5KC8A 3DUFB 3C8MA 2QLJA 4FE7A 4FQ7A 4RE5A 4HGZA 3VDNB 3VR6H 1P2DA 1MJNA 1MRNA 3QI2A 2MR5A 3JS5A 4AM8A 5LU8A 3NOQA 3RJMA 1Z2AA 1ZXLA 3CTMA 4GICA 4JC8A 3T5DA 2BGIA 3UFXB 5JMTA 3NM4A 1GPKA 1TEVA 4LJ5A 3WDSA 2XCSB 1REQA 3G59A 2WJVA 3VC2A 3OETA 2XWSA 2WF5A 4PAGA 1SM4A 3IIEA 3AF5A 3E22A 4QEKA 4WN9A 4NOKA 5JWOA 1XRPA 2J0SA 3KLOA 1YMUA 2G9UA 2DQ4A 1XDGA 4FOPA 5KYTA 2V6MA 2WVGA 5KYUB 1G2PA 3C4QA 4WOPA 4O8ZA 1RZRD 3C3YA 2GAAA 3ENZA 5JXGA 1BEEA 1XDBA 3GA7A 2M6KA 1R8XA 4MHTA 3FRIA 5HF8A 1CJBA 4QUHA 3GEMA 4KL8S 4C2TA 4PLCA 4QFMA 3K0HA 1FUIA 5AM2A 2P9QA 4KGDA 5TS2A 2X2OA 4LOHA 1NSFA 3FCAA 4UEOA 3K0FA 1MR3F 3OD1A 2FJPA 2F59A 4QVIA 2X42A 4B45A 2C0CA 3EWAA 3TEJA 3JD0A 2OBYA 3SJBA 1JMYA 4QDZA 2C2BA 4NDZA 3FF4A 3R3SA 3CEMA 1U80A 2OOKA 3LC0A 3P1JA 1X1QA 2CWDA 3MJVA 1QBKC 3UK6A 5HOEA 1U2RA 1PZMA 5HTKA 3WGYA 4H1WA 4ZKDA 2I8AA 4RTQA 3OBIA 4RQAA 1WIWA 3U3DA 3WXBA 3RTCA 1K9VF 1KJ8A 1LJ8A 1IZ8A 2PG3A 3L4JA 3CJTA 3DO8A 2QJRA 2XJ9A 1M2GA 1PJ8A 1SVMA 3MN1A 2RGNC 2GASA 3AEKB 3BK1A 5G02A 4QYIA 2X9QA 7REQB 2ZTLA 3C7TA 4Y1FA 5AM0A 2HHJA 4WNIA 4IJVA 3AJEA 2W6JA 4B6PA 2YWXA 3I39X 2B9VA 4MUKA 4ZRMA 2ZSJA 3DLBA 1THTA 1Y4SA 2QPAA 3MWGA 4O8CA 1E3JA 5BSTA 5I3CA 5IG2A 1Y8QA 3LCVB 2ZE8A 4MA4A 4XDYA 3CW8X 2WD7B 4XUEA 4RKQA 1E1QA 1O6ZA 2WC1A 3HM2A 3T5MA 4EJFA 3DMTC 4KIWA 2VHQA 3N2ZB 1E92A 1CJKC 1E1RA 2OXRA 1XTBA 4IQ8A 3TOSA 4XIGS 3WLJA 1QG2A 5A71A 3SHFA 8ADHA 4Q05A 3FR8A 4I4LA 1Y82A 1SKUA 1T25A 1WA5A 3JAKB 1GV1A 1NN0A 3O0TA 5IZCA 3W9SA 3Q8WA 5A7GA 5I9IA 2NU7B 5BURA 3MWDA 2CXXA 1D0IA 5AJYA 1LSUA 1YL5A 2F3PA 2PWZA 1SOUA 4IIJB 1DSSG 3ILHA 1N2CE 4ES6A 2P79A 3U60B 4IIEA 3IJ5A 5DRYA 2A0KA 4RA6B 1DKMA 2RGCA 2BFOA 3A05A 2H31A 2ZPTX 2HTEA 2G0AA 2C2OA 1CJCA 4Q16A 1GUAA 3CUEF 1W8DA 3ADPA 4DLLA 1SIUA 1YL6A 4TTPA 4P3PA 6LDHA 2AQ8A 3IAHA 4X64B 4DC1A 4AAYA 1JHMA 4C3VA 5LOVA 1JE0A 4K7JA 3NBQA 2P5YA 3EPPA 4MRRA 2Z0MA 2POQX 1PJ4A 4LC9A 1ML3A 5E7MA 3VV2A 4P7BA 3Q7PA 5CMLA 1UXGA 2WSMA 4IIHA 4XCXA 1V96A 1I9GA 1UXJA 3C43A 3FCCA 4BVAA 1YZHA 5FHQA 1LQUA 5FI0B 3K8YA 1NLYA 2OG1A 5DH9A 4WH0A 1MOQA 4FOTA 3A31A 2DY0A 1OT3A 3JATB 1QRRA 1RR6A 1TJ3A 5A3JA 3PF9A 2OGUA 3UF0A 3HE3A 1R6VA 4RACA 4FWIB 4RK6A 3SLKA 2VF2A 3DDNA 3UMRA 4AL4A 1U2DC 1SRQA 4HD8A 3SE0A 1E3DA 4B3DA 1UK9A 2AF4C 1JEAA 3MAGA 1P19A 4UE6A 3Q40A 4Z2YA 3GEGA 3TJRA 4DR3B 2P91A 3PWZA 1FXUA 3CJRA 3VX4A 4JVLA 3VKGA 1M2WA 3TG8A 3CKKA 3KXIA 2GO7A 4CNBA 3A2MA 1GTVA 3G6KA 2K2WA 1F0KA 4R2KA 4Y6RA 2IIPA 1VKRA 3D02A 4H15A 4TWRA 5DGIA 3DOCA 3RRNA 5L3QA 1AUOA 4JFAA 3W5HA 3IMCA 4LCJA 2ZJ5A 4QTZA 5TRTA 1V5WA 2UZ1A 1E61A 4HUJA 2XXJA 1D4FA 2II6A 3K92A 4G4SO 4G1EB 3TRJA 4DLRA 3P2EA 4QQFA 3MLAA 2UAGA 4TL8A 4WXRA 2D1YA 2PY6A 3VSAA 2QRLA 1KWGA 4AMZA 1MT0A 2DAPA 2DKOA 3BE4A 1SVLA 4E4RA 2OENG 3F90A 5LN1A 3AKEA 4MV1A 2O2IA 3CX3A 5TEWA 1KMHA 3BTOA 3MIIA 4G2NA 4F1KA 4NJEB 5ESDA 4C21A 3BSFA 3K9QO 1H93A 1XKXA 3L0OA 3FFBA 1OPRA 2VJMB 3OQPA 4MW6A 3BILA 1KU0A 3D7SA 3MJCA 2IEBA 1CBUA 2O5RA 1G3QA 4LOJA 5AI5A 5HK8A 3LA8A 3ZCTA 1T2UA 1XZJA 4N8EA 5U4XA 4ND8A 3DV0A 4GUAA 4HNRA 4XLTA 4GI1A 4R1MA 2GN2A 4RHEA 4KGXA 2A9RA 5K3FA 1XO1A 1ZIOA 2ZVQX 4G9EA 4X8LA 3T4EA 1CDZA 3FOZA 2CXOA 5CLFA 3DQZA 4FMBB 4JY7A 3MF4A 1FP4A 3EXFA 1RRMA 1XR3A 2C88A 4JP2A 4Q1EA 3ZY6A 2FZGA 3NOOA 2QM3A 2BFFB 4AMGA 1X7WB 1C7JA 4PONA 4XGRA 2J5RA 2BJHA 4JLSA 3V7NA 2FJ0A 2IYEA 1BDIA 5ENDA 3B6MA 2WE8A 4TMYA 4BN5A 3QA9A 3T1TA 2SBTA 1KQOA 1YAJA 3AVWA 3M5WA 2O06A 2OBBA 1AZWA 1L4LA 1R6UA 3GAAA 3HKCB 3IURA 4YFYA 2ZAGA 3UMMA 4OA5A 4YCMA 4JBLA 2QP4A 4D0RA 4RMJA 3VX3A 4O4JA 2BF4A 2GD1O 1TCAA 2UYOA 4MIYA 3W2HA 3TNFA 1L3IA 3SP1A 1IZZA 2VP5A 3CUKA 3NYQA 4ZGGA 5BUZA 5KNDA 3G8DA 5EVCA 2FPGA 4AROA 5G41A 5F77A 1KOGA 3WRVA 1BU5A 4N3BA 3PP8A 5JYBA 3RFFA 1WMDA 4M8SA 3W78A 4EJSC 4LYAA 4Q93A 5KQSA 1VJDA 2NO1A 4NATA 4KXFB 2V54A 5J2UF 4ID3A 1O8CA 1W52X 1JN0A 1W4CA 2DF8A 2O0KA 1M33A 1RQNA 1JEQB 2OOSA 3H8SA 3KQPA 3H8VA 1QYRA 2ZSEA 3ILVA 2XVMA 4FTWA 4B4OA 4UTZA 4BUZA 2HWUA 1Z5GA 2EP8A 1EEHA 3MRTA 4Q4CA 4Z9YA 1KBQA 4Z3KA 3B3GA 1C1HA 1L5RA 3OZWA 4C7OB 1O4WA 2Q5CA 1GZ4A 4RDCA 1RXVA 3ANTA 4EFKA 5EJ6A 2QF7A 2VYNA 1BOOA 4EGAA 1CNEA 4R0NA 2CV2A 3MMSA 3W5VA 4OGGA 5HIIA 1H6BA 2CMHA 2NZJA 2AZXA 2BJWA 4KOEC 2FRDC 1QGUB 4K0KB 3HVJA 1ZXXA 2WUGA 3PZRA 1PJBA 2LKCA 4UPVA 4DM3A 4Z1MA 1OLSA 5BMVF 5C8VA 2H6EA 2GD0A 1KZ4A 3MS2A 1AS3A 5FF9A 2OXTA 4AS2A 4EPTA 2CNLA 1XYYA 1W96A 4JLBA 4GPBA 2CXNA 2ZRMA 3CZ4A 3J81k 3DTNA 3WJ2A 2FN3A 1L5VA 3SSMA 2G1PA 1YUMA 1Z0DA 3L02A 1V8DA 3IHLA 3ODPA 5EP4A 1HK7A 3E58A 5G4KA 4FHCA 5CAEB 1ISRA 3A2NA 1P2FA 3H1GA 3IPCA 3TLEA 1JR3A 1IBCA 2QTTA 1Z7BA 2FKNA 2GI4A 3QPAA 1SGWA 4ITRC 1XLVA 4CLXA 5B55A 2Z6UA 1UKEA 1UJCA 2QLBA 1JSCA 3OLCX 5ECGC