3V2XA

Crystal structure of the peptide bound complex of the ankyrin repeat domains of human ankra2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
166
structure length
166
Chain Sequence
GANSLSVHQLAAQGEMLYLATRIEQENVINHTDEEGFTPLMWAAAHGQIAVVEFLLQNGADPQLLGKGRESALSLACSKGYTDIVKMLLDCGVDVNEYDWNGGTPLLYAVHGNHVKCVKMLLESGADPTIETDSGYNSMDLAVALGYRSVQQVIESHLLKLLQNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin repeat family A protein 2
publication title Sequence-Specific Recognition of a PxLPxI/L Motif by an Ankyrin Repeat Tumbler Lock.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 58
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3v2xA00
4B93B 2ZGGA 3TWWA 2V4HC 2F37A 3B95A 3C5RA 1D9SA 3ZUVB 1G3NB 2Y1LE 2P2CP 3TWTA 3Q9UC 4HRMB 2RFAA 4DX7D 2DVWA 5FIOA 2AJAA 4QQIA 5AN8A 2XENA 1OY3D 1SW6A 2XEEA 3ZU7B 5CEDB 3DEOA 4J8YA 1N0QA 2ETBA 3EU9A 5AQ7A 3B7BA 1MJ0A 1A5EA 4YDWA 4BESA 2A5EA 2ETAA 2HE0A 1MX6A 1BI7B 2QC9A 2XZDG 1WDYA 3TWXA 2XEHA 5EIBE 1DCQA 2J8SD 4CYMD 4HQDA 4HI8A 2F8XK 2F8YA 5ENTD 4LSZE 5AARA 5HRYA 3EHRA 1IXVA 2B0OE 3SO8A 4ZHBA 3ZNGA 3T8KA 5CBNA 3KEAA 5EYPF 1UOHA 4G8LA 1K1AA 3V30A 5AAOA 3LJNA 4GPMA 3W9FA 3J5PA 3NOGD 4K5CA 4O60A 5CECB 4DX5D 5AQAA 4DX6D 1N11A 2FO1E 4G8KA 3TWVA 4GMRA 2ETCA 3JXIA 5HS0A 2DZNA 4Z68A 4BEPA 1MX2A 4LNUD 4DX2A 1K3ZD 3IXEA 1AWCB 3ZKJA 3TWUA 4DUIA 3JXJA 4HBDA 3V2OA 1DC2A 4ZFHA 1BLXB 5JMND 3UI2A 5BXOA 5KWDA 3J5QB 2BKKB 4YDYA 4CZ2D 4DRXE 5ITZF 3EHQA 4BERA 4U96D 4LG6A 3HRAA 3TWQA 1N0RA 4DX1A 1MX4A 2Y0BG 5EYLA 3F6QA 5BXUA 4OAUC 5AQ9A 1YMPA 2V5QC 2DWZA 4RLYA 2DZOA 1BI8B 4A63B 4HRNA 3W9GA 1OT8A 1QYMA 1S70B 4HLLA 4QFVA 1YCSB 3T9KA 2JABA 2VGEA 3HG0D 4TUMA 5CERB 1K1BA 3Q9NC 1NFIE 4HNAD 1TR4A 2NYJA 4K5AB 3JUEA 2PNNA 5EN5D 5JA4D 4ATZD 2MYOA 4F6RD 5HKPA 3UXGA 2KXPC 2KBXA 4JB8P 4N5QA 5D66A 5ENRD 5KNGA 2XZTG 3V79K 4OAVB 3V31A 2L6BA 4BETA 1MYOA 4U95D 2RFMA 4HRLA 5AQBA 1IHBA 4BSZB 1SVXA 1IKND 3UTMA 4C48B 1AP7A 3NOCD 1BD8A 5CBOA 5CEAA 3TWSA 2QYJA 4K5BA 3AAAC 3V2XA 4O1PA 4F1PA 5ENQD 4HI9A 5KNHD 1BU9A 3D9HA 1YYHA 4J7WA 5ENSD 5KBAA 1WG0A 4O1OA 5ENOD 2BKGA 4HB5A 4U8VD 5EILA 2ZGDA 4UUCA 5FINA 3AJIA 3TWRA 5ENPD 5EIDA 3NBNB 4NIKA 4U8YD 3DEPA
chains in the Genus database with same CATH superfamily
2R2LA 3L16A 2F37A 2IY0C 3CK8A 5G05J 1G3NB 1OWLA 4CRWA 3T8MA 2AJAA 3UM3A 4BT9A 5EX3A 1N0QA 3EU9A 5AQ7A 4H7XA 4AIFA 3DXKG 4N2SA 4C0MA 3VLDA 1KZOA 5EIBE 1OWMA 3FU6A 1K8KG 2AVPA 3ZRHA 2B0OE 3TG4A 4UWFA 4KZCA 3SGHA 2PM7A 3J5PA 4URKA 3PRZA 3U3WA 2VSOE 1KT1A 2L0TB 3IXEA 2DIWA 3JXJA 2E2EA 5JMND 4BX8A 2QZAA 4XKCA 4LG6A 1N54A 3F6QA 4OAUC 1YMPA 4DLOA 4B0ZA 3ZW3A 1HE8A 2IEJA 2LXMA 2ZIRA 4M7CA 4AY5A 3DXMG 4K5AB 2WXFA 3SY2A 4F1SA 3RKVA 4J0UA 2X6HA 1V54E 2IO3C 1KLXA 3APCA 1UG3A 4U95D 4EQFA 3PEUB 4EZKA 5AYWD 4C48B 1MHQA 4GU5A 4IN3B 3S7FA 2CFZA 5E76A 2GROB 2RG8A 2I1JA 2VSNA 3AS4A 4NIKA 3DBSA 3DEPA 5BT1A 4GZDA 5ARFA 3ULYA 2XQ0A 2WQHA 4NURA 4LRZA 1XNFA 2KZTB 4FHKA 2XENA 3ZU7B 3CSFA 1MJ0A 1H6KA 2B6CA 4I1MA 5BNWA 1H2VC 3ASGA 1ELKA 1HG2A 3T5XA 4DPRA 3SZ7A 3K9IA 1ZBPA 2H6GA 4GTTA 5EKQD 5EYPF 3PH0C 3PZ4A 4G8LA 4I17A 3CV0A 2EIJE 1OCOE 4K03A 5D0QD 5AQAA 2DZNA 3AG2E 1FT1A 1W3BA 4GAAA 3J5QB 3FTZA 4YDYA 4Q69A 4FU3A 4FLBA 1MX4A 3DSUA 5BXUA 4HORA 2DWZA 3Q79A 4BT8A 2WXIA 3HXDA 5DBKA 1D8EA 4KVMA 4JB8P 2L6BA 3NZUA 2OVFA 4GTQA 3ENEA 3QC1A 3SFYA 2EQXA 3HVEA 4IULA 3FU3A 3TWWA 3JQ1A 4I6GA 3FUJA 4RQIA 4XI9A 2E0IA 2DBAA 3UM1A 4J8YA 2A4ZA 3ULQA 5BW8C 2P9UG 2BF0X 2J8SD 4CYMD 2AWIA 3L82A 3KEZA 3TXNA 3SFXA 2AXVA 1XGWA 4I2ZA 1UOHA 3DSVA 5ENNA 5FTPA 4DX5D 4NRHB 2KC7A 3UT4A 4EBAG 2P9LG 4AP2A 4R7LA 3O48A 4HBDA 3EUVA 3CHPA 1DC2A 3FHEA 1UJJA 2JLBA 1FT2A 4YDEA 2YINA 1QBQA 2KM4A 3QWVA 1SA5A 1RZ4A 2HO1A 4PDXA 3UINC 5T4YA 4W9RA 3AG4E 2LSUA 3MCXA 3NQPA 3ZEFA 3IHVA 1U3CA 3DSWA 3EDTB 4G23A 5G04J 4OAVB 1H6OA 3B7UX 3MJWA 4BETA 2PM6A 2ZU6B 4MKTA 4UQXA 1AP7A 3FULA 1EPUA 3AAAC 3MYVA 3BU8A 1N9AA 2BEDA 3PE3A 1BU9A 1QZ2A 1OCCE 2GRPB 3ZHEA 4ME2A 4HOSA 4N3BA 2VQ2A 1IQUA 3AG3E 1TN8A 3QWWA 3RK6A 1JCQA 3ZUVB 4I1OB 3T5VA 4KMOA 4G24A 3CQCB 1P5QA 2A5EA 4I2WA 4HQDA 1LTXA 4AJWA 2F8YA 3CSTA 2H6FA 3ZNGA 3CGHA 3KEAA 4HOUA 3AS5A 3JXIA 4U0SA 2GW1A 3TWUA 4CT0A 1NP7A 5CCMA 2BKKB 4FC8A 3E32A 3CVWA 5AQ9A 4TXRA 3DWLG 3TL5A 2MHKA 3LPZA 3C3QA 2XPYA 3V79K 3DSXA 3FUDA 2WVIA 3UTMA 3ASHA 1TNZA 4ACLA 2LO6A 3ZVVA 5B1BE 3D9OA 4WNDA 3AJIA 2WXOA 3MKQA 1FVFA 4CDRA 1TNOA 3E4BA 3CEQA 5FWQA 2P2CP 2PL2A 3FH8A 1N4QA 4HRMB 1PAQA 1E8YA 4TXPA 4A1SA 3ZIMA 4L1BA 4YDWA 4H7YA 1IQRA 2OEWA 4HS2A 4K0RA 4CEMA 2X6FA 3EHRA 1IXVA 3L54A 4XKBA 4L2LA 3RRUA 3W9FA 3BUAA 2V4LA 4APFA 2X6JA 2YNQA 4BFRA 3ZKJA 5JHAA 4DUIA 4ABNA 4AV7A 3ULEG 5BXOA 4GA1A 5ITZF 4BERA 1LD8A 2MRIA 3HRAA 3TWQA 4GMLA 2GRNB 3EIQC 4RLYA 3L9TA 2A5UA 1S70B 1ZU2A 2JABA 4HNAD 3APDA 3ZYQA 1TR4A 2NYJA 2WMOA 4UI9C 4FP7A 3G2TA 4C0EA 1HU3A 5T3RA 4BTAA 4B8AA 3B7SA 3LVQE 4JHJA 2RFMA 4HRLA 1E7VA 2ILRA 4J6IA 1HZ4A 4F1PA 3FUKA 1OXJA 3D9HA 4LEUA 1Y6IA 2L6JA 3TWRA 2H6IA 3FUHA 1S64A 4U8YD 5HI7A 2HYZA 4N3AA 2OOEA 5B1AE 5J90A 3PNLB 2R5SA 3CVPA 3ML9A 3OXLA 3TWTA 4EECA 4DX7D 2MOWA 2R05A 5FIOA 1SW6A 2OEVA 3S7JA 4B89A 2CHZA 1HG5A 2J08A 1O1TA 4I9CA 2VTBB 2XEHA 3ASNE 1X5BA 2XS8A 2GRRB 3CR3A 3S2AA 3CVNA 2EILE 4HFGA 4KT6B 5CBNA 4LCTA 4RG9A 3LJNA 2X6KA 4K5CA 2LNIA 2NSZA 3BG0B 4ATGA 3LEWA 3EHNA 3E30A 1AWCB 3V2OA 4UQYA 3EHQA 4U96D 3ABLE 5CHEE 2LSVA 3EHMA 3CVLA 4DK5A 3D9PA 3CHMA 3MX3A 3Q9NC 3CHRA 4OVVA 4RVBA 4JHRA 4APOA 5A23A 2Q7FA 2IONA 4XZ4A 4GZ5A 3UIOC 3PZ3A 1MYOA 3QK0A 3PNTB 5IY5E 2V5FA 1N4RA 5ENQD 3Q7FA 1U2VG 4U8VD 3PZ2A 4UWGA 3CHOA 2RKKA 1E90A 4GTVA 2J09A 4U04A 1EDUA 4TXQA 3FFLA 2Y1LE 3CK9A 2RFAA 3I5PA 5FZQA 3RSEG 3BQOA 4UQZA 2UY1B 4D10C 2I2OA 3EJNA 5LCWJ 3QARA 5CCLA 1JPLA 1UW4B 5KJLA 4GMJA 4LSZE 4BY6A 4C9BB 4ZHBA 3RU0A 3Q4AB 2H6HA 1TNUA 3RRNB 5AAOA 4GPMA 3PVLA 2FO1E 4G8KA 4EHMA 1U3DA 3E33A 4BEPA 1OCZE 1K3ZD 4PS3A 2KZTA 3CVUA 4G1TA 2XCCA 3FU0A 3ZYLA 4TRQA 2V5QC 2J49A 1S63A 4A63B 3SF4A 3NB2A 4AVXA 2WXMA 1DNPA 1FVHA 4BX9A 2PNNA 5EN5D 2Y4TA 3ABME 3ML8A 5ENRD 5KNGA 4IRUA 3QKYA 1PC2A 4BSZB 5KJMA 3FDHA 3TWSA 4K5BA 5KCMA 4GCNA 3I4GA 2FBNA 5FINA 1HF8A 4B93B 3D9LA 2GRMA 3S7BA 3X2QE 3D9NA 2PQNA 3OTNA 3L6AA 3VTXA 5AN8A 4WNGA 1FCHA 3URZA 2WXPA 4BESA 1N95A 2CHWA 1UJKA 2XZDG 1WDYA 3PZDA 3SHFA 1DCEA 1Z5SC 5HRYA 3FH5A 3LKUA 3ZXSA 3T8KA 2BTDA 2I9CA 3RRMB 3P1UA 1N11A 3HIZA 1N4SA 1N94A 3TJPA 1MZCA 4P29A 3UT8A 5KWDA 1IHGA 5DIZA 5A6CA 5ANRA 4GYYA 4EPZA 5HQ8A 4OVUA 3GW4A 3PUJA 1Z3XA 1O5MA 4I9EA 2AXZA 3QJZA 4L7TA 5B3SE 1NI1A 3Q7AA 4WUYA 3CIAA 2X3MA 3AG1E 3ASDA 3NOCD 4ANWA 3G2UA 3IBEA 3HXCA 5KBAA 1VDYA 2WXRA 3SNXA 3QWPA 2Y3AA 2CHXA 2XS1A 2XRZA 1JCSA 4FADA 4EBAA 1E8WA 4EZLA 2FO7A 3B95A 5CRUA 1ELWA 1NA3A 3FUNA 3SD5A 2ETBA 3B7BA 5CMWA 4GA2A 3QAQA 4IYPA 4L23A 2Y4UA 4BTBA 1Y8MA 2VGXA 5ENTD 1HX8A 3U9WA 4AXHA 5JJTA 3UT7A 2EINE 4O60A 3ZYMA 1KT0A 4XE0A 3CVXA 3FUFA 3TWVA 1MX2A 3B7TA 1TYQG 3GZ1A 4E85A 3O4ZA 4CDMA 3MV2B 1OWOA 3I4RB 4CCAA 1O1RA 4YVOA 2C2LA 3JCKC 4KZ0A 3DPDA 2WQ7A 4DX1A 2IQCA 2P9KG 2QY7A 5EYLA 2WPVA 4ACKA 3LY7A 1BI8B 4L2YA 1Q2ZA 1X81A 1NFIE 3RIBA 1Z3YA 2WXGA 4GZ6A 4KYOB 4GB9A 2WB2A 4ANXA 3KD7A 2WXQA 2UWJG 2WXNA 2WXJA 1TJFA 3KAEA 3B7RL 3U64A 1WG0A 4O1OA 3FUMA 5BV0A 4CDNA 4J8SA 4F53A 4DJAA 3TXMA 2ZGGA 2P9PG 2X6IA 3MZLB 3CHSA 3SBSA 5D0OD 3DEOA 5J08A 4DI4A 3MGBA 4JPSA 4MBGA 3L08A 3E37A 4JHKA 4I6JA 5LOZA 3LVRE 2R17C 2I6HA 4PUCA 2PZIA 3Q49B 1TN7A 3LY9A 3ESLA 3V30A 4BSXA 2DYSE 4DX6D 4YNDA 3N71A 1E7UA 3NZSA 3U4TA 2VSXE 3G2WA 3E34A 3IV0A 3BEEA 4JZYA 3CKCA 4ILHB 3OXFA 1B89A 3C3OA 5JJ7A 3D9IA 2DZOA 3RJVA 2X38A 4HLLA 1YCSB 5G05C 4TUMA 3SI5A 3D9MA 5HKPA 1SA4A 3LJ3A 4GYOA 4HVBA 4UWKA 3FTXA 1SVXA 4G25A 4MS6A 2QYJA 3Q78A 4U07A 5KJKA 5ENSD 2BKGA 4MRUA 3PEVB 4WWOA 3QB2A 3FP3A 5FQ6A 4NQ0A 4QQIA 1OY3D 4JA9A 3NAWA 2WQ6A 3PZ1A 4TV3A 2ETAA 3HXBA 3TWXA 3GYZA 1RW2A 1HS6A 2IU1A 2LUHA 3I3NA 1JCRA 3OAWA 5CECB 3JYSA 3CK7A 3ISMC 3ABKE 4FA6A 5FZRA 2BUGA 2PQRA 3ESKA 4HLEA 4GCOA 2RD0A 1O1SA 2I1KA 2VTBA 4CT4A 3D9JA 4JEUA 3LDZA 3UM2A 4AY6A 3HG0D 3FUEA 1K1BA 2XGMA 1WY6A 4N39A 4GZ3A 3IKOB 4X8QA 2QFCA 1HO8A 4F6RD 4KBQA 5D66A 3QNKA 1HFAA 5BPPA 4WWNA 4U0ZA 1IHBA 2YHCA 4FULA 1UN9A 3UMVA 2C0MA 4YDOA 5A7DB 2VJ8A 4HOTA 3MKRA 4PH4B 2ZGDA 5ENPD 4ILGA 3Q5MA 3CQGB 4EZJA 3C5RA 4XI0A 1KZPA 3Q9UC 4OYSA 2GRLA 4UI9J 3FTSA 3FH7A 3ONKA 3LCAA 5M72A 1OCRE 2WXHA 2DYRE 2HE0A 4GTPA 4AM9A 1TN6A 1NL4A 3UQ3A 1QNFA 3TAXA 1OWNA 4XIFA 1SZAA 2P58C 4CGVA 3L22A 3ZN3A 1K1AA 1SZ9A 1E8ZA 2WMNA 3EIJA 1H19A 5HS0A 4LNUD 5FQ7A 5AENA 5JHBA 3QOUA 5JJ6A 2JEKA 3KSLA 2XHEA 3R7RA 4GTSA 4GA0A 2J07A 4CZ2D 4ANUA 2UY1A 4J8FA 2ZXWE 4J8DA 2FULA 1H6PA 4G11A 4LNBA 5FZSA 3CKBA 3GZSA 4QFVA 3HHMA 3RO2A 4RSYA 3KSQA 4F3VA 4A3VA 4G2VA 4JXTA 4GZCA 3RO3A 4A3TA 3MV3B 3JUEA 5JA4D 3UXGA 2KBXA 3UUXA 3JUIA 1N52A 2J4DA 4L9PA 1KPSB 4U8HA 4WNFA 4A1GA 5LP0A 3G2VA 3FU5A 3LY8A 2YHEA 4JL0A 4J7WA 3ONLA 4JD2G 3L13A 2FI7A 4HB5A 3Q15A 4UUCA 3NBNB 1NZNA 2J9QA 2FEZA 2V4HC 3OXGA 3CVYA 4G26A 3PS6A 2GGFA 3G2SA 4MLPA 4I6EA 3QDNA 2XEEA 4FJZA 2IFUA 2HR2A 3Q73A 2V0PA 4WWPA 2VSYA 1YA0A 2QC9A 2ZISA 4J8EA 3PE4A 1D8DA 1TEZA 4GTMA 3ZXPA 2F8XK 4LERA 5AARA 3AU5A 4WAFA 3VTYA 3WG7E 1UN8A 5FT9A 5G04C 2ETCA 1MQSA 2M63A 2VGYA 4PS8A 5CMYA 4ZFHA 3SQVA 1E96B 2CFUA 1H2TC 4B8CB 1EYHA 1N0RA 3ZYKA 2Y0BG 4GTOA 2CG2A 3HVEB 4Y6CA 3BG1B 4Y6WA 3W9GA 4CGWA 2VYIA 3C98A 4A55A 3UM0A 4YVQC 3PDNA 2MYOA 5G55A 3WXXA 1INZA 2XZTG 2KATA 3P2BA 5CBOA 5CEAA 3HDXA 3VLFA 2XCBA 3FTYA 3SBTB 1YYHA 2EIKE 1HXIA 3UKUG 2XPZA 5AJLA 5CEDB 3ZPJA 1V55E 3SFZA 5ANLA 1WM5A 2LAHA 1NA0A 1BI7B 2WXKA 4FHJA 3DSTA 3SO8A 5LX8A 2R03A 4XEIG 5CRVA 3NOGD 1JWGA 1QQEA 2OV8A 3UX4A 2R59A 5LFAA 3HXFA 4B94A 1ZB1A 3ASFA 5T8IA 4BWRA 4JEHA 3PREA 4F7AA 3UI2A 3L17A 3ZHEB 2XEVA 3FUIA 1HH8A 3UIPC 5G2NA 1EF1C 2VGXB 3VLEA 3EU5A 1IYGA 1ELRA 4V3IA 3R7QA 4GPKA 3GZ2A 5C1DA 3IEGA 4GYWA 2IF4A 5AQBA 3Q75A 4JA7A 1IKND 2IO2C 2P9NG 3IHYA 1Z6TA 1TNYA 3V2XA 4Q96A 3ZGQA 5KNHD 1H0AA 2LXLA 2OCCE 1FPPA 4JW1A 2P9SG 4N5CA 5D2MC 3LXUX 4Z68A 3TGOA 2KCLA 2WM9A 3D3MA 3DSSA 1D9SA 2P9IG 2DVWA 4LUNU 2EIME 4TUUA 5AIJA 5BV1A 4FLHA 5EX0A 2NC9A 1OUVA 3DPYA 4LNGA 1A5EA 3FEXA 3APFA 1DVPA 2NXPA 2V8SE 4JC8A 2XPIA 3CVVA 1LF8A 3C3RA 5ARGA 3FTUA 4JVSA 4DI3A 3FTWA 4N2QA 1GW6A 2IOSA 4GMRA 3ASOE 3ZFWA 4KXKB 4U7EB 4I1AA 3S7DA 3C72A 1BLXB 4DRXE 2KCVA 4I43A 2IJGX 2Y69E 3CLJA 2YQ8A 3MKQB 3UKRG 3JQ0A 4AEZC 1L5JA 4HOQA 1QYMA 3R9MA 3T9KA 2VGEA 3NF1A 1JWFA 4GTRA 3MA5A 4U0UA 2J4BA 2F0YA 4N5QA 3V31A 2AXUA 3B13A 3MEKA 1N4PA 2XRYA 2L0IA 2FF4A 4O1PA 3HXEA 3AU4A 4HI9A 3PUKA 1S0PA 3AS8A 3FY4A 5ENOD 2OVBA 5EILA 3U66A 2DCPA 2LAIA 1OWPA 5EIDA 4ILIA 4E6HA 2ONDA 2AW6A 3RAUA 5AJDA 3CHQA 5E75A 5C2YA 1H2UA 4RG6A 4DLQA 1A17A 2XGOA 1TJCA 4FJYA 1MX6A 4NACA 2R02A 4KVOA 1DCQA 2KCKA 4UI9K 4HI8A 1BPOA 4HXIA 3DRAA 3HYMB 1TNBA 3LYAA 4U63A 4N3CA 1PY1A 2IOLA 3UPVA 3LS8A 3FEYA 4DX2A 1JUQA 1E8XA 1WAO1 5FJYA 2HM8A 4O6FA 4UWHA 2XGSA 3Q47B 5FQ4A 4Q94A 4HRNA 5KJNA 1OT8A 3CVQA 5CERB 5H7PA 4AOFA 5FQ8A 3R9AB 2WXLA 4ATZD 2KXPC 2L9BA 4UWLA 5LCWC 3KS2A 5BUZA 2C0LA 3FTVA 4ANVA 2CG3A 4XX5A 1LD7A 1BD8A 4WNEA 2GRQB 5EDSA 4PS7A 3TG5A 4M3OA 1SQMA 3FWVA 2QYUA 3D9KA
chains in the Genus database with same CATH topology
4B93B 2ZGGA 3TWWA 2V4HC 2F37A 3B95A 3C5RA 1D9SA 3ZUVB 1G3NB 2Y1LE 2P2CP 3TWTA 3Q9UC 4HRMB 2RFAA 4DX7D 2DVWA 5FIOA 2AJAA 4QQIA 5AN8A 2XENA 1OY3D 1SW6A 2XEEA 3ZU7B 5CEDB 3DEOA 4J8YA 1N0QA 2ETBA 3EU9A 5AQ7A 3B7BA 1MJ0A 1A5EA 4YDWA 4BESA 2A5EA 2ETAA 2HE0A 1MX6A 1BI7B 2QC9A 2XZDG 1WDYA 3TWXA 2XEHA 5EIBE 1DCQA 2J8SD 4CYMD 4HQDA 4HI8A 2F8XK 2F8YA 5ENTD 4LSZE 5AARA 5HRYA 3EHRA 1IXVA 2B0OE 3SO8A 4ZHBA 3ZNGA 3T8KA 5CBNA 3KEAA 5EYPF 1UOHA 4G8LA 1K1AA 3V30A 5AAOA 3LJNA 4GPMA 3W9FA 3J5PA 3NOGD 4K5CA 4O60A 5CECB 4DX5D 5AQAA 4DX6D 1N11A 2FO1E 4G8KA 3TWVA 4GMRA 2ETCA 3JXIA 5HS0A 2DZNA 4Z68A 4BEPA 1MX2A 4LNUD 4DX2A 1K3ZD 3IXEA 1AWCB 3ZKJA 3TWUA 4DUIA 3JXJA 4HBDA 3V2OA 1DC2A 4ZFHA 1BLXB 5JMND 3UI2A 5BXOA 5KWDA 3J5QB 2BKKB 4YDYA 4CZ2D 4DRXE 5ITZF 3EHQA 4BERA 4U96D 4LG6A 3HRAA 3TWQA 1N0RA 4DX1A 1MX4A 2Y0BG 5EYLA 3F6QA 5BXUA 4OAUC 5AQ9A 1YMPA 2V5QC 2DWZA 4RLYA 2DZOA 1BI8B 4A63B 4HRNA 3W9GA 1OT8A 1QYMA 1S70B 4HLLA 4QFVA 1YCSB 3T9KA 2JABA 2VGEA 3HG0D 4TUMA 5CERB 1K1BA 3Q9NC 1NFIE 4HNAD 1TR4A 2NYJA 4K5AB 3JUEA 2PNNA 5EN5D 5JA4D 4ATZD 2MYOA 4F6RD 5HKPA 3UXGA 2KXPC 2KBXA 4JB8P 4N5QA 5D66A 5ENRD 5KNGA 2XZTG 3V79K 4OAVB 3V31A 2L6BA 4BETA 1MYOA 4U95D 2RFMA 4HRLA 5AQBA 1IHBA 4BSZB 1SVXA 1IKND 3UTMA 4C48B 1AP7A 3NOCD 1BD8A 5CBOA 5CEAA 3TWSA 2QYJA 4K5BA 3AAAC 3V2XA 4O1PA 4F1PA 5ENQD 4HI9A 5KNHD 1BU9A 3D9HA 1YYHA 4J7WA 5ENSD 5KBAA 1WG0A 4O1OA 5ENOD 2BKGA 4HB5A 4U8VD 5EILA 2ZGDA 4UUCA 5FINA 3AJIA 3TWRA 5ENPD 5EIDA 3NBNB 4NIKA 4U8YD 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B93 B;  2ZGG A;  3TWW A;  2V4H C;  2F37 A;  3B95 A;  3C5R A;  1D9S A;  3ZUV B;  1G3N B;  2Y1L E;  2P2C P;  3TWT A;  3Q9U C;  4HRM B;  2RFA A;  4DX7 D;  2DVW A;  5FIO A;  2AJA A;  4QQI A;  5AN8 A;  2XEN A;  1OY3 D;  1SW6 A;  2XEE A;  3ZU7 B;  5CED B;  3DEO A;  4J8Y A;  1N0Q A;  2ETB A;  3EU9 A;  5AQ7 A;  3B7B A;  1MJ0 A;  1A5E A;  4YDW A;  4BES A;  2A5E A;  2ETA A;  2HE0 A;  1MX6 A;  1BI7 B;  2QC9 A;  2XZD G;  1WDY A;  3TWX A;  2XEH A;  5EIB E;  1DCQ A;  2J8S D;  4CYM D;  4HQD A;  4HI8 A;  2F8X K;  2F8Y A;  5ENT D;  4LSZ E;  5AAR A;  5HRY A;  3EHR A;  1IXV A;  2B0O E;  3SO8 A;  4ZHB A;  3ZNG A;  3T8K A;  5CBN A;  3KEA A;  5EYP F;  1UOH A;  4G8L A;  1K1A A;  3V30 A;  5AAO A;  3LJN A;  4GPM A;  3W9F A;  3J5P A;  3NOG D;  4K5C A;  4O60 A;  5CEC B;  4DX5 D;  5AQA A;  4DX6 D;  1N11 A;  2FO1 E;  4G8K A;  3TWV A;  4GMR A;  2ETC A;  3JXI A;  5HS0 A;  2DZN A;  4Z68 A;  4BEP A;  1MX2 A;  4LNU D;  4DX2 A;  1K3Z D;  3IXE A;  1AWC B;  3ZKJ A;  3TWU A;  4DUI A;  3JXJ A;  4HBD A;  3V2O A;  1DC2 A;  4ZFH A;  1BLX B;  5JMN D;  3UI2 A;  5BXO A;  5KWD A;  3J5Q B;  2BKK B;  4YDY A;  4CZ2 D;  4DRX E;  5ITZ F;  3EHQ A;  4BER A;  4U96 D;  4LG6 A;  3HRA A;  3TWQ A;  1N0R A;  4DX1 A;  1MX4 A;  2Y0B G;  5EYL A;  3F6Q A;  5BXU A;  4OAU C;  5AQ9 A;  1YMP A;  2V5Q C;  2DWZ A;  4RLY A;  2DZO A;  1BI8 B;  4A63 B;  4HRN A;  3W9G A;  1OT8 A;  1QYM A;  1S70 B;  4HLL A;  4QFV A;  1YCS B;  3T9K A;  2JAB A;  2VGE A;  3HG0 D;  4TUM A;  5CER B;  1K1B A;  3Q9N C;  1NFI E;  4HNA D;  1TR4 A;  2NYJ A;  4K5A B;  3JUE A;  2PNN A;  5EN5 D;  5JA4 D;  4ATZ D;  2MYO A;  4F6R D;  5HKP A;  3UXG A;  2KXP C;  2KBX A;  4JB8 P;  4N5Q A;  5D66 A;  5ENR D;  5KNG A;  2XZT G;  3V79 K;  4OAV B;  3V31 A;  2L6B A;  4BET A;  1MYO A;  4U95 D;  2RFM A;  4HRL A;  5AQB A;  1IHB A;  4BSZ B;  1SVX A;  1IKN D;  3UTM A;  4C48 B;  1AP7 A;  3NOC D;  1BD8 A;  5CBO A;  5CEA A;  3TWS A;  2QYJ A;  4K5B A;  3AAA C;  3V2X A;  4O1P A;  4F1P A;  5ENQ D;  4HI9 A;  5KNH D;  1BU9 A;  3D9H A;  1YYH A;  4J7W A;  5ENS D;  5KBA A;  1WG0 A;  4O1O A;  5ENO D;  2BKG A;  4HB5 A;  4U8V D;  5EIL A;  2ZGD A;  4UUC A;  5FIN A;  3AJI A;  3TWR A;  5ENP D;  5EID A;  3NBN B;  4NIK A;  4U8Y D;  3DEP A; 
#chains in the Genus database with same CATH topology
 2R2L A;  3L16 A;  2F37 A;  2IY0 C;  3CK8 A;  5G05 J;  1G3N B;  1OWL A;  4CRW A;  3T8M A;  2AJA A;  3UM3 A;  4BT9 A;  5EX3 A;  1N0Q A;  3EU9 A;  5AQ7 A;  4H7X A;  4AIF A;  3DXK G;  4N2S A;  4C0M A;  3VLD A;  1KZO A;  5EIB E;  1OWM A;  3FU6 A;  1K8K G;  2AVP A;  3ZRH A;  2B0O E;  3TG4 A;  4UWF A;  4KZC A;  3SGH A;  2PM7 A;  3J5P A;  4URK A;  3PRZ A;  3U3W A;  2VSO E;  1KT1 A;  2L0T B;  3IXE A;  2DIW A;  3JXJ A;  2E2E A;  5JMN D;  4BX8 A;  2QZA A;  4XKC A;  4LG6 A;  1N54 A;  3F6Q A;  4OAU C;  1YMP A;  4DLO A;  4B0Z A;  3ZW3 A;  1HE8 A;  2IEJ A;  2LXM A;  2ZIR A;  4M7C A;  4AY5 A;  3DXM G;  4K5A B;  2WXF A;  3SY2 A;  4F1S A;  3RKV A;  4J0U A;  2X6H A;  1V54 E;  2IO3 C;  1KLX A;  3APC A;  1UG3 A;  4U95 D;  4EQF A;  3PEU B;  4EZK A;  5AYW D;  4C48 B;  1MHQ A;  4GU5 A;  4IN3 B;  3S7F A;  2CFZ A;  5E76 A;  2GRO B;  2RG8 A;  2I1J A;  2VSN A;  3AS4 A;  4NIK A;  3DBS A;  3DEP A;  5BT1 A;  4GZD A;  5ARF A;  3ULY A;  2XQ0 A;  2WQH A;  4NUR A;  4LRZ A;  1XNF A;  2KZT B;  4FHK A;  2XEN A;  3ZU7 B;  3CSF A;  1MJ0 A;  1H6K A;  2B6C A;  4I1M A;  5BNW A;  1H2V C;  3ASG A;  1ELK A;  1HG2 A;  3T5X A;  4DPR A;  3SZ7 A;  3K9I A;  1ZBP A;  2H6G A;  4GTT A;  5EKQ D;  5EYP F;  3PH0 C;  3PZ4 A;  4G8L A;  4I17 A;  3CV0 A;  2EIJ E;  1OCO E;  4K03 A;  5D0Q D;  5AQA A;  2DZN A;  3AG2 E;  1FT1 A;  1W3B A;  4GAA A;  3J5Q B;  3FTZ A;  4YDY A;  4Q69 A;  4FU3 A;  4FLB A;  1MX4 A;  3DSU A;  5BXU A;  4HOR A;  2DWZ A;  3Q79 A;  4BT8 A;  2WXI A;  3HXD A;  5DBK A;  1D8E A;  4KVM A;  4JB8 P;  2L6B A;  3NZU A;  2OVF A;  4GTQ A;  3ENE A;  3QC1 A;  3SFY A;  2EQX A;  3HVE A;  4IUL A;  3FU3 A;  3TWW A;  3JQ1 A;  4I6G A;  3FUJ A;  4RQI A;  4XI9 A;  2E0I A;  2DBA A;  3UM1 A;  4J8Y A;  2A4Z A;  3ULQ A;  5BW8 C;  2P9U G;  2BF0 X;  2J8S D;  4CYM D;  2AWI A;  3L82 A;  3KEZ A;  3TXN A;  3SFX A;  2AXV A;  1XGW A;  4I2Z A;  1UOH A;  3DSV A;  5ENN A;  5FTP A;  4DX5 D;  4NRH B;  2KC7 A;  3UT4 A;  4EBA G;  2P9L G;  4AP2 A;  4R7L A;  3O48 A;  4HBD A;  3EUV A;  3CHP A;  1DC2 A;  3FHE A;  1UJJ A;  2JLB A;  1FT2 A;  4YDE A;  2YIN A;  1QBQ A;  2KM4 A;  3QWV A;  1SA5 A;  1RZ4 A;  2HO1 A;  4PDX A;  3UIN C;  5T4Y A;  4W9R A;  3AG4 E;  2LSU A;  3MCX A;  3NQP A;  3ZEF A;  3IHV A;  1U3C A;  3DSW A;  3EDT B;  4G23 A;  5G04 J;  4OAV B;  1H6O A;  3B7U X;  3MJW A;  4BET A;  2PM6 A;  2ZU6 B;  4MKT A;  4UQX A;  1AP7 A;  3FUL A;  1EPU A;  3AAA C;  3MYV A;  3BU8 A;  1N9A A;  2BED A;  3PE3 A;  1BU9 A;  1QZ2 A;  1OCC E;  2GRP B;  3ZHE A;  4ME2 A;  4HOS A;  4N3B A;  2VQ2 A;  1IQU A;  3AG3 E;  1TN8 A;  3QWW A;  3RK6 A;  1JCQ A;  3ZUV B;  4I1O B;  3T5V A;  4KMO A;  4G24 A;  3CQC B;  1P5Q A;  2A5E A;  4I2W A;  4HQD A;  1LTX A;  4AJW A;  2F8Y A;  3CST A;  2H6F A;  3ZNG A;  3CGH A;  3KEA A;  4HOU A;  3AS5 A;  3JXI A;  4U0S A;  2GW1 A;  3TWU A;  4CT0 A;  1NP7 A;  5CCM A;  2BKK B;  4FC8 A;  3E32 A;  3CVW A;  5AQ9 A;  4TXR A;  3DWL G;  3TL5 A;  2MHK A;  3LPZ A;  3C3Q A;  2XPY A;  3V79 K;  3DSX A;  3FUD A;  2WVI A;  3UTM A;  3ASH A;  1TNZ A;  4ACL A;  2LO6 A;  3ZVV A;  5B1B E;  3D9O A;  4WND A;  3AJI A;  2WXO A;  3MKQ A;  1FVF A;  4CDR A;  1TNO A;  3E4B A;  3CEQ A;  5FWQ A;  2P2C P;  2PL2 A;  3FH8 A;  1N4Q A;  4HRM B;  1PAQ A;  1E8Y A;  4TXP A;  4A1S A;  3ZIM A;  4L1B A;  4YDW A;  4H7Y A;  1IQR A;  2OEW A;  4HS2 A;  4K0R A;  4CEM A;  2X6F A;  3EHR A;  1IXV A;  3L54 A;  4XKB A;  4L2L A;  3RRU A;  3W9F A;  3BUA A;  2V4L A;  4APF A;  2X6J A;  2YNQ A;  4BFR A;  3ZKJ A;  5JHA A;  4DUI A;  4ABN A;  4AV7 A;  3ULE G;  5BXO A;  4GA1 A;  5ITZ F;  4BER A;  1LD8 A;  2MRI A;  3HRA A;  3TWQ A;  4GML A;  2GRN B;  3EIQ C;  4RLY A;  3L9T A;  2A5U A;  1S70 B;  1ZU2 A;  2JAB A;  4HNA D;  3APD A;  3ZYQ A;  1TR4 A;  2NYJ A;  2WMO A;  4UI9 C;  4FP7 A;  3G2T A;  4C0E A;  1HU3 A;  5T3R A;  4BTA A;  4B8A A;  3B7S A;  3LVQ E;  4JHJ A;  2RFM A;  4HRL A;  1E7V A;  2ILR A;  4J6I A;  1HZ4 A;  4F1P A;  3FUK A;  1OXJ A;  3D9H A;  4LEU A;  1Y6I A;  2L6J A;  3TWR A;  2H6I A;  3FUH A;  1S64 A;  4U8Y D;  5HI7 A;  2HYZ A;  4N3A A;  2OOE A;  5B1A E;  5J90 A;  3PNL B;  2R5S A;  3CVP A;  3ML9 A;  3OXL A;  3TWT A;  4EEC A;  4DX7 D;  2MOW A;  2R05 A;  5FIO A;  1SW6 A;  2OEV A;  3S7J A;  4B89 A;  2CHZ A;  1HG5 A;  2J08 A;  1O1T A;  4I9C A;  2VTB B;  2XEH A;  3ASN E;  1X5B A;  2XS8 A;  2GRR B;  3CR3 A;  3S2A A;  3CVN A;  2EIL E;  4HFG A;  4KT6 B;  5CBN A;  4LCT A;  4RG9 A;  3LJN A;  2X6K A;  4K5C A;  2LNI A;  2NSZ A;  3BG0 B;  4ATG A;  3LEW A;  3EHN A;  3E30 A;  1AWC B;  3V2O A;  4UQY A;  3EHQ A;  4U96 D;  3ABL E;  5CHE E;  2LSV A;  3EHM A;  3CVL A;  4DK5 A;  3D9P A;  3CHM A;  3MX3 A;  3Q9N C;  3CHR A;  4OVV A;  4RVB A;  4JHR A;  4APO A;  5A23 A;  2Q7F A;  2ION A;  4XZ4 A;  4GZ5 A;  3UIO C;  3PZ3 A;  1MYO A;  3QK0 A;  3PNT B;  5IY5 E;  2V5F A;  1N4R A;  5ENQ D;  3Q7F A;  1U2V G;  4U8V D;  3PZ2 A;  4UWG A;  3CHO A;  2RKK A;  1E90 A;  4GTV A;  2J09 A;  4U04 A;  1EDU A;  4TXQ A;  3FFL A;  2Y1L E;  3CK9 A;  2RFA A;  3I5P A;  5FZQ A;  3RSE G;  3BQO A;  4UQZ A;  2UY1 B;  4D10 C;  2I2O A;  3EJN A;  5LCW J;  3QAR A;  5CCL A;  1JPL A;  1UW4 B;  5KJL A;  4GMJ A;  4LSZ E;  4BY6 A;  4C9B B;  4ZHB A;  3RU0 A;  3Q4A B;  2H6H A;  1TNU A;  3RRN B;  5AAO A;  4GPM A;  3PVL A;  2FO1 E;  4G8K A;  4EHM A;  1U3D A;  3E33 A;  4BEP A;  1OCZ E;  1K3Z D;  4PS3 A;  2KZT A;  3CVU A;  4G1T A;  2XCC A;  3FU0 A;  3ZYL A;  4TRQ A;  2V5Q C;  2J49 A;  1S63 A;  4A63 B;  3SF4 A;  3NB2 A;  4AVX A;  2WXM A;  1DNP A;  1FVH A;  4BX9 A;  2PNN A;  5EN5 D;  2Y4T A;  3ABM E;  3ML8 A;  5ENR D;  5KNG A;  4IRU A;  3QKY A;  1PC2 A;  4BSZ B;  5KJM A;  3FDH A;  3TWS A;  4K5B A;  5KCM A;  4GCN A;  3I4G A;  2FBN A;  5FIN A;  1HF8 A;  4B93 B;  3D9L A;  2GRM A;  3S7B A;  3X2Q E;  3D9N A;  2PQN A;  3OTN A;  3L6A A;  3VTX A;  5AN8 A;  4WNG A;  1FCH A;  3URZ A;  2WXP A;  4BES A;  1N95 A;  2CHW A;  1UJK A;  2XZD G;  1WDY A;  3PZD A;  3SHF A;  1DCE A;  1Z5S C;  5HRY A;  3FH5 A;  3LKU A;  3ZXS A;  3T8K A;  2BTD A;  2I9C A;  3RRM B;  3P1U A;  1N11 A;  3HIZ A;  1N4S A;  1N94 A;  3TJP A;  1MZC A;  4P29 A;  3UT8 A;  5KWD A;  1IHG A;  5DIZ A;  5A6C A;  5ANR A;  4GYY A;  4EPZ A;  5HQ8 A;  4OVU A;  3GW4 A;  3PUJ A;  1Z3X A;  1O5M A;  4I9E A;  2AXZ A;  3QJZ A;  4L7T A;  5B3S E;  1NI1 A;  3Q7A A;  4WUY A;  3CIA A;  2X3M A;  3AG1 E;  3ASD A;  3NOC D;  4ANW A;  3G2U A;  3IBE A;  3HXC A;  5KBA A;  1VDY A;  2WXR A;  3SNX A;  3QWP A;  2Y3A A;  2CHX A;  2XS1 A;  2XRZ A;  1JCS A;  4FAD A;  4EBA A;  1E8W A;  4EZL A;  2FO7 A;  3B95 A;  5CRU A;  1ELW A;  1NA3 A;  3FUN A;  3SD5 A;  2ETB A;  3B7B A;  5CMW A;  4GA2 A;  3QAQ A;  4IYP A;  4L23 A;  2Y4U A;  4BTB A;  1Y8M A;  2VGX A;  5ENT D;  1HX8 A;  3U9W A;  4AXH A;  5JJT A;  3UT7 A;  2EIN E;  4O60 A;  3ZYM A;  1KT0 A;  4XE0 A;  3CVX A;  3FUF A;  3TWV A;  1MX2 A;  3B7T A;  1TYQ G;  3GZ1 A;  4E85 A;  3O4Z A;  4CDM A;  3MV2 B;  1OWO A;  3I4R B;  4CCA A;  1O1R A;  4YVO A;  2C2L A;  3JCK C;  4KZ0 A;  3DPD A;  2WQ7 A;  4DX1 A;  2IQC A;  2P9K G;  2QY7 A;  5EYL A;  2WPV A;  4ACK A;  3LY7 A;  1BI8 B;  4L2Y A;  1Q2Z A;  1X81 A;  1NFI E;  3RIB A;  1Z3Y A;  2WXG A;  4GZ6 A;  4KYO B;  4GB9 A;  2WB2 A;  4ANX A;  3KD7 A;  2WXQ A;  2UWJ G;  2WXN A;  2WXJ A;  1TJF A;  3KAE A;  3B7R L;  3U64 A;  1WG0 A;  4O1O A;  3FUM A;  5BV0 A;  4CDN A;  4J8S A;  4F53 A;  4DJA A;  3TXM A;  2ZGG A;  2P9P G;  2X6I A;  3MZL B;  3CHS A;  3SBS A;  5D0O D;  3DEO A;  5J08 A;  4DI4 A;  3MGB A;  4JPS A;  4MBG A;  3L08 A;  3E37 A;  4JHK A;  4I6J A;  5LOZ A;  3LVR E;  2R17 C;  2I6H A;  4PUC A;  2PZI A;  3Q49 B;  1TN7 A;  3LY9 A;  3ESL A;  3V30 A;  4BSX A;  2DYS E;  4DX6 D;  4YND A;  3N71 A;  1E7U A;  3NZS A;  3U4T A;  2VSX E;  3G2W A;  3E34 A;  3IV0 A;  3BEE A;  4JZY A;  3CKC A;  4ILH B;  3OXF A;  1B89 A;  3C3O A;  5JJ7 A;  3D9I A;  2DZO A;  3RJV A;  2X38 A;  4HLL A;  1YCS B;  5G05 C;  4TUM A;  3SI5 A;  3D9M A;  5HKP A;  1SA4 A;  3LJ3 A;  4GYO A;  4HVB A;  4UWK A;  3FTX A;  1SVX A;  4G25 A;  4MS6 A;  2QYJ A;  3Q78 A;  4U07 A;  5KJK A;  5ENS D;  2BKG A;  4MRU A;  3PEV B;  4WWO A;  3QB2 A;  3FP3 A;  5FQ6 A;  4NQ0 A;  4QQI A;  1OY3 D;  4JA9 A;  3NAW A;  2WQ6 A;  3PZ1 A;  4TV3 A;  2ETA A;  3HXB A;  3TWX A;  3GYZ A;  1RW2 A;  1HS6 A;  2IU1 A;  2LUH A;  3I3N A;  1JCR A;  3OAW A;  5CEC B;  3JYS A;  3CK7 A;  3ISM C;  3ABK E;  4FA6 A;  5FZR A;  2BUG A;  2PQR A;  3ESK A;  4HLE A;  4GCO A;  2RD0 A;  1O1S A;  2I1K A;  2VTB A;  4CT4 A;  3D9J A;  4JEU A;  3LDZ A;  3UM2 A;  4AY6 A;  3HG0 D;  3FUE A;  1K1B A;  2XGM A;  1WY6 A;  4N39 A;  4GZ3 A;  3IKO B;  4X8Q A;  2QFC A;  1HO8 A;  4F6R D;  4KBQ A;  5D66 A;  3QNK A;  1HFA A;  5BPP A;  4WWN A;  4U0Z A;  1IHB A;  2YHC A;  4FUL A;  1UN9 A;  3UMV A;  2C0M A;  4YDO A;  5A7D B;  2VJ8 A;  4HOT A;  3MKR A;  4PH4 B;  2ZGD A;  5ENP D;  4ILG A;  3Q5M A;  3CQG B;  4EZJ A;  3C5R A;  4XI0 A;  1KZP A;  3Q9U C;  4OYS A;  2GRL A;  4UI9 J;  3FTS A;  3FH7 A;  3ONK A;  3LCA A;  5M72 A;  1OCR E;  2WXH A;  2DYR E;  2HE0 A;  4GTP A;  4AM9 A;  1TN6 A;  1NL4 A;  3UQ3 A;  1QNF A;  3TAX A;  1OWN A;  4XIF A;  1SZA A;  2P58 C;  4CGV A;  3L22 A;  3ZN3 A;  1K1A A;  1SZ9 A;  1E8Z A;  2WMN A;  3EIJ A;  1H19 A;  5HS0 A;  4LNU D;  5FQ7 A;  5AEN A;  5JHB A;  3QOU A;  5JJ6 A;  2JEK A;  3KSL A;  2XHE A;  3R7R A;  4GTS A;  4GA0 A;  2J07 A;  4CZ2 D;  4ANU A;  2UY1 A;  4J8F A;  2ZXW E;  4J8D A;  2FUL A;  1H6P A;  4G11 A;  4LNB A;  5FZS A;  3CKB A;  3GZS A;  4QFV A;  3HHM A;  3RO2 A;  4RSY A;  3KSQ A;  4F3V A;  4A3V A;  4G2V A;  4JXT A;  4GZC A;  3RO3 A;  4A3T A;  3MV3 B;  3JUE A;  5JA4 D;  3UXG A;  2KBX A;  3UUX A;  3JUI A;  1N52 A;  2J4D A;  4L9P A;  1KPS B;  4U8H A;  4WNF A;  4A1G A;  5LP0 A;  3G2V A;  3FU5 A;  3LY8 A;  2YHE A;  4JL0 A;  4J7W A;  3ONL A;  4JD2 G;  3L13 A;  2FI7 A;  4HB5 A;  3Q15 A;  4UUC A;  3NBN B;  1NZN A;  2J9Q A;  2FEZ A;  2V4H C;  3OXG A;  3CVY A;  4G26 A;  3PS6 A;  2GGF A;  3G2S A;  4MLP A;  4I6E A;  3QDN A;  2XEE A;  4FJZ A;  2IFU A;  2HR2 A;  3Q73 A;  2V0P A;  4WWP A;  2VSY A;  1YA0 A;  2QC9 A;  2ZIS A;  4J8E A;  3PE4 A;  1D8D A;  1TEZ A;  4GTM A;  3ZXP A;  2F8X K;  4LER A;  5AAR A;  3AU5 A;  4WAF A;  3VTY A;  3WG7 E;  1UN8 A;  5FT9 A;  5G04 C;  2ETC A;  1MQS A;  2M63 A;  2VGY A;  4PS8 A;  5CMY A;  4ZFH A;  3SQV A;  1E96 B;  2CFU A;  1H2T C;  4B8C B;  1EYH A;  1N0R A;  3ZYK A;  2Y0B G;  4GTO A;  2CG2 A;  3HVE B;  4Y6C A;  3BG1 B;  4Y6W A;  3W9G A;  4CGW A;  2VYI A;  3C98 A;  4A55 A;  3UM0 A;  4YVQ C;  3PDN A;  2MYO A;  5G55 A;  3WXX A;  1INZ A;  2XZT G;  2KAT A;  3P2B A;  5CBO A;  5CEA A;  3HDX A;  3VLF A;  2XCB A;  3FTY A;  3SBT B;  1YYH A;  2EIK E;  1HXI A;  3UKU G;  2XPZ A;  5AJL A;  5CED B;  3ZPJ A;  1V55 E;  3SFZ A;  5ANL A;  1WM5 A;  2LAH A;  1NA0 A;  1BI7 B;  2WXK A;  4FHJ A;  3DST A;  3SO8 A;  5LX8 A;  2R03 A;  4XEI G;  5CRV A;  3NOG D;  1JWG A;  1QQE A;  2OV8 A;  3UX4 A;  2R59 A;  5LFA A;  3HXF A;  4B94 A;  1ZB1 A;  3ASF A;  5T8I A;  4BWR A;  4JEH A;  3PRE A;  4F7A A;  3UI2 A;  3L17 A;  3ZHE B;  2XEV A;  3FUI A;  1HH8 A;  3UIP C;  5G2N A;  1EF1 C;  2VGX B;  3VLE A;  3EU5 A;  1IYG A;  1ELR A;  4V3I A;  3R7Q A;  4GPK A;  3GZ2 A;  5C1D A;  3IEG A;  4GYW A;  2IF4 A;  5AQB A;  3Q75 A;  4JA7 A;  1IKN D;  2IO2 C;  2P9N G;  3IHY A;  1Z6T A;  1TNY A;  3V2X A;  4Q96 A;  3ZGQ A;  5KNH D;  1H0A A;  2LXL A;  2OCC E;  1FPP A;  4JW1 A;  2P9S G;  4N5C A;  5D2M C;  3LXU X;  4Z68 A;  3TGO A;  2KCL A;  2WM9 A;  3D3M A;  3DSS A;  1D9S A;  2P9I G;  2DVW A;  4LUN U;  2EIM E;  4TUU A;  5AIJ A;  5BV1 A;  4FLH A;  5EX0 A;  2NC9 A;  1OUV A;  3DPY A;  4LNG A;  1A5E A;  3FEX A;  3APF A;  1DVP A;  2NXP A;  2V8S E;  4JC8 A;  2XPI A;  3CVV A;  1LF8 A;  3C3R A;  5ARG A;  3FTU A;  4JVS A;  4DI3 A;  3FTW A;  4N2Q A;  1GW6 A;  2IOS A;  4GMR A;  3ASO E;  3ZFW A;  4KXK B;  4U7E B;  4I1A A;  3S7D A;  3C72 A;  1BLX B;  4DRX E;  2KCV A;  4I43 A;  2IJG X;  2Y69 E;  3CLJ A;  2YQ8 A;  3MKQ B;  3UKR G;  3JQ0 A;  4AEZ C;  1L5J A;  4HOQ A;  1QYM A;  3R9M A;  3T9K A;  2VGE A;  3NF1 A;  1JWF A;  4GTR A;  3MA5 A;  4U0U A;  2J4B A;  2F0Y A;  4N5Q A;  3V31 A;  2AXU A;  3B13 A;  3MEK A;  1N4P A;  2XRY A;  2L0I A;  2FF4 A;  4O1P A;  3HXE A;  3AU4 A;  4HI9 A;  3PUK A;  1S0P A;  3AS8 A;  3FY4 A;  5ENO D;  2OVB A;  5EIL A;  3U66 A;  2DCP A;  2LAI A;  1OWP A;  5EID A;  4ILI A;  4E6H A;  2OND A;  2AW6 A;  3RAU A;  5AJD A;  3CHQ A;  5E75 A;  5C2Y A;  1H2U A;  4RG6 A;  4DLQ A;  1A17 A;  2XGO A;  1TJC A;  4FJY A;  1MX6 A;  4NAC A;  2R02 A;  4KVO A;  1DCQ A;  2KCK A;  4UI9 K;  4HI8 A;  1BPO A;  4HXI A;  3DRA A;  3HYM B;  1TNB A;  3LYA A;  4U63 A;  4N3C A;  1PY1 A;  2IOL A;  3UPV A;  3LS8 A;  3FEY A;  4DX2 A;  1JUQ A;  1E8X A;  1WAO 1;  5FJY A;  2HM8 A;  4O6F A;  4UWH A;  2XGS A;  3Q47 B;  5FQ4 A;  4Q94 A;  4HRN A;  5KJN A;  1OT8 A;  3CVQ A;  5CER B;  5H7P A;  4AOF A;  5FQ8 A;  3R9A B;  2WXL A;  4ATZ D;  2KXP C;  2L9B A;  4UWL A;  5LCW C;  3KS2 A;  5BUZ A;  2C0L A;  3FTV A;  4ANV A;  2CG3 A;  4XX5 A;  1LD7 A;  1BD8 A;  4WNE A;  2GRQ B;  5EDS A;  4PS7 A;  3TG5 A;  4M3O A;  1SQM A;  3FWV A;  2QYU A;  3D9K A; 
#chains in the Genus database with same CATH homology
 4B93 B;  2ZGG A;  3TWW A;  2V4H C;  2F37 A;  3B95 A;  3C5R A;  1D9S A;  3ZUV B;  1G3N B;  2Y1L E;  2P2C P;  3TWT A;  3Q9U C;  4HRM B;  2RFA A;  4DX7 D;  2DVW A;  5FIO A;  2AJA A;  4QQI A;  5AN8 A;  2XEN A;  1OY3 D;  1SW6 A;  2XEE A;  3ZU7 B;  5CED B;  3DEO A;  4J8Y A;  1N0Q A;  2ETB A;  3EU9 A;  5AQ7 A;  3B7B A;  1MJ0 A;  1A5E A;  4YDW A;  4BES A;  2A5E A;  2ETA A;  2HE0 A;  1MX6 A;  1BI7 B;  2QC9 A;  2XZD G;  1WDY A;  3TWX A;  2XEH A;  5EIB E;  1DCQ A;  2J8S D;  4CYM D;  4HQD A;  4HI8 A;  2F8X K;  2F8Y A;  5ENT D;  4LSZ E;  5AAR A;  5HRY A;  3EHR A;  1IXV A;  2B0O E;  3SO8 A;  4ZHB A;  3ZNG A;  3T8K A;  5CBN A;  3KEA A;  5EYP F;  1UOH A;  4G8L A;  1K1A A;  3V30 A;  5AAO A;  3LJN A;  4GPM A;  3W9F A;  3J5P A;  3NOG D;  4K5C A;  4O60 A;  5CEC B;  4DX5 D;  5AQA A;  4DX6 D;  1N11 A;  2FO1 E;  4G8K A;  3TWV A;  4GMR A;  2ETC A;  3JXI A;  5HS0 A;  2DZN A;  4Z68 A;  4BEP A;  1MX2 A;  4LNU D;  4DX2 A;  1K3Z D;  3IXE A;  1AWC B;  3ZKJ A;  3TWU A;  4DUI A;  3JXJ A;  4HBD A;  3V2O A;  1DC2 A;  4ZFH A;  1BLX B;  5JMN D;  3UI2 A;  5BXO A;  5KWD A;  3J5Q B;  2BKK B;  4YDY A;  4CZ2 D;  4DRX E;  5ITZ F;  3EHQ A;  4BER A;  4U96 D;  4LG6 A;  3HRA A;  3TWQ A;  1N0R A;  4DX1 A;  1MX4 A;  2Y0B G;  5EYL A;  3F6Q A;  5BXU A;  4OAU C;  5AQ9 A;  1YMP A;  2V5Q C;  2DWZ A;  4RLY A;  2DZO A;  1BI8 B;  4A63 B;  4HRN A;  3W9G A;  1OT8 A;  1QYM A;  1S70 B;  4HLL A;  4QFV A;  1YCS B;  3T9K A;  2JAB A;  2VGE A;  3HG0 D;  4TUM A;  5CER B;  1K1B A;  3Q9N C;  1NFI E;  4HNA D;  1TR4 A;  2NYJ A;  4K5A B;  3JUE A;  2PNN A;  5EN5 D;  5JA4 D;  4ATZ D;  2MYO A;  4F6R D;  5HKP A;  3UXG A;  2KXP C;  2KBX A;  4JB8 P;  4N5Q A;  5D66 A;  5ENR D;  5KNG A;  2XZT G;  3V79 K;  4OAV B;  3V31 A;  2L6B A;  4BET A;  1MYO A;  4U95 D;  2RFM A;  4HRL A;  5AQB A;  1IHB A;  4BSZ B;  1SVX A;  1IKN D;  3UTM A;  4C48 B;  1AP7 A;  3NOC D;  1BD8 A;  5CBO A;  5CEA A;  3TWS A;  2QYJ A;  4K5B A;  3AAA C;  3V2X A;  4O1P A;  4F1P A;  5ENQ D;  4HI9 A;  5KNH D;  1BU9 A;  3D9H A;  1YYH A;  4J7W A;  5ENS D;  5KBA A;  1WG0 A;  4O1O A;  5ENO D;  2BKG A;  4HB5 A;  4U8V D;  5EIL A;  2ZGD A;  4UUC A;  5FIN A;  3AJI A;  3TWR A;  5ENP D;  5EID A;  3NBN B;  4NIK A;  4U8Y D;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...