3V3XA

Nitroxide spin labels in protein gb1: n8/k28 double mutant
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein G
publication title High-resolution structure of a protein spin-label in a solvent-exposed beta-sheet and comparison with DEER spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 8
structure length 56
sequence length 56
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3v3xA00
5HHDG 1FD6A 4OZCA 2ZW0A 4HKZE 2J53A 1F2RI 2ZW1A 1K50A 4OZAA 2NMQA 1IGCA 5HI1A 1MHXA 4D2KA 4OZBA 2JSVX 5BMGA 1IBXA 1XCTL 4WH4A 3FILB 1FCCC 2RPVA 2I38A 1D4BA 1HZ5A 2ONQA 2PTLA 5BMHA 2KACA 1UWXA 2IGDA 1FCLA 1Q10A 2OEDA 1P7EA 2EELA 1KH0A 1EM7A 1YNTE 4KGRA 1K52A 1MPEA 1HZ6A 4GLSC 3GB1A 1K53A 1IGDA 1PGAA 2N7JA 3MP9A 2KQ4X 2JU6X 2JWUA 1C9FA 1YMHE 4IOIE 1F2RC 2QSDA 2IGGA 2ON8A 2JZPA 3FILA 2RMMA 1QKZA 2N9KA 4KGTA 4IKGA 1HEZE 1XF5L 2PW9A 2N9LA 3V3XA 2LHDA 1ZXHA 1IBXB 2KWDA 2KDMA 5BMIA 5HFYA 1GB1A 2PLPA 2JXTA 2LHEA 3UI3A 1XCQL 1GB4A 1MI0A 2GI9A 1P7FA 2KN4A 2LGIA 2GB1A 2LUMA 4HJGE 1MVKA 1K51A 1JMLA 2K0PA 1PGBA 1PGXA 1MHHE 2QMTA 4KGSA 4MACA 2IGHA 5JXVA 5HG2A 2J52A 2I2YA
chains in the Genus database with same CATH superfamily
4YTMB 4PS7A 1GG3A 1KM7A 4A90A 2J0MA 3N1XC 4W9KA 2MW5A 4JGHB 3NVZA 3KLSX 4N58A 3HRDD 1I4GA 3A9JA 4X57B 2FIDA 2V4LA 1SB3C 1XQQA 4KKIA 3APDA 4WQOB 1V80A 2RGFA 4HPPA 5D3DA 2KDFB 1FNWA 4J6IA 3RFZB 2N7DA 4WWOA 2KWUB 1FCLA 3L17A 1TBEA 1YNTE 4GDLB 1OQQA 2NPTB 3P63A 1QT9A 3AM9A 4XWTA 4GXBA 3ZXRA 4YSXB 4WJQA 4HCNB 2WHIA 3ZNID 3NS1A 4NQLB 3TCAA 3B2GA 3VAWA 2AX5A 3ENEA 1WYWB 5CHWA 4E74A 4S0RA 4MEMA 4ICVA 2LASA 1YMHE 2UU7A 4NPNA 4BOZB 1AWDA 2QSDA 1ZKHA 5AZFA 2ON8A 4A9AA 2KN5A 2WGSA 3ZJVA 3AV8A 2W9NA 1YD8U 2JX5A 2OHFA 1GJZA 2PPHA 5KHQA 3UQAA 2BS2B 1R4NB 2L7RA 3V6EB 3IAM1 1L6UA 2MCNB 1R4MI 2W55A 1NENB 5C23A 2LUMA 3EFCA 2KMCA 1LQBA 1TGZB 4BKTA 1RM6C 1SGHA 2K1FA 3BWUD 4MGYE 4GN1A 1FM0D 1TS2A 2V9HA 2L00B 3O13A 1ACCA 4JE3B 4NNJB 4OZCA 2CS4A 1PQSA 5JZEB 2N9XA 3B2FA 1K50A 5J2RA 4GIVA 2XK5A 3BK2A 5HI1A 1F1HA 4OVUA 3DVNU 3BVMA 3HVZA 4AWJA 3AE3B 2B3AA 4WAAA 2PE9A 3TEYA 1XLPA 2BYVE 1EF1A 2ZZPB 2GBKA 1MPEA 3N1ZC 3RZWC 4A20A 4IWOA 3DBHB 5G5HA 4KSLC 2JZ3B 1YX5B 3L54A 1RWSA 2HTHA 4MJSA 4IOIE 2DWQA 3AEDB 3GE8C 1E8YA 3W9CB 4ZHPA 4KV2A 2HD5B 2HE7A 3ZIMA 2DENB 2L0TA 3IFWB 5BO4B 4MDKE 4NJ6A 2QC8A 1D5XC 1KLUD 3PZ8A 1I4PA 4LDTD 3OJ4B 3AE8B 3AEGB 1JCKB 4RGTA 1VZ8A 1GB1A 3UINB 1FXTB 2NBUA 5LXIB 4XGAB 3ZTDA 4BFRA 4RFBA 4HWIB 3IHPC 2IYDB 2HJ1A 4USAA 4K7WA 3WIMA 2LXCA 5J17A 1UH6A 4RM9A 2CR5A 3SFDB 2O6VA 2DYBA 1WGHA 2NTTA 2EKIA 3S2AA 1L2NA 1ZP0B 3I63C 3VXWA 3R7RA 4DXAB 1F2RI 3ABVB 2RR9A 5AUKA 2Z8LA 2K6QA 4TV3A 3A1QB 2KFJA 5E6NA 5MPOA 4A3PA 4B9KA 2I38A 2IPKD 3R8BA 1JALA 5AZGA 4C56C 2PEAA 2IGDA 4W9JA 4OW0A 1KFYB 3R66C 3K9OB 1WR1A 2KKCA 4XX5A 2Y5PA 4EFOA 3WAPA 2INDC 2MBHA 3L16A 4JWUC 1C76A 3R2TA 1NBFC 2DYMA 3N1YC 3APCA 1UUPA 5IO9A 4LNKA 3B1LX 2ACZB 2KQ4X 2LMCA 4RH6A 5AEKB 1PDXA 3MTNB 4L1BA 4ANWA 1F0ZA 3ZVVA 2K6DB 3HK0A 2ASQA 4HDOA 1P9DU 4YTPB 1V81A 2G45B 1V9JA 1HE8A 2DAJA 3E9SA 1UZXB 2MBQA 3M3JA 2JYEA 4GMVA 3TEWA 3UQBA 2JXTA 3UI3A 1TS4A 2HDEA 2ZCCA 1MI0A 3PHWB 3ZNGC 3BVGA 3ZJUA 3DPDA 1N62A 3VTWA 4PT5A 4GSWA 4RM8A 1L7YA 2LJ5A 3C0RB 3A4RA 3CF6E 1HQRD 3T9LA 3N20C 1J7BA 1C4CA 3GZNB 2CKHB 4RCOA 2J53A 4WWNA 1WIAA 2JRHA 2MJEA 2BT6A 4MSQB 3PPAA 5FR3A 1T5XD 3Q3FA 5IKCM 2GRIA 4NQKE 3U4EG 1QOAA 2MQJA 3LB8C 3P4QB 3V62A 3SR6A 1D4BA 3RZFA 2KOXA 1KOTA 4LJPB 4IC7B 1V86A 1EU4A 1RFAA 1P7EA 2EELA 1OQYA 4BBNF 3NVYA 5LXHA 2LVPA 2JPHA 1H8CA 4KX6B 3DVGX 2BYEA 1QF6A 2ZPYA 2ZJDA 4M00A 2VZKD 2WXLA 4ARIA 3C8YA 2C9WB 3AE7B 1G6JA 2GBRA 3ALBA 1SEBD 4IM2A 4F8CB 2KXJA 4US9A 4MM3B 2R2OA 2FIFA 3JVZX 4A6QA 4DWFA 2AEHA 4KIKB 1V1PB 4LCDE 2FE8A 2JZZA 4G50A 2KX0A 5HFYA 3MFGA 1HA5A 1YJ1A 2MEKA 2H88B 3URYA 3T3NA 4HEA1 1WY8A 4REZA 1N6ZA 2QCZA 1FFVA 1XXGA 3U52E 1JMLA 2KVRA 3P4PB 2GBMA 3NZUA 3QCAA 5D94A 4K1RB 2DYOA 3NRZA 1I4HA 3IXSA 2LWPA 2FNJB 4K3BA 1LO5D 1LXDA 4FA6A 2ZW1A 1YOVB 2KJRA 4OZAA 1WWTA 1ET9A 1ZPSA 4L23A 4BKSD 1A5RA 1FXAA 3I3TB 4YXDB 1N5XA 4CHKA 2RDHA 1SBBB 2IY0B 5D3IB 4C7ZA 4WIPA 2PTLA 3PZDA 2D5GA 2KAJA 2WDRB 2R61A 3LXFA 3OWEB 4K81A 1KLVA 3VUWA 2DZMA 2V3PA 2WXMA 4NAWA 1L0VB 4GLSC 1UELA 1WJ6A 1BT0A 1UNSA 3PSEB 2WX1A 1SIFA 2IGGA 2MHJA 2MRPA 2XNAC 1ENFA 1OTRB 2K39A 1J7AA 1QKZA 4ASWC 3DVNV 3GP7A 3Q8EA 4CYEA 3MHSD 4I6PA 3W2DA 3AE5B 3VQIA 1F52A 2V3SA 3ZRFA 3EECA 4MH0E 3BYTB 1JQ4A 2CU3A 2IJ0A 3TJPA 5CHFA 2FUHB 4LDTB 2LGYA 4OVZA 1MVKA 2WXNA 2IO2B 1PGBA 1MG4A 2YVCA 2WS3B 5C1ZA 1WRIA 1E8XA 4EZKA 1WXMA 2AL6A 2RSUA 2WXFA 2Z0DB 2RDGA 3T8MA 2I2YA 3SEBA 2EKEC 1FNUA 2ZEQA 1T0RC 1FD6A 1UGJA 3B9JA 4HKZE 4ZRJA 4O1NA 3VTUA 1UF0A 1FPYA 4FADA 2LUEA 3DWMA 1T0QC 1VDVA 4B0EA 3T3OA 1WZ0A 2L83A 1E10A 1CJEA 3DWGC 3PS6A 4ICUA 4P1BC 3EUB2 3NUHB 2DLBA 3KWVA 3UF8A 1Y8RC 2PMVA 2O2VB 2SEBD 2N9EB 3O65B 1YN4A 3OJ3A 4HJKA 1LFDA 2FCSA 1E6EB 1WE6A 1K53A 4FXCA 4RF0A 3DBRB 5IAAC 2DZKA 3DBLB 3DVGY 3VDZA 2JWUA 3PHXB 1NEKB 2DX5B 4FULA 3SU8X 2AYOB 3QWZB 4P16A 2FCMA 3L4PA 4B0MA 4FJVB 2BYTA 5H92C 1SXTA 2EMTA 2HTME 3ZW3A 2N9LA 2MP2B 3PRMB 1FO4A 2AL3A 4W9LA 3RNAC 2LVQA 3GS2A 4MELA 2K22A 3H7SA 3X0WA 1QQRA 2BS3B 3JSVB 3AB5A 3ZDMC 3QX1A 1ZDVA 4KGSA 2IGHA 2RPQA 2Z59B 2WXPA 4ZRKA 3U7ZA 3RPFC 2ZW0A 3HM3A 3IT6B 4DBGA 3LDZE 2V1YA 3RT3B 2D3BA 2M4NA 5TSSA 1P98A 5FKAC 5EDSA 1GOZA 2NMQA 1IGCA 1Q0WB 1MFWA 1T6BX 2C7MB 1SE3A 4PK1A 2NBVB 2JSVX 1IBXA 3H7PB 4WH4A 2C5LC 1YIWA 3Q14C 3ZRCA 1CMXB 5EE1A 1UGMA 1C78A 2ONQA 4IM0A 3R2IA 4PYUA 2D11A 1BXTA 1QOFA 4DXGA 1FFUA 4RGOS 4C80A 1KH0A 3MJ5A 2QILA 1WXSA 1JWAD 1DOXA 2LGXA 3RNFC 2NCNA 4N59A 4HCPB 3Q6BA 4AOFA 3ZJTA 1ZXIA 3AMZA 2V0GA 4JQWC 3NZ3A 4IDIA 1FEHA 3NZSA 3RD2A 3QHTA 1WRDB 1J0GA 2JT4B 2BWFA 2KWCA 2VZKB 1JWMD 1YN5A 2FCQA 4DHZE 2J0JA 2N9KA 2JVCA 4GOCA 4KSKC 1XF5L 1V97A 2E3TA 4MSMB 4KZ0A 2WXGA 3P2BA 3M95A 4FJYA 2LJIA 4A3OA 4WJOA 1NI3A 4GDLA 2L05A 2NPTA 4M0WB 3V05A 4HLEA 2JWZA 4M8MA 2WXRA 3P4SB 1QOBA 2GI9A 4LNFA 2K3UA 2KT7A 4P1CC 4LTUA 2LXAA 5GMVA 1FXIA 4GDKB 1V2YA 1MHHE 3TUOA 4DDID 2D07B 4MACA 1RRBA 4PS3A 4ANUA 2Y5CA 4JPSA 1R4NI 2VRRB 4IUMB 2BB6A 2XBBC 4RF1A 3AEEB 1HXYD 2D3CA 1N61A 1TKEA 4DXFA 4ITKA 3KUCB 1TKYA 1YN3A 2W54A 3ZNHB 4P7IA 3VHTC 1RFKA 4ANVA 3KQ4A 1JRPA 1E7VA 3HM6X 3JYUA 2KNBA 2FUG1 4HRSA 3H8HA 1L0XB 3SD5A 1YQBA 4HPMB 3M63B 5GXGB 3BK1A 3IT4B 1CQVA 3N32A 3SFEB 2KD0A 3FAHA 3BINA 3K9PB 4H2AA 5JHAA 4F7ZA 3L0WB 2E6XA 3FC4A 2ZVOA 3AE4B 1TTNA 1XEEA 4W9EA 1WGDA 2ICIA 2N0SB 2WYQA 1U4AA 1IGDA 4LNOA 1D3ZA 1MG8A 3MP9A 2BKRB 3ZLZA 3NVWA 2KZRA 4BKGA 1PFDA 3V61A 3RULA 2L3ZA 3KYCD 2L1AA 1CZPA 1E5WA 2FAZA 1WJ4A 1AYFA 1SSNA 1C4PA 1TYGB 2X38A 3V3XA 1OQRA 3DBHI 4LK0M 1Y56A 1E8WA 1VZ7A 3R7QA 1Z5SB 2PIAA 1D5MC 4A8XC 1P7FA 1VR9A 4ZYSA 2GB1A 4HJGE 3AEBB 4YWGG 2KFKB 2SAKA 3A9KB 4CO7A 1UWMA 3W1SC 3PGEA 4M0WA 3Q8FA 3UIOB 5HG2A 2UYZB 4RGMA 1E7PB 2KX3A 1WXQA 2NTSA 4IG7B 5DPSA 3AECB 5G55A 1BUIC 2KO3A 3MC9A 4EZLA 4PS8A 4C4VB 5BMGA 4W9DA 4S17A 4URKA 2K8BA 1XCTL 1DYQA 3KW5B 2KVZA 3TL5A 1D5ZC 1L4DB 4AJYB 1YJIA 4WJPA 4FHKA 4HPLB 3FKYA 2AWTA 2HJ8A 2JF5A 1NYRA 2H89B 3KUDB 2MJ3A 4I6NB 4BKSA 4XDCA 3X23A 2NR2A 3GOEA 4AP4C 2PKOA 3APFA 3Q3NC 4JWSC 2MBOA 3DOWA 3H1UA 2KANA 1EWCA 2WXIA 1TJEA 4W9GA 1C9FA 3A1QA 3EHVA 5D6JB 2RMMA 1AN8A 4ZDVA 1Q1OA 3IAS1 4K7SA 2KTFA 3TSSA 4DHZB 4K7UA 3EFUA 1C1YB 2CJNA 2N1WA 2I1JA 1ZXHA 3Q2AC 4IW0A 5C2TB 1QLBB 2L0FA 2WXHA 3QA8A 5IA7A 2DBYA 4EUTA 1NVID 1XCQL 4N9F4 3DHHC 3DQVA 4EOYA 1Q5WB 4II3B 3RUIB 1J8CA 1L5PA 2M0AA 3QAQA 3L10B 4TKNA 4TQ0A 3RNGC 1PGXA 3QK0A 4LJOB 2MWSB 3KUZA 3ZGZA 1SE4A 1ZDXA 4XWWA 5C3JB 2D3AA 4XC2A 2J52A 5HHDG 2KFKA 2IBIB 3WANA 4YSYB 2GBJA 3QQ8B 1KJTA 3PZ7A 4ZHOA 1L6VA 1VLBA 3ZYYX 2J42A 1WYGA 4ANXA 4D2KA 2YEPF 3BYYB 2WXJA 3FILB 3Q8AA 5H8YE 1TT5B 2KC2A 4FLHA 5FR6A 4M8NA 3OG5A 5G5GA 3TEZA 2C60A 4KDLB 5CX3A 4MH8A 5BMHA 3AE9B 4XYCA 1WGKA 1OEYA 3U30A 4G3XB 1GAQB 3GZNI 4ACFA 2WXKA 1K52A 2QDFA 2YEPB 3P1MA 2K5PA 3HHMA 1SJHD 3CWIA 1WF9A 3DHGC 2KLGA 3GB1A 5JHBA 2L52A 3EGRA 1ET6A 3MC0B 5BYSA 4ZRIA 2JU6X 3VUXA 2QHOA 3CIRB 1IP9A 2W3RA 1HTQA 2GOWA 2AQ3B 1B1ZA 3WA0A 2MBEA 3Q69A 1WGGA 1IPGA 2BPSA 2WLBA 3A9JB 4F1SA 1ZGUB 2LHDA 1V5OA 4LLGM 2NBWB 4FHJA 1F77A 1QILA 1AW7A 1YX6B 1C79A 3VVWB 4TMAB 3ZXVA 2KHWB 1MJDA 2KLCA 1EUVB 2BGFA 3UGBB 1B9RA 2BWES 2KMMA 5IOIA 3SHQA 4W9HA 1V6EA 2CHWA 4E71A 1FMAD 4MM3A 1TZ1A 1I7HA 1YQ4B 4KDIC 1GUAB 2L32A 4LNNA 5BYQA 1WX9A 2ZPNA 1FIQA 3VRBB 4W9IA 4KIKA 1V1PA 1HTOA 4DHJB 4OZBA 2JUOA 1V5TA 3RI7C 2IO1B 2LRWA 1EWYC 1I4RA 1KF6B 1WX8A 2L8JA 3PV1A 5LNK1 3B08A 4HK2A 4B6WA 1WMHB 1T0SC 2W3SA 1V8CA 1XO3A 4FN2A 1OFFA 1WXVA 4RNAA 3RCZA 3ZTCA 5CTRC 2BTEA 3JW0X 4K3CA 2OJWA 1GC7A 3NJTA 4KKJA 1WSPA 1R4MB 2N7JA 2JQRB 4JX1C 1M4VA 3ECIA 1JWSD 1WXAA 1L4ZB 2X8XX 2KDBA 4DQOC 2WXOA 1DOIA 1XLNA 5DPWA 2XK5B 2IO3B 2AQ2B 4AJWA 3N30A 1C4AA 1XLOA 3WAMA 2GBNA 3MHZA 2XN9C 4EE2A 4W9FA 3SDLC 1QZEA 4J3OD 3CMMB 3LJ3A 3N3KB 2LHEA 3LYYA 1I4QA 1VCBA 2KN4A 2LGIA 1L0YB 1P3QU 3Q3MC 4XDDA 3CSTA 3Q8CA 1J19A 1NI2A 3PVLA 2KJ6A 2WU5B 2KK8A 2GLSA 4BZAA 2KJHB 1T0YA 3AH7A 1GC6A 2IO0B 3E56A 3DDCB 2D10A 4YSZB 2KYWA 1MHXA 4MJSB 4C00A 2DZIA 5D7GA 1JWUD 2OOBB 2LD9A 2RPVA 2KDIA 1E0ZA 5DPRA 2N9PC 4RGNA 1DGJA 1X1MA 1ISNA 3AN1A 4GU2A 3P4RB 1ZUD2 1T3QA 2KMAA 4AUQC 4WJNA 1Q10A 4B95A 2IDYA 3TEXA 3KVFB 2KDEB 2Q5WD 4N6EB 3VH4B 2FCNA 1WMHA 2B76B 2MH7A 2QIEB 2KQ7A 3WCQA 1I35A 2DHZA 1RAXA 2WDQB 3NS8A 3ZNZB 4ZRQA 1C3TA 3KH0A 1UD7A 1F9JA 2EMSA 2LI5A 3N9YC 1TS5A 3EA6A 1M94A 1F2RC 3KWLA 3NHEB 2O6VB 2V3NA 3VH3B 2MX2A 1GPXA 4LNIA 2CHZA 1JWBD 1TKGA 5E6OA 5HKHA 2PW9A 2INPE 2PVOD 1WJNA 4GB9A 2LVOA 4HDQA 1CK1A 3ZO5B 1TIFA 2KWDA 5BMIA 2O2VA 2TSSA 3DBRI 3DBLI 3R3MA 2LEKA 1LGRA 5TR5A 1ZE3D 2UWQA 3WAOA 1SIJA 2K0PA 1KLGD 4UDUC 4DK5A 2QMTA 4WQMA 3RN9C 3VFKA 1FRDA 3TBLD 3RYTA 1WGYA 2ZCBA 2INCC 2JRIB 4TUUA 1YJJA 1I42A 1TZOA 3PLVA 2QJLA 2REXA 2MP2A 3ZKJC 4ZOHC 1S3SG 4HROA 2MJDA 4NJCA 2K8CA 2W82A 4WURA 4US8A 1WR6E 2RDBC 1N5WA 2DAFA 3AU5A 1VJKA 1UWXA 3JSVA 3L08A 4WAFA 4FJZA 4DHJD 2WNMA 2C7NB 3DHIC 2L76A 1J7CA 3PLUA 4KGRA 3RNCC 3OLMD 5KHOA 4FBJB 1KRHA 2WDTB 3VRAB 1VZ6A 3RNBC 4HXDA 2AQ1B 5L83A 4NY0A 5EE9A 4I6LB 4NAMA 1RLFA 2K25A 1D6EC 3H7PA 3AEFB 1ZW7A 1OEYJ 3NOBA 2G4DB 1RYJA 2Y5BB 2KTRB 1ESFA 1HEZE 3BZDB 1SE9A 3DBSA 5DCNA 2M56B 2BS4B 4MGKE 5CHVC 5IP4D 3U8ZA 2KDMA 3V6CB 1WM2A 3Q3JA 5AUIA 1E7UA 3QARA 4KVGB 4NZLB 1KTKA 1JRUA 3PTFC 1K8RB 4XE0A 3RNEC 5E6PA 5LLIA 2CJOA 3VR9B 3I57A 2K9XA 5I4DA 1FNVA 4PYZA 1FCCC 4IM3A 3AE6B 5BYRA 4WWMA 2JY6A 3ZQ4A 1HZ5A 2WQYB 2MLBA 2BKFA 3UIPB 5IN7A 4XZ4A 3H6NA 4GDKA 3ZDTA 3QIJA 1DOYA 3M62B 1HZ6A 4BOSC 4AS1A 3PRPB 1VD2A 4CQNA 1SF0A 1E90A 4L2YA 1R7SA 3BIID 2QEJC 3TIXA 3OAWA 3MJWA 2D3GA 5DPTA 2WU2B 3ZUNA 1NDDA 3A4SC 2JZPA 1TY0A 1I4XA 3ML8A 1ZOYB 2WWZA 3BVZA 4KGTA 1A70A 4BVUC 2WX0A 2RD0A 3U2SC 4YL8A 4JIOU 3PRZA 3J9CA 3VUYA 2XEWA 5E6JA 4M01A 2O6VD 1EO6A 2PLPA 2KTRA 3KYDD 4JL9A 2PE6B 1JW9D 1GB4A 3AE1B 4BAXA 4MGZE 4A55A 2VH2A 3D32A 4GGQA 2FBWB 4TQ1A 4DDGD 4EZJA 1BMLC 1ROEA 5G2NA 1WE7A 5T8IA 3ONSA 3RMKC 3MC8A 3C19A 2PVGC 4IWPA 3AXCA 4NAWB 3IBEA 2LFIA 3VR8B 3Q8BA 3V60A 4ARCA 4Q2JA 3NG0A 2R2QA 2BF8B 5JH5C 4BBNC 4G11A 1V49A 4W9CA 3NVVA 4YTNB 3IVFA 4IWQA 2BVCA 2WXQA 3GE3C 1H4RA 2BB5A 1WM3A 2MSED 4C7YA 2VH1A 2I1KA 3AULA 2BBCA 4R3DA 3A9KA 1TY2A 2BQQA 2PJHA 3WALA 1VRAB 3AU4A 3DCGA 3IG3A 1WJUA 2DNFA 3HIZA 3Q3OC 2M8SA 3BY4B 4YT0B 1OGWA 1AARA 3U7DA 2LGDA 1IUEA 2G4SA 1WH3A 1P1AA 1GNUA 3B0AA 4OHJA 1PGAA 3HVDA 3W1SA 2MA9B 4C4VA 1XD3B 4TSSA 4OVVA 1WZ3A 3L13A 2NS5A 4AQ7A 4JLCA 2J0KA 2YLMA 1STEA 2M19A 3ML9A 2OJRA 3I5JC 3NY5A 1SE2A 3W1YA 2JXXA 4MT5A 5EE3A 3AE2B 3PREA 3PO0A 2V4IB 4RMAA 1LM8B 3H9DA 2D2QA 4M02A 1SJED 1K51A 5D2MB 2BW2A 1E9MA 4HVBA 3W5UB 4EEWA 2WDVB 2KQSA 1IYFA 3VTVA 1WGRA 5JXVA 4E3CA 1N60A 2KWVB 3HUIA 1EF5A 3AI5A 2M0XA 1WX7A 2N1VA 5EE0A 3AEAB 2ZNVC 3QJZA 1N63A 5L95C 5FK9C 2Y3AA 1WI0A 4G0NB 1YQ3B 1P0RA 2ZVNA 2IY1B 4EKUA 2N7EA 2M17A 2M1MA 2KACA 4MGIE 1EU3A 2ZNVB 3A33B 2OEDA 2N4FA 4P6VF 2CU1A 1EM7A 2KC1A 1FRRA 1PUTA 4ZRPA 2BYFA 1V1OA 2WP9B 5J18A 2G9HD 2LRUA 3I9V1 1Z2MA 2LZ6A 2J4XA 2G1EA 3CSFA 3PT2B 4ZYNA 2A4ZA 3FILA 2INNE 1UBQA 4IKGA 4WWPA 2NVUI 2JYTA 4NJ7A 3W5VB 5AZHA 1NYQA 3QC8B 1S1QB 3TMPB 2G3QB 2IZVB 2MBBB 2J7QB 1IBXB 2LGSA 1UBIA 2K8HA 1JROA 2C7HA 4II2B 1E8ZA 3P42A 1TS3A 4QAYA 2Z0EB 2CHXA 2DZJA 1XT9B 2GMIC 4HKQA 3ETRA 2A5UA 4KZCA 1C77A 1PYWD 1QOGA 1WFYA 1XLQA 3EC8A
chains in the Genus database with same CATH topology
4YTMB 3IXSA 1WXQA 2NTSA 1YJJA 4A90A 1TZOA 3AECB 1LO5D 2QJLA 2ZW1A 3NVZA 1BUIC 3KLSX 4N58A 4OZAA 1WWTA 1ET9A 3HRDD 1I4GA 1ZPSA 1SB3C 4L23A 4ZOHC 5BMGA 4HROA 4KKIA 1FXAA 2MJDA 4YXDB 1XCTL 1DYQA 1N5XA 4NJCA 2W82A 1D5ZC 2RDHA 4WURA 4US8A 1L4DB 1YJIA 1SBBB 5D3DA 1FNWA 5D3IB 4C7ZA 1N5WA 4WIPA 2PTLA 2D5GA 2KAJA 1VJKA 2R61A 2WDRB 3LXFA 1UWXA 3RFZB 4WAFA 1FCLA 1NYRA 2H89B 2WNMA 2MJ3A 1YNTE 4GDLB 1OQQA 3OWEB 1J7CA 4KGRA 3P63A 4XDCA 1QT9A 3AM9A 4XWTA 1KRHA 2V3PA 4YSXB 2WXMA 1L0VB 4GLSC 3VRAB 3NS1A 2PKOA 3B2GA 1VZ6A 2AX5A 2AQ1B 1UNSA 4JWSC 1EWCA 2WXIA 1TJEA 5EE9A 4NAMA 1C9FA 1YMHE 1D6EC 1AWDA 2QSDA 2IGGA 3AEFB 2ON8A 4A9AA 2XNAC 2RMMA 1ENFA 1J7AA 1QKZA 1AN8A 1RYJA 3ZJVA 3AV8A 1ESFA 1HEZE 3GP7A 2JX5A 2OHFA 3IAS1 3TSSA 3Q8EA 2BS2B 3BZDB 3W2DA 3AE5B 3IAM1 2M56B 2CJNA 3VQIA 1L6UA 2BS4B 1ZXHA 5C2TB 1QLBB 2KDMA 2WXHA 2DBYA 3BYTB 1JQ4A 2CU3A 2IJ0A 5AUIA 1NVID 1XCQL 2W55A 1NENB 2LUMA 1L5PA 4OVZA 1MVKA 2M0AA 4TQ0A 2WXNA 1PGBA 2WS3B 1PGXA 1RM6C 1WRIA 4NZLB 3ZGZA 1KTKA 1SE4A 1ZDXA 3BWUD 4XWWA 5C3JB 2WXFA 1FM0D 1TS2A 2RDGA 2J52A 2I2YA 3SEBA 3O13A 4XE0A 1ACCA 1FNUA 5HHDG 1FD6A 4JE3B 1UGJA 3B9JA 4OZCA 4HKZE 2CJOA 4YSYB 3B2FA 3I57A 1K50A 3VR9B 3PZ7A 4ZHOA 2K9XA 1L6VA 3BK2A 5HI1A 1VLBA 3ZYYX 2J42A 5I4DA 4O1NA 1WYGA 4D2KA 2YEPF 3BYYB 4B0EA 3DWMA 1VDVA 1FNVA 2WXJA 3FILB 1FCCC 2L83A 3AE6B 1CJEA 3Q8AA 3BVMA 3DWGC 4WWMA 3HVZA 5BYRA 1E10A 5H8YE 5G5GA 3TEZA 3EUB2 3NUHB 3ZQ4A 1HZ5A 2WQYB 4MH8A 5BMHA 2DLBA 3AE9B 3KWVA 1WGKA 3AE3B 1GAQB 2PMVA 2SEBD 3TEYA 1XLPA 1DOYA 2WXKA 1YN4A 1K52A 2YEPB 3P1MA 2K5PA 1MPEA 1HZ6A 4AS1A 1SJHD 3CWIA 4CQNA 1E6EB 1SF0A 3GB1A 5G5HA 1K53A 4L2YA 1R7SA 4FXCA 3BIID 2QEJC 4RF0A 2L52A 3EGRA 1ET6A 3MC0B 5BYSA 1RWSA 2WU2B 2JU6X 2JWUA 4IOIE 3CIRB 2W3RA 1NEKB 2DWQA 3AEDB 2JZPA 3W9CB 1TY0A 4ZHPA 2AQ3B 1B1ZA 1I4XA 4P16A 1ZOYB 3BVZA 3Q69A 3L4PA 4KGTA 4B0MA 1A70A 2WLBA 2BYTA 5H92C 1SXTA 2HTME 2N9LA 3U2SC 1D5XC 1KLUD 3J9CA 3PZ8A 1FO4A 1I4PA 2LHDA 4LLGM 5E6JA 3AE8B 3AEGB 1JCKB 4RGTA 1VZ8A 1GB1A 1F77A 2PLPA 1QILA 3GS2A 1AW7A 1JW9D 1GB4A 1C79A 2K22A 3AE1B 4A55A 4RFBA 4TMAB 1QQRA 2BS3B 4USAA 2FBWB 3AB5A 4TQ1A 1BMLC 1ROEA 1ZDVA 1B9RA 4KGSA 2IGHA 2KMMA 5T8IA 3SFDB 2WXPA 2NTTA 2EKIA 2PVGC 3U7ZA 4NAWB 3RPFC 2ZW0A 1FMAD 1ZP0B 3IT6B 1I7HA 2LFIA 1YQ4B 3VR8B 1F2RI 2L32A 3ABVB 5BYQA 3Q8BA 5TSSA 5FKAC 1GOZA 2NMQA 4ARCA 1IGCA 1FIQA 4Q2JA 5AUKA 3VRBB 2Z8LA 1T6BX 1V1PA 1SE3A 4OZBA 2JSVX 1IBXA 3NVVA 5MPOA 4WH4A 4YTNB 1EWYC 1I4RA 1KF6B 5EE1A 2WXQA 2I38A 2IPKD 5LNK1 3R8BA 1JALA 1C78A 2ONQA 2BB5A 3R2IA 4C7YA 2W3SA 1V8CA 4C56C 2BBCA 1XO3A 2IGDA 1BXTA 1QOFA 4R3DA 4DXGA 1FFUA 1TY2A 1OFFA 4RGOS 4C80A 4OW0A 1KFYB 1VRAB 1KH0A 3MJ5A 2QILA 2Y5PA 4RNAA 1JWAD 1DOXA 4N59A 4YT0B 4JWUC 1C76A 3ZJTA 1ZXIA 3AMZA 2BTEA 2V0GA 3R2TA 3NZ3A 2DYMA 4IDIA 1FEHA 1IUEA 1UUPA 4KKJA 4OHJA 1WSPA 1PGAA 2ACZB 2N7JA 2JQRB 3HVDA 2KQ4X 3W1SA 2LMCA 4JX1C 4RH6A 1M4VA 4TSSA 1PDXA 4L1BA 1JWSD 2VZKB 4AQ7A 1JWMD 1YN5A 1F0ZA 1L4ZB 3T3OA 1STEA 2M19A 2N9KA 4YTPB 4DQOC 2WXOA 1DOIA 1XLNA 1XF5L 1V97A 2E3TA 2WXGA 2AQ2B 1SE2A 3E9SA 1C4AA 1XLOA 2LJIA 3MHZA 2XN9C 4EE2A 4MT5A 1NI3A 2JYEA 4J3OD 3TEWA 5EE3A 3AE2B 2JXTA 2LHEA 3UI3A 3V05A 1TS4A 3PO0A 3LYYA 2HDEA 1I4QA 2V4IB 2WXRA 3P4SB 1QOBA 1MI0A 2GI9A 2KN4A 2LGIA 1L0YB 4XDDA 2K3UA 1SJED 1K51A 2BW2A 1E9MA 4LTUA 3Q8CA 3BVGA 3ZJUA 3W5UB 2WDVB 1FXIA 1N62A 4PT5A 4GDKB 1MHHE 3TUOA 4MACA 5JXVA 2WU5B 2Y5CA 4JPSA 1N60A 3HUIA 1HQRD 2BB6A 1J7BA 4RF1A 3AH7A 1C4CA 3AEEB 4RCOA 1HXYD 5EE0A 3AEAB 2J53A 1N63A 1N61A 1TKEA 3E56A 4DXFA 4ITKA 5FK9C 2Y3AA 1TKYA 1YN3A 2W54A 4YSZB 1MHXA 1YQ3B 2BT6A 2MJEA 1RFKA 5FR3A 1T5XD 5D7GA 3KQ4A 1JRPA 1JWUD 2FUG1 2RPVA 2GRIA 3U4EG 1E0ZA 1QOAA 4HRSA 3LB8C 3H8HA 3P4QB 1L0XB 3SR6A 1D4BA 4RGNA 1DGJA 2KACA 3AN1A 1EU3A 3P4RB 5GXGB 1ZUD2 1T3QA 1EU4A 3BK1A 1Q10A 1CQVA 3IT4B 2IDYA 2OEDA 3SFEB 3TEXA 3FAHA 1P7EA 2EELA 4P6VF 4N6EB 2Q5WD 1EM7A 4H2AA 1FRRA 3NVYA 1PUTA 4ZRPA 1V1OA 2WP9B 2G9HD 2E6XA 4KX6B 2B76B 2MH7A 2QIEB 3FC4A 1QF6A 3WCQA 3AE4B 3I9V1 2WDQB 1XEEA 2ICIA 2N0SB 2VZKD 4ZRQA 2WXLA 1IGDA 4ARIA 2J4XA 3C8YA 3N9YC 1TS5A 3AE7B 3MP9A 2G1EA 3EA6A 1F2RC 3KWLA 2V3NA 3NVWA 1SEBD 1PFDA 3FILA 2INNE 1GPXA 1JWBD 2L1AA 1CZPA 4US9A 1TKGA 4MM3B 4IKGA 2JYTA 4A6QA 2PW9A 1AYFA 2INPE 3W5VB 1SSNA 2PVOD 1NYQA 1C4PA 1TYGB 2X38A 3V3XA 1CK1A 1V1PB 1OQRA 2FE8A 4LK0M 1IBXB 1Y56A 2KWDA 5BMIA 1VZ7A 5HFYA 2TSSA 3MFGA 1JROA 1HA5A 2MEKA 1D5MC 2PIAA 2H88B 3P42A 1TS3A 3URYA 2LEKA 3T3NA 4A8XC 1P7FA 1VR9A 1ZE3D 4ZYSA 2GB1A 4HEA1 4HJGE 4REZA 1FFVA 3AEBB 4YWGG 1XXGA 3U52E 1JMLA 1SIJA 3ETRA 2SAKA 3P4PB 4HKQA 2K0PA 1C77A 1PYWD 1KLGD 1QOGA 1UWMA 4UDUC 1XLQA 4M0WA 2QMTA 3Q8FA 4WQMA 5HG2A 2DYOA 4RGMA 3NRZA 1FRDA 1I4HA 1E7PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHD G;  1FD6 A;  4OZC A;  2ZW0 A;  4HKZ E;  2J53 A;  1F2R I;  2ZW1 A;  1K50 A;  4OZA A;  2NMQ A;  1IGC A;  5HI1 A;  1MHX A;  4D2K A;  4OZB A;  2JSV X;  5BMG A;  1IBX A;  1XCT L;  4WH4 A;  3FIL B;  1FCC C;  2RPV A;  2I38 A;  1D4B A;  1HZ5 A;  2ONQ A;  2PTL A;  5BMH A;  2KAC A;  1UWX A;  2IGD A;  1FCL A;  1Q10 A;  2OED A;  1P7E A;  2EEL A;  1KH0 A;  1EM7 A;  1YNT E;  4KGR A;  1K52 A;  1MPE A;  1HZ6 A;  4GLS C;  3GB1 A;  1K53 A;  1IGD A;  1PGA A;  2N7J A;  3MP9 A;  2KQ4 X;  2JU6 X;  2JWU A;  1C9F A;  1YMH E;  4IOI E;  1F2R C;  2QSD A;  2IGG A;  2ON8 A;  2JZP A;  3FIL A;  2RMM A;  1QKZ A;  2N9K A;  4KGT A;  4IKG A;  1HEZ E;  1XF5 L;  2PW9 A;  2N9L A;  3V3X A;  2LHD A;  1ZXH A;  1IBX B;  2KWD A;  2KDM A;  5BMI A;  5HFY A;  1GB1 A;  2PLP A;  2JXT A;  2LHE A;  3UI3 A;  1XCQ L;  1GB4 A;  1MI0 A;  2GI9 A;  1P7F A;  2KN4 A;  2LGI A;  2GB1 A;  2LUM A;  4HJG E;  1MVK A;  1K51 A;  1JML A;  2K0P A;  1PGB A;  1PGX A;  1MHH E;  2QMT A;  4KGS A;  4MAC A;  2IGH A;  5JXV A;  5HG2 A;  2J52 A;  2I2Y A; 
#chains in the Genus database with same CATH topology
 4YTM B;  4PS7 A;  1GG3 A;  1KM7 A;  4A90 A;  2J0M A;  3N1X C;  4W9K A;  2MW5 A;  4JGH B;  3NVZ A;  3KLS X;  4N58 A;  3HRD D;  1I4G A;  3A9J A;  4X57 B;  2FID A;  2V4L A;  1SB3 C;  1XQQ A;  4KKI A;  3APD A;  4WQO B;  1V80 A;  2RGF A;  4HPP A;  5D3D A;  2KDF B;  1FNW A;  4J6I A;  3RFZ B;  2N7D A;  4WWO A;  2KWU B;  1FCL A;  3L17 A;  1TBE A;  1YNT E;  4GDL B;  1OQQ A;  2NPT B;  3P63 A;  1QT9 A;  3AM9 A;  4XWT A;  4GXB A;  3ZXR A;  4YSX B;  4WJQ A;  4HCN B;  2WHI A;  3ZNI D;  3NS1 A;  4NQL B;  3TCA A;  3B2G A;  3VAW A;  2AX5 A;  3ENE A;  1WYW B;  5CHW A;  4E74 A;  4S0R A;  4MEM A;  4ICV A;  2LAS A;  1YMH E;  2UU7 A;  4NPN A;  4BOZ B;  1AWD A;  2QSD A;  1ZKH A;  5AZF A;  2ON8 A;  4A9A A;  2KN5 A;  2WGS A;  3ZJV A;  3AV8 A;  2W9N A;  1YD8 U;  2JX5 A;  2OHF A;  1GJZ A;  2PPH A;  5KHQ A;  3UQA A;  2BS2 B;  1R4N B;  2L7R A;  3V6E B;  3IAM 1;  1L6U A;  2MCN B;  1R4M I;  2W55 A;  1NEN B;  5C23 A;  2LUM A;  3EFC A;  2KMC A;  1LQB A;  1TGZ B;  4BKT A;  1RM6 C;  1SGH A;  2K1F A;  3BWU D;  4MGY E;  4GN1 A;  1FM0 D;  1TS2 A;  2V9H A;  2L00 B;  3O13 A;  1ACC A;  4JE3 B;  4NNJ B;  4OZC A;  2CS4 A;  1PQS A;  5JZE B;  2N9X A;  3B2F A;  1K50 A;  5J2R A;  4GIV A;  2XK5 A;  3BK2 A;  5HI1 A;  1F1H A;  4OVU A;  3DVN U;  3BVM A;  3HVZ A;  4AWJ A;  3AE3 B;  2B3A A;  4WAA A;  2PE9 A;  3TEY A;  1XLP A;  2BYV E;  1EF1 A;  2ZZP B;  2GBK A;  1MPE A;  3N1Z C;  3RZW C;  4A20 A;  4IWO A;  3DBH B;  5G5H A;  4KSL C;  2JZ3 B;  1YX5 B;  3L54 A;  1RWS A;  2HTH A;  4MJS A;  4IOI E;  2DWQ A;  3AED B;  3GE8 C;  1E8Y A;  3W9C B;  4ZHP A;  4KV2 A;  2HD5 B;  2HE7 A;  3ZIM A;  2DEN B;  2L0T A;  3IFW B;  5BO4 B;  4MDK E;  4NJ6 A;  2QC8 A;  1D5X C;  1KLU D;  3PZ8 A;  1I4P A;  4LDT D;  3OJ4 B;  3AE8 B;  3AEG B;  1JCK B;  4RGT A;  1VZ8 A;  1GB1 A;  3UIN B;  1FXT B;  2NBU A;  5LXI B;  4XGA B;  3ZTD A;  4BFR A;  4RFB A;  4HWI B;  3IHP C;  2IYD B;  2HJ1 A;  4USA A;  4K7W A;  3WIM A;  2LXC A;  5J17 A;  1UH6 A;  4RM9 A;  2CR5 A;  3SFD B;  2O6V A;  2DYB A;  1WGH A;  2NTT A;  2EKI A;  3S2A A;  1L2N A;  1ZP0 B;  3I63 C;  3VXW A;  3R7R A;  4DXA B;  1F2R I;  3ABV B;  2RR9 A;  5AUK A;  2Z8L A;  2K6Q A;  4TV3 A;  3A1Q B;  2KFJ A;  5E6N A;  5MPO A;  4A3P A;  4B9K A;  2I38 A;  2IPK D;  3R8B A;  1JAL A;  5AZG A;  4C56 C;  2PEA A;  2IGD A;  4W9J A;  4OW0 A;  1KFY B;  3R66 C;  3K9O B;  1WR1 A;  2KKC A;  4XX5 A;  2Y5P A;  4EFO A;  3WAP A;  2IND C;  2MBH A;  3L16 A;  4JWU C;  1C76 A;  3R2T A;  1NBF C;  2DYM A;  3N1Y C;  3APC A;  1UUP A;  5IO9 A;  4LNK A;  3B1L X;  2ACZ B;  2KQ4 X;  2LMC A;  4RH6 A;  5AEK B;  1PDX A;  3MTN B;  4L1B A;  4ANW A;  1F0Z A;  3ZVV A;  2K6D B;  3HK0 A;  2ASQ A;  4HDO A;  1P9D U;  4YTP B;  1V81 A;  2G45 B;  1V9J A;  1HE8 A;  2DAJ A;  3E9S A;  1UZX B;  2MBQ A;  3M3J A;  2JYE A;  4GMV A;  3TEW A;  3UQB A;  2JXT A;  3UI3 A;  1TS4 A;  2HDE A;  2ZCC A;  1MI0 A;  3PHW B;  3ZNG C;  3BVG A;  3ZJU A;  3DPD A;  1N62 A;  3VTW A;  4PT5 A;  4GSW A;  4RM8 A;  1L7Y A;  2LJ5 A;  3C0R B;  3A4R A;  3CF6 E;  1HQR D;  3T9L A;  3N20 C;  1J7B A;  1C4C A;  3GZN B;  2CKH B;  4RCO A;  2J53 A;  4WWN A;  1WIA A;  2JRH A;  2MJE A;  2BT6 A;  4MSQ B;  3PPA A;  5FR3 A;  1T5X D;  3Q3F A;  5IKC M;  2GRI A;  4NQK E;  3U4E G;  1QOA A;  2MQJ A;  3LB8 C;  3P4Q B;  3V62 A;  3SR6 A;  1D4B A;  3RZF A;  2KOX A;  1KOT A;  4LJP B;  4IC7 B;  1V86 A;  1EU4 A;  1RFA A;  1P7E A;  2EEL A;  1OQY A;  4BBN F;  3NVY A;  5LXH A;  2LVP A;  2JPH A;  1H8C A;  4KX6 B;  3DVG X;  2BYE A;  1QF6 A;  2ZPY A;  2ZJD A;  4M00 A;  2VZK D;  2WXL A;  4ARI A;  3C8Y A;  2C9W B;  3AE7 B;  1G6J A;  2GBR A;  3ALB A;  1SEB D;  4IM2 A;  4F8C B;  2KXJ A;  4US9 A;  4MM3 B;  2R2O A;  2FIF A;  3JVZ X;  4A6Q A;  4DWF A;  2AEH A;  4KIK B;  1V1P B;  4LCD E;  2FE8 A;  2JZZ A;  4G50 A;  2KX0 A;  5HFY A;  3MFG A;  1HA5 A;  1YJ1 A;  2MEK A;  2H88 B;  3URY A;  3T3N A;  4HEA 1;  1WY8 A;  4REZ A;  1N6Z A;  2QCZ A;  1FFV A;  1XXG A;  3U52 E;  1JML A;  2KVR A;  3P4P B;  2GBM A;  3NZU A;  3QCA A;  5D94 A;  4K1R B;  2DYO A;  3NRZ A;  1I4H A;  3IXS A;  2LWP A;  2FNJ B;  4K3B A;  1LO5 D;  1LXD A;  4FA6 A;  2ZW1 A;  1YOV B;  2KJR A;  4OZA A;  1WWT A;  1ET9 A;  1ZPS A;  4L23 A;  4BKS D;  1A5R A;  1FXA A;  3I3T B;  4YXD B;  1N5X A;  4CHK A;  2RDH A;  1SBB B;  2IY0 B;  5D3I B;  4C7Z A;  4WIP A;  2PTL A;  3PZD A;  2D5G A;  2KAJ A;  2WDR B;  2R61 A;  3LXF A;  3OWE B;  4K81 A;  1KLV A;  3VUW A;  2DZM A;  2V3P A;  2WXM A;  4NAW A;  1L0V B;  4GLS C;  1UEL A;  1WJ6 A;  1BT0 A;  1UNS A;  3PSE B;  2WX1 A;  1SIF A;  2IGG A;  2MHJ A;  2MRP A;  2XNA C;  1ENF A;  1OTR B;  2K39 A;  1J7A A;  1QKZ A;  4ASW C;  3DVN V;  3GP7 A;  3Q8E A;  4CYE A;  3MHS D;  4I6P A;  3W2D A;  3AE5 B;  3VQI A;  1F52 A;  2V3S A;  3ZRF A;  3EEC A;  4MH0 E;  3BYT B;  1JQ4 A;  2CU3 A;  2IJ0 A;  3TJP A;  5CHF A;  2FUH B;  4LDT B;  2LGY A;  4OVZ A;  1MVK A;  2WXN A;  2IO2 B;  1PGB A;  1MG4 A;  2YVC A;  2WS3 B;  5C1Z A;  1WRI A;  1E8X A;  4EZK A;  1WXM A;  2AL6 A;  2RSU A;  2WXF A;  2Z0D B;  2RDG A;  3T8M A;  2I2Y A;  3SEB A;  2EKE C;  1FNU A;  2ZEQ A;  1T0R C;  1FD6 A;  1UGJ A;  3B9J A;  4HKZ E;  4ZRJ A;  4O1N A;  3VTU A;  1UF0 A;  1FPY A;  4FAD A;  2LUE A;  3DWM A;  1T0Q C;  1VDV A;  4B0E A;  3T3O A;  1WZ0 A;  2L83 A;  1E10 A;  1CJE A;  3DWG C;  3PS6 A;  4ICU A;  4P1B C;  3EUB 2;  3NUH B;  2DLB A;  3KWV A;  3UF8 A;  1Y8R C;  2PMV A;  2O2V B;  2SEB D;  2N9E B;  3O65 B;  1YN4 A;  3OJ3 A;  4HJK A;  1LFD A;  2FCS A;  1E6E B;  1WE6 A;  1K53 A;  4FXC A;  4RF0 A;  3DBR B;  5IAA C;  2DZK A;  3DBL B;  3DVG Y;  3VDZ A;  2JWU A;  3PHX B;  1NEK B;  2DX5 B;  4FUL A;  3SU8 X;  2AYO B;  3QWZ B;  4P16 A;  2FCM A;  3L4P A;  4B0M A;  4FJV B;  2BYT A;  5H92 C;  1SXT A;  2EMT A;  2HTM E;  3ZW3 A;  2N9L A;  2MP2 B;  3PRM B;  1FO4 A;  2AL3 A;  4W9L A;  3RNA C;  2LVQ A;  3GS2 A;  4MEL A;  2K22 A;  3H7S A;  3X0W A;  1QQR A;  2BS3 B;  3JSV B;  3AB5 A;  3ZDM C;  3QX1 A;  1ZDV A;  4KGS A;  2IGH A;  2RPQ A;  2Z59 B;  2WXP A;  4ZRK A;  3U7Z A;  3RPF C;  2ZW0 A;  3HM3 A;  3IT6 B;  4DBG A;  3LDZ E;  2V1Y A;  3RT3 B;  2D3B A;  2M4N A;  5TSS A;  1P98 A;  5FKA C;  5EDS A;  1GOZ A;  2NMQ A;  1IGC A;  1Q0W B;  1MFW A;  1T6B X;  2C7M B;  1SE3 A;  4PK1 A;  2NBV B;  2JSV X;  1IBX A;  3H7P B;  4WH4 A;  2C5L C;  1YIW A;  3Q14 C;  3ZRC A;  1CMX B;  5EE1 A;  1UGM A;  1C78 A;  2ONQ A;  4IM0 A;  3R2I A;  4PYU A;  2D11 A;  1BXT A;  1QOF A;  4DXG A;  1FFU A;  4RGO S;  4C80 A;  1KH0 A;  3MJ5 A;  2QIL A;  1WXS A;  1JWA D;  1DOX A;  2LGX A;  3RNF C;  2NCN A;  4N59 A;  4HCP B;  3Q6B A;  4AOF A;  3ZJT A;  1ZXI A;  3AMZ A;  2V0G A;  4JQW C;  3NZ3 A;  4IDI A;  1FEH A;  3NZS A;  3RD2 A;  3QHT A;  1WRD B;  1J0G A;  2JT4 B;  2BWF A;  2KWC A;  2VZK B;  1JWM D;  1YN5 A;  2FCQ A;  4DHZ E;  2J0J A;  2N9K A;  2JVC A;  4GOC A;  4KSK C;  1XF5 L;  1V97 A;  2E3T A;  4MSM B;  4KZ0 A;  2WXG A;  3P2B A;  3M95 A;  4FJY A;  2LJI A;  4A3O A;  4WJO A;  1NI3 A;  4GDL A;  2L05 A;  2NPT A;  4M0W B;  3V05 A;  4HLE A;  2JWZ A;  4M8M A;  2WXR A;  3P4S B;  1QOB A;  2GI9 A;  4LNF A;  2K3U A;  2KT7 A;  4P1C C;  4LTU A;  2LXA A;  5GMV A;  1FXI A;  4GDK B;  1V2Y A;  1MHH E;  3TUO A;  4DDI D;  2D07 B;  4MAC A;  1RRB A;  4PS3 A;  4ANU A;  2Y5C A;  4JPS A;  1R4N I;  2VRR B;  4IUM B;  2BB6 A;  2XBB C;  4RF1 A;  3AEE B;  1HXY D;  2D3C A;  1N61 A;  1TKE A;  4DXF A;  4ITK A;  3KUC B;  1TKY A;  1YN3 A;  2W54 A;  3ZNH B;  4P7I A;  3VHT C;  1RFK A;  4ANV A;  3KQ4 A;  1JRP A;  1E7V A;  3HM6 X;  3JYU A;  2KNB A;  2FUG 1;  4HRS A;  3H8H A;  1L0X B;  3SD5 A;  1YQB A;  4HPM B;  3M63 B;  5GXG B;  3BK1 A;  3IT4 B;  1CQV A;  3N32 A;  3SFE B;  2KD0 A;  3FAH A;  3BIN A;  3K9P B;  4H2A A;  5JHA A;  4F7Z A;  3L0W B;  2E6X A;  3FC4 A;  2ZVO A;  3AE4 B;  1TTN A;  1XEE A;  4W9E A;  1WGD A;  2ICI A;  2N0S B;  2WYQ A;  1U4A A;  1IGD A;  4LNO A;  1D3Z A;  1MG8 A;  3MP9 A;  2BKR B;  3ZLZ A;  3NVW A;  2KZR A;  4BKG A;  1PFD A;  3V61 A;  3RUL A;  2L3Z A;  3KYC D;  2L1A A;  1CZP A;  1E5W A;  2FAZ A;  1WJ4 A;  1AYF A;  1SSN A;  1C4P A;  1TYG B;  2X38 A;  3V3X A;  1OQR A;  3DBH I;  4LK0 M;  1Y56 A;  1E8W A;  1VZ7 A;  3R7Q A;  1Z5S B;  2PIA A;  1D5M C;  4A8X C;  1P7F A;  1VR9 A;  4ZYS A;  2GB1 A;  4HJG E;  3AEB B;  4YWG G;  2KFK B;  2SAK A;  3A9K B;  4CO7 A;  1UWM A;  3W1S C;  3PGE A;  4M0W A;  3Q8F A;  3UIO B;  5HG2 A;  2UYZ B;  4RGM A;  1E7P B;  2KX3 A;  1WXQ A;  2NTS A;  4IG7 B;  5DPS A;  3AEC B;  5G55 A;  1BUI C;  2KO3 A;  3MC9 A;  4EZL A;  4PS8 A;  4C4V B;  5BMG A;  4W9D A;  4S17 A;  4URK A;  2K8B A;  1XCT L;  1DYQ A;  3KW5 B;  2KVZ A;  3TL5 A;  1D5Z C;  1L4D B;  4AJY B;  1YJI A;  4WJP A;  4FHK A;  4HPL B;  3FKY A;  2AWT A;  2HJ8 A;  2JF5 A;  1NYR A;  2H89 B;  3KUD B;  2MJ3 A;  4I6N B;  4BKS A;  4XDC A;  3X23 A;  2NR2 A;  3GOE A;  4AP4 C;  2PKO A;  3APF A;  3Q3N C;  4JWS C;  2MBO A;  3DOW A;  3H1U A;  2KAN A;  1EWC A;  2WXI A;  1TJE A;  4W9G A;  1C9F A;  3A1Q A;  3EHV A;  5D6J B;  2RMM A;  1AN8 A;  4ZDV A;  1Q1O A;  3IAS 1;  4K7S A;  2KTF A;  3TSS A;  4DHZ B;  4K7U A;  3EFU A;  1C1Y B;  2CJN A;  2N1W A;  2I1J A;  1ZXH A;  3Q2A C;  4IW0 A;  5C2T B;  1QLB B;  2L0F A;  2WXH A;  3QA8 A;  5IA7 A;  2DBY A;  4EUT A;  1NVI D;  1XCQ L;  4N9F 4;  3DHH C;  3DQV A;  4EOY A;  1Q5W B;  4II3 B;  3RUI B;  1J8C A;  1L5P A;  2M0A A;  3QAQ A;  3L10 B;  4TKN A;  4TQ0 A;  3RNG C;  1PGX A;  3QK0 A;  4LJO B;  2MWS B;  3KUZ A;  3ZGZ A;  1SE4 A;  1ZDX A;  4XWW A;  5C3J B;  2D3A A;  4XC2 A;  2J52 A;  5HHD G;  2KFK A;  2IBI B;  3WAN A;  4YSY B;  2GBJ A;  3QQ8 B;  1KJT A;  3PZ7 A;  4ZHO A;  1L6V A;  1VLB A;  3ZYY X;  2J42 A;  1WYG A;  4ANX A;  4D2K A;  2YEP F;  3BYY B;  2WXJ A;  3FIL B;  3Q8A A;  5H8Y E;  1TT5 B;  2KC2 A;  4FLH A;  5FR6 A;  4M8N A;  3OG5 A;  5G5G A;  3TEZ A;  2C60 A;  4KDL B;  5CX3 A;  4MH8 A;  5BMH A;  3AE9 B;  4XYC A;  1WGK A;  1OEY A;  3U30 A;  4G3X B;  1GAQ B;  3GZN I;  4ACF A;  2WXK A;  1K52 A;  2QDF A;  2YEP B;  3P1M A;  2K5P A;  3HHM A;  1SJH D;  3CWI A;  1WF9 A;  3DHG C;  2KLG A;  3GB1 A;  5JHB A;  2L52 A;  3EGR A;  1ET6 A;  3MC0 B;  5BYS A;  4ZRI A;  2JU6 X;  3VUX A;  2QHO A;  3CIR B;  1IP9 A;  2W3R A;  1HTQ A;  2GOW A;  2AQ3 B;  1B1Z A;  3WA0 A;  2MBE A;  3Q69 A;  1WGG A;  1IPG A;  2BPS A;  2WLB A;  3A9J B;  4F1S A;  1ZGU B;  2LHD A;  1V5O A;  4LLG M;  2NBW B;  4FHJ A;  1F77 A;  1QIL A;  1AW7 A;  1YX6 B;  1C79 A;  3VVW B;  4TMA B;  3ZXV A;  2KHW B;  1MJD A;  2KLC A;  1EUV B;  2BGF A;  3UGB B;  1B9R A;  2BWE S;  2KMM A;  5IOI A;  3SHQ A;  4W9H A;  1V6E A;  2CHW A;  4E71 A;  1FMA D;  4MM3 A;  1TZ1 A;  1I7H A;  1YQ4 B;  4KDI C;  1GUA B;  2L32 A;  4LNN A;  5BYQ A;  1WX9 A;  2ZPN A;  1FIQ A;  3VRB B;  4W9I A;  4KIK A;  1V1P A;  1HTO A;  4DHJ B;  4OZB A;  2JUO A;  1V5T A;  3RI7 C;  2IO1 B;  2LRW A;  1EWY C;  1I4R A;  1KF6 B;  1WX8 A;  2L8J A;  3PV1 A;  5LNK 1;  3B08 A;  4HK2 A;  4B6W A;  1WMH B;  1T0S C;  2W3S A;  1V8C A;  1XO3 A;  4FN2 A;  1OFF A;  1WXV A;  4RNA A;  3RCZ A;  3ZTC A;  5CTR C;  2BTE A;  3JW0 X;  4K3C A;  2OJW A;  1GC7 A;  3NJT A;  4KKJ A;  1WSP A;  1R4M B;  2N7J A;  2JQR B;  4JX1 C;  1M4V A;  3ECI A;  1JWS D;  1WXA A;  1L4Z B;  2X8X X;  2KDB A;  4DQO C;  2WXO A;  1DOI A;  1XLN A;  5DPW A;  2XK5 B;  2IO3 B;  2AQ2 B;  4AJW A;  3N30 A;  1C4A A;  1XLO A;  3WAM A;  2GBN A;  3MHZ A;  2XN9 C;  4EE2 A;  4W9F A;  3SDL C;  1QZE A;  4J3O D;  3CMM B;  3LJ3 A;  3N3K B;  2LHE A;  3LYY A;  1I4Q A;  1VCB A;  2KN4 A;  2LGI A;  1L0Y B;  1P3Q U;  3Q3M C;  4XDD A;  3CST A;  3Q8C A;  1J19 A;  1NI2 A;  3PVL A;  2KJ6 A;  2WU5 B;  2KK8 A;  2GLS A;  4BZA A;  2KJH B;  1T0Y A;  3AH7 A;  1GC6 A;  2IO0 B;  3E56 A;  3DDC B;  2D10 A;  4YSZ B;  2KYW A;  1MHX A;  4MJS B;  4C00 A;  2DZI A;  5D7G A;  1JWU D;  2OOB B;  2LD9 A;  2RPV A;  2KDI A;  1E0Z A;  5DPR A;  2N9P C;  4RGN A;  1DGJ A;  1X1M A;  1ISN A;  3AN1 A;  4GU2 A;  3P4R B;  1ZUD 2;  1T3Q A;  2KMA A;  4AUQ C;  4WJN A;  1Q10 A;  4B95 A;  2IDY A;  3TEX A;  3KVF B;  2KDE B;  2Q5W D;  4N6E B;  3VH4 B;  2FCN A;  1WMH A;  2B76 B;  2MH7 A;  2QIE B;  2KQ7 A;  3WCQ A;  1I35 A;  2DHZ A;  1RAX A;  2WDQ B;  3NS8 A;  3ZNZ B;  4ZRQ A;  1C3T A;  3KH0 A;  1UD7 A;  1F9J A;  2EMS A;  2LI5 A;  3N9Y C;  1TS5 A;  3EA6 A;  1M94 A;  1F2R C;  3KWL A;  3NHE B;  2O6V B;  2V3N A;  3VH3 B;  2MX2 A;  1GPX A;  4LNI A;  2CHZ A;  1JWB D;  1TKG A;  5E6O A;  5HKH A;  2PW9 A;  2INP E;  2PVO D;  1WJN A;  4GB9 A;  2LVO A;  4HDQ A;  1CK1 A;  3ZO5 B;  1TIF A;  2KWD A;  5BMI A;  2O2V A;  2TSS A;  3DBR I;  3DBL I;  3R3M A;  2LEK A;  1LGR A;  5TR5 A;  1ZE3 D;  2UWQ A;  3WAO A;  1SIJ A;  2K0P A;  1KLG D;  4UDU C;  4DK5 A;  2QMT A;  4WQM A;  3RN9 C;  3VFK A;  1FRD A;  3TBL D;  3RYT A;  1WGY A;  2ZCB A;  2INC C;  2JRI B;  4TUU A;  1YJJ A;  1I42 A;  1TZO A;  3PLV A;  2QJL A;  2REX A;  2MP2 A;  3ZKJ C;  4ZOH C;  1S3S G;  4HRO A;  2MJD A;  4NJC A;  2K8C A;  2W82 A;  4WUR A;  4US8 A;  1WR6 E;  2RDB C;  1N5W A;  2DAF A;  3AU5 A;  1VJK A;  1UWX A;  3JSV A;  3L08 A;  4WAF A;  4FJZ A;  4DHJ D;  2WNM A;  2C7N B;  3DHI C;  2L76 A;  1J7C A;  3PLU A;  4KGR A;  3RNC C;  3OLM D;  5KHO A;  4FBJ B;  1KRH A;  2WDT B;  3VRA B;  1VZ6 A;  3RNB C;  4HXD A;  2AQ1 B;  5L83 A;  4NY0 A;  5EE9 A;  4I6L B;  4NAM A;  1RLF A;  2K25 A;  1D6E C;  3H7P A;  3AEF B;  1ZW7 A;  1OEY J;  3NOB A;  2G4D B;  1RYJ A;  2Y5B B;  2KTR B;  1ESF A;  1HEZ E;  3BZD B;  1SE9 A;  3DBS A;  5DCN A;  2M56 B;  2BS4 B;  4MGK E;  5CHV C;  5IP4 D;  3U8Z A;  2KDM A;  3V6C B;  1WM2 A;  3Q3J A;  5AUI A;  1E7U A;  3QAR A;  4KVG B;  4NZL B;  1KTK A;  1JRU A;  3PTF C;  1K8R B;  4XE0 A;  3RNE C;  5E6P A;  5LLI A;  2CJO A;  3VR9 B;  3I57 A;  2K9X A;  5I4D A;  1FNV A;  4PYZ A;  1FCC C;  4IM3 A;  3AE6 B;  5BYR A;  4WWM A;  2JY6 A;  3ZQ4 A;  1HZ5 A;  2WQY B;  2MLB A;  2BKF A;  3UIP B;  5IN7 A;  4XZ4 A;  3H6N A;  4GDK A;  3ZDT A;  3QIJ A;  1DOY A;  3M62 B;  1HZ6 A;  4BOS C;  4AS1 A;  3PRP B;  1VD2 A;  4CQN A;  1SF0 A;  1E90 A;  4L2Y A;  1R7S A;  3BII D;  2QEJ C;  3TIX A;  3OAW A;  3MJW A;  2D3G A;  5DPT A;  2WU2 B;  3ZUN A;  1NDD A;  3A4S C;  2JZP A;  1TY0 A;  1I4X A;  3ML8 A;  1ZOY B;  2WWZ A;  3BVZ A;  4KGT A;  1A70 A;  4BVU C;  2WX0 A;  2RD0 A;  3U2S C;  4YL8 A;  4JIO U;  3PRZ A;  3J9C A;  3VUY A;  2XEW A;  5E6J A;  4M01 A;  2O6V D;  1EO6 A;  2PLP A;  2KTR A;  3KYD D;  4JL9 A;  2PE6 B;  1JW9 D;  1GB4 A;  3AE1 B;  4BAX A;  4MGZ E;  4A55 A;  2VH2 A;  3D32 A;  4GGQ A;  2FBW B;  4TQ1 A;  4DDG D;  4EZJ A;  1BML C;  1ROE A;  5G2N A;  1WE7 A;  5T8I A;  3ONS A;  3RMK C;  3MC8 A;  3C19 A;  2PVG C;  4IWP A;  3AXC A;  4NAW B;  3IBE A;  2LFI A;  3VR8 B;  3Q8B A;  3V60 A;  4ARC A;  4Q2J A;  3NG0 A;  2R2Q A;  2BF8 B;  5JH5 C;  4BBN C;  4G11 A;  1V49 A;  4W9C A;  3NVV A;  4YTN B;  3IVF A;  4IWQ A;  2BVC A;  2WXQ A;  3GE3 C;  1H4R A;  2BB5 A;  1WM3 A;  2MSE D;  4C7Y A;  2VH1 A;  2I1K A;  3AUL A;  2BBC A;  4R3D A;  3A9K A;  1TY2 A;  2BQQ A;  2PJH A;  3WAL A;  1VRA B;  3AU4 A;  3DCG A;  3IG3 A;  1WJU A;  2DNF A;  3HIZ A;  3Q3O C;  2M8S A;  3BY4 B;  4YT0 B;  1OGW A;  1AAR A;  3U7D A;  2LGD A;  1IUE A;  2G4S A;  1WH3 A;  1P1A A;  1GNU A;  3B0A A;  4OHJ A;  1PGA A;  3HVD A;  3W1S A;  2MA9 B;  4C4V A;  1XD3 B;  4TSS A;  4OVV A;  1WZ3 A;  3L13 A;  2NS5 A;  4AQ7 A;  4JLC A;  2J0K A;  2YLM A;  1STE A;  2M19 A;  3ML9 A;  2OJR A;  3I5J C;  3NY5 A;  1SE2 A;  3W1Y A;  2JXX A;  4MT5 A;  5EE3 A;  3AE2 B;  3PRE A;  3PO0 A;  2V4I B;  4RMA A;  1LM8 B;  3H9D A;  2D2Q A;  4M02 A;  1SJE D;  1K51 A;  5D2M B;  2BW2 A;  1E9M A;  4HVB A;  3W5U B;  4EEW A;  2WDV B;  2KQS A;  1IYF A;  3VTV A;  1WGR A;  5JXV A;  4E3C A;  1N60 A;  2KWV B;  3HUI A;  1EF5 A;  3AI5 A;  2M0X A;  1WX7 A;  2N1V A;  5EE0 A;  3AEA B;  2ZNV C;  3QJZ A;  1N63 A;  5L95 C;  5FK9 C;  2Y3A A;  1WI0 A;  4G0N B;  1YQ3 B;  1P0R A;  2ZVN A;  2IY1 B;  4EKU A;  2N7E A;  2M17 A;  2M1M A;  2KAC A;  4MGI E;  1EU3 A;  2ZNV B;  3A33 B;  2OED A;  2N4F A;  4P6V F;  2CU1 A;  1EM7 A;  2KC1 A;  1FRR A;  1PUT A;  4ZRP A;  2BYF A;  1V1O A;  2WP9 B;  5J18 A;  2G9H D;  2LRU A;  3I9V 1;  1Z2M A;  2LZ6 A;  2J4X A;  2G1E A;  3CSF A;  3PT2 B;  4ZYN A;  2A4Z A;  3FIL A;  2INN E;  1UBQ A;  4IKG A;  4WWP A;  2NVU I;  2JYT A;  4NJ7 A;  3W5V B;  5AZH A;  1NYQ A;  3QC8 B;  1S1Q B;  3TMP B;  2G3Q B;  2IZV B;  2MBB B;  2J7Q B;  1IBX B;  2LGS A;  1UBI A;  2K8H A;  1JRO A;  2C7H A;  4II2 B;  1E8Z A;  3P42 A;  1TS3 A;  4QAY A;  2Z0E B;  2CHX A;  2DZJ A;  1XT9 B;  2GMI C;  4HKQ A;  3ETR A;  2A5U A;  4KZC A;  1C77 A;  1PYW D;  1QOG A;  1WFY A;  1XLQ A;  3EC8 A; 
#chains in the Genus database with same CATH homology
 4YTM B;  3IXS A;  1WXQ A;  2NTS A;  1YJJ A;  4A90 A;  1TZO A;  3AEC B;  1LO5 D;  2QJL A;  2ZW1 A;  3NVZ A;  1BUI C;  3KLS X;  4N58 A;  4OZA A;  1WWT A;  1ET9 A;  3HRD D;  1I4G A;  1ZPS A;  1SB3 C;  4L23 A;  4ZOH C;  5BMG A;  4HRO A;  4KKI A;  1FXA A;  2MJD A;  4YXD B;  1XCT L;  1DYQ A;  1N5X A;  4NJC A;  2W82 A;  1D5Z C;  2RDH A;  4WUR A;  4US8 A;  1L4D B;  1YJI A;  1SBB B;  5D3D A;  1FNW A;  5D3I B;  4C7Z A;  1N5W A;  4WIP A;  2PTL A;  2D5G A;  2KAJ A;  1VJK A;  2R61 A;  2WDR B;  3LXF A;  1UWX A;  3RFZ B;  4WAF A;  1FCL A;  1NYR A;  2H89 B;  2WNM A;  2MJ3 A;  1YNT E;  4GDL B;  1OQQ A;  3OWE B;  1J7C A;  4KGR A;  3P63 A;  4XDC A;  1QT9 A;  3AM9 A;  4XWT A;  1KRH A;  2V3P A;  4YSX B;  2WXM A;  1L0V B;  4GLS C;  3VRA B;  3NS1 A;  2PKO A;  3B2G A;  1VZ6 A;  2AX5 A;  2AQ1 B;  1UNS A;  4JWS C;  1EWC A;  2WXI A;  1TJE A;  5EE9 A;  4NAM A;  1C9F A;  1YMH E;  1D6E C;  1AWD A;  2QSD A;  2IGG A;  3AEF B;  2ON8 A;  4A9A A;  2XNA C;  2RMM A;  1ENF A;  1J7A A;  1QKZ A;  1AN8 A;  1RYJ A;  3ZJV A;  3AV8 A;  1ESF A;  1HEZ E;  3GP7 A;  2JX5 A;  2OHF A;  3IAS 1;  3TSS A;  3Q8E A;  2BS2 B;  3BZD B;  3W2D A;  3AE5 B;  3IAM 1;  2M56 B;  2CJN A;  3VQI A;  1L6U A;  2BS4 B;  1ZXH A;  5C2T B;  1QLB B;  2KDM A;  2WXH A;  2DBY A;  3BYT B;  1JQ4 A;  2CU3 A;  2IJ0 A;  5AUI A;  1NVI D;  1XCQ L;  2W55 A;  1NEN B;  2LUM A;  1L5P A;  4OVZ A;  1MVK A;  2M0A A;  4TQ0 A;  2WXN A;  1PGB A;  2WS3 B;  1PGX A;  1RM6 C;  1WRI A;  4NZL B;  3ZGZ A;  1KTK A;  1SE4 A;  1ZDX A;  3BWU D;  4XWW A;  5C3J B;  2WXF A;  1FM0 D;  1TS2 A;  2RDG A;  2J52 A;  2I2Y A;  3SEB A;  3O13 A;  4XE0 A;  1ACC A;  1FNU A;  5HHD G;  1FD6 A;  4JE3 B;  1UGJ A;  3B9J A;  4OZC A;  4HKZ E;  2CJO A;  4YSY B;  3B2F A;  3I57 A;  1K50 A;  3VR9 B;  3PZ7 A;  4ZHO A;  2K9X A;  1L6V A;  3BK2 A;  5HI1 A;  1VLB A;  3ZYY X;  2J42 A;  5I4D A;  4O1N A;  1WYG A;  4D2K A;  2YEP F;  3BYY B;  4B0E A;  3DWM A;  1VDV A;  1FNV A;  2WXJ A;  3FIL B;  1FCC C;  2L83 A;  3AE6 B;  1CJE A;  3Q8A A;  3BVM A;  3DWG C;  4WWM A;  3HVZ A;  5BYR A;  1E10 A;  5H8Y E;  5G5G A;  3TEZ A;  3EUB 2;  3NUH B;  3ZQ4 A;  1HZ5 A;  2WQY B;  4MH8 A;  5BMH A;  2DLB A;  3AE9 B;  3KWV A;  1WGK A;  3AE3 B;  1GAQ B;  2PMV A;  2SEB D;  3TEY A;  1XLP A;  1DOY A;  2WXK A;  1YN4 A;  1K52 A;  2YEP B;  3P1M A;  2K5P A;  1MPE A;  1HZ6 A;  4AS1 A;  1SJH D;  3CWI A;  4CQN A;  1E6E B;  1SF0 A;  3GB1 A;  5G5H A;  1K53 A;  4L2Y A;  1R7S A;  4FXC A;  3BII D;  2QEJ C;  4RF0 A;  2L52 A;  3EGR A;  1ET6 A;  3MC0 B;  5BYS A;  1RWS A;  2WU2 B;  2JU6 X;  2JWU A;  4IOI E;  3CIR B;  2W3R A;  1NEK B;  2DWQ A;  3AED B;  2JZP A;  3W9C B;  1TY0 A;  4ZHP A;  2AQ3 B;  1B1Z A;  1I4X A;  4P16 A;  1ZOY B;  3BVZ A;  3Q69 A;  3L4P A;  4KGT A;  4B0M A;  1A70 A;  2WLB A;  2BYT A;  5H92 C;  1SXT A;  2HTM E;  2N9L A;  3U2S C;  1D5X C;  1KLU D;  3J9C A;  3PZ8 A;  1FO4 A;  1I4P A;  2LHD A;  4LLG M;  5E6J A;  3AE8 B;  3AEG B;  1JCK B;  4RGT A;  1VZ8 A;  1GB1 A;  1F77 A;  2PLP A;  1QIL A;  3GS2 A;  1AW7 A;  1JW9 D;  1GB4 A;  1C79 A;  2K22 A;  3AE1 B;  4A55 A;  4RFB A;  4TMA B;  1QQR A;  2BS3 B;  4USA A;  2FBW B;  3AB5 A;  4TQ1 A;  1BML C;  1ROE A;  1ZDV A;  1B9R A;  4KGS A;  2IGH A;  2KMM A;  5T8I A;  3SFD B;  2WXP A;  2NTT A;  2EKI A;  2PVG C;  3U7Z A;  4NAW B;  3RPF C;  2ZW0 A;  1FMA D;  1ZP0 B;  3IT6 B;  1I7H A;  2LFI A;  1YQ4 B;  3VR8 B;  1F2R I;  2L32 A;  3ABV B;  5BYQ A;  3Q8B A;  5TSS A;  5FKA C;  1GOZ A;  2NMQ A;  4ARC A;  1IGC A;  1FIQ A;  4Q2J A;  5AUK A;  3VRB B;  2Z8L A;  1T6B X;  1V1P A;  1SE3 A;  4OZB A;  2JSV X;  1IBX A;  3NVV A;  5MPO A;  4WH4 A;  4YTN B;  1EWY C;  1I4R A;  1KF6 B;  5EE1 A;  2WXQ A;  2I38 A;  2IPK D;  5LNK 1;  3R8B A;  1JAL A;  1C78 A;  2ONQ A;  2BB5 A;  3R2I A;  4C7Y A;  2W3S A;  1V8C A;  4C56 C;  2BBC A;  1XO3 A;  2IGD A;  1BXT A;  1QOF A;  4R3D A;  4DXG A;  1FFU A;  1TY2 A;  1OFF A;  4RGO S;  4C80 A;  4OW0 A;  1KFY B;  1VRA B;  1KH0 A;  3MJ5 A;  2QIL A;  2Y5P A;  4RNA A;  1JWA D;  1DOX A;  4N59 A;  4YT0 B;  4JWU C;  1C76 A;  3ZJT A;  1ZXI A;  3AMZ A;  2BTE A;  2V0G A;  3R2T A;  3NZ3 A;  2DYM A;  4IDI A;  1FEH A;  1IUE A;  1UUP A;  4KKJ A;  4OHJ A;  1WSP A;  1PGA A;  2ACZ B;  2N7J A;  2JQR B;  3HVD A;  2KQ4 X;  3W1S A;  2LMC A;  4JX1 C;  4RH6 A;  1M4V A;  4TSS A;  1PDX A;  4L1B A;  1JWS D;  2VZK B;  4AQ7 A;  1JWM D;  1YN5 A;  1F0Z A;  1L4Z B;  3T3O A;  1STE A;  2M19 A;  2N9K A;  4YTP B;  4DQO C;  2WXO A;  1DOI A;  1XLN A;  1XF5 L;  1V97 A;  2E3T A;  2WXG A;  2AQ2 B;  1SE2 A;  3E9S A;  1C4A A;  1XLO A;  2LJI A;  3MHZ A;  2XN9 C;  4EE2 A;  4MT5 A;  1NI3 A;  2JYE A;  4J3O D;  3TEW A;  5EE3 A;  3AE2 B;  2JXT A;  2LHE A;  3UI3 A;  3V05 A;  1TS4 A;  3PO0 A;  3LYY A;  2HDE A;  1I4Q A;  2V4I B;  2WXR A;  3P4S B;  1QOB A;  1MI0 A;  2GI9 A;  2KN4 A;  2LGI A;  1L0Y B;  4XDD A;  2K3U A;  1SJE D;  1K51 A;  2BW2 A;  1E9M A;  4LTU A;  3Q8C A;  3BVG A;  3ZJU A;  3W5U B;  2WDV B;  1FXI A;  1N62 A;  4PT5 A;  4GDK B;  1MHH E;  3TUO A;  4MAC A;  5JXV A;  2WU5 B;  2Y5C A;  4JPS A;  1N60 A;  3HUI A;  1HQR D;  2BB6 A;  1J7B A;  4RF1 A;  3AH7 A;  1C4C A;  3AEE B;  4RCO A;  1HXY D;  5EE0 A;  3AEA B;  2J53 A;  1N63 A;  1N61 A;  1TKE A;  3E56 A;  4DXF A;  4ITK A;  5FK9 C;  2Y3A A;  1TKY A;  1YN3 A;  2W54 A;  4YSZ B;  1MHX A;  1YQ3 B;  2BT6 A;  2MJE A;  1RFK A;  5FR3 A;  1T5X D;  5D7G A;  3KQ4 A;  1JRP A;  1JWU D;  2FUG 1;  2RPV A;  2GRI A;  3U4E G;  1E0Z A;  1QOA A;  4HRS A;  3LB8 C;  3H8H A;  3P4Q B;  1L0X B;  3SR6 A;  1D4B A;  4RGN A;  1DGJ A;  2KAC A;  3AN1 A;  1EU3 A;  3P4R B;  5GXG B;  1ZUD 2;  1T3Q A;  1EU4 A;  3BK1 A;  1Q10 A;  1CQV A;  3IT4 B;  2IDY A;  2OED A;  3SFE B;  3TEX A;  3FAH A;  1P7E A;  2EEL A;  4P6V F;  4N6E B;  2Q5W D;  1EM7 A;  4H2A A;  1FRR A;  3NVY A;  1PUT A;  4ZRP A;  1V1O A;  2WP9 B;  2G9H D;  2E6X A;  4KX6 B;  2B76 B;  2MH7 A;  2QIE B;  3FC4 A;  1QF6 A;  3WCQ A;  3AE4 B;  3I9V 1;  2WDQ B;  1XEE A;  2ICI A;  2N0S B;  2VZK D;  4ZRQ A;  2WXL A;  1IGD A;  4ARI A;  2J4X A;  3C8Y A;  3N9Y C;  1TS5 A;  3AE7 B;  3MP9 A;  2G1E A;  3EA6 A;  1F2R C;  3KWL A;  2V3N A;  3NVW A;  1SEB D;  1PFD A;  3FIL A;  2INN E;  1GPX A;  1JWB D;  2L1A A;  1CZP A;  4US9 A;  1TKG A;  4MM3 B;  4IKG A;  2JYT A;  4A6Q A;  2PW9 A;  1AYF A;  2INP E;  3W5V B;  1SSN A;  2PVO D;  1NYQ A;  1C4P A;  1TYG B;  2X38 A;  3V3X A;  1CK1 A;  1V1P B;  1OQR A;  2FE8 A;  4LK0 M;  1IBX B;  1Y56 A;  2KWD A;  5BMI A;  1VZ7 A;  5HFY A;  2TSS A;  3MFG A;  1JRO A;  1HA5 A;  2MEK A;  1D5M C;  2PIA A;  2H88 B;  3P42 A;  1TS3 A;  3URY A;  2LEK A;  3T3N A;  4A8X C;  1P7F A;  1VR9 A;  1ZE3 D;  4ZYS A;  2GB1 A;  4HEA 1;  4HJG E;  4REZ A;  1FFV A;  3AEB B;  4YWG G;  1XXG A;  3U52 E;  1JML A;  1SIJ A;  3ETR A;  2SAK A;  3P4P B;  4HKQ A;  2K0P A;  1C77 A;  1PYW D;  1KLG D;  1QOG A;  1UWM A;  4UDU C;  1XLQ A;  4M0W A;  2QMT A;  3Q8F A;  4WQM A;  5HG2 A;  2DYO A;  4RGM A;  3NRZ A;  1FRD A;  1I4H A;  1E7P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...