3V45A

Crystal structure of de novo designed serine hydrolase osh55, northeast structural genomics consortium target or130
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
ARIREVQGDITEFQGDAIVNAANNYLKLGAGVAGAILRKGGPSIQEECDRIGKIRVGEAAVTGAGNLPVRYVIHAAVLGDEPASLETVRKATKSALEKAVELGLKTVAFTALGAWVGGLPAEAVLRVMLEEIKKAPDTLEVTGVHGTEKSAEAARRALLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of activated serine-containing catalytic triads with atomic-level accuracy.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords Serine hydrolase OSH55
total genus 56
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2011-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3v45A00
2VRIA 3JRUA 5FSZA 4GVWA 4D86A 4GVVA 3GQOA 4JVVA 4ZY2A 3SIGA 3GQEA 4R7MA 4IQYA 3KZWA 4GUAA 5CB5A 5HIHA 3EJFA 2DX6A 3KR4A 4R6TA 5DUSA 3JZTA 4ETKA 4J5QA 2FAVA 5FSUA 1VHUA 4KSIA 3KQZA 2J9AA 1TXZA 1LCPA 5HOLA 5CMSA 4J5SA 3IJ3A 2BFRA 4ETJA 4ABKA 4ZY1A 2L8RA 2LGRA 4J5RA 1BLLE 5FSYA 4UMLA 1ZR5A 5CBMA 3GPOA 4J4ZA 3Q71A 3EWQA 3V45A 2FXKA 3EWOA 3IIDA 4KYBA 3SIJA 5AILA 3SIIA 5E3BA 4K0CA 4JCAA 3EJGA 4ZY0A 1ZR3A 3KQXA 1LANA 1GYTA 3IIFA 1HJZA 1SPVA 3EKEA 2ACFA 3Q6ZA 3EWRA 3SIHA 1LAPA 3GPGA 1YD9A 4ZX8A 4TU0A 5D8NA 4ZYQA 1BPMA 3H8EA 1LAMA 4JGKA 3ETIA 3VFQA 4JLLA 2EWBA 4X2TA 5FSVA 4ESSA 4R76A 5FSXA 1NJRA 2AFCA 3KR5A 2FG1A 3EWPA 1BPNA 3H8GA 4ZI6A 3PEIA 3H8FA 5CB3A 4ZX9A 2X47A 3T8WA 2BFQA 4ABLA 3GPQA 2EEEA 2XD7A 4K3NA 1TY8A 3V2BA 3EW5A
chains in the Genus database with same CATH superfamily
2VRIA 3JRUA 2JZEA 5FSZA 4GVWA 4D86A 4GVVA 3GQOA 4JVVA 4ZY2A 3SIGA 3GQEA 4R7MA 4IQYA 3KZWA 4GUAA 5CB5A 5HIHA 3EJFA 2DX6A 3KR4A 4R6TA 5DUSA 3JZTA 4ETKA 4J5QA 2FAVA 5FSUA 1VHUA 4KSIA 3KQZA 2J9AA 1TXZA 1LCPA 5HOLA 5CMSA 4J5SA 3IJ3A 2BFRA 2KQVA 4ETJA 4ABKA 4ZY1A 2L8RA 2LGRA 4J5RA 1BLLE 5FSYA 4UMLA 1ZR5A 5CBMA 3GPOA 4J4ZA 3Q71A 3EWQA 3V45A 2FXKA 3EWOA 3IIDA 4KYBA 3SIJA 5AILA 3SIIA 5E3BA 4K0CA 4JCAA 3EJGA 4ZY0A 1ZR3A 2JZDA 3KQXA 1LANA 1GYTA 3IIFA 1HJZA 1SPVA 3EKEA 2ACFA 3Q6ZA 3EWRA 3SIHA 1LAPA 3GPGA 1YD9A 4ZX8A 4TU0A 5D8NA 4ZYQA 1BPMA 3H8EA 1LAMA 2W2GA 4JGKA 3ETIA 3VFQA 4JLLA 2EWBA 4X2TA 5FSVA 4ESSA 4R76A 5FSXA 1NJRA 2WCTA 2AFCA 3KR5A 2JZFA 2FG1A 3EWPA 1BPNA 3H8GA 4ZI6A 3PEIA 3H8FA 5CB3A 4ZX9A 2X47A 3T8WA 2BFQA 4ABLA 3GPQA 2EEEA 2XD7A 4K3NA 1TY8A 2RNKA 3V2BA 3EW5A
chains in the Genus database with same CATH topology
2VRIA 3JRUA 5FSZA 4GVWA 4D86A 4GVVA 3GQOA 4JVVA 4ZY2A 3SIGA 3GQEA 4R7MA 4IQYA 3KZWA 4GUAA 5CB5A 5HIHA 3EJFA 2DX6A 3KR4A 4R6TA 5DUSA 3JZTA 4ETKA 4J5QA 2FAVA 5FSUA 1VHUA 4KSIA 3KQZA 2J9AA 1TXZA 1LCPA 5HOLA 5CMSA 4J5SA 3IJ3A 2BFRA 4ETJA 4ABKA 4ZY1A 2L8RA 2LGRA 4J5RA 1BLLE 5FSYA 4UMLA 1ZR5A 5CBMA 3GPOA 4J4ZA 3Q71A 3EWQA 3V45A 2FXKA 3EWOA 3IIDA 4KYBA 3SIJA 5AILA 3SIIA 5E3BA 4K0CA 4JCAA 3EJGA 4ZY0A 1ZR3A 3KQXA 1LANA 1GYTA 3IIFA 1HJZA 1SPVA 3EKEA 2ACFA 3Q6ZA 3EWRA 3SIHA 1LAPA 3GPGA 1YD9A 4ZX8A 4TU0A 5D8NA 4ZYQA 1BPMA 3H8EA 1LAMA 4JGKA 3ETIA 3VFQA 4JLLA 2EWBA 4X2TA 5FSVA 4ESSA 4R76A 5FSXA 1NJRA 2AFCA 3KR5A 2FG1A 3EWPA 1BPNA 3H8GA 4ZI6A 3PEIA 3H8FA 5CB3A 4ZX9A 2X47A 3T8WA 2BFQA 4ABLA 3GPQA 2EEEA 2XD7A 4K3NA 1TY8A 3V2BA 3EW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VRI A;  3JRU A;  5FSZ A;  4GVW A;  4D86 A;  4GVV A;  3GQO A;  4JVV A;  4ZY2 A;  3SIG A;  3GQE A;  4R7M A;  4IQY A;  3KZW A;  4GUA A;  5CB5 A;  5HIH A;  3EJF A;  2DX6 A;  3KR4 A;  4R6T A;  5DUS A;  3JZT A;  4ETK A;  4J5Q A;  2FAV A;  5FSU A;  1VHU A;  4KSI A;  3KQZ A;  2J9A A;  1TXZ A;  1LCP A;  5HOL A;  5CMS A;  4J5S A;  3IJ3 A;  2BFR A;  4ETJ A;  4ABK A;  4ZY1 A;  2L8R A;  2LGR A;  4J5R A;  1BLL E;  5FSY A;  4UML A;  1ZR5 A;  5CBM A;  3GPO A;  4J4Z A;  3Q71 A;  3EWQ A;  3V45 A;  2FXK A;  3EWO A;  3IID A;  4KYB A;  3SIJ A;  5AIL A;  3SII A;  5E3B A;  4K0C A;  4JCA A;  3EJG A;  4ZY0 A;  1ZR3 A;  3KQX A;  1LAN A;  1GYT A;  3IIF A;  1HJZ A;  1SPV A;  3EKE A;  2ACF A;  3Q6Z A;  3EWR A;  3SIH A;  1LAP A;  3GPG A;  1YD9 A;  4ZX8 A;  4TU0 A;  5D8N A;  4ZYQ A;  1BPM A;  3H8E A;  1LAM A;  4JGK A;  3ETI A;  3VFQ A;  4JLL A;  2EWB A;  4X2T A;  5FSV A;  4ESS A;  4R76 A;  5FSX A;  1NJR A;  2AFC A;  3KR5 A;  2FG1 A;  3EWP A;  1BPN A;  3H8G A;  4ZI6 A;  3PEI A;  3H8F A;  5CB3 A;  4ZX9 A;  2X47 A;  3T8W A;  2BFQ A;  4ABL A;  3GPQ A;  2EEE A;  2XD7 A;  4K3N A;  1TY8 A;  3V2B A;  3EW5 A; 
#chains in the Genus database with same CATH topology
 2VRI A;  3JRU A;  2JZE A;  5FSZ A;  4GVW A;  4D86 A;  4GVV A;  3GQO A;  4JVV A;  4ZY2 A;  3SIG A;  3GQE A;  4R7M A;  4IQY A;  3KZW A;  4GUA A;  5CB5 A;  5HIH A;  3EJF A;  2DX6 A;  3KR4 A;  4R6T A;  5DUS A;  3JZT A;  4ETK A;  4J5Q A;  2FAV A;  5FSU A;  1VHU A;  4KSI A;  3KQZ A;  2J9A A;  1TXZ A;  1LCP A;  5HOL A;  5CMS A;  4J5S A;  3IJ3 A;  2BFR A;  2KQV A;  4ETJ A;  4ABK A;  4ZY1 A;  2L8R A;  2LGR A;  4J5R A;  1BLL E;  5FSY A;  4UML A;  1ZR5 A;  5CBM A;  3GPO A;  4J4Z A;  3Q71 A;  3EWQ A;  3V45 A;  2FXK A;  3EWO A;  3IID A;  4KYB A;  3SIJ A;  5AIL A;  3SII A;  5E3B A;  4K0C A;  4JCA A;  3EJG A;  4ZY0 A;  1ZR3 A;  2JZD A;  3KQX A;  1LAN A;  1GYT A;  3IIF A;  1HJZ A;  1SPV A;  3EKE A;  2ACF A;  3Q6Z A;  3EWR A;  3SIH A;  1LAP A;  3GPG A;  1YD9 A;  4ZX8 A;  4TU0 A;  5D8N A;  4ZYQ A;  1BPM A;  3H8E A;  1LAM A;  2W2G A;  4JGK A;  3ETI A;  3VFQ A;  4JLL A;  2EWB A;  4X2T A;  5FSV A;  4ESS A;  4R76 A;  5FSX A;  1NJR A;  2WCT A;  2AFC A;  3KR5 A;  2JZF A;  2FG1 A;  3EWP A;  1BPN A;  3H8G A;  4ZI6 A;  3PEI A;  3H8F A;  5CB3 A;  4ZX9 A;  2X47 A;  3T8W A;  2BFQ A;  4ABL A;  3GPQ A;  2EEE A;  2XD7 A;  4K3N A;  1TY8 A;  2RNK A;  3V2B A;  3EW5 A; 
#chains in the Genus database with same CATH homology
 2VRI A;  3JRU A;  5FSZ A;  4GVW A;  4D86 A;  4GVV A;  3GQO A;  4JVV A;  4ZY2 A;  3SIG A;  3GQE A;  4R7M A;  4IQY A;  3KZW A;  4GUA A;  5CB5 A;  5HIH A;  3EJF A;  2DX6 A;  3KR4 A;  4R6T A;  5DUS A;  3JZT A;  4ETK A;  4J5Q A;  2FAV A;  5FSU A;  1VHU A;  4KSI A;  3KQZ A;  2J9A A;  1TXZ A;  1LCP A;  5HOL A;  5CMS A;  4J5S A;  3IJ3 A;  2BFR A;  4ETJ A;  4ABK A;  4ZY1 A;  2L8R A;  2LGR A;  4J5R A;  1BLL E;  5FSY A;  4UML A;  1ZR5 A;  5CBM A;  3GPO A;  4J4Z A;  3Q71 A;  3EWQ A;  3V45 A;  2FXK A;  3EWO A;  3IID A;  4KYB A;  3SIJ A;  5AIL A;  3SII A;  5E3B A;  4K0C A;  4JCA A;  3EJG A;  4ZY0 A;  1ZR3 A;  3KQX A;  1LAN A;  1GYT A;  3IIF A;  1HJZ A;  1SPV A;  3EKE A;  2ACF A;  3Q6Z A;  3EWR A;  3SIH A;  1LAP A;  3GPG A;  1YD9 A;  4ZX8 A;  4TU0 A;  5D8N A;  4ZYQ A;  1BPM A;  3H8E A;  1LAM A;  4JGK A;  3ETI A;  3VFQ A;  4JLL A;  2EWB A;  4X2T A;  5FSV A;  4ESS A;  4R76 A;  5FSX A;  1NJR A;  2AFC A;  3KR5 A;  2FG1 A;  3EWP A;  1BPN A;  3H8G A;  4ZI6 A;  3PEI A;  3H8F A;  5CB3 A;  4ZX9 A;  2X47 A;  3T8W A;  2BFQ A;  4ABL A;  3GPQ A;  2EEE A;  2XD7 A;  4K3N A;  1TY8 A;  3V2B A;  3EW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...