3V2XA

Crystal structure of the peptide bound complex of the ankyrin repeat domains of human ankra2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
GANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ankyrin repeat family A protein 2
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3v2xA00
3EHRA 2MYOA 4HRLA 4OAUC 1UOHA 2XEHA 1DCQA 2ZGGA 4BETA 2XZDG 3B7BA 5JMND 4DX6D 2F8YA 1MX6A 2KBXA 1S70B 5ENRD 5AQ9A 4BSZB 2B0OE 1IKND 4K5BA 4UUCA 5BXUA 4F1PA 2NYJA 3UI2A 2F8XK 2HE0A 1D9SA 3UXGA 1K1BA 4HI9A 1TR4A 1MJ0A 5ENPD 3DEOA 1BU9A 1SW6A 3J5QB 3V31A 4NIKA 5AAOA 4YDWA 2P2CP 2ETCA 5AQBA 4A63B 4HRMB 3TWWA 4F6RD 2F37A 5EIDA 5CEAA 2Y0BG 2RFMA 5HKPA 5CBOA 4ZFHA 4U96D 5FIOA 1OY3D 4HNAD 5KNGA 4QFVA 3UTMA 1K1AA 4RLYA 5BXOA 4U8YD 2DVWA 4HQDA 4ATZD 4DUIA 1AWCB 3T9KA 1MX4A 3HG0D 2V5QC 3TWRA 4CZ2D 5ENOD 4DX7D 5CBNA 2V4HC 1BLXB 1K3ZD 3EHQA 2DZOA 1OT8A 4O1OA 5AARA 4QQIA 4O1PA 1MYOA 2QC9A 2QYJA 2VGEA 3AJIA 4G8LA 2DWZA 3NBNB 4HI8A 4HLLA 4GMRA 1NFIE 3W9GA 4LG6A 5KNHD 3TWSA 4HRNA 3TWTA 3NOCD 1IHBA 3Q9NC 5FINA 4ZHBA 4BESA 4B93B 2BKKB 4DRXE 1SVXA 4O60A 4Z68A 3AAAC 5EN5D 3TWVA 5EILA 4BERA 2FO1E 4BEPA 1N11A 4G8KA 3V2XA 2J8SD 3J5PA 4K5AB 4LNUD 3V2OA 3JUEA 3C5RA 5ENSD 5AQAA 5CECB 1YYHA 1N0QA 1N0RA 5KBAA 3V30A 4GPMA 3TWUA 4DX5D 3V79K 4N5QA 5ENQD 1DC2A 5AN8A 4CYMD 2Y1LE 1BI7B 2DZNA 4DX1A 5ITZF 3W9FA 4HBDA 3ZUVB 3NOGD 3EU9A 2ETAA 1WDYA 5HRYA 1BD8A 1A5EA 2L6BA 3JXIA 3ZNGA 2RFAA 5EIBE 2AJAA 2XENA 2XZTG 2BKGA 4HB5A 3ZU7B 4JB8P 3TWQA 4DX2A 1WG0A 3TWXA 3SO8A 1G3NB 4LSZE 4U95D 4C48B 3DEPA 5EYLA 1QYMA 1BI8B 2JABA 1AP7A 2KXPC 3D9HA 5HS0A 5CEDB 5JA4D 1IXVA 5D66A 2ETBA 4OAVB 3KEAA 3T8KA 4YDYA 2PNNA 3B95A 1MX2A 5CERB 5EYPF 3F6QA 3LJNA 4K5CA 3IXEA 3Q9UC 3ZKJA 1YMPA 4J8YA 4U8VD 3HRAA 4TUMA 2ZGDA 5ENTD 5AQ7A 5KWDA 3JXJA 1YCSB 2A5EA 4J7WA 2XEEA
chains in the Genus database with same CATH superfamily
3KSLA 3HXCA 2FULA 3D9OA 4I43A 3DSTA 3SHFA 3FTSA 3CVXA 4CDRA 1S70B 5ENRD 2HM8A 2I9CA 3CEQA 3ZHEB 2HE0A 3ZYLA 1HO8A 3DWLG 3FHEA 4YDWA 3JUIA 1NI1A 1TN7A 2A4ZA 3QK0A 2AWIA 4HOSA 2F37A 3OTNA 3L08A 5HQ8A 2E2EA 1NA0A 5ANRA 1XNFA 4Y6CA 1N4PA 4ACLA 4N3BA 4G23A 3CR3A 1MX4A 3R7QA 5FQ7A 2P9PG 3C3RA 1QZ2A 3WXXA 2UWJG 2WXPA 3D9PA 4B0ZA 2I1KA 4WAFA 2KCVA 4U0ZA 2BKKB 1PC2A 1E90A 3MYVA 5JJ7A 2RD0A 3SI5A 2DCPA 2WXKA 1K8KG 5FWQA 1UW4B 3PE3A 3QAQA 3CK9A 3GZ2A 5A23A 4I2WA 3RRUA 5JJ6A 4ME2A 2C0LA 4GTQA 3CSTA 4I6GA 1ZBPA 2BF0X 4FP7A 2IOSA 3TWQA 3OXFA 2BUGA 1HE8A 3ABKE 1JUQA 3DPYA 2L0IA 2DYRE 3HXDA 3PEUB 2RKKA 3IHYA 4G24A 3F6QA 3UKRG 3Q9UC 4GA0A 4CT4A 4DPRA 5BV0A 2ZGGA 3PUJA 4MKTA 2IO2C 4A55A 3D9LA 3G2SA 4AIFA 5FQ8A 3CIAA 4F7AA 4JZYA 3Q5MA 3ULYA 3QJZA 4GMLA 1GW6A 2ETCA 3CLJA 3ZVVA 5CCMA 1ZB1A 5FZRA 2CG2A 4GZDA 2YQ8A 5EX3A 4B94A 3NBNB 3G2TA 4ZHBA 3ONLA 3Q9NC 4O60A 4N3CA 4J8DA 4BEPA 3ZYKA 5AENA 2J8SD 5JJTA 3HXEA 4TUUA 4TV3A 3UQ3A 2WXMA 4DX5D 3LDZA 3ML9A 1Z5SC 1JCRA 1U3CA 3ASFA 4F53A 2QFCA 1KT0A 4UWKA 1BD8A 4CDNA 4BT8A 4HB5A 3FUMA 2KATA 4XE0A 5LCWJ 4WNDA 3TWXA 2EIJE 2H6GA 5D66A 1RZ4A 3APCA 4PS7A 4J8SA 1H2UA 3ASHA 3PEVB 1SA4A 4GTRA 2MYOA 3CHSA 1TN6A 2VYIA 5DIZA 3PZDA 5E75A 4DX6D 2F8YA 4HOUA 1O5MA 3DRAA 3FULA 2NYJA 3FH5A 5CRVA 3FFLA 3T5XA 4J0UA 1N9AA 2IO3C 4I17A 4EZKA 1HG5A 2J4BA 4HRMB 4A63B 4GA2A 2RFMA 5CBOA 5AJDA 1W3BA 1N4SA 3T5VA 3IBEA 4U63A 5AJLA 3L13A 3SQVA 2JLBA 1DVPA 3JQ0A 1KZOA 2QC9A 2QYJA 3OXLA 4L7TA 4HLLA 5DBKA 2OEWA 1N52A 4ATGA 5A6CA 3B7UX 5EN5D 5JHAA 3S7JA 3R9AB 2Y4UA 3FTXA 1E8WA 2DZNA 3W9FA 4GU5A 3ZXSA 4KZ0A 2L6BA 3IEGA 4EBAA 1OCCE 3ZGQA 2XZTG 4CRWA 3CHPA 3NQPA 4O6FA 5EYLA 3TG4A 1ZU2A 5HS0A 3TAXA 4LRZA 4L9PA 1E8XA 1N95A 4GTTA 3UM0A 3RIBA 3U66A 2OVFA 2VJ8A 4YDEA 3TXMA 3MV3B 1UG3A 3PH0C 2WXFA 4J7WA 4C0EA 4FULA 4UQYA 3EUVA 1MX6A 2H6FA 3ZFWA 4EZLA 1IKND 2JEKA 2IOLA 2VQ2A 2GROB 4K5BA 3Q7AA 3Q78A 4KVOA 4J8FA 5ENPD 2I1JA 4GMJA 3CVVA 4AY5A 5CEAA 1LTXA 4I1MA 3AU4A 3RJVA 4WUYA 4JD2G 2GW1A 3SFYA 3PZ2A 5FT9A 4J6IA 4ATZD 4DUIA 4JHJA 2OEVA 2DBAA 3EDTB 3UINC 4X8QA 2DWZA 4GMRA 4G26A 3MEKA 2GRMA 1E8YA 2AVPA 4B93B 3LS8A 3CKBA 4FC8A 4XEIG 4OYSA 2LXMA 4WWOA 5BUZA 3PUKA 3NZUA 3TJPA 4N2SA 1YA0A 2X3MA 2LNIA 5FQ6A 3TWUA 3AG3E 5ENQD 2FEZA 2L6JA 3ZUVB 1TNOA 2XENA 3SFXA 4IULA 4HLEA 2JABA 3G2UA 4FU3A 5T3RA 3FUNA 3U64A 3CK8A 2P9KG 3G2WA 3AS4A 2OVBA 4U0SA 2KZTA 3ULEG 1H6KA 2XEHA 2IONA 3Q15A 3EJNA 2FBNA 2KBXA 4BTBA 1N54A 2IY0C 2ILRA 1D8DA 1SW6A 4LUNU 4ACKA 1TJCA 3AG1E 3TWWA 5J90A 3LVRE 1FPPA 3FY4A 2V8SE 1TN8A 3RO2A 3RO3A 3BG0B 1H2VC 4FJZA 4GA1A 4IN3B 4XKBA 3CVUA 3DSVA 3CKCA 3ULQA 2R2LA 3JYSA 3FUDA 3I5PA 2VSOE 1S63A 3D9JA 3FU3A 2R17C 3QWPA 4PS3A 4F3VA 2YHEA 3C5RA 5CECB 1N0QA 3V79K 4N5QA 4R7LA 3CHQA 3D9KA 3MZLB 2YNQA 3UKUG 4AV7A 4CGVA 3BQOA 3CHOA 4I9CA 5BNWA 2HYZA 4YVOA 4ILGA 3DSXA 3ONKA 2XPZA 3KAEA 2VSXE 3ZKJA 2WB2A 1HG2A 4PS8A 1K1BA 2C2LA 2Q7FA 2XZDG 2IF4A 3ZYQA 1KZPA 2ZXWE 2AW6A 3L22A 4PDXA 2PM6A 3RKVA 1MZCA 4HFGA 2AXUA 2X6JA 2P2CP 5BW8C 4U0UA 2WXJA 4GZ5A 4PUCA 4ZFHA 3E32A 5KNGA 2LXLA 4WNEA 3PZ1A 4B89A 2V5QC 4O1OA 2XRZA 5FTPA 4LNGA 4N2QA 1NFIE 5FINA 3PZ4A 5KJMA 3HXFA 4DRXE 3FU0A 4Z68A 3CSFA 2KZTB 5CCLA 4K5AB 1OWPA 1TYQG 5FJYA 4DI4A 3L16A 3MJWA 3FH7A 5CHEE 5AN8A 2X38A 4UWFA 1LD8A 4UQXA 5ENNA 5EIBE 3NB2A 1KT1A 3Q47B 2XQ0A 3OXGA 3ZIMA 2BKGA 2QY7A 1PAQA 3ENEA 1AP7A 3D9HA 1UJKA 4D10C 1HU3A 3UM2A 4UI9J 5G2NA 2LSUA 4OVUA 3FEXA 3MKRA 1FVHA 2Y4TA 3PNTB 4UWGA 1YCSB 2XCCA 4HRLA 1DCQA 4BETA 4F1SA 2M63A 5EX0A 3URZA 3UM1A 3P2BA 4F1PA 1O1TA 2P58C 4HI9A 4L23A 3DEOA 4A3VA 3J5QB 3LCAA 4A1GA 3S2AA 5AQBA 4HS2A 5EIDA 2Y0BG 4GAAA 3I4RB 2BEDA 1WAO1 3MCXA 1FCHA 1EPUA 3QC1A 2XPYA 1BLXB 4ANUA 1S0PA 5T8IA 4JC8A 4LG6A 1SVXA 3CQGB 3ZN3A 4BERA 1HZ4A 5E76A 1KPSB 3AS5A 2EIME 2J49A 4HORA 4IYPA 1UJJA 1HX8A 3MX3A 1Y8MA 2PL2A 3APDA 1SZAA 1E8ZA 1SZ9A 3JCKC 3ZU7B 3FUEA 3DSUA 2X6IA 5CMYA 4H7YA 2ETBA 3UX4A 1O1SA 3T8KA 3CV0A 3R9MA 3QB2A 4G11A 3C3OA 4K5CA 4H7XA 5D0QD 2XS8A 1EDUA 3EHRA 4BSXA 4AP2A 2J4DA 2CG3A 5ANLA 4JHRA 2LSVA 4UUCA 3C72A 2I6HA 3UXGA 3HDXA 4JA7A 5HI7A 5H7PA 4N5CA 3ML8A 3HXBA 3PNLB 3QDNA 3APFA 3FU6A 3T9KA 2NSZA 4K03A 4QQIA 2J07A 3LXUX 5D2MC 1H2TC 2R05A 3TL5A 1N11A 2ZIRA 4HOTA 1TJFA 4P29A 3S7DA 1JPLA 4APFA 3V30A 3LJ3A 1P5QA 2WXHA 3ZYMA 2EQXA 1JWFA 1BI7B 4OVVA 3EU9A 3TXNA 4AOFA 2J08A 3UT7A 1NP7A 2DIWA 4JXTA 3Q49B 3FUHA 4NACA 2QYUA 5JA4D 3C3QA 4OAVB 3EIQC 1JCQA 1ELWA 2PNNA 3B13A 3B95A 4AJWA 4GYWA 1MHQA 2KM4A 3JXJA 5BT1A 4NRHB 4JPSA 3EHMA 4BX9A 1UN8A 2LAHA 4KXKB 1EYHA 2VGXA 4G25A 5KJKA 2UY1A 3QWVA 2EIKE 2P9SG 4Q96A 2OCCE 5LX8A 2BTDA 2WXQA 1SA5A 2KCLA 4GPKA 4DI3A 2DVWA 4L2YA 2FO7A 4DX7D 3IHVA 5D0OD 3SZ7A 4I2ZA 1MYOA 4GYYA 1SQMA 1IQUA 3EU5A 1HF8A 4HRNA 1NA3A 3NOCD 1D8EA 4BESA 3P1UA 2VTBA 3UIPC 3JUEA 4XX5A 5KBAA 5G04C 3HHMA 2WQHA 2X6HA 5KJNA 1DCEA 5FZSA 3FWVA 3ESLA 4CGWA 2CHZA 1IYGA 4L2LA 4YDOA 1FVFA 4K0RA 4U8HA 3L17A 3QKYA 1Q2ZA 4CDMA 2PQNA 4Q69A 5M72A 4GTOA 3CGHA 1H6OA 5CERB 4G1TA 2WXIA 3LJNA 4GYOA 1IHGA 1YMPA 2KCKA 2ZGDA 2GRLA 1Y6IA 5JMND 4DK5A 3FTUA 2H6IA 3CVLA 3UM3A 1EF1C 3G2VA 2F8XK 3UI2A 2WPVA 1MQSA 1BU9A 2VSNA 5G04J 4F6RD 1JCSA 4HOQA 3ABLE 4HXIA 3VLDA 3RAUA 2L0TB 4FHJA 2P9NG 1HS6A 5LFAA 3X2QE 5FQ4A 2V0PA 3LPZA 4JW1A 3B7RL 2MHKA 2CHXA 5EILA 4ANWA 1H19A 4I6EA 4GZ6A 4XKCA 5C2YA 3PVLA 5EDSA 2XHEA 3LY7A 1DC2A 3GZSA 2WXLA 3LKUA 3FUJA 4HBDA 1N4RA 3CQCB 3PREA 1ELRA 2ZU6B 3SO8A 3ZPJA 3E37A 5CEDB 4MBGA 5ARFA 2OOEA 2EINE 3HVEA 3MKQB 4U8VD 1FT1A 4WNGA 5AQ7A 2AXZA 2P9UG 2LUHA 3ABME 2FI7A 4OAUC 2GGFA 5ARGA 1OWOA 3B7BA 3ZEFA 3CVWA 4AM9A 2B0OE 4XZ4A 4G2VA 2IQCA 4ILHB 3UPVA 4PH4B 1V54E 2VGYA 4LCTA 3V31A 2XGMA 4CEMA 3FH8A 1U2VG 4U07A 2CHWA 1HH8A 3FP3A 4HVBA 4QFVA 5IY5E 2C0MA 1K1AA 4M3OA 4U8YD 5B1AE 3VLEA 3ASOE 2V4HC 3EHQA 2NXPA 2OV8A 4JEHA 4URKA 3D9MA 4WWNA 2GRNB 3PS6A 4KYOB 4XI0A 3HYMB 4FLHA 4BWRA 4UWLA 2P9IG 3SBSA 3OAWA 1Z6TA 4LEUA 4ABNA 1UN9A 3RK6A 3T8MA 2AJAA 4DLOA 4EECA 1H6PA 3CVPA 3D9IA 1WG0A 1G3NB 4LSZE 3JQ1A 1QBQA 1IXVA 3FEYA 2B6CA 4XI9A 5KJLA 3RRMB 2LAIA 3FUFA 4APOA 4M7CA 1S64A 3DSWA 4UWHA 3SNXA 4JA9A 1LD7A 1L5JA 3BU8A 3U4TA 1OWNA 2PQRA 4NIKA 2XCBA 4YVQC 1E7VA 2WXNA 3RRNB 5AAOA 3I4GA 2R59A 3SY2A 5HKPA 2VTBB 5AYWD 1X81A 2XGSA 3Q4AB 1OWLA 3HG0D 5CBNA 4GTSA 2X6KA 3Q79A 2P9LG 2A5UA 1E7UA 3SBTB 3W9GA 3FUIA 3AAAC 3TWVA 3R7RA 3V2XA 2XGOA 2GRPB 4KBQA 4LNUD 4E85A 5AQAA 1YYHA 3GW4A 3UIOC 3GYZA 2Y1LE 5AIJA 2R02A 2XPIA 3JXIA 2VSYA 2RFAA 3ZHEA 2WXGA 4A1SA 3KEZA 4TRQA 4WWPA 3IKOB 4RSYA 1ELKA 3IV0A 3ZXPA 3U9WA 3QWWA 3S7FA 1KLXA 3K9IA 2WMNA 3QARA 4TXRA 1NL4A 4CCAA 2WQ7A 2Y3AA 3AG4E 4BSZB 2R03A 4GTMA 4AVXA 2EILE 3DXMG 3CHMA 3SD5A 1WM5A 2R5SA 4DJAA 4GTPA 1QQEA 3B7SA 4BFRA 3NZSA 4Y6WA 1AWCB 4JL0A 5G55A 2WXRA 3PZ3A 5AARA 3AJIA 4E6HA 4BT9A 4C9BB 1HXIA 3TWSA 1IHBA 4C0MA 2IJGX 2MOWA 2WVIA 4FHKA 2FO1E 3DPDA 4KMOA 3FU5A 1Z3XA 3KD7A 2V4LA 4GPMA 4V3IA 1FT2A 4RQIA 2KC7A 4TXPA 5FZQA 2I2OA 2RG8A 3MA5A 3FTYA 3ZRHA 1A5EA 3Q75A 3LYAA 1TEZA 2QZAA 4JB8P 2IU1A 4FLBA 4Q94A 3ASGA 4FJYA 4KVMA 4YDYA 2WXOA 3QOUA 2XEVA 2E0IA 1Z3YA 2WM9A 1RW2A 3Q73A 3D3MA 4GZCA 4UI9K 3U3WA 4EZJA 4MRUA 3UT8A 1B89A 3DSSA 5G05C 2ONDA 3O48A 5BXUA 3NF1A 3VTXA 1MJ0A 3HVEB 3L54A 3AS8A 3LEWA 2XS1A 4U96D 3E34A 3UTMA 4EBAG 3AG2E 3S7BA 3ASNE 1BPOA 4N3AA 3TGOA 4CZ2D 3EHNA 1TNUA 5CMWA 4C48B 3O4ZA 4G8LA 2LO6A 4HI8A 3VTYA 2IEJA 3NAWA 5KNHD 3TWTA 1OWMA 3TG5A 4ILIA 1JWGA 4KT6B 4GB9A 2F0YA 4CT0A 4I9EA 4EPZA 2YHCA 2UY1B 1X5BA 2FF4A 5B3SE 3EIJA 4RVBA 4UI9C 1HFAA 3E30A 4YNDA 3ESKA 3ZW3A 2ETAA 1WDYA 1OCZE 3PDNA 2NC9A 4DX2A 2ZISA 1O1RA 1INZA 2Y69E 1V55E 5G05J 3L6AA 3KEAA 5A7DB 5BPPA 1IQRA 3CK7A 3RU0A 3WG7E 3KS2A 4XIFA 2YINA 2HO1A 3Q7FA 1DNPA 2HR2A 1OCRE 4DLQA 3PRZA 2XEEA 1H0AA 2H6HA 4EHMA 4EQFA 1OXJA 3FUKA 1N4QA 1D9SA 2XRYA 1TR4A 4I1OB 3CVYA 3E33A 5LCWC 1LF8A 3LVQE 2X6FA 4B8AA 4A3TA 4MS6A 5FIOA 1A17A 1OY3D 4AY6A 1PY1A 4HNAD 3UUXA 3BUAA 4RLYA 5BXOA 1TNBA 4AEZC 3CHRA 3TWRA 5ENOD 3L82A 1K3ZD 4TXQA 4UQZA 1OCOE 5LP0A 2WQ6A 3ISMC 3B7TA 1VDYA 4G8KA 1XGWA 3BEEA 5KCMA 3V2OA 1TNYA 5ENSD 4NURA 1N0RA 2CFZA 3KSQA 4CYMD 5ITZF 3NOGD 4NQ0A 5HRYA 4RG9A 4JVSA 3UT4A 2IFUA 3SGHA 3DXKG 4N39A 4U95D 1BI8B 5J08A 2KXPC 3BG1B 2AXVA 3VLFA 3AU5A 1E96B 3ASDA 3GZ1A 1N94A 3SF4A 3RSEG 3LY8A 2VGXB 3FTWA 5B1BE 3CVNA 3HIZA 4J8YA 3HRAA 4TUMA 4U04A 2A5EA 3L9TA 1U3DA 1UOHA 3SFZA 3DBSA 1NZNA 4FADA 5AQ9A 3QNKA 5EKQD 3I3NA 4GCNA 4LERA 4LNBA 4W9RA 4KZCA 4GZ3A 1QNFA 2WMOA 3CVQA 3UMVA 5BV1A 2CFUA 4ANXA 1OUVA 3C98A 2J09A 3LY9A 3MV2B 4HQDA 4BTAA 4ANVA 4BY6A 2PM7A 4RG6A 2DZOA 1OT8A 4O1PA 2J9QA 2VGEA 4FA6A 4IRUA 4MLPA 2MRIA 2PZIA 3J5PA 4JEUA 2GRQB 3MGBA 4GCOA 4WNFA 5JHBA 3MKQA 3D9NA 4AXHA 3FTZA 3PE4A 5T4YA 4DX1A 4I1AA 4GTVA 3E4BA 5C1DA 4L1BA 3ZNGA 4J8EA 2GRRB 1TNZA 2DYSE 5LOZA 4JHKA 4U7EB 3FDHA 3DEPA 1QYMA 2V5FA 3N71A 4I6JA 5CRUA 1MX2A 2L9BA 5EYPF 3FTVA 3IXEA 4BX8A 1WY6A 5ENTD 4B8CB 5KWDA
chains in the Genus database with same CATH topology
3EHRA 2MYOA 4HRLA 4OAUC 1UOHA 2XEHA 1DCQA 2ZGGA 4BETA 2XZDG 3B7BA 5JMND 4DX6D 2F8YA 1MX6A 2KBXA 1S70B 5ENRD 5AQ9A 4BSZB 2B0OE 1IKND 4K5BA 4UUCA 5BXUA 4F1PA 2NYJA 3UI2A 2F8XK 2HE0A 1D9SA 3UXGA 1K1BA 4HI9A 1TR4A 1MJ0A 5ENPD 3DEOA 1BU9A 1SW6A 3J5QB 3V31A 4NIKA 5AAOA 4YDWA 2P2CP 2ETCA 5AQBA 4A63B 4HRMB 3TWWA 4F6RD 2F37A 5EIDA 5CEAA 2Y0BG 2RFMA 5HKPA 5CBOA 4ZFHA 4U96D 5FIOA 1OY3D 4HNAD 5KNGA 4QFVA 3UTMA 1K1AA 4RLYA 5BXOA 4U8YD 2DVWA 4HQDA 4ATZD 4DUIA 1AWCB 3T9KA 1MX4A 3HG0D 2V5QC 3TWRA 4CZ2D 5ENOD 4DX7D 5CBNA 2V4HC 1BLXB 1K3ZD 3EHQA 2DZOA 1OT8A 4O1OA 5AARA 4QQIA 4O1PA 1MYOA 2QC9A 2QYJA 2VGEA 3AJIA 4G8LA 2DWZA 3NBNB 4HI8A 4HLLA 4GMRA 1NFIE 3W9GA 4LG6A 5KNHD 3TWSA 4HRNA 3TWTA 3NOCD 1IHBA 3Q9NC 5FINA 4ZHBA 4BESA 4B93B 2BKKB 4DRXE 1SVXA 4O60A 4Z68A 3AAAC 5EN5D 3TWVA 5EILA 4BERA 2FO1E 4BEPA 1N11A 4G8KA 3V2XA 2J8SD 3J5PA 4K5AB 4LNUD 3V2OA 3JUEA 3C5RA 5ENSD 5AQAA 5CECB 1YYHA 1N0QA 1N0RA 5KBAA 3V30A 4GPMA 3TWUA 4DX5D 3V79K 4N5QA 5ENQD 1DC2A 5AN8A 4CYMD 2Y1LE 1BI7B 2DZNA 4DX1A 5ITZF 3W9FA 4HBDA 3ZUVB 3NOGD 3EU9A 2ETAA 1WDYA 5HRYA 1BD8A 1A5EA 2L6BA 3JXIA 3ZNGA 2RFAA 5EIBE 2AJAA 2XENA 2XZTG 2BKGA 4HB5A 3ZU7B 4JB8P 3TWQA 4DX2A 1WG0A 3TWXA 3SO8A 1G3NB 4LSZE 4U95D 4C48B 3DEPA 5EYLA 1QYMA 1BI8B 2JABA 1AP7A 2KXPC 3D9HA 5HS0A 5CEDB 5JA4D 1IXVA 5D66A 2ETBA 4OAVB 3KEAA 3T8KA 4YDYA 2PNNA 3B95A 1MX2A 5CERB 5EYPF 3F6QA 3LJNA 4K5CA 3IXEA 3Q9UC 3ZKJA 1YMPA 4J8YA 4U8VD 3HRAA 4TUMA 2ZGDA 5ENTD 5AQ7A 5KWDA 3JXJA 1YCSB 2A5EA 4J7WA 2XEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  2MYO A;  4HRL A;  4OAU C;  1UOH A;  2XEH A;  1DCQ A;  2ZGG A;  4BET A;  2XZD G;  3B7B A;  5JMN D;  4DX6 D;  2F8Y A;  1MX6 A;  2KBX A;  1S70 B;  5ENR D;  5AQ9 A;  4BSZ B;  2B0O E;  1IKN D;  4K5B A;  4UUC A;  5BXU A;  4F1P A;  2NYJ A;  3UI2 A;  2F8X K;  2HE0 A;  1D9S A;  3UXG A;  1K1B A;  4HI9 A;  1TR4 A;  1MJ0 A;  5ENP D;  3DEO A;  1BU9 A;  1SW6 A;  3J5Q B;  3V31 A;  4NIK A;  5AAO A;  4YDW A;  2P2C P;  2ETC A;  5AQB A;  4A63 B;  4HRM B;  3TWW A;  4F6R D;  2F37 A;  5EID A;  5CEA A;  2Y0B G;  2RFM A;  5HKP A;  5CBO A;  4ZFH A;  4U96 D;  5FIO A;  1OY3 D;  4HNA D;  5KNG A;  4QFV A;  3UTM A;  1K1A A;  4RLY A;  5BXO A;  4U8Y D;  2DVW A;  4HQD A;  4ATZ D;  4DUI A;  1AWC B;  3T9K A;  1MX4 A;  3HG0 D;  2V5Q C;  3TWR A;  4CZ2 D;  5ENO D;  4DX7 D;  5CBN A;  2V4H C;  1BLX B;  1K3Z D;  3EHQ A;  2DZO A;  1OT8 A;  4O1O A;  5AAR A;  4QQI A;  4O1P A;  1MYO A;  2QC9 A;  2QYJ A;  2VGE A;  3AJI A;  4G8L A;  2DWZ A;  3NBN B;  4HI8 A;  4HLL A;  4GMR A;  1NFI E;  3W9G A;  4LG6 A;  5KNH D;  3TWS A;  4HRN A;  3TWT A;  3NOC D;  1IHB A;  3Q9N C;  5FIN A;  4ZHB A;  4BES A;  4B93 B;  2BKK B;  4DRX E;  1SVX A;  4O60 A;  4Z68 A;  3AAA C;  5EN5 D;  3TWV A;  5EIL A;  4BER A;  2FO1 E;  4BEP A;  1N11 A;  4G8K A;  3V2X A;  2J8S D;  3J5P A;  4K5A B;  4LNU D;  3V2O A;  3JUE A;  3C5R A;  5ENS D;  5AQA A;  5CEC B;  1YYH A;  1N0Q A;  1N0R A;  5KBA A;  3V30 A;  4GPM A;  3TWU A;  4DX5 D;  3V79 K;  4N5Q A;  5ENQ D;  1DC2 A;  5AN8 A;  4CYM D;  2Y1L E;  1BI7 B;  2DZN A;  4DX1 A;  5ITZ F;  3W9F A;  4HBD A;  3ZUV B;  3NOG D;  3EU9 A;  2ETA A;  1WDY A;  5HRY A;  1BD8 A;  1A5E A;  2L6B A;  3JXI A;  3ZNG A;  2RFA A;  5EIB E;  2AJA A;  2XEN A;  2XZT G;  2BKG A;  4HB5 A;  3ZU7 B;  4JB8 P;  3TWQ A;  4DX2 A;  1WG0 A;  3TWX A;  3SO8 A;  1G3N B;  4LSZ E;  4U95 D;  4C48 B;  3DEP A;  5EYL A;  1QYM A;  1BI8 B;  2JAB A;  1AP7 A;  2KXP C;  3D9H A;  5HS0 A;  5CED B;  5JA4 D;  1IXV A;  5D66 A;  2ETB A;  4OAV B;  3KEA A;  3T8K A;  4YDY A;  2PNN A;  3B95 A;  1MX2 A;  5CER B;  5EYP F;  3F6Q A;  3LJN A;  4K5C A;  3IXE A;  3Q9U C;  3ZKJ A;  1YMP A;  4J8Y A;  4U8V D;  3HRA A;  4TUM A;  2ZGD A;  5ENT D;  5AQ7 A;  5KWD A;  3JXJ A;  1YCS B;  2A5E A;  4J7W A;  2XEE A; 
#chains in the Genus database with same CATH topology
 3KSL A;  3HXC A;  2FUL A;  3D9O A;  4I43 A;  3DST A;  3SHF A;  3FTS A;  3CVX A;  4CDR A;  1S70 B;  5ENR D;  2HM8 A;  2I9C A;  3CEQ A;  3ZHE B;  2HE0 A;  3ZYL A;  1HO8 A;  3DWL G;  3FHE A;  4YDW A;  3JUI A;  1NI1 A;  1TN7 A;  2A4Z A;  3QK0 A;  2AWI A;  4HOS A;  2F37 A;  3OTN A;  3L08 A;  5HQ8 A;  2E2E A;  1NA0 A;  5ANR A;  1XNF A;  4Y6C A;  1N4P A;  4ACL A;  4N3B A;  4G23 A;  3CR3 A;  1MX4 A;  3R7Q A;  5FQ7 A;  2P9P G;  3C3R A;  1QZ2 A;  3WXX A;  2UWJ G;  2WXP A;  3D9P A;  4B0Z A;  2I1K A;  4WAF A;  2KCV A;  4U0Z A;  2BKK B;  1PC2 A;  1E90 A;  3MYV A;  5JJ7 A;  2RD0 A;  3SI5 A;  2DCP A;  2WXK A;  1K8K G;  5FWQ A;  1UW4 B;  3PE3 A;  3QAQ A;  3CK9 A;  3GZ2 A;  5A23 A;  4I2W A;  3RRU A;  5JJ6 A;  4ME2 A;  2C0L A;  4GTQ A;  3CST A;  4I6G A;  1ZBP A;  2BF0 X;  4FP7 A;  2IOS A;  3TWQ A;  3OXF A;  2BUG A;  1HE8 A;  3ABK E;  1JUQ A;  3DPY A;  2L0I A;  2DYR E;  3HXD A;  3PEU B;  2RKK A;  3IHY A;  4G24 A;  3F6Q A;  3UKR G;  3Q9U C;  4GA0 A;  4CT4 A;  4DPR A;  5BV0 A;  2ZGG A;  3PUJ A;  4MKT A;  2IO2 C;  4A55 A;  3D9L A;  3G2S A;  4AIF A;  5FQ8 A;  3CIA A;  4F7A A;  4JZY A;  3Q5M A;  3ULY A;  3QJZ A;  4GML A;  1GW6 A;  2ETC A;  3CLJ A;  3ZVV A;  5CCM A;  1ZB1 A;  5FZR A;  2CG2 A;  4GZD A;  2YQ8 A;  5EX3 A;  4B94 A;  3NBN B;  3G2T A;  4ZHB A;  3ONL A;  3Q9N C;  4O60 A;  4N3C A;  4J8D A;  4BEP A;  3ZYK A;  5AEN A;  2J8S D;  5JJT A;  3HXE A;  4TUU A;  4TV3 A;  3UQ3 A;  2WXM A;  4DX5 D;  3LDZ A;  3ML9 A;  1Z5S C;  1JCR A;  1U3C A;  3ASF A;  4F53 A;  2QFC A;  1KT0 A;  4UWK A;  1BD8 A;  4CDN A;  4BT8 A;  4HB5 A;  3FUM A;  2KAT A;  4XE0 A;  5LCW J;  4WND A;  3TWX A;  2EIJ E;  2H6G A;  5D66 A;  1RZ4 A;  3APC A;  4PS7 A;  4J8S A;  1H2U A;  3ASH A;  3PEV B;  1SA4 A;  4GTR A;  2MYO A;  3CHS A;  1TN6 A;  2VYI A;  5DIZ A;  3PZD A;  5E75 A;  4DX6 D;  2F8Y A;  4HOU A;  1O5M A;  3DRA A;  3FUL A;  2NYJ A;  3FH5 A;  5CRV A;  3FFL A;  3T5X A;  4J0U A;  1N9A A;  2IO3 C;  4I17 A;  4EZK A;  1HG5 A;  2J4B A;  4HRM B;  4A63 B;  4GA2 A;  2RFM A;  5CBO A;  5AJD A;  1W3B A;  1N4S A;  3T5V A;  3IBE A;  4U63 A;  5AJL A;  3L13 A;  3SQV A;  2JLB A;  1DVP A;  3JQ0 A;  1KZO A;  2QC9 A;  2QYJ A;  3OXL A;  4L7T A;  4HLL A;  5DBK A;  2OEW A;  1N52 A;  4ATG A;  5A6C A;  3B7U X;  5EN5 D;  5JHA A;  3S7J A;  3R9A B;  2Y4U A;  3FTX A;  1E8W A;  2DZN A;  3W9F A;  4GU5 A;  3ZXS A;  4KZ0 A;  2L6B A;  3IEG A;  4EBA A;  1OCC E;  3ZGQ A;  2XZT G;  4CRW A;  3CHP A;  3NQP A;  4O6F A;  5EYL A;  3TG4 A;  1ZU2 A;  5HS0 A;  3TAX A;  4LRZ A;  4L9P A;  1E8X A;  1N95 A;  4GTT A;  3UM0 A;  3RIB A;  3U66 A;  2OVF A;  2VJ8 A;  4YDE A;  3TXM A;  3MV3 B;  1UG3 A;  3PH0 C;  2WXF A;  4J7W A;  4C0E A;  4FUL A;  4UQY A;  3EUV A;  1MX6 A;  2H6F A;  3ZFW A;  4EZL A;  1IKN D;  2JEK A;  2IOL A;  2VQ2 A;  2GRO B;  4K5B A;  3Q7A A;  3Q78 A;  4KVO A;  4J8F A;  5ENP D;  2I1J A;  4GMJ A;  3CVV A;  4AY5 A;  5CEA A;  1LTX A;  4I1M A;  3AU4 A;  3RJV A;  4WUY A;  4JD2 G;  2GW1 A;  3SFY A;  3PZ2 A;  5FT9 A;  4J6I A;  4ATZ D;  4DUI A;  4JHJ A;  2OEV A;  2DBA A;  3EDT B;  3UIN C;  4X8Q A;  2DWZ A;  4GMR A;  4G26 A;  3MEK A;  2GRM A;  1E8Y A;  2AVP A;  4B93 B;  3LS8 A;  3CKB A;  4FC8 A;  4XEI G;  4OYS A;  2LXM A;  4WWO A;  5BUZ A;  3PUK A;  3NZU A;  3TJP A;  4N2S A;  1YA0 A;  2X3M A;  2LNI A;  5FQ6 A;  3TWU A;  3AG3 E;  5ENQ D;  2FEZ A;  2L6J A;  3ZUV B;  1TNO A;  2XEN A;  3SFX A;  4IUL A;  4HLE A;  2JAB A;  3G2U A;  4FU3 A;  5T3R A;  3FUN A;  3U64 A;  3CK8 A;  2P9K G;  3G2W A;  3AS4 A;  2OVB A;  4U0S A;  2KZT A;  3ULE G;  1H6K A;  2XEH A;  2ION A;  3Q15 A;  3EJN A;  2FBN A;  2KBX A;  4BTB A;  1N54 A;  2IY0 C;  2ILR A;  1D8D A;  1SW6 A;  4LUN U;  4ACK A;  1TJC A;  3AG1 E;  3TWW A;  5J90 A;  3LVR E;  1FPP A;  3FY4 A;  2V8S E;  1TN8 A;  3RO2 A;  3RO3 A;  3BG0 B;  1H2V C;  4FJZ A;  4GA1 A;  4IN3 B;  4XKB A;  3CVU A;  3DSV A;  3CKC A;  3ULQ A;  2R2L A;  3JYS A;  3FUD A;  3I5P A;  2VSO E;  1S63 A;  3D9J A;  3FU3 A;  2R17 C;  3QWP A;  4PS3 A;  4F3V A;  2YHE A;  3C5R A;  5CEC B;  1N0Q A;  3V79 K;  4N5Q A;  4R7L A;  3CHQ A;  3D9K A;  3MZL B;  2YNQ A;  3UKU G;  4AV7 A;  4CGV A;  3BQO A;  3CHO A;  4I9C A;  5BNW A;  2HYZ A;  4YVO A;  4ILG A;  3DSX A;  3ONK A;  2XPZ A;  3KAE A;  2VSX E;  3ZKJ A;  2WB2 A;  1HG2 A;  4PS8 A;  1K1B A;  2C2L A;  2Q7F A;  2XZD G;  2IF4 A;  3ZYQ A;  1KZP A;  2ZXW E;  2AW6 A;  3L22 A;  4PDX A;  2PM6 A;  3RKV A;  1MZC A;  4HFG A;  2AXU A;  2X6J A;  2P2C P;  5BW8 C;  4U0U A;  2WXJ A;  4GZ5 A;  4PUC A;  4ZFH A;  3E32 A;  5KNG A;  2LXL A;  4WNE A;  3PZ1 A;  4B89 A;  2V5Q C;  4O1O A;  2XRZ A;  5FTP A;  4LNG A;  4N2Q A;  1NFI E;  5FIN A;  3PZ4 A;  5KJM A;  3HXF A;  4DRX E;  3FU0 A;  4Z68 A;  3CSF A;  2KZT B;  5CCL A;  4K5A B;  1OWP A;  1TYQ G;  5FJY A;  4DI4 A;  3L16 A;  3MJW A;  3FH7 A;  5CHE E;  5AN8 A;  2X38 A;  4UWF A;  1LD8 A;  4UQX A;  5ENN A;  5EIB E;  3NB2 A;  1KT1 A;  3Q47 B;  2XQ0 A;  3OXG A;  3ZIM A;  2BKG A;  2QY7 A;  1PAQ A;  3ENE A;  1AP7 A;  3D9H A;  1UJK A;  4D10 C;  1HU3 A;  3UM2 A;  4UI9 J;  5G2N A;  2LSU A;  4OVU A;  3FEX A;  3MKR A;  1FVH A;  2Y4T A;  3PNT B;  4UWG A;  1YCS B;  2XCC A;  4HRL A;  1DCQ A;  4BET A;  4F1S A;  2M63 A;  5EX0 A;  3URZ A;  3UM1 A;  3P2B A;  4F1P A;  1O1T A;  2P58 C;  4HI9 A;  4L23 A;  3DEO A;  4A3V A;  3J5Q B;  3LCA A;  4A1G A;  3S2A A;  5AQB A;  4HS2 A;  5EID A;  2Y0B G;  4GAA A;  3I4R B;  2BED A;  1WAO 1;  3MCX A;  1FCH A;  1EPU A;  3QC1 A;  2XPY A;  1BLX B;  4ANU A;  1S0P A;  5T8I A;  4JC8 A;  4LG6 A;  1SVX A;  3CQG B;  3ZN3 A;  4BER A;  1HZ4 A;  5E76 A;  1KPS B;  3AS5 A;  2EIM E;  2J49 A;  4HOR A;  4IYP A;  1UJJ A;  1HX8 A;  3MX3 A;  1Y8M A;  2PL2 A;  3APD A;  1SZA A;  1E8Z A;  1SZ9 A;  3JCK C;  3ZU7 B;  3FUE A;  3DSU A;  2X6I A;  5CMY A;  4H7Y A;  2ETB A;  3UX4 A;  1O1S A;  3T8K A;  3CV0 A;  3R9M A;  3QB2 A;  4G11 A;  3C3O A;  4K5C A;  4H7X A;  5D0Q D;  2XS8 A;  1EDU A;  3EHR A;  4BSX A;  4AP2 A;  2J4D A;  2CG3 A;  5ANL A;  4JHR A;  2LSV A;  4UUC A;  3C72 A;  2I6H A;  3UXG A;  3HDX A;  4JA7 A;  5HI7 A;  5H7P A;  4N5C A;  3ML8 A;  3HXB A;  3PNL B;  3QDN A;  3APF A;  3FU6 A;  3T9K A;  2NSZ A;  4K03 A;  4QQI A;  2J07 A;  3LXU X;  5D2M C;  1H2T C;  2R05 A;  3TL5 A;  1N11 A;  2ZIR A;  4HOT A;  1TJF A;  4P29 A;  3S7D A;  1JPL A;  4APF A;  3V30 A;  3LJ3 A;  1P5Q A;  2WXH A;  3ZYM A;  2EQX A;  1JWF A;  1BI7 B;  4OVV A;  3EU9 A;  3TXN A;  4AOF A;  2J08 A;  3UT7 A;  1NP7 A;  2DIW A;  4JXT A;  3Q49 B;  3FUH A;  4NAC A;  2QYU A;  5JA4 D;  3C3Q A;  4OAV B;  3EIQ C;  1JCQ A;  1ELW A;  2PNN A;  3B13 A;  3B95 A;  4AJW A;  4GYW A;  1MHQ A;  2KM4 A;  3JXJ A;  5BT1 A;  4NRH B;  4JPS A;  3EHM A;  4BX9 A;  1UN8 A;  2LAH A;  4KXK B;  1EYH A;  2VGX A;  4G25 A;  5KJK A;  2UY1 A;  3QWV A;  2EIK E;  2P9S G;  4Q96 A;  2OCC E;  5LX8 A;  2BTD A;  2WXQ A;  1SA5 A;  2KCL A;  4GPK A;  4DI3 A;  2DVW A;  4L2Y A;  2FO7 A;  4DX7 D;  3IHV A;  5D0O D;  3SZ7 A;  4I2Z A;  1MYO A;  4GYY A;  1SQM A;  1IQU A;  3EU5 A;  1HF8 A;  4HRN A;  1NA3 A;  3NOC D;  1D8E A;  4BES A;  3P1U A;  2VTB A;  3UIP C;  3JUE A;  4XX5 A;  5KBA A;  5G04 C;  3HHM A;  2WQH A;  2X6H A;  5KJN A;  1DCE A;  5FZS A;  3FWV A;  3ESL A;  4CGW A;  2CHZ A;  1IYG A;  4L2L A;  4YDO A;  1FVF A;  4K0R A;  4U8H A;  3L17 A;  3QKY A;  1Q2Z A;  4CDM A;  2PQN A;  4Q69 A;  5M72 A;  4GTO A;  3CGH A;  1H6O A;  5CER B;  4G1T A;  2WXI A;  3LJN A;  4GYO A;  1IHG A;  1YMP A;  2KCK A;  2ZGD A;  2GRL A;  1Y6I A;  5JMN D;  4DK5 A;  3FTU A;  2H6I A;  3CVL A;  3UM3 A;  1EF1 C;  3G2V A;  2F8X K;  3UI2 A;  2WPV A;  1MQS A;  1BU9 A;  2VSN A;  5G04 J;  4F6R D;  1JCS A;  4HOQ A;  3ABL E;  4HXI A;  3VLD A;  3RAU A;  2L0T B;  4FHJ A;  2P9N G;  1HS6 A;  5LFA A;  3X2Q E;  5FQ4 A;  2V0P A;  3LPZ A;  4JW1 A;  3B7R L;  2MHK A;  2CHX A;  5EIL A;  4ANW A;  1H19 A;  4I6E A;  4GZ6 A;  4XKC A;  5C2Y A;  3PVL A;  5EDS A;  2XHE A;  3LY7 A;  1DC2 A;  3GZS A;  2WXL A;  3LKU A;  3FUJ A;  4HBD A;  1N4R A;  3CQC B;  3PRE A;  1ELR A;  2ZU6 B;  3SO8 A;  3ZPJ A;  3E37 A;  5CED B;  4MBG A;  5ARF A;  2OOE A;  2EIN E;  3HVE A;  3MKQ B;  4U8V D;  1FT1 A;  4WNG A;  5AQ7 A;  2AXZ A;  2P9U G;  2LUH A;  3ABM E;  2FI7 A;  4OAU C;  2GGF A;  5ARG A;  1OWO A;  3B7B A;  3ZEF A;  3CVW A;  4AM9 A;  2B0O E;  4XZ4 A;  4G2V A;  2IQC A;  4ILH B;  3UPV A;  4PH4 B;  1V54 E;  2VGY A;  4LCT A;  3V31 A;  2XGM A;  4CEM A;  3FH8 A;  1U2V G;  4U07 A;  2CHW A;  1HH8 A;  3FP3 A;  4HVB A;  4QFV A;  5IY5 E;  2C0M A;  1K1A A;  4M3O A;  4U8Y D;  5B1A E;  3VLE A;  3ASO E;  2V4H C;  3EHQ A;  2NXP A;  2OV8 A;  4JEH A;  4URK A;  3D9M A;  4WWN A;  2GRN B;  3PS6 A;  4KYO B;  4XI0 A;  3HYM B;  4FLH A;  4BWR A;  4UWL A;  2P9I G;  3SBS A;  3OAW A;  1Z6T A;  4LEU A;  4ABN A;  1UN9 A;  3RK6 A;  3T8M A;  2AJA A;  4DLO A;  4EEC A;  1H6P A;  3CVP A;  3D9I A;  1WG0 A;  1G3N B;  4LSZ E;  3JQ1 A;  1QBQ A;  1IXV A;  3FEY A;  2B6C A;  4XI9 A;  5KJL A;  3RRM B;  2LAI A;  3FUF A;  4APO A;  4M7C A;  1S64 A;  3DSW A;  4UWH A;  3SNX A;  4JA9 A;  1LD7 A;  1L5J A;  3BU8 A;  3U4T A;  1OWN A;  2PQR A;  4NIK A;  2XCB A;  4YVQ C;  1E7V A;  2WXN A;  3RRN B;  5AAO A;  3I4G A;  2R59 A;  3SY2 A;  5HKP A;  2VTB B;  5AYW D;  1X81 A;  2XGS A;  3Q4A B;  1OWL A;  3HG0 D;  5CBN A;  4GTS A;  2X6K A;  3Q79 A;  2P9L G;  2A5U A;  1E7U A;  3SBT B;  3W9G A;  3FUI A;  3AAA C;  3TWV A;  3R7R A;  3V2X A;  2XGO A;  2GRP B;  4KBQ A;  4LNU D;  4E85 A;  5AQA A;  1YYH A;  3GW4 A;  3UIO C;  3GYZ A;  2Y1L E;  5AIJ A;  2R02 A;  2XPI A;  3JXI A;  2VSY A;  2RFA A;  3ZHE A;  2WXG A;  4A1S A;  3KEZ A;  4TRQ A;  4WWP A;  3IKO B;  4RSY A;  1ELK A;  3IV0 A;  3ZXP A;  3U9W A;  3QWW A;  3S7F A;  1KLX A;  3K9I A;  2WMN A;  3QAR A;  4TXR A;  1NL4 A;  4CCA A;  2WQ7 A;  2Y3A A;  3AG4 E;  4BSZ B;  2R03 A;  4GTM A;  4AVX A;  2EIL E;  3DXM G;  3CHM A;  3SD5 A;  1WM5 A;  2R5S A;  4DJA A;  4GTP A;  1QQE A;  3B7S A;  4BFR A;  3NZS A;  4Y6W A;  1AWC B;  4JL0 A;  5G55 A;  2WXR A;  3PZ3 A;  5AAR A;  3AJI A;  4E6H A;  4BT9 A;  4C9B B;  1HXI A;  3TWS A;  1IHB A;  4C0M A;  2IJG X;  2MOW A;  2WVI A;  4FHK A;  2FO1 E;  3DPD A;  4KMO A;  3FU5 A;  1Z3X A;  3KD7 A;  2V4L A;  4GPM A;  4V3I A;  1FT2 A;  4RQI A;  2KC7 A;  4TXP A;  5FZQ A;  2I2O A;  2RG8 A;  3MA5 A;  3FTY A;  3ZRH A;  1A5E A;  3Q75 A;  3LYA A;  1TEZ A;  2QZA A;  4JB8 P;  2IU1 A;  4FLB A;  4Q94 A;  3ASG A;  4FJY A;  4KVM A;  4YDY A;  2WXO A;  3QOU A;  2XEV A;  2E0I A;  1Z3Y A;  2WM9 A;  1RW2 A;  3Q73 A;  3D3M A;  4GZC A;  4UI9 K;  3U3W A;  4EZJ A;  4MRU A;  3UT8 A;  1B89 A;  3DSS A;  5G05 C;  2OND A;  3O48 A;  5BXU A;  3NF1 A;  3VTX A;  1MJ0 A;  3HVE B;  3L54 A;  3AS8 A;  3LEW A;  2XS1 A;  4U96 D;  3E34 A;  3UTM A;  4EBA G;  3AG2 E;  3S7B A;  3ASN E;  1BPO A;  4N3A A;  3TGO A;  4CZ2 D;  3EHN A;  1TNU A;  5CMW A;  4C48 B;  3O4Z A;  4G8L A;  2LO6 A;  4HI8 A;  3VTY A;  2IEJ A;  3NAW A;  5KNH D;  3TWT A;  1OWM A;  3TG5 A;  4ILI A;  1JWG A;  4KT6 B;  4GB9 A;  2F0Y A;  4CT0 A;  4I9E A;  4EPZ A;  2YHC A;  2UY1 B;  1X5B A;  2FF4 A;  5B3S E;  3EIJ A;  4RVB A;  4UI9 C;  1HFA A;  3E30 A;  4YND A;  3ESK A;  3ZW3 A;  2ETA A;  1WDY A;  1OCZ E;  3PDN A;  2NC9 A;  4DX2 A;  2ZIS A;  1O1R A;  1INZ A;  2Y69 E;  1V55 E;  5G05 J;  3L6A A;  3KEA A;  5A7D B;  5BPP A;  1IQR A;  3CK7 A;  3RU0 A;  3WG7 E;  3KS2 A;  4XIF A;  2YIN A;  2HO1 A;  3Q7F A;  1DNP A;  2HR2 A;  1OCR E;  4DLQ A;  3PRZ A;  2XEE A;  1H0A A;  2H6H A;  4EHM A;  4EQF A;  1OXJ A;  3FUK A;  1N4Q A;  1D9S A;  2XRY A;  1TR4 A;  4I1O B;  3CVY A;  3E33 A;  5LCW C;  1LF8 A;  3LVQ E;  2X6F A;  4B8A A;  4A3T A;  4MS6 A;  5FIO A;  1A17 A;  1OY3 D;  4AY6 A;  1PY1 A;  4HNA D;  3UUX A;  3BUA A;  4RLY A;  5BXO A;  1TNB A;  4AEZ C;  3CHR A;  3TWR A;  5ENO D;  3L82 A;  1K3Z D;  4TXQ A;  4UQZ A;  1OCO E;  5LP0 A;  2WQ6 A;  3ISM C;  3B7T A;  1VDY A;  4G8K A;  1XGW A;  3BEE A;  5KCM A;  3V2O A;  1TNY A;  5ENS D;  4NUR A;  1N0R A;  2CFZ A;  3KSQ A;  4CYM D;  5ITZ F;  3NOG D;  4NQ0 A;  5HRY A;  4RG9 A;  4JVS A;  3UT4 A;  2IFU A;  3SGH A;  3DXK G;  4N39 A;  4U95 D;  1BI8 B;  5J08 A;  2KXP C;  3BG1 B;  2AXV A;  3VLF A;  3AU5 A;  1E96 B;  3ASD A;  3GZ1 A;  1N94 A;  3SF4 A;  3RSE G;  3LY8 A;  2VGX B;  3FTW A;  5B1B E;  3CVN A;  3HIZ A;  4J8Y A;  3HRA A;  4TUM A;  4U04 A;  2A5E A;  3L9T A;  1U3D A;  1UOH A;  3SFZ A;  3DBS A;  1NZN A;  4FAD A;  5AQ9 A;  3QNK A;  5EKQ D;  3I3N A;  4GCN A;  4LER A;  4LNB A;  4W9R A;  4KZC A;  4GZ3 A;  1QNF A;  2WMO A;  3CVQ A;  3UMV A;  5BV1 A;  2CFU A;  4ANX A;  1OUV A;  3C98 A;  2J09 A;  3LY9 A;  3MV2 B;  4HQD A;  4BTA A;  4ANV A;  4BY6 A;  2PM7 A;  4RG6 A;  2DZO A;  1OT8 A;  4O1P A;  2J9Q A;  2VGE A;  4FA6 A;  4IRU A;  4MLP A;  2MRI A;  2PZI A;  3J5P A;  4JEU A;  2GRQ B;  3MGB A;  4GCO A;  4WNF A;  5JHB A;  3MKQ A;  3D9N A;  4AXH A;  3FTZ A;  3PE4 A;  5T4Y A;  4DX1 A;  4I1A A;  4GTV A;  3E4B A;  5C1D A;  4L1B A;  3ZNG A;  4J8E A;  2GRR B;  1TNZ A;  2DYS E;  5LOZ A;  4JHK A;  4U7E B;  3FDH A;  3DEP A;  1QYM A;  2V5F A;  3N71 A;  4I6J A;  5CRU A;  1MX2 A;  2L9B A;  5EYP F;  3FTV A;  3IXE A;  4BX8 A;  1WY6 A;  5ENT D;  4B8C B;  5KWD A; 
#chains in the Genus database with same CATH homology
 3EHR A;  2MYO A;  4HRL A;  4OAU C;  1UOH A;  2XEH A;  1DCQ A;  2ZGG A;  4BET A;  2XZD G;  3B7B A;  5JMN D;  4DX6 D;  2F8Y A;  1MX6 A;  2KBX A;  1S70 B;  5ENR D;  5AQ9 A;  4BSZ B;  2B0O E;  1IKN D;  4K5B A;  4UUC A;  5BXU A;  4F1P A;  2NYJ A;  3UI2 A;  2F8X K;  2HE0 A;  1D9S A;  3UXG A;  1K1B A;  4HI9 A;  1TR4 A;  1MJ0 A;  5ENP D;  3DEO A;  1BU9 A;  1SW6 A;  3J5Q B;  3V31 A;  4NIK A;  5AAO A;  4YDW A;  2P2C P;  2ETC A;  5AQB A;  4A63 B;  4HRM B;  3TWW A;  4F6R D;  2F37 A;  5EID A;  5CEA A;  2Y0B G;  2RFM A;  5HKP A;  5CBO A;  4ZFH A;  4U96 D;  5FIO A;  1OY3 D;  4HNA D;  5KNG A;  4QFV A;  3UTM A;  1K1A A;  4RLY A;  5BXO A;  4U8Y D;  2DVW A;  4HQD A;  4ATZ D;  4DUI A;  1AWC B;  3T9K A;  1MX4 A;  3HG0 D;  2V5Q C;  3TWR A;  4CZ2 D;  5ENO D;  4DX7 D;  5CBN A;  2V4H C;  1BLX B;  1K3Z D;  3EHQ A;  2DZO A;  1OT8 A;  4O1O A;  5AAR A;  4QQI A;  4O1P A;  1MYO A;  2QC9 A;  2QYJ A;  2VGE A;  3AJI A;  4G8L A;  2DWZ A;  3NBN B;  4HI8 A;  4HLL A;  4GMR A;  1NFI E;  3W9G A;  4LG6 A;  5KNH D;  3TWS A;  4HRN A;  3TWT A;  3NOC D;  1IHB A;  3Q9N C;  5FIN A;  4ZHB A;  4BES A;  4B93 B;  2BKK B;  4DRX E;  1SVX A;  4O60 A;  4Z68 A;  3AAA C;  5EN5 D;  3TWV A;  5EIL A;  4BER A;  2FO1 E;  4BEP A;  1N11 A;  4G8K A;  3V2X A;  2J8S D;  3J5P A;  4K5A B;  4LNU D;  3V2O A;  3JUE A;  3C5R A;  5ENS D;  5AQA A;  5CEC B;  1YYH A;  1N0Q A;  1N0R A;  5KBA A;  3V30 A;  4GPM A;  3TWU A;  4DX5 D;  3V79 K;  4N5Q A;  5ENQ D;  1DC2 A;  5AN8 A;  4CYM D;  2Y1L E;  1BI7 B;  2DZN A;  4DX1 A;  5ITZ F;  3W9F A;  4HBD A;  3ZUV B;  3NOG D;  3EU9 A;  2ETA A;  1WDY A;  5HRY A;  1BD8 A;  1A5E A;  2L6B A;  3JXI A;  3ZNG A;  2RFA A;  5EIB E;  2AJA A;  2XEN A;  2XZT G;  2BKG A;  4HB5 A;  3ZU7 B;  4JB8 P;  3TWQ A;  4DX2 A;  1WG0 A;  3TWX A;  3SO8 A;  1G3N B;  4LSZ E;  4U95 D;  4C48 B;  3DEP A;  5EYL A;  1QYM A;  1BI8 B;  2JAB A;  1AP7 A;  2KXP C;  3D9H A;  5HS0 A;  5CED B;  5JA4 D;  1IXV A;  5D66 A;  2ETB A;  4OAV B;  3KEA A;  3T8K A;  4YDY A;  2PNN A;  3B95 A;  1MX2 A;  5CER B;  5EYP F;  3F6Q A;  3LJN A;  4K5C A;  3IXE A;  3Q9U C;  3ZKJ A;  1YMP A;  4J8Y A;  4U8V D;  3HRA A;  4TUM A;  2ZGD A;  5ENT D;  5AQ7 A;  5KWD A;  3JXJ A;  1YCS B;  2A5E A;  4J7W A;  2XEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...