3V4BA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and l-tartrate
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
402
structure length
384
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIDLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and l-tartrate
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
total genus 142
structure length 384
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v4bA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v4bA01
2GGGA 3VCNA 3DERA 4G7FA 4A35A 2OKTA 3OPSA 2OZ8A 2PS2A 3MWCA 2PGEA 5J04A 2ONEA 3RR1A 3FVDA 3UXLA 4KWSA 4G8TA 3TW9A 2PU1A 1FHVA 4GIRA 3PWGA 4H2HA 3DG3A 1XPYA 2P0IA 3DGBA 2OZTA 5FJRA 1MNSA 3RRAA 2HXUA 3QKEA 2QDDA 4A6GA 3HPFA 4E5TA 1P48A 3R10A 1E9IA 3S47A 2XH2A 3SN0A 4IP5A 3Q45A 2PODA 4J3ZA 4FI4A 3H70A 4DX3A 1ELSA 1JDFA 2P88A 3OTRA 3ES8A 1JCTA 3PFRA 2POZA 3MSYA 1KCZA 1DTNA 3V5FA 4YWSA 3MZNA 3TWAA 3GY1A 1EC7A 2MNRA 4HN8A 3ES7A 5FJPA 1IYXA 2DW6A 4K1WA 2OG9A 1SJDA 3R1ZA 2HNEA 2ZADA 4KT2A 1RVKA 4IP4A 4H19A 3H8AA 3UGVA 1MRAA 7ENLA 1MDRA 3MKCA 3MUCA 3VDGA 3UCDA 3DG6A 4GGBA 2PP3A 3B97A 3FYYA 5BOEA 1L8PA 3ZVHA 5BOFA 3UJSA 2O56A 1PDZA 3SBFA 2OQYA 1BKHA 2AKZA 2OQHA 2AKMA 4MKSA 3UXKA 3IJQA 4IT1A 1OEPA 3QN3A 3U4FA 3SQSA 4ROPA 4GYPC 3H12A 4A3RA 2PPGA 3UJFA 3R11A 3R25A 3NXLA 1SJCA 3PWIA 3ZLGA 2OFJA 1FHUA 3NZGA 2PTYA 4HCLA 3PK7A 2QGYA 3EKGA 4HNLA 4Z1YA 3QLDA 2HZGA 3VC6A 4H83A 6ENLA 4ZCWA 2OVLA 3V3WA 3CYJA 4X2PA 1F9CA 2XH0A 2FKPA 3CXOA 2PTXA 2P8CA 1BQGA 3T6CA 1YEYA 3U9IA 2GGIA 2OZ3A 2AL2A 2OX4A 3JVAA 3CB3A 4DN1A 3GC2A 2PU0A 3OZMA 1TZZA 3IJIA 1SJBA 2PSNA 3QPEA 3DEQA 3D47A 4IL0A 3OW1A 2QJJA 1ECQA 3P0WA 2GGHA 3DFHA 4M0XA 3DFYA 4K2SA 3SSZA 4ZA0A 3N4EA 2DW7A 2MUCA 4M6UA 2GGJA 1JPDX 2XSXA 4GYPA 4E4FA 3DESA 3T9PA 1TE6A 1KKOA 3V4BA 1R6WA 3H7VA 2OLAA 2OPJA 3VA8A 3TQPA 2PTZA 3EEZA 3SN4A 3ZLHA 4GISA 3V5CA 3P93A 3I6EA 2XGZA 3OZYA 2GL5A 3SJNA 1XS2A 3SN1A 3K1GA 3NFUA 4DYEA 3ZLFA 4J1OA 2PP0A 3R0KA 1NELA 3FXGA 1MUCA 3RGTA 3KUMA 4JN7A 3T4WA 4GMEA 3MY9A 4F4RA 4K8GA 1P43A 2HXTA 3CT2A 2PP1A 3QTPA 2XH7A 3VC5A 3R0UA 3DIPA 5FJOA 4GGHA 3P3BA 3TCSA 4ENLA 4DXKA 5IDZA 4MGGA 3S5SA 3I6TA 3ZVIA 2QDEA 3ENLA 3IK4A 2PMQA 5EU9A 2GSHA 4IZGA 1SJAA 3FJ4A 3CAWA 3UJEA 3STPA 4DHGA 3RITA 1EC8A 3UJ2A 3N4FA 4KEMA 3TOYA 3JZUA 2RDXA 3BJSA 3RCYA 2NQLA 2ZC8A 1PDYA 3BOXA 3T8QA 2GGEA 4E4UA 2QJNA 4HYRA 3CK5A 3FV9A 3RO6A 2PGWA 4JN8A 2CHRA 2PA6A 1KKRA 2PTWA 2GDQA 3ZVHB 1KD0A 4HPNA 4HNCA 4E8GA 3TJIA 4H1ZA 1WUFA 2OO6A 4JHMA 5ENLA 1MDLA 3N6HA 1R0MA 1EBGA 2XH4A 2QVHA 3FCPA 3GO2A 4GFIA 3TJ4A 3TWBA 3THUA 3JW7A 4E6MA 4IL2A 3I4KA 4FP1A 4EWJA 2FYMA 3BSMA 4MMWA 3DG7A 4Z17A 3TTEA 2AL1A 1W6TA 3DDMA 4IHCA 3MQTA 3VFCA 1ONEA 2PCEA 1WUEA 2I5QA 1EC9A 4HCHA 3N6JA 5FJUA 2AL2B 3OP2A 3VCCA 3GD6A 3D46A 4DWDA 1TKKA 3Q4DA 4HCDA 4KPLA 2QJMA 3NO1A 1EBHA 3IJLA 2P3ZA 2P8BA 2QQ6A 3UJRA 3UCCA 5FJTA 1NU5A 1JPMA
chains in the Genus database with same CATH superfamily
1AA1B 2DFAA 4I9AA 1U5VA 1CNVA 3EB3A 4J2PA 4CNSA 3U5YA 4MJ2A 3ARRA 1XDIA 5LYRA 1M03A 1XLIA 2OZ8A 2IMRA 4LVBA 3WFLA 3R8GA 2HNHA 5J04A 1J4EA 4J27A 3WNPA 1AH3A 1EH9A 3SY1A 3IGHX 5DMMA 5FKYA 1HIZA 2W4XA 2R1NA 5CC5A 1RQEA 2GJXA 1C8XA 4YN5A 4GZEA 1KNWA 3WIJA 2E8YA 2NZLA 3CHVA 2WOIA 3URNA 1IZJA 1KWKA 1FWAC 4JQ4A 5HMFA 2DZVA 3CV1A 4CD6A 4MNMA 1UZ1A 4BJHA 3SFKA 2FIQA 1CGVA 3MUXA 2I17A 3QC0A 2PEVA 5EFDA 2OYMA 1QK0A 5GJNA 4EOUA 2BP1A 5FJIA 1SYTA 2FTPA 2XN0A 1JZ8A 4PB5A 3NWRA 4IUGA 3KLKA 1TV8A 2DUZA 3KLLA 2A7NA 1W9PA 4IPIA 2OG9A 4DIAA 1GZ1A 3BWWA 1MI3A 2GK1B 3W37A 4UFHA 2HNEA 3KDOA 2WK2A 4QSFA 4JKLA 1K9EA 4DB7A 4H19A 3B9DA 4RV8A 3J7HA 2QMKA 4ZODA 1TIMA 2DVTA 3KHJA 1SM9A 1Y5WA 4LWWA 3M4HA 2CLEA 3K8MA 1EP2A 3LX9A 3A22A 2ZRZA 3VVGA 1D7FA 3KVJA 1XDMA 1JIBA 3QQWA 4KS0A 1Z69A 4OU1A 3WMBA 3EWYA 1AZ1A 4B90A 4IX2A 3UZXA 1W9XA 3AROA 5FMHA 2WSQA 4FEZA 3IVSA 3UQNA 1PV8A 3GWQA 2EG6A 3COTA 3DU0A 3RPTA 5I3FA 5J5DA 1F4HA 3II4A 3NVWB 3UJFA 1KM3A 1O94A 5AVNA 4MDOA 1QHPA 3NIYA 5AC5A 2W5FA 4GO9A 1GETA 3LLFA 2A3LA 3VKBA 5AFDA 4XKYB 3AUOA 2G97A 5G5HB 3IJ9A 1CYGA 3W1NA 3CYJA 4K8HA 5FS8A 2XIJA 3L21A 2GH5A 4PYSA 1BQGA 3NQ6A 3ZR4A 2GPTA 1PX3A 2JBMA 5CAHA 3FY1A 3WQPA 4E3TA 3BOFA 4NEVA 1XLBA 4Q4QA 3GC2A 1W3LA 3IJIA 3M5XA 3SCOA 4RE3A 5EBUA 3D47A 3MB9A 2INFA 4CN4A 5BZAA 1NF0A 1B57A 1G9HA 5K9CA 4ZSTA 5I24A 5AECA 1EP3A 4LAOA 4AZBA 1TUXA 3EMQA 3SY8A 3W9ZA 1UR1A 4NAFB 3S6DA 3HM7A 4E3VA 1G67A 5E0KA 1QOPA 5ABEA 1BGAA 2CU0A 2C13A 2ZX8A 3QY7A 3RF9A 1GVIA 2J3NA 3MKKA 1Q6LA 3EEZA 2D23A 2DIJA 3W38A 3QPYA 1BSLA 2Z2UA 2Y5JA 1VPXA 5M2FX 1J9YA 4QR6A 2D73A 4HOXA 1GOQA 1Q63A 3OZYA 4E4PA 2GL5A 4H01A 4O50A 3OQEA 4DUWA 2WWDA 4QSHA 5D05A 2I16A 1H61A 2W79A 4MNKA 3ZWSA 4LW7A 3LBMA 4L1XA 4DO6A 3NVTA 4LQ1A 3IJDA 2HE5A 3N11A 3LSBA 1E43A 3QBUA 3RGTA 5A6MA 1DJGA 4JN7A 4MNJA 4LPCA 2E6DA 3H22A 4DLFA 2Y85A 1KTCA 3B9EA 3DKJA 3UWUA 2ASHA 4QTGA 1ZCOA 2VX6A 3MSGA 4NNAA 1S5VA 1W2PA 3QSRA 3I6TA 3N9KA 2WBAA 1BF2A 1CLVA 2QJIA 1F73A 2VO5A 2O0TA 3PZTA 1EDQA 2RDUA 2ZA2A 4S3DA 2XISA 3W7QA 5DX7A 5DT5A 2Y1HA 4FX6M 3DK4A 2D1ZA 4Q7BA 4XD4A 1NHSA 3PBGA 2X40A 3ZXWA 5H2ZA 4KIRA 4IXXA 4BV6A 1U33A 2ALDA 1RK6A 1YIXA 2J7DA 3HZ3A 1AH4A 4X2RA 4LNCA 4GBDA 1PXGA 1M5WA 3BQ6A 5CZJA 3ZMRA 1FXPA 3KBSA 2IQDA 2BVTA 3KCJA 4C5YA 4IG2B 2C1HA 1FHDA 3OLGA 3BMVA 1VS1A 4E6MA 2QR6A 2CBUA 3QFBA 1LWIA 3NSMA 1YDNA 2FZNA 4CNTA 4MMWA 3LHZA 4PEEA 1JZ7A 2E9LA 2J8FA 2E0PA 3NTYA 4FOUA 3W83A 2X2YA 2PF0A 2HQMA 1NP2A 2PCEA 3LU2A 1DJQA 3ANYA 5T8GA 2XZ9A 2XFFA 2QCHA 2FH6A 5CBJA 2X42A 3P14A 3TDFA 1TZ7A 4Q6JA 1A53A 3RLUA 1VBUA 1A0DA 4KEZA 3MP5A 2QEZA 5AC8A 1RJQA 2PDPA 4OBRA 1DQXA 4RXGA 2PRHA 2ZE3A 1DJIA 4KETA 5TBOA 5FF0A 3WLOA 4D6JA 2DSKA 4S2CA 2FVMA 4QAWA 3ZIZA 3AISA 4GC3A 1GPFA 4KIEA 2AQWA 2TMDA 3KM8A 4IIFA 4ZOEA 4QM1A 1ZBWA 3V16A 2QCMA 1KBJA 2Y5EA 1LPFA 3P61A 3O0FA 2ZDRA 1KFKA 3TMQA 4AHQA 3L4UA 1UUOA 3WH5A 1W8SA 4GH3A 3VGDA 2Z00A 4G7EB 1ITUA 3U6WA 4P2VA 3OZPA 2WAGA 3SAZA 4XZBA 3DHFA 4AZCA 1OD0A 4R9XA 3LCGA 3W00A 4GJ1A 1BXCA 2TODA 4B3KA 1GG0A 2J9XA 2CBIA 1ELSA 3AMGA 4LT9A 2H9AB 3LZ5A 3AICA 2FB2A 1PJ9A 3VGHA 4HMCA 2WO5A 1OZMA 1HW6A 2R91A 1EC7A 3PFMA 3ZO9A 2X0SA 5HMEA 2WHKA 1BGGA 3QQ0A 3IAPA 5JBFA 2ZADA 3DYOA 4QE4A 3TTYA 1L8NA 4FR6A 3WQGA 3H8AA 3UGVA 1XSIA 3PBYA 2L5HA 1YBQA 4QXIA 3W87A 4ATLA 1I2PA 2GR3A 4ONVA 1EIXA 3NSXA 4AD2A 4A21A 3VIFA 1SVDA 2IPWA 4IWWA 1E9ZB 1UBSA 2X09A 3UNDA 1FDJA 4IQLA 5BOOA 2Y89A 3QKZA 1PX4A 4EVZA 3QN3A 4QEEA 5JCKA 1EWEA 4MZ1A 1XIHA 4JTIA 2FTWA 1DJHA 3WJZA 3ZSSA 4BCEA 4XZIA 2WC7A 3JU2A 1YQ2A 4PULA 3NXLA 3V0SA 3W7KA 2QCFA 5CLWA 3W22A 4QJ3B 5U1OA 1NHQA 4Q8MA 3ZLGA 1N82A 2BV9A 4M82A 1P1XA 1FHUA 1RLCL 2CWXA 3FA3A 1I0DA 1LG1A 5JCNA 1DQUA 2QVNA 3M43A 4OWGA 1RP9A 2OU4A 3AZTA 3EAUA 3QR1A 1NDYA 1PZ1A 2IPJA 5A6SA 1OC6A 5LNWA 1LLZA 1UMYA 1YXCA 2O9PA 1MEHA 2ALRA 2P5NA 4FK9A 3QGVA 1HXJA 2O9OA 2ZXDA 1GEQA 4RDVA 3XINA 3A5VA 2NLYA 3AXHA 2AOSA 1TQJA 1KXQA 4Z2JA 3RYSA 3TSDA 4M0XA 3B0PA 2QCDB 3QV9A 1GOOA 4ATDA 1DWJM 3FJNA 3WD2A 3S9IA 4ZOCA 5EMKA 1UH4A 2OCZA 2GVYA 3QVQA 4ZMGA 4H4ZA 3FSTA 3DBNA 4DY1A 3WMSA 2HQAA 3SUSA 4GVGA 1PZ3A 1PCWA 3KOFA 1R6WA 1ICSA 3MS8A 3T0CA 3WQWA 2E09A 5HANA 2NLIA 1R7OA 2ZYFA 3ZLHA 4GISA 4LS2A 4HNOA 3KFTA 2WCGA 4G7EA 1O5QA 1ZLPA 1XS2A 4M1BA 3SN1A 3ZFHA 1H62A 5B7YA 2WHLA 1V3MA 4DJFC 2YBUA 4J1OA 1LDCA 2EEXA 3GRIA 5JQ9A 1H2IA 1AUSL 1KFBA 4P7RA 1X6UA 1H7RA 3TR2A 2H9AA 4AIOA 4F4RA 1BEUA 3MMUA 1TJPA 4DO4A 5F4SA 4HTBA 4EXBA 1P7TB 3RPMA 4CVWA 1MEWA 2EPOA 5K7JA 4CQDA 4BEUA 2D3NA 3G0SA 3BLDA 4JTTA 1OJTA 1TB3A 3OOQA 4IX0A 4JHZA 1EC8A 1AODA 1VEPA 3ZJ6A 4DWSA 4EWND 3W0KA 3EOOA 4H7CA 4DJDA 1Q6GA 2PTDA 2ACRA 3V0UA 2ISDA 1RBAA 2DUXA 2YLAA 2DIEA 1PB0A 1V6VA 4HYRA 3FKKA 4O1EA 4GINA 4YL2A 1E6XM 1A5NC 4JL2A 3LA4A 3URAA 1AMYA 4IH3A 3ZVHB 4JNYA 4NJIA 1QI0A 2CLHA 1MQQA 3ITXA 3CMGA 2XG9A 4MB3A 1QTWA 2QDGA 4QX4A 3L12A 5E9XA 1BWCA 2X1RA 3WEMA 4IIGA 3SZ8A 1B4KA 3PJXA 5HUOA 3TJ4A 4M19A 3SGUA 2J24A 1BKSA 1ME9A 3NM3A 3LB0A 2VP8A 4HGXA 5I79A 4JX6A 1AL8A 1JD7A 3G77A 5BRQA 3GXMA 1K1DA 2QULA 4Z17A 4GXMA 2YA1A 4K7YA 1EX1A 4KPRA 4GH1A 4K8EA 2DPEA 1ITQA 1EP1A 5JXQA 2ZC1A 4PCPA 4H9VA 5MF5A 2WMFA 4TVDA 3TTSA 4G1KA 5EPDA 2WNQA 3L0NA 3CUGA 4Z1AA 3P80A 3EB2A 3BJFA 3PZGA 1GOIA 3MCNA 2PCQA 4S2BA 3CZKA 3TQ0A 4JFWA 2Y7EA 1V0KA 3F4VA 2GDUA 2P3ZA 4AQLA 3TYAA 4W86A 5DCBA 1GQLA 4CQCA 4DJFD 4TVWA 2GDVA 5A3HA 4B3LA 1E5JA 3V36A 3SB0A 1EFZA 1XC4A 5LKYA 3NQCA 3TSMA 3C6CA 4O19A 1VFTA 2HBVA 3CB8A 3TH6A 3TONA 4DBDA 1HQTA 4G8TA 3K30A 3FSUA 1GT8A 2OODA 1W8GA 3ECQA 4XBSA 3E1F1 5KTLA 3B04A 2VC9A 4GCAA 4C60A 2P10A 3RLHA 1TYPA 3T8LA 2VNCA 5K4ZA 4EM4A 1JI1A 3NSNA 2RHGA 1XQLA 4NJJA 4RK8A 4O1CA 5REQA 2VMFA 2V5DA 2VM8A 5CEWA 1N7KA 3GYCA 5D09A 1V02A 3LEPA 2R8WA 1W1YA 1XIEA 5E6YA 4KRUA 1GWJA 2BX7A 5A6BA 2FLIA 2OELA 3GXDA 4J3ZA 3AWOA 3EXRA 3H54A 3VKAA 4E38A 1SW3A 3HPSA 3DJGX 2DZBA 4JN6A 1JCTA 3PFRA 1HGYA 4C1NA 3WDHA 5HK4A 5DY3A 1EHAA 4NRRA 3WLQA 4PRWA 3VGBA 1LT8A 4K1WA 2C79A 4R27A 1WA3A 2QIIA 3DXIA 1SJDA 3W6LA 4JTDA 1P0KA 3CH0A 1I60A 2X16A 5I77A 1XGDA 5XINA 1QNRA 1V59A 3PPFA 2FTYA 5CPQA 1SMDA 1OADA 4ZB0A 5AN7A 4Q4PA 2I5GA 2EQ8A 1M01A 3ZVHA 1X1ZA 3W2UA 1PIFA 5BXSA 4XTIA 4WEVX 2JF6A 2PWFA 2ZRWA 1GVQA 4S3JA 2LLEA 4AZ5A 4IMEA 1HJVA 3PG6A 4Q3MA 1QPNA 3W7MA 3D3FA 1XDLA 3GXIA 5I3KA 3PAJA 4MWAE 3GNRA 4CN6A 1KM2A 3S2NA 5C7VA 2YJQA 3WNMA 1X98A 2EG7A 1H2JA 3A21A 4HZ8A 1Z8AA 2YCEA 2QUNA 1ONFA 5A69A 1GEUA 1RA5A 3AXIA 2WANA 5AC7A 1YEYA 1E9LA 2AQOA 3SCWA 3D3AA 1YMYA 1YHTA 3SQLA 4ERIA 3EWZA 2WVVA 1MFUA 3OW1A 5F4XA 1F4AA 1OX4B 2JALA 4DJEA 4JTEA 2WP5A 2WMHA 3UY7A 3ARSA 2CESA 1UC4A 2W27A 3W74A 5GNYA 3WBWA 2FMNA 1NHPA 1TPWA 4GQBA 4MTVA 3NYZA 2E68A 3KBMA 1SW0A 2DGAA 2EAWA 3ABQA 4I6VA 3DESA 3LCLA 4AWUA 1C9WA 1DTUA 3A3WA 3ALGA 1B4EA 2V6OA 3U2OA 3FFSA 2ISFA 1XD1A 4JYDA 5C54A 1E51A 3DZ1A 2EQDA 2QF8A 5FACA 3KWSA 3M41A 3V35A 3II1A 3VA8A 3WLIA 1FTXA 4J5NA 2CZ5A 2WPGA 4GZIA 1JDEA 1FDZA 4XAYA 7PTDA 3EMCA 2YDAA 3HV9A 4EMWA 3C8NA 1Z42A 4PMJA 4PMVA 3W86A 1H5YA 1H60A 3K1DA 1U30A 1X6NA 2PP0A 3W25A 2O9RA 4BEQA 4B5UA 2BVYA 1DIKA 2WOVA 3H2CA 1WZMA 2XHYA 1UKPA 4IPJA 1LRNA 4LAKA 3RPDA 4K8GA 3AN1A 4Q4RA 1KFJA 3D5HA 5DRIA 4AZIA 4OUEA 3AQUA 1SO6A 3VOJA 1ADSA 1QI3A 4GGHA 4GUGA 4DXKA 4PCFA 1OABA 2NW0A 2R24A 1ZP3A 1Q8JA 3FK4A 1Y5XA 1KBKA 4GXWA 1HP4A 1XLLA 1IF2A 4N9DA 3N4FA 5LHEA 1AJZA 2X1SA 3IGSA 2IKHA 3TLLA 1J2WA 2UY5A 2WVTA 2ZC8A 1G94A 3BOXA 3BAYA 1DHPA 1MFVA 4J57A 2OEKA 1MW2A 1A0CA 1ZJAA 2PDUA 4MB1A 2KX9A 1L6WA 5JCMA 4W88A 1ICQA 1MW1A 3AYTA 4H50A 2GJLA 4AD4A 1XIDA 4EQRA 2J7CA 2Y70A 3MUZ1 1LBFA 1FWEC 3LV5A 2IQ0A 2Y4SA 4S39A 3FGCB 3TIMA 4AVFA 3G5EA 1A3XA 1M53A 1GHSA 4KRTA 1IWPA 1GZJA 3LQLA 3N3TA 2HV5A 2F2KA 4IP7A 3TWBA 3HA1A 3ZYZA 1D3CA 5GVJA 5CGMA 1ECEA 3BSMA 3FG2P 3NURA 3ABSA 4NXSA 4PBFA 1JZ4A 1H63A 4YXGA 2D2GA 3N3MA 3QY8A 3PZVA 5J5RA 3VAVA 1JEZA 1X1OA 4IMFA 1QVBA 3TTEA 3S5NA 4ORIA 4LUYA 1W6TA 3T40A 3EDFA 4RNJA 1VRDA 1VAHA 4GQRA 1I6NA 2XVPA 4UQBA 5AHFA 1T41A 4RDYA 4BK9A 2DEPA 3GU2A 1OM0A 2OGJA 2WVSA 5BCAA 3GR4A 3SI9A 3BLIA 3KOYA 2REQB 1F07A 4GI6A 1N63C 4KPLA 1A5LC 1KCKA 1ONXA 1H50A 2P8BA 3LHUA 3TA6A 2E8ZA 3NS1B 4LUTA 1JPMA 3KBVA 4ALDA 2HWGA 2D3LA 3Q2DA 4INFA 4IIDA 4GIEA 2IQTA 2QCGA 4ADTA 3FVDA 1OIMA 4KWSA 2PDMA 4TMBA 4YNGA 3TP4A 1TTPA 4N9BA 4CNUA 1US3A 2H90A 3CUFA 4HPHA 3FN9A 5AY7A 1UD8A 3TZFA 3TK7A 4Q8VA 4UTWA 3BQ5A 1TX2A 3NQ8A 3CUJA 1P4CA 2X2GA 4QEHA 3K4DA 3R10A 3WH6A 4DF0A 1EJTC 3LXBA 1JI2A 4BF9A 2NXIA 3V7PA 2V5CA 2Z1XA 4Z08A 3GIQA 3QRHA 3VOGA 4AXKA 4WY0A 3U8GA 3A9BA 4CNNA 3G1YA 3MZNA 2RGMA 4B9ZA 4XZ9A 3QFWA 3I7RA 1VBHA 4I6KA 3R2GA 3WDJA 1Z9AA 3OHMB 2BHZA 4M6QA 2W3SA 3BC9A 3HBLA 3EUB3 4TO8A 1F3XA 4G56A 3THQA 2HK1A 2WP6A 4IMAA 2NV1A 1NWUA 1NF7A 5E93A 4PN2A 1ISZA 2DQXA 4EQWA 1MMFA 4K68A 1GNXA 4GGBA 1ZBCA 4PMDA 4UXDA 2E5AA 4UTLA 2DDXA 4NILA 2PRLA 2EQ6A 1JCMP 4WIWA 2VD8A 2PAJA 1QHOA 3L4YA 3N9SA 2DU2A 1VRXA 4JTSA 3UR8A 3WLRA 5A8OA 3VIMA 5BMWA 3VIKA 1YDVA 2ZUSA 4GJJA 4Y9PA 2KAUC 2B7NA 3EWXA 1LL6A 3MP4A 4QDPA 3OO2A 1CEOA 4GCXA 3WK0A 3B8DA 4EANA 5HDRA 4XZMX 4Z1YA 3QLDA 5F1UA 4A3YA 4IMGA 5FOOA 1CGTA 1XYLA 1CXFA 1O95A 3DK9A 3N04A 3VKCA 4FX7A 1XC6A 3BZGA 2WMGA 2CLIA 4N42A 3KBWA 5IXEA 1X2GA 1A5SA 1SZRA 3WJSA 1WBJA 4DAFA 1FFRA 2WKJA 1WXZA 3MO4A 4UTTC 1B3WA 1KR1A 1Y8BA 1SJBA 3AMLA 4OHQA 2V68A 4JBRA 2Z1SA 1I9CB 3P0WA 1VFSA 3GXTA 4WXZA 4LY8A 4CQAA 1G1YA 3BLOA 4JD4A 4Y9NA 1ZZMA 3DFYA 2FGZA 1Z32X 5AC4A 1D7YA 1BYCA 4AY8A 4MY8A 1TVLA 3LENA 1LCOA 1E72M 4NZ4A 2PURA 8RUCA 3ATZA 4Q8OA 2Y61A 1UD2A 3E6EA 3LXDA 3AWNA 4Z0SA 2HCVA 4DM2A 1WX0A 3ELFA 1NDZA 2BY1A 1XYMA 1NIUA 2Z4GA 1F6PA 1C9DA 1J18A 4WGXA 3UA3A 3EOLA 4RW3A 2QGHA 1L2QA 2FHCA 3TKFA 2XWEA 3ONBA 4L4LA 2PDIA 1V6WA 3E96A 3PB0A 5C9ZA 3L68A 3NFUA 2XYLA 3N1AA 3Q65A 2CYGA 3BW3A 3W4RA 2YVFA 1R7AA 1CXIA 1E5NA 1E6SM 3R43A 2TPRA 1A5AA 1J0KA 1TPEA 2GQAA 4ML9A 3KDNA 4JTRA 4JNMA 5JMUA 1PWLA 1MQPA 3LNMA 3S2LA 1V4YA 1TYGA 3DJJA 4US6A 3THAA 4YMZA 4GI8A 4L56A 2XVGA 3P3BA 3TCSA 5BROA 2G41A 4UMCA 4PMUA 2YDQA 4YWIA 2YZ5A 1P1MA 1CLKA 4N0RA 5D2YA 4S3GA 5CBIA 4JEQA 1SJAA 2OMAA 2F6KA 2FPYA 3STPA 1AMKA 3RFAA 3RU8X 5KZDA 1XKJA 3QGAC 4RNFA 4RJEA 3EPMA 3C52A 3FLUA 3LHTA 4D6IA 2NQLA 3JUGA 4R7WA 5D9PA 4B92A 1TWWA 5AHNA 2XU2A 1WZLA 3NGFA 4I8YA 2G3MA 1CIUA 4BKNA 4F2UA 2Z1VA 3FDGA 1DWIM 1TFVA 1XYZA 1XUUA 4GG9A 2YCKX 4B5SA 2UZ9A 4NUWA 1RCQA 4LYRA 1DWGM 3GAKA 4LNYA 2PDCA 3MUY1 1V97A 4HPNA 1K02A 4GX8A 3AMDA 4GZJA 3I3DA 4WJEA 1RALA 4M3PA 3THCA 1RVGA 4X9YA 2FGLA 3CV6A 5H8MA 1LYXA 3ARQA 3B9AA 3N6HA 4JEJA 2FH8A 4Z0JA 5HNTA 3MMTA 2C71A 3UCQA 1MXDA 1VDVA 3G1XA 3M0YA 2QVHA 4GRSA 4BWLA 2INZA 3GO2A 1E6QM 1S46A 1JF5A 4PMQA 2H3DA 2ZVIA 3M0IA 4MSSA 1DJYA 3BW2A 1AQMA 3I4KA 3VIOA 2YCLB 3UGRA 4UR7A 3GG8A 2VHLA 1PWMA 4EK7A 4F0LA 3WMLA 3T42A 4FOKA 1KFEA 2OB3A 3E2RA 3B8SA 1V3LA 1GRTA 1LJYA 2DT3A 4ZXLA 3T2OA 4ZO9A 1XLHA 5TAOA 4ZOHB 1R47A 4O13A 3ITCA 3AIEA 3FHAA 3FDKA 1PKNA 3E02A 1KFLA 3HQ1A 4UTMA 3OA5A 3PC0A 2QJMA 4JTFA 3AO0A 1LRTA 4H4WA 1J6PA 1B0IA 3CQKA 3E2VA 2G3JA 3VABA 1W1TA 2C19A 4D9PA 4S3FA 1JCXA 1XLGA 2YL9A 2GGGA 3KL3A 4YPJA 5BXTA 3LCIA 1M9HA 4GC4A 3UPWA 4JAWA 3BO9A 2CNCA 3POCA 1KXHA 4LRTA 4TVUA 2VDGA 1QOXA 1QI4A 1EEXA 2HVMA 3WLHA 3C5QA 3E74A 2JF7A 1O6IA 1OX5A 1G4PA 1D3GA 3W07A 1GYMA 2NUYA 3UG8A 3QFEA 1E0WA 4L1WA 3PBMA 1W17A 3SUUA 2YGYA 1W3IA 1QJWA 3LM7A 3ABRA 1UIPA 2HBXA 5ABFB 1ZFJA 4XZWA 3UERA 1P48A 5D4YA 3UY8A 5D04C 4DBEA 4IP5A 1J11A 1GYLA 4C1KA 4F0SA 1XLCA 1EKOA 1M68A 3FOKA 4PB3A 4JHOA 3BAWA 4H2CA 1IHIA 3GY1A 1GTHA 4HN8A 3HW2A 3GNOA 4O18A 3GHRA 3GRTA 3S6OA 3R1ZA 2HE8A 4CD4A 4NXKA 1U1UA 5HWNA 3TQVA 3CWNA 1UUMA 4C6KA 4KEVA 3AMKA 2A79A 3EWDA 4S3AA 3AU6A 2XVKA 3W7CA 5FSDC 4EPDC 3NDOA 2WZTA 2B31A 2PP3A 5CPLA 3PVFA 2PE4A 4IPPA 1ZDLA 1GVEA 4UMAA 1L6SA 2E4TA 3VUSA 3SBFA 3E38A 1FWFC 1BKHA 2A3EA 4RCXA 4W8LA 3PANA 2G3FA 1F76A 2AKMA 2Z26A 4GA8A 3AS1A 1B30A 1ONRA 1DIDA 1YNYA 1FFUC 2P50A 4E2VA 2CW6A 4EAYA 2EQ9A 2G37A 2A2IA 3P8JA 1Q6DA 3S83A 4X22A 2V2DA 4EACA 3SO7A 2A6LA 4TV6A 4UTKA 1RQBA 2OFJA 1T8QA 3HGJA 2XUCA 4KWWA 3WD4A 3HRDC 2J66A 1EOMA 4LEFA 4ZCWA 2CLKA 3T6CA 4Y9MA 2AMGA 2ZZBA 5AYZA 2CHNA 3L2LA 5AC6A 2OLHA 1HN1A 1UQZA 1EYEA 4Y8EA 2DZWA 4H04A 2F7FA 4EMIA 2YXXA 1C8QA 2PSNA 3D6NA 3N18A 1RJPA 2VZSA 2BCPA 4DAIA 4O28A 2YXGA 5CC6A 4XAZA 3LXCA 2W54A 3VIIA 1FO4A 1DWFM 2C3DA 1FH7A 3VXGA 5HQEA 1F7BA 1FDYA 2ZX9A 3GH7A 5EBAA 1E0UA 3WELA 4XV0A 2R1LA 2NQ9A 3Q6JA 2P76A 4NYUA 3S3GA 1VQZA 1TMLA 5DXYA 2OPJA 3MI2A 4PCNA 5DQPA 4TOQA 4EQXA 4J2MA 3NVVB 3SN4A 3OBKA 3ABXA 4LC8A 3F03K 4RUBA 1D9EA 4P8XA 1R3VA 2FJKA 4HMEA 3I6EA 3WNLA 5ABFA 5CJNA 1OBAA 4RNIA 2X99A 3POHA 3K1GA 3R13A 3WLMA 1UR2A 3DCPA 4M6PA 4YVVA 2PDLA 3XIMA 1M04A 1UWUA 4I9TA 2O92A 4AZ7A 3DC8A 2QLYA 3N6QA 3AS2A 1IE7C 4HMNA 3CAKA 1ZBVA 3BICA 1JPKA 2FHBA 3T7VA 3MHFA 4M7TA 1GREA 5FJOA 4LEQA 3S1VA 4LVGA 4O17A 2FZDA 1NARA 3HG5A 3KP0A 3V0TA 3LTPA 3PUGA 3U7BA 4EPEC 3OODA 4R5EA 4LBSA 3W23A 1XINA 1K4QA 2PLJA 3AIQA 4JKMA 4UFIA 8XIAA 2C7FA 2FMOA 1DWAM 4C6PA 3ZM8A 5RUBA 3RM9A 4I5XA 4I90A 3NQVA 4HKPA 5I3JA 2VX7A 3PAOA 3H6OA 3DN5A 1DXLA 1Q6FA 4QDMA 3RO6A 2Y7FA 1DEDA 4JN8A 4HA4A 4FNUA 1C91A 1OC7A 4C6LA 2X7WA 3GNNA 3EEGA 4HNCA 3B9JB 1P6BA 5EYWA 2W91A 3U2ZA 3KAOA 1PZ0A 4IGHA 4WLCA 5HATA 4HOWA 4ZO8A 5F7UA 4XK2A 3SCNA 2I56A 1YPIA 2HPIA 7XIMA 3LTSA 4HPJA 4IM4A 4CCZA 4Z2GA 3B3DA 1FFVC 4LS1A 4O52A 1WDPA 3KHDA 2BG5A 5H91A 3Q67A 1XGZA 3H23A 1F3WA 2ZZ3A 3TJLA 1NVMA 1MO0A 3QHOA 3LY0A 3T2PA 1WDRA 5JBEA 3SDOA 1UA7A 1UUQA 4L4OA 1EXBA 4DI9A 4JTQA 1DE6A 1P0DA 2E7FA 4X0NA 4S3CA 4S3KA 1UP0A 2I5QA 2D22A 1ZB5A 2D0HA 3ITLA 1W3NA 4G2DA 3PG9A 5FJUA 3LCFA 1LUCA 2F61A 2ZIDA 4I7WA 3VNKA 1SZNA 3GD6A 3K46A 3M7SA 4YTUA 4Z2IA 1YW1A 4PBEA 4QG6A 4W9TA 3G22A 3Q4DA 1UBPC 1FCBA 1JUKA 3W88A 1EBHA 4J28A 2C91A 1NSJA 1GUVA 2QQ6A 4O54A 1W54A 5CZKA 1KRCC 5HXMA 4AMCA 1V7YA 3OG2A 1NH6A 4HB7A 3TN6A 3RHGA 1CPUA 4A05A 4M24A 1UW9A 5FL1A 3GNXA 4LB4A 4O0ZA 5I23A 1XHCA 5HAOA 4NL1A 3ITVA 2BASA 2ZUNA 2DY3A 1AOGA 3H55A 1GKPA 4ACZB 1ZAHA 2J78A 2YR1A 3PWGA 3M1ZA 4NZCA 5U7SA 3VE7A 3W53A 2J75A 5PTDA 2WBKA 3QSTA 3QZ6A 4A2SA 4W89A 4XKMA 3WDQA 4U3AA 6ALDA 3C56A 2QAEA 1JNDA 2QDDA 1A5MC 1VP5A 2X1TA 1FWSA 5LGZA 2E6AA 4ZB5A 5CC7A 3JS3A 4K3ZA 1GVOA 4I3GA 5F2IA 2FJUB 4D6FA 3A4AA 1FCUA 3KWXA 5E09A 4HD5A 5I3GA 2CZDA 3F2BA 1Q7ZA 2ANUA 2UY4A 2ZX6A 4H9UA 4XVEA 1CGUA 1N8IA 1NP0A 5FF2A 4LF1A 3ES7A 5FJPA 1UP2A 4AH7A 4TTUA 4UR8A 4ES4A 1L0PA 1P6WA 1LM1A 1RD6A 1BQCA 4CCDA 3CZ8A 1RVKA 3ZOAA 1A5OC 4KFPA 1R3RA 1QFEA 2J25A 3TOPA 4FS9A 1XH2A 4AG0A 3WQ5A 3GIYA 2B7PA 2G95A 5A8NA 1F61A 3HIJA 1SU5A 2X8RA 3GU1A 1QI5A 3HO8A 3ZJ8A 5AYXA 3BMXA 1XF0A 4JIRA 1N8WA 1TX0A 4JFSA 2OQLA 1G7UA 4XUGA 4HSOA 3EBVA 1YADA 4X61A 4JX5A 1E40A 3LTYA 3LGGA 3VNYA 5H6HA 1F8IA 4L7ZA 1ZBKA 3NR0A 2V8ZA 3P7YA 4NZ5A 2O7QA 2RABA 1ZY8A 4D8AA 2E9BA 3FJ6A 5EFFA 1SJCA 8A3HA 3IUIA 1JPIA 4XISA 2QW5A 2XWDA 3BGAA 4EXAA 4H7ZA 4HCLA 4XIMA 4UZSA 4C91A 2GVJA 4AF0B 1VLWA 1V51A 1TPH1 1GONA 1WXJA 2CFFA 4ACYA 5I3IA 4WKHA 3CTLA 5JU6A 2P3EA 3HJZA 4FAMA 3ABZA 1JDCA 4UQ9A 2YB1A 2WPBA 4H8UA 1BVNP 2CXGA 3DYPA 1KM5A 3B8IA 3EX4A 1N5XA 3QV8A 2E3ZA 4A8RA 2W67A 1TZZA 5ABGA 2ZWZA 4AX7A 4GXPA 3FYOA 3BV4A 2ISSA 2INEA 2A21A 2VVNA 3KP1A 3OEXA 2DW7A 1W0MA 1UWRA 3W72A 1EJVC 2TPSA 2NQZA 4JCMA 3GVVA 4OIFA 4XX6A 3LCWA 4RKAA 1KQYA 2XSXA 1M7XA 1ZXIC 4Y96A 4E4FA 2NWRA 3UXDA 5FEPA 4O8RA 2E5BA 3NOEA 4F9DA 3EMZA 3HJEA 1GERA 4WOQA 3B8UA 1VFUA 3KZSA 5CJMA 5A6AA 4Y9OA 2BLEA 1CENA 4A22A 3GU9A 2VQTA 2ZCGA 4Y7EA 2JFEX 1KRMA 2WKGA 3VDAA 2XGZA 4WJXA 5HR6A 3M46A 2AAQA 1SR0A 2CEQA 2YX0A 3TAOA 5H8UA 3H24A 1RPXA 4UNLA 4ZSUA 5EB8A 3B40A 3WFZA 4DF1A 3NQBA 1SZGA 1UR9A 2CXEA 4WXYA 1UASA 3F5JA 5IFTA 5BWAA 1JEHA 2CZVA 1MUCA 3GD3A 1V0MA 2VENA 3MY9A 2NX9A 2WNNA 3GDLA 3NQAA 3USBA 2B4GA 5MKGA 1OGSA 4NZ1A 5C8BB 1QASA 2GQ3A 5M3WA 1OFAA 1FWRA 4RW5A 4N4PA 3FX4A 3L2MA 5D32A 2JEQA 2GSHA 2GVLA 3RLVA 4HHPA 2DV0A 1K8XA 3SCSA 5C2CA 1YPXA 3UJEA 4AWEA 1UWSA 1VPYA 2PD9A 2DJXA 4NZ3A 3UJ2A 3NXFA 4C65A 1DVJA 3A12A 4DELA 3RCYA 1OCQA 4XSLA 4BA0A 1WKDA 1H1NA 1QWKA 5I3HA 3FJLA 2E25A 3WCZA 2BY0A 2YCJA 3GH4A 5GRTA 1K6AA 3FV9A 1YQZA 4PUWA 1GCYA 1BWVA 4OOUA 2CHRA 3TN5A 4JR5A 1WPCA 1RLDA 3SY5A 3NQ2A 5IRPA 4YLWA 3GDBA 3KVLA 1VEMA 4XTDA 5I3DA 4KW2A 4IFKA 1TUFA 4O4VA 4BF5A 4NZJA 1XDJA 2VFFA 4AEFA 3N13A 2WM1A 4DQWA 3N2CA 2BY2A 3MSDA 4U5KA 1H1YA 1TV3A 4AF0A 1O1ZA 2FYMA 3MV01 3A7RA 1ONWA 3BLFA 5CJ5A 3NO5A 1LLWA 3TW7A 1IT7A 3UZZA 4O1DA 4MFDA 1B90A 3G2GA 7REQB 4IXHA 2CETA 3H7RA 1NM9A 1RK5A 5XIMA 4E8DA 6A3HA 1DIOA 1N8FA 5IBXC 5CBBA 3T44A 5AZ1A 3KRZA 2H8XA 2QMJA 3BPWA 1NAL1 2VC6A 5CKSA 2VFGA 3GG0A 1O1HA 4PA8A 3RG6A 1GVSA 1KFCA 1H3GA 4HK7A 3N73A 4PODA 5C9XA 4C5ZA 3OGVA 3WMCA 1JCLA 4GIAA 4G7FA 3ETRB 3R6IA 5DCEA 3U57A 4PMRA 3VMNA 3WJWA 3TJXA 2BGNE 3MWCA 4ZR8A 1WXYA 1H51A 1XCFA 4YHEA 4R7OA 2VZVA 2Z0IA 3TW9A 4Q7IA 4GIRA 1F3PA 1KM4A 2BY3A 2JKPA 1XPYA 4WQ6A 1OX6A 1UKQA 1TTIA 6XIMA 4YVXA 1RM6B 1UD6A 3WG6A 4UB9A 1TCMA 2BC1A 3SRHA 2R9ZA 4BY3A 3GTHA 1QPOA 2J7GA 2WNWA 1THFD 1V3KA 1VQTA 2JK6A 3AI0A 2PDBA 2FGBA 2XH2A 3GB6A 3PZQA 3GR8A 4U2YA 4PTVA 2PODA 3H4GA 4HVXA 1JZ6A 5C9UA 3WYZA 4MOZA 3VNDA 7ODCA 4D6HA 3OTRA 1T0OA 2CIPA 4P8WA 3WENA 4I5UA 4KGJA 1XI3A 5AYBA 1IYXA 4C7FA 5M1TA 2XJ7A 5CG7A 4ZTXA 2CITA 1TPDA 4KT2A 2V6AA 4QG9A 1ZALA 1SZFA 1IGWA 3W7NA 2YQUA 1LROA 4UTUA 1NWRA 3JZEA 3AC0A 2YL8A 3W7DA 4HPXA 4MUZA 4BS0A 2GJXB 5E9AA 3UW6A 1Z48A 4JNZA 5T26A 3DHDA 1RCOB 5G5IA 1E4LA 5CZTA 4JIEA 2Z29A 3GM8A 3IV8A 3K8KA 4UQCA 2FDSA 3GW3A 4B3ZA 2OQYA 1UC5A 2PFHA 3E9AA 8TIMA 1GOWA 2V67A 3MMDA 5CGTA 1LQ0A 4W93A 4B9YA 1G4TA 4A3RA 4JX4A 1Q3NA 3E2SA 3PN8A 4HSHA 3T0TA 3IARA 3W27A 3SURA 3CO4A 3H2NA 1KQZA 1FUYA 3R12A 3T05A 3IK2A 4KCTA 4RE4A 5JH2A 2BVDA 2HZGA 3WH8A 3GIPA 3W2LA 4TU1A 2J77A 2NVDA 4PRRA 3NPVA 4B15A 5EY5A 2J8TA 3GTIA 3TROA 2WSYA 5CSRA 1XFBA 1VIZA 5HMSA 3EA3A 5A2AA 5G4EA 3QPEA 4U28A 4B5TA 3DEQA 4LRSA 4UR9A 4HZ6A 5HPOA 1ZJHA 3KRSA 3DFPA 5DF0A 2Y63A 1OQFA 1QI2A 2VI0A 3WLLA 1TTQA 1IT8A 3IV3A 2VEFA 1GGOA 2VL4A 2Z1BA 3L66A 1CZ1A 4GVFA 2HDJA 2OT1A 2BBFA 3PSVA 4PFMA 1PIIA 1LBLA 5I07A 1QNSA 4WUIA 1MW0A 3ANVA 4DVOA 4REQA 3AHVA 1SFLA 2J7BA 4IUOA 1J10A 1GK8A 5DT7A 1OFBA 2OLAA 2QPXA 3G3DA 3CQHA 4B4HA 3QHNA 3G1HA 1VBJA 4QS5A 4W7VA 4EP8C 1QO2A 3C8FA 3VM7A 3VUPA 5DELA 1UCWA 4MWAA 3YPIA 5C5YA 5IHSA 1E56A 1K7XA 3A13A 3SJ3A 3GUWA 1RBOB 4GQQA 2F84A 2HS6A 3WLTA 2NQJA 3G1DA 2CZFA 1I2QA 1UH3A 4QS6A 1W1ZA 3CL8A 3BJTA 3KCOA 6TIMA 4Q7NA 3VE9A 1GW1A 2JEPA 1O68A 5D33A 5FF4A 3FXGA 3IC9A 2X50A 4S1FA 1V03A 3T4WA 2WM0A 1K03A 2PDGA 1AW5A 3TYZA 1V7AA 2XH7A 3R0UA 4O15A 1RSCA 1FKWA 1UKOA 4AD5A 3OYXA 1KBLA 1EJUC 1HJWA 3PP7A 3I68A 1Q66A 1JXJA 2CCRA 3LD5A 2R82A 4LJ3A 3WQ4A 4QHRA 4B91A 4TV5A 4LBUA 5K9XA 1IXOA 4O1AA 1R2SA 1K8YA 3KVMA 5LXEA 1VJZA 1A4LA 1A49A 3GG1A 4YTRA 2NUXA 5I02A 5BU6A 4IIBA 3KZPA 4QGCA 1V79A 5JIWA 4G1NA 4LYQA 4J3SA 2A3BA 2VOMA 4DNMA 3BAXA 3SECA 1DP0A 1KKRA 3GG7A 3F1QA 4J3VA 1DXFA 3BTNA 1B3ZA 3TJIA 1PIGA 1OK4A 2NSXA 5IBXA 2FZMA 1AW1A 2QAFA 4URIA 3ITYA 1VR6A 4L9XA 3E2QA 4US5D 4GRTA 3MUIA 3EWUA 3MHUA 1FIQB 1IV8A 1M7OA 4D71A 1EWDA 4UOZA 5HINA 4ILSA 1NDWA 4F0RA 1DPMA 4CCCA 5I5RA 1CX9A 4XB3A 1H7NA 3DG7A 3OIHA 6REQA 8CGTA 4PC8A 3C2EA 2CKRA 1PCKA 4NP7A 4ZGYA 3WJXA 5FEWA 2NPXA 4IICA 4KEUA 2I14A 2ZXBA 4EF8A 1OCNA 4FPSA 1AD1A 4LFYA 1SW7A 1BXNA 3EANA 4EX4A 4OECA 3W7IA 3VK5A 3WF3A 1OY0A 1JRBA 4UQDA 3DFOA 1Q85A 4M8UA 2C8NA 4UOJA 4LCRA 1QMLA 3E0IA 4C6IA 3E49A 1N62C 3IJLA 3N19B 1HJQA 3MCMA 4IGMA 3GLCA 1J5SA 2ZA3A 3NL6A 2HPMA 2ACSA 5FJTA 3OG3A 4HTYA 1TRIA 1Q6QA 4W84A 2BTMA 3V18A 2V3AA 4K8DA 1TE1A 4JFUA 2X8CA 3HQPA 2OKTA 1TSIA 4NQ1A 3L5LA 3OVRA 2PGEA 1FA2A 4V27A 1WQ5A 1TREA 1AJ2A 2WQDA 3BLPX 4YU1A 2PU1A 1TPVA 1FWCC 4X0VA 2WYSA 3PG8A 1K9DA 3AYSA 1X1NA 3OLEA 1NFBA 3DG3A 1HNYA 1UR4A 4Z1BA 4MAZA 5JRBA 4I7VA 4P7NA 3CHDA 4WHBA 1L9WA 1TR1A 1LZOA 4B2DA 2WCSA 1KV5A 3EXSA 5M5DA 1UWQA 2E67A 2PDYA 4MB5A 3L4WA 5DFAA 2D0GA 4DRSA 2E1DA 2J27A 2ZBTA 1F2JA 2VT0A 2XN1A 5A8GA 4IOTA 3DECA 3UG4A 3ZT7A 4NASA 1JCJA 1GKRA 3W2JA 1E9YB 3TWAA 2OTDA 3U2CA 1DWHM 1S2CA 2XINA 4O10A 1YYAA 2PWGA 4HJWA 1K70A 3TZNA 3M16A 3RCMA 1U83A 3VNLA 4GZ7A 4HOZA 2WQPA 2A3HA 3MBDA 4HHMA 1PVNA 4LU0A 3CU2A 4BQ3A 3L4TA 3V1PA 2DT2A 4XG1A 4HNNA 2CLMA 1ZNNA 1R3YA 2QAPA 3PTQA 2YDSA 4XVDA 2ZZCA 4ZO6A 1W3KA 4H4XA 3UR2A 2VGFA 3LERA 3DG6A 3LCHA 3AU2A 3LHVA 3BG5A 3VZXA 1L8PA 4UTHA 5H8PA 1E0TA 4PTWA 1WYIA 2EF9A 3DI1A 4JTAA 3LSCA 1ODUA 2E1WA 4C6FA 3PHAA 2HEJA 1KXTA 3UXIA 2V63A 1VYPX 3S9ZA 5FSEC 5DY2A 4AZCB 2VTFA 3CIVA 1YNQA 1TJ0A 3I3EA 5EBKA 1JROA 3IUDA 4QDWA 2BXYA 1XH1A 3BCDA 3PWIA 4IF2A 5HNRA 3G1SA 5G2IA 1QNVA 1GJWA 2C1GA 1AW2A 3O6DA 4GYJA 3VC6A 4H83A 1W31A 6ENLA 3WDPP 2FKPA 3SRFA 3W7PA 3BH4A 1G5AA 3L67A 1Q2SA 1WV2A 4P8UA 4UFLA 3JVAA 1YBQB 3WNNA 1JFXA 2G3NA 4R85A 3B8TA 1W1IE 3GTNA 3G1RA 5CCZA 1XHGA 1GESA 4GLEA 3QMRA 1LVLA 1S3TC 1XLMA 3N4EA 3MC5A 2YXOA 4Q6XA 1O5KA 1POJA 4A8LA 4YS1A 2NX3A 2QPUA 4O53A 5AOUA 3WF4A 2BS9A 1UD4A 3GFYA 3SQMA 4KESA 1KM1A 2VCBA 1KKOA 1QW9A 3UNTA 3OHIA 4DWSC 5FESA 3EAOA 4MVAA 1EJ7L 3EX3A 2A0NA 4NJHA 4DJDC 4CVUA 4R53A 2WSKA 1XYAA 1ZCCA 5CPMA 1Q45A 3HGSA 1XL9A 1WAUA 5KZMA 3GRSA 3AJ7A 2GR2A 5LNRA 1M6JA 3OC4A 1E4NA 4YYFA 1KC7A 4E2OA 3RXZA 3GYEA 1OFQA 3A6OA 3W2NA 2JKAA 1A4MA 3ZQ9A 1SR9A 3EZ4A 1ZAIA 4RPPA 3KUMA 4PB4A 3L5AA 4BQ4A 1ZTVA 4LUIA 3GNPA 3QHMA 4A4AA 1B31A 1EX5A 4I9JA 3WD3A 3UEQA 2QDEA 3RM4A 5LNSA 1UYQA 1C7SA 4IIHA 1OFPA 3RJYA 3NRZB 1SO3A 5LA1A 3FJ4A 3OIXA 3W1MA 2ZICA 4ZEPA 3TLQA 2C15A 3MDWA 4KEMA 2GJRA 3JZUA 3VU2A 2VEPA 5A1AA 5I0DA 1UA3A 2XIBA 1FKXA 5FF3A 3AIBA 5F1VA 2HROA 1CTNA 1U22A 4GACA 5BXRA 4J56A 3PZOA 2WJFA 4ZQPA 1XPGA 4H9YA 1IEXA 4FALA 1WDQA 4E2BA 3RK8A 1R30A 2ABBA 2UV8G 3CO8A 1VKFA 3TA9A 3QOKA 1B54A 1W5OA 3AOFA 1IIHA 3CJPA 1BVWA 3IJ6A 1HX0A 2O7SA 1S5MA 2EJAA 3E0LA 4C1LA 2XIMA 3KE0A 1EBGA 3CMFA 4M81A 2WW5A 1NFGA 4I5RA 1N55A 1G6CA 2V5JA 4GFIA 3SEPA 2PBOA 3FA5A 5LXXA 3FKRA 3W75A 2HK0A 1IT0A 1PZ2A 2YFNA 2TSYA 1G69A 1KM0A 1R87A 2V38A 4WDWA 3VMPA 4UBPC 2GWGA 3HQNA 3M0HA 1VFFA 3TC3A 3CAVA 2XGBA 4WY0F 3AAMA 1W3HA 2VEMA 4GK8A 3DDMA 3CZEA 5G1MA 4HU4A 4DWSB 1WUEA 4HA3A 3T08A 4H00A 1HL8A 4NF7A 1F3EA 4DWSD 1SB3B 1DL3A 3G3MA 3QYQA 3WKZA 2VQUA 3E5PA 1AQFA 4ML4A 1XYFA 3NQFA 4DJDD 4QITA 1YX1A 3SCQA 3EX2A 4NX5A 4C6NA 1S39A 4MLJA 2OT0A 3G6MA 3TYDA 3S0CA 5LA2A 4MNLA 2NT0A 4K6AA 1JZ2A 1OCJA 1XISA 3ZS4A 1FXQA 2GJNA 4N02A 1FH8A 1L6YA 2W61A 3EDJA 4H8NA 1LP6A 3VKKA 5AHIA 4C6DA 3TN4A 2QCCA 3BV7A 3TU9A 3PY2A 4R34A 1FHVA 2Z7GA 4H4RA 1KFWA 4ZB2A 4AFYA 2V69A 3NQEA 4WCJA 4H2HA 4AU0A 3ARWA 3A5FA 3OYZA 3IVTA 1AG1O 3NM1A 3RMEA 4L4PA 2OZTA 2OOFA 4DNAA 1VBGA 4EIVA 5KMYA 4GVIA 3SIMA 4A6GA 3MHGA 5G2WA 5D8ZA 4AIBA 3VD5A 4AIUA 1KTBA 3UWYA 2G8ZA 3VNJA 1PYMA 3P5ZA 2X30A 5E0CA 4UOQA 3W81A 4K7ZA 1ZMCA 3HV8A 3RX3A 2VYOA 3RRXA 2BGSA 4DX3A 4WD0A 2Z2AA 1FWGC 3VZZA 4UZUA 4AD1A 1PX8A 4V1XA 2OXNA 2VR2A 4PSRA 2VGBA 1QBAA 1E15A 2OWXA 3QQ1A 3B06A 3VCRA 4BR1A 3REQB 2DSWA 4AISA 2ZUMA 3W29A 5A94A 2ISWA 4K1GA 3CQJA 3EKZA 3WLKX 2WLYA 3BLLA 5A8QA 5KVIA 3N29A 2D2OA 3KEHA 3RX2A 3S2JA 4ADWA 1GYNA 4WK9A 1CXKA 3NOYA 2VX5A 3UCDA 1XH0A 1QPKA 1VH7A 1QW7A 3B97A 3N9RA 1CB7B 4WX2A 5D02A 3M5ZA 3GDRA 3QFAA 3N17A 4WOZA 3UT0A 1GJPA 1WE5A 1B2YA 4DJEC 3BLEA 1HTIA 1T96A 1X7IA 2A6NA 3GS6A 1TO3A 3DGRA 1E1FA 4DBUA 2ZZ4A 1W9UA 5REQB 4ZTYA 3IJQA 1BRLA 4Y8FA 4IGNA 1EUNA 5CPNA 4PR4A 3NQDA 4JQ2A 4O11A 4R33A 3JRKA 4KWUA 1ZHAA 2Z7KA 1L6FA 4A3HA 3VD4A 4DYKA 4GPNA 1JL8A 1Q7QA 4C1NB 5A6BD 4NKCA 4M52A 5B80A 3OVPA 1QXLA 1N61C 4APNA 5IFPA 3IACA 3WNOA 5HMDA 2XDFA 1ME8A 3W1LA 2J79A 4EF9A 5HPCA 5I6SA 4JFTA 1LRQA 2ZRXA 2QV4A 4U33A 1ZY9A 2YW3A 3KBNA 2QYGA 2X1IA 3W7OA 3VM5A 5I06A 4WJ8A 2QKFA 1UG6A 1UKTA 2ZXQA 3L7RA 1PL9A 4JIQA 5GJMA 3AIVA 4DBWA 4HHHA 2PUZA 4O0QA 3K4WA 1JRCA 1JRPA 2QCEA 3CNYA 3CLWA 4WKFA 2GGJA 1VPQA 3GZ3A 1UZHA 3EWWA 1RJRA 4KKXA 1JDDA 3OBEA 4GYPA 4IJCA 3H2AA 1E4MM 3MT1A 1JOAA 1TE6A 3DFQA 4GNKB 2Y8UA 2PD5A 1QK2A 4QIUA 3TN3A 1A5CA 1A5KC 1XBYA 4XD3A 2W62A 5DEZA 3RDKA 1VLIA 4DNHA 3PNUA 1CDGA 1FX6A 3V5CA 1TV2A 2O4QA 1HP5A 1FBAA 1CGYA 1UPMB 1ML1A 1RY8A 4RNHA 5E5CA 3WBYA 5D9OA 4WDUA 4D6DA 3UVIA 4JQAA 4OOZA 3EDEA 4MG4A 1A5UA 3W7JA 4V2XA 4NG3A 2ZVRA 1GJUA 3P84A 3R7MA 3R0KA 2WMKA 1XLDA 3W3OA 1NELA 1KW1A 2DZAA 2YYUA 3GBEA 3C0SA 4GNVA 1U1JA 3DFSA 4QE1A 1P43A 1YTDA 2FZ9A 2WVVB 3VC5A 3W2KA 1XR2A 3VZYA 1WP6A 3P74A 3FYPA 3UETA 3ME3A 3N15A 3BVJA 1E1EA 3REQA 1OFRA 2F6XA 4DJED 1XFCA 4BQ5A 1LWHA 3MJYA 5TD4A 3WJYA 4X60A 1GORA 4JL1A 4DHGA 1XRSA 2NXHA 1QNOA 1S5WA 2AAAA 3LBOA 3B0UX 5AHEA 2NV2A 3P0XA 3UZJA 9XIAA 2BB0A 3PPHA 4LV9A 1XM3A 3WEZA 1VGAA 2Y62A 1WB0A 1DKWA 1PEZA 4E4UA 3S42A 2EKGA 1JQVA 3VNZA 3PWAA 2DVUA 3OGSA 4DLMA 5CPOA 3HPAA 1VCVA 3VDCA 3MW7A 2XFYA 1I2RA 1XQKA 1Q5MA 2YYTA 1P0EA 4MLRA 3W7LA 2CFYA 1WUFA 2OO6A 4Q8PA 3UFYA 1CWYA 3AZRA 4LIIA 2XH4A 4LVFA 3JW7A 3UR5A 1REQA 1B3XA 3O9NA 5LHFA 4LH8A 4MFEA 3W7EA 1FWWA 2V3BA 4LY4A 3TYEA 2J7HA 3W1AA 2JGQA 1WYGA 4XZLX 3STEA 3KXQA 4PUUA 3VI2A 3P6LA 1M41A 3MQTA 4PTXA 5C70A 1PTGA 4UTWC 3FIGA 3AXXA 4RZ4A 2OYLA 4H4TA 3S1XA 3CBWA 4MYXA 4QISA 2DSVA 4JYEA 1J0JA 1EDTA 4PCSA 3XISA 2PDHA 1UHVA 3KL0A 2YKKA 2D2HA 1U5JA 3GNDA 2E5DA 3T78A 1EOKA 4W7WA 4U10A 3NO1A 3GVWA 3O6AA 1J0YA 1X7FA 4L6DA 2BC0A 4A8IA 4ASTA 2GOKA 3MVTA 1E1CA 2RH9A 1LOLA 1CECA 1IWAA 3CL7A 4H9ZA 4DZ5A 1J96A 1UB3A 5D2TA 5K4XA 2J7EA 2VEKA 2XVLA 4LUSA 3NL5A 2OR2A 4JOMA 1RH9A 3B4YA 1EEPA 3B03A 4PUEA 1PAMA 3HOJA 4WRHA 4EM3A 1Y5VA 4P7QA 5DXXA 1HKIA 3R07C 2X0YA 1X8CA 1PS9A 1JCYA 2GRTA 3LQGA 3AMCA 4J3TA 3VIHA 3KTSA 5A8PA 2OKOA 3BOLA 3SCPA 4TX9A 1LOSA 4LYPA 1EL3A 3ATYA 1AH0A 3RJXA 3Q94A 1EF2A 1H7XA 1MEIA 3LHWA 2OSWA 4W85A 3RILA 1H7WA 3ZJ7A 1K7FA 3VILA 4A8NA 2O4MA 3KBJA 1Q4WA 4H6QA 2CHOA 4IISA 3LI0A 1MNSA 2PF8A 3FW6A 1Q6RA 3HPFA 2XGIA 4J3WA 4AZGA 4IFOA 1E9IA 4CLMA 1TPC1 1E6NA 4H8VA 4NSBA 3MVIA 2FPVA 2O9TA 3FAWA 1QW8A 1VD6A 1DXEA 3PJWA 2NVKX 4GABA 4BI6A 3H26A 4P7LA 1JDFA 3ES8A 1J6OA 3CAQA 3R8RA 1DNCA 1KCZA 4J3XA 3KLJA 4PH6A 2V3EA 4YWSA 3LI1A 4BI7A 2A5HA 2PDQA 4HSNA 1BXBA 2V5BA 2XIOA 3WUFA 5DN1A 1ZMDA 4LUTB 3IIXA 2Q3RA 3VD3A 4HIBA 2PDFA 3PR2A 2CLFA 3OJGA 2ZRVA 4L9ZA 3M0KA 3S46A 5ABTA 4Z1DA 2CERA 4DZAA 4GX9A 3N2BA 2BZNA 1V3HA 1R9XA 5F4WA 1JGIA 3G6LA 5T9BG 4BURA 3CUIA 3CPRA 5BOEA 1QRQA 1UOKA 2EKCA 4RX0A 4H4IA 3QR3A 3UJSA 4FZIA 3ABOA 3KX6A 1XSJA 1FWDC 2VR5A 4LAMA 4MYAA 1XCWA 5A8MA 4AD0A 3O8AA 1MW3A 2ZZ0A 1UJQA 3QW4B 4UFMA 4DUXA 1HKVA 1VIWA 3SQSA 2WB5A 4Q8UA 9CGTA 4NAEA 1XBZA 1LLOA 3T09A 3ISIX 1DQWA 2C16A 3R25A 3LMZA 3N25A 2EHHA 4GUFA 3VIPA 3G1VA 1VFMA 4WY0B 2YVJA 3UWVA 4PUDA 3VPLA 2BDQA 1LL7A 1W2VA 1CGWA 4PGLA 3T0AA 4HNLA 5HUPA 3S5OA 4X63A 3IPWA 1CB2A 4HNUA 4Q4MA 3K8LA 3U4AA 1U5HA 4CNOA 4NYYA 1KM6A 3QZAA 3A9IA 2OZ3A 5CSUA 3WQ6A 3UPBA 3H2OA 2MANA 3M9YA 3LYEA 2H3BA 1L6GA 2BHYA 1C92A 1B9BA 3WFAA 2XVNA 4IMDA 4OV9A 2BODX 2JIEA 3T1GA 4MB4A 3TXZA 1K9TA 3NGJA 4KBXA 1Q4NX 3VX0A 2A7PA 3DOPA 1R3WA 3CHCA 1LQAA 1H4PA 4K7VA 4ZA0A 4IMCA 3C0QA 1ZK7A 1E0VA 2Z6JA 3EWBX 4MY9A 3MJMA 3PJTA 3WUBA 3VTRA 4CKQA 3P62A 2XN2A 4FLSA 2QT3A 2CKSA 1NHRA 3Q37A 1GRAA 1AFSA 1J8VA 4W7UA 1VB9A 2VJXA 2JIWA 1FCVA 4HA1A 1E4IA 1UR0A 3GKFA 4LUJA 1CCWB 3GTFA 1TPB1 2XTKA 3MI6A 3AJXA 2D69A 4ZO7A 4CEXC 3MU7A 1XIGA 3HU7A 1BYBA 1WDSA 2I1OA 4IFRA 1JFHA 2Y7DA 3NZPA 3GC4A 4AVOA 3OLIA 1NWSA 4DYEA 5IDIA 3CC1A 1UIOA 2ZKMX 1XYBA 3SCTA 5CPSA 4QG8A 1FWIC 4R7JA 1GQNA 3ZSTA 5A95A 1E70M 2WXDM 9RUBA 4BWLC 1R3TA 4XBKA 2Y2WA 2DT0A 4OKDA 1W9BM 4NVTA 4AXNA 3FA4A 5JUVA 5EU9A 1PKYA 3LN3A 2W3ZA 3CLMA 1S1RA 1WZAA 4Q8QA 1BTCA 5LSMA 4B16A 1CXEA 2B7QA 1VZWA 1MWOA 4XWUA 4OT7A 3CYVA 4LAUA 4AHOA 1JR1A 3QF0A 5C7HA 3T8QA 4XZNX 3S8HA 2GGEA 4Q8NA 4W4QA 2GQWA 3AM9A 5DBTA 1ZRQA 3GZAA 2NWSA 2VVSA 2PA6A 3LMYA 1P6CA 3APGA 2GDQA 2KZHA 3WH9A 3VD9A 3WQFA 3HMJG 3C2FA 5CH9A 3BG3A 3T07A 4XUYA 3O0KA 2BOEX 2EJ1A 7CGTA 1I75A 2DORA 4FNTA 4LCSA 2YB4A 1F05A 3P82A 1BAGA 1EGMA 3O1NA 1Z6KA 2R1PA 2YW4A 4C7DA 3C0LA 2R94A 1EJWC 1FWJC 1H41A 5B7ZA 3W02A 2OEJA 4GI4A 4ERGA 5E1QA 4F8XA 1RCXB 4O1FA 1I2NA 3CV7A 2AL1A 4J35A 4D72A 1UP3A 3MUAA 3I7QA 4RR4A 3CGBA 1ONEA 4B5NA 4US5A 3A4XA 3W82A 2WZHA 4F9JA 3ARZA 3NEVA 3CHFA 3DH9A 3MYOA 4AAJA 3KOXA 2ZE0A 1MRQA 5ECUA 4OE7A 5DMLA 4CD5A 4AY7A 3FXYA 4HCDA 3UP8A 1XUZA 1YDOA 2VEGA 3V5OA 2V5LA 3L65A 3W1TA 2CBVA 2WOQA 4ATWA 4CGTA 5KINA 1DBTA 4AWSA 3W1PA 2GK1A 3O0HA 3O6YX 1EQCA 3H2EA 5K3VA 1X97A 4XZHA 4QQUA 4X9SA 5HWJA 3ZR5A 4QFUA 3RR1A 5DRCA 4HJFA 3ARTA 4JDYA 1W56A 3B0XA 3SRKA 1ME7A 1E3XA 3F4NA 3UU0A 4PFHA 4OTKA 3WDIA 3LGDA 3ARUA 4MDPA 5AHMA 2ACQA 2P0IA 4D2JA 3T4CA 3FAXA 1KGUA 3RR4A 4YTQA 5D9NA 3WSUA 1ISXA 7TAAA 2ADAA 2CDUA 1OGBA 2NVCA 2G0WA 2Y7GA 3HMCA 1MQRA 5C0QA 5EMJA 1ZPTA 2OJPA 2D0FA 3UWQA 4TIMA 4GFSA 2X1UA 3KRUA 5A2CA 1TIWA 1QT1A 5GNZA 2POZA 3WN6A 2HRWA 1EBDA 3PPGA 5GJPA 1GQKA 4Q22A 4XKYA 5H1WA 3S2CA 5HULA 2DW6A 4V1YA 4H4UA 1FP9A 2WSRA 2WZIA 3WQEA 1A0EA 3BG9A 4C6JA 1CGXA 3GDTA 4QRNA 3SGZA 3TYBA 1ENUA 4IP4A 1EJSC 3S1WA 4TQTA 4LS0A 1MDRA 4NHVA 3IWPA 3VDGA 3GBDA 3TNOA 2YZRA 1GVYA 3OZOA 4AY1A 4JFVA 5CXPA 2Y0FA 1V6YA 6TAAA 1W3TA 2VCCA 5G1YA 1K4HA 1HUVA 2VGIA 3W71A 1VBRA 1JYVA 4MJ4A 4MUPA 4GY7A 5FJJA 2AKZA 3UWWA 3U7VA 2Z2BA 3LADA 4NAFA 4MKSA 3LK6A 2R1KA 2DSUA 1SPQA 4IT1A 1FCQA 4UTIA 3Q58A 3H12A 4V15A 4OGZA 2ESCA 2ZRUA 2HISA 4DUVA 3R11A 4R3UA 5G1TA 3M64A 3AFBA 4AYGA 1QATA 3TFXA 3K13A 3MTWA 4M29A 4UMBA 3V75A 2WHMA 1DJXA 2Y8VA 5BXPA 3EKGA 1UWIA 2C0AA 1HJXA 3FEQA 3M5VA 2ZZ6A 5A2BA 3BAKA 4X2PA 1B3VA 1Q6OA 5DBUA 1W9DM 3CV2A 3A3HA 1JXKA 1BYAA 1BSIA 4HYWA 4PMOA 4TMCA 4KWVA 3OBAA 4DN1A 1CW2A 3OZMA 4AMAA 4WSKA 4EQSA 4D6CA 3PJUA 4P7OA 1HF6A 1ISWA 1P0BA 4MM1A 3A4WA 1OC5A 3VX1A 1Z41A 1TR9A 4WKAA 1EZ2A 3C4UA 4ZBCA 3AZSA 2MUCA 2G3IA 1TPFA 5JH1A 1TCDA 4EPKA 3WBEA 1GSNA 1XSKA 3CH9A 2OSYA 4ICNA 4LV4A 1W91A 4RZBA 3ZWTA 2AQVA 1P0NA 3ARXA 1LL4A 2V5KA 2XSBA 1JUBA 1BZLA 1XBVA 1V5XA 3B0VC 4FO4A 3SW6A 3H7VA 2WJDA 1W3JA 1UKSA 1SUXA 4YCOA 2J62A 2BSLA 3CASA 4IJRA 3BANA 1PHQA 4HT3A 3I7SA 3PTDA 3PUOA 5GQBA 3VDHA 1XLAA 5HJYA 4FMVA 3ZLFA 3VINA 1UH2A 3SUWA 4C7GA 2YBVA 1Y7VA 2PBGA 1YXDA 4AVNA 4L64A 2WKLA 4UCGA 4IG2A 1GHRA 4HNVA 2YA0A 4RE2A 1JYXA 1D8CA 3N2MA 2DZTA 4XQ6A 5HQMA 4UQEA 5G5GB 2NVAA 3VD7A 3HG3A 3EB4A 3WDRA 4YHGA 1GQIA 3W7GA 4W5ZA 3T2QA 4HZMA 2Y88A 4IZGA 2DZUA 1PE1A 3OB8A 3A7AA 5KSWA 3C3NA 2WZMA 5AKQA 5HQLA 1EJRC 4E8CA 1JDAA 3WBAA 4AC7C 2J9YA 5IOBA 5AYIA 2BFGA 5T91A 4LOCA 1KLYA 1R9YA 1US2A 1K3UA 4MIMA 2J88A 2B0MA 3NJ3A 2DZSA 2Z24A 4IGSA 4U31A 4XAPA 3LPOA 4Y90A 4R9OA 4C6BA 4RL3A 4B4FA 2P0OA 1E6ZA 5JIPA 3E0FA 1PTDA 4QJ5B 1H1ZA 3MBFA 3WQVA 1KD0A 4PUMA 4DO7A 3MCOA 1K77A 3M07A 4QNWA 4MAVA 4M7SA 3P8IA 3ARPA 2A7RA 3WD1A 2IW0A 3RCNA 1KV8A 4PMNA 2H6RA 4UTFA 1YDYA 5D2VA 1IEWA 2QJGA 2NQ5A 1F8MA 4CQ9A 1F74A 4PSPA 3C0JA 3TX9A 1K8ZA 1U1HA 2PRMA 2OGYA 1OWQA 4FP1A 3W84A 3LM3A 1IR2A 2C18A 1O5RA 1S7MA 1NDAA 1MYRA 1MSSA 3F4DA 1NY1A 3W70A 5HJLA 1SFSA 4AZ6A 2QCNA 2B81A 2RUSA 4IHCA 4FX9A 3U48A 2VURA 1POKA 1W5PA 1PYFA 4HP5A 1C29A 3A47A 1X6LA 3SCVA 5GNXA 3CGTA 3CWHA 2VRJA 3GQYA 3FVMA 4HYVA 4TUFA 4PMZA 3WK2A 5EA9A 1Z44A 1JZ3A 2BOFX 5C2GA 4DM1A 3VYLA 4WR3A 3UCCA 3G8EA 4WVXA 3C2OA 4LA1A 3W1UA 3L9CA 3CGCA 1DORA 3NDYA 4MJZA 5AYYA 4H41A 1F6KA 8XIMA 1K8CA 1TVPA 4JTHA 2WPFA 1TPUA 5CSYA 2XM1A 4KCUA 2YVGA 3S4TA 1TA3B 3DFNA 3SCUA 3MZ2A 1TJRA 2W55A 1HKKA 5A5WA 2ATSA 4Z2HA 2XIIA 3CIWA 3PS7A 1D7KA 3N12A 4NIRA 3L5MA 1LOQA 5EMYA 3WL1A 3L2IA 3ZZ1A 2RDWA 3O06A 3GDKA 3QKEA 4W8BA 1ZS2A 3MWAA 1W5MA 1JCNA 1DJNA 4L65A 3S9YA 4WSJA 4CN1A 1HL2A 3B8WA 3WF2A 2F6UA 5BRBA 2QXWA 5AHLA 1LUCB 4TTGA 4GHRA 3Q45A 3E3HA 4LXFA 3VOFA 4PTDA 4YJ5A 3MKVA 1FHLA 2P88A 3IJ7A 3M0MA 1IR1A 3AYVA 1X8FA 3O07A 5FL0A 3NPUA 1AQ0A 3WLPA 3N14A 1EA0A 1BHGA 2CZEA 1KBBA 1OYBA 3V1HA 2DQWA 1ZGDA 2XFWA 5LIXX 2QZRA 3EDKA 4NJKA 1N5WC 4M5PA 2OEMA 3MSRA 1GRBA 4HZ7A 2BXZA 4OUIA 1OF6A 3D0CA 1MRAA 2FHFA 3NL3A 3A7UA 7ENLA 3K4AA 3RX4A 3MKCA 3CPGA 3CZGA 1SFJA 1YXYA 1ZAJA 4QBXA 3W1QA 4JTJA 1PO9A 3ICJA 3NEHA 1G7VA 3S1UA 4W87A 2QCDA 3QTGA 4GD0A 4NNBA 3VKJA 4FNRA 3BGJA 3VIJA 3RO8A 2A1YA 1I45A 3LXAA 1C90A 1XWYA 2FVKA 4GI9A 1FVPA 4UQAA 1ZJBA 1S5NA 2GYIA 1B9ZA 4PEKA 4R88A 3U4FA 3H4KA 2WCAA 4ROPA 3I3BA 3LLDA 3OGRA 1A47A 2ODOA 6XIAA 4S3EA 4FA3A 3GUGA 4CU7A 2V2CA 1NOUA 2J6XA 1RA0A 3MP3A 4I8DA 2Z1WA 5FAJA 5IM51 3NZGA 2JE8A 4HQVA 4D6GA 4GKTA 2BHUA 3BDKA 3UESA 1VJIA 4KQNA 3TQKA 3H21A 3GR7A 3L0KA 1F9CA 2XH0A 4FLQA 3CXOA 2RGLA 4LGXA 1QCWA 4CQBA 3ZT6A 4PTNA 1V77A 2FVLA 2XIQA 1UOZA 2OWWA 4G6CA 5I78A 4ADSA 2QJJA 1MNZA 6PTDA 1ECQA 1GW9A 3CZLA 2X0HA 3TE9A 1IZKA 1C3FA 4H6RA 1P7TA 5A6JA 1UROA 2GUUA 1WKYA 4K2SA 2QDHA 3QLLA 1S5TA 1OFDA 5HNNA 2CBJA 1C93A 2RDTA 1BWLA 3WO8A 3PB2A 4PZVA 5LNVA 5E70A 1XYCA 3GKAA 1TA3A 2HS8A 4YVPA 4XBJA 3UA4A 3V4BA 1V6UA 3WNKA 1SO5A 3QH2A 3TQPA 9XIMA 1BVZA 4KF1A 2AGKA 1GZGA 1IEQA 1W1VA 2A4AA 4DPQA 4ICCX 4ROQA 3A3XA 4IPLA 2DP3A 2YLLA 3ARVA 4CNPA 2YIHA 2VWTA 2PGRA 1Y65A 3NQ7A 3T55A 3EOSA 4QLLA 3EGJA 1QBBA 2HXTA 3DYMA 4FXRA 1OVDA 3CT2A 3QTPA 2IUZA 4Q4OA 1M65A 4AEOA 4F2TA 2QUMA 2ZOXA 1NEYA 3OVGA 3QW3A 1ISVA 1EUAA 3C2VA 4Z2KA 2ZZ5A 3LNPA 1RBLA 4RZ5A 1EO5A 3BJSA 1FEBA 1TYTA 2IKGA 3QGKC 3DK8A 3TW6A 3UZWA 3GFZA 2GUYA 2E6FA 4JTCA 1EJXC 4IQDA 3TCEA 2WVUA 4KFNA 2C1IA 4G9PA 4TXEA 4TX8A 2PGWA 4UNIA 4FLRA 1QO5A 2W6RA 4ZENA 2VUNA 3O15A 1TRDA 3BK0A 2PTWA 2PWVA 4DYJA 4DJFA 3W76A 4JKKA 4PL1A 3LRLA 1UQYA 1FQ0A 4ERAA 5FCZA 2H8ZA 4PL2A 3TTQA 3H4WA 2PWHA 1E71M 3BGGA 3O7UA 4RPQA 1XIBA 2DSZA 3FCPA 5BMXA 3CMJA 3EYPA 3FS2A 5BYWA 1ZKQA 5C55A 5EGRA 1JAEA 4RXFA 4DZIA 3KCLA 3IGUA 3CIXA 2VFDA 1S38A 4M56A 1J01A 3DAQA 1JNEA 3QV6A 4YTSA 3SFWA 5MKGB 4EWJA 1G4EA 4P5UA 2GOUA 4JDRA 3MPGA 3AALA 3SIZA 4FNPA 3HFTA 4JXCA 4UC5A 4RV3A 1OCBA 3CQ0A 4Z1CA 3E0VA 4LAZA 1DIEA 1KTNA 4TR9A 3EPNA 2V3DA 4HCHA 1HGWA 2V3GA 4UTJA 5CC3A 2AL2B 1VFHA 4L6OA 1GOMA 3L5OA 4NI3A 1TKKA 2E6YA 5FIPA 3L8KA 4G5DA 3PNZA 4M51A 3CL6A 4N2YA 1HKWA 4KRZA 3BCJA 3TNBA 1PTAA 1KA9F 1OINA 4O12A 3RLGA 3IUHA 1SZEA 3THDA 2QHAA 4TX6A 2W9MA 1PKMA 4IFKB 3KL5A 1JPHA 3VO0A 4OBTA 2VZOA 3L23A 2ZUWA 3UXLA 3NZRA 3U2EA 3EPOA 1Z7AA 1I0BA 1X38A 3LG3A 3WZ0E 5KVHA 2Z27A 1V08A 2VFEA 3L4XA 5BRPA 1WAWA 2PB1A 1PPIA 4QROA 1H5VA 3AIRA 5FEZA 3R79A 1KN0A 1XRVA 4KCWA 1CBGA 1RR2A 3NZQA 4V33A 3VIGA 3DGBA 3CUZA 3RRAA 3WUEA 1KR0A 2JGYA 2E3TA 4DXVA 3W6MA 3DX5A 3OU8A 3EKLA 4JYFA 3R58A 4YYCA 5HOSA 3DFTA 2UWFA 1ISYA 1CXLA 1AJ0A 1W1PA 5CSSA 3WX7A 1OSEA 2I5IA 1XLJA 2ZTJA 5TF0A 1JYWA 1UWTA 3DKLA 4PE8A 3ITOA 3MDUA 3ALFA 1HO4A 3PZUA 1KBIA 2G50A 5ABHA 3ZR6A 2VFIA 1R5YA 2GFTA 4J4KA 5EMUA 2ZQ0A 1IXPA 3BE7A 3OVQA 1F5ZA 2Q3OA 3LPPA 3VNMA 4BFAA 2QUUA 1O66A 4GKLA 2RJGA 3KVKA 3DHPA 4IIEA 2FQIA 3R8HA 4JIIX 5GPRA 1I1XA 2J74A 1H09A 2P1FA 1Q13A 1UD5A 4IQEA 5CAKA 3MUCA 3P2VA 2GJPA 2IPGA 3L4VA 2DVXA 1OX4A 2CPUA 2PDWA 1Q6CA 1WOAA 5KEZA 4QJ4B 2G4FA 5I7GA 4LBRA 3N34A 5BOFA 4H7VA 4GE8A 1O4UA 5A6KA 1A3WA 3O16A 4DF2A 1KWGA 1IZCA 4ZL1A 4L80A 2PI6A 1LG2A 3B9NA 1I2OA 3UXKA 2CC0A 3F4WA 1E6PA 4QCEA 4CEUC 1R46A 4FIQA 3RMJA 1TV5A 2PPGA 3R0DA 1VF8A 3QC3A 4J3UA 4J40A 4O16A 1VJSA 2Y6ZA 4FXSA 1SGJA 3KS6A 3C3UA 2V30A 4OJYA 3RNDA 3WEOA 3GVRA 4UFKA 3LUTA 3PTMA 2QGYA 4F2BA 4CCEA 1R9ZA 3EX6A 2J9ZA 1J79A 2OVLA 3NQGA 3HB9A 3W7HA 4MWAC 4ICMA 4ZFCA 2GGIA 3N2XA 2AL2A 5CZSA 2IS7A 1XANA 1EYWA 3S6TA 4NZFA 1EO7A 1T5AA 2GVEA 2PU0A 4C6MA 3HG2A 4LB3A 2E28A 1DJZA 3GVGA 3W7RA 4NU7A 1T3QC 3G8RA 3UWZA 3O6CA 1RPKA 3A64A 1YRRA 2V2HA 4CD7A 2ZZ2A 1HJSA 4M6UA 2AGTA 2FDMA 4XAGA 1O7AA 2HMCA 5TR3A 4RDWA 5KITA 3H2FA 3T9PA 1H7PA 1TVNA 1AL7A 2WNZA 5D38A 1RQHA 2ZUTA 4C6EA 1MXSA 1O60A 3OLDA 4AUBA 3TAKA 3GH5A 2PTZA 3AHTA 3TYUA 4WF7A 1S2TA 1PHWA 3GHTA 2DJLA 3SJNA 5LIYX 3EX1A 3C2YA 2W3RA 1UD3A 3BL3A 3GX9A 3CGDA 1MVYA 1HVQA 3SUTA 2EPKX 3PZMA 3FGCA 1J2BA 1Q6EA 5DO8A 3UVAA 1EPXA 2ZDSA 4PUNA 5HWMA 2HSAA 3M6DA 4FLOA 4H8HA 2PP1A 3ORWA 3UXAA 4B5XA 5HR7A 3P67A 3DIPA 4D8LA 4ZVJA 3RU6A 4NT0A 1H0IA 4CU8A 4DXXA 3A4JA 2ZZ1A 2Q02A 2UBPC 5M03A 1QDSA 6CGTA 4OFCA 3UD6A 1UMLA 1IXNA 3UZYA 3LBCA 1OK6A 2PGFA 3AHZA 4JY8A 1LF1A 4Y2WA 4XIAA 3F5LA 3I4EA 3M0VA 1IEVA 3W85A 1KRBC 1NQ6A 1KXVA 4V28A 1PDYA 4REQB 3F2DA 4LALA 1FP8A 3CQIA 5JCIA 4HU8A 3LOTA 3WF0A 2REQA 4JTKA 1QNQA 3CK5A 4CQ8A 2A3AA 5BW6A 4F66A 4S3BA 4KERA 4PCTA 3DH7A 4Q8TA 5K9DA 3DBPA 3NQMA 4MWAB 3UYIA 1QOQA 3W24A 4E8GA 1IGSA 2WPCA 5IHRA 4F0KA 1TWDA 1NFPA 1PSCA 4FB7A 4MWAD 1US0A 1MDLA 1BF6A 4MF4A 1MXGA 1R0MA 1HKMA 3F5KA 5FEXA 4MPKA 3WL0A 3NVDA 2CLLA 2V81A 2J47A 1IXQA 1K7EA 1TTJA 3LS9A 2FFIA 3PBWA 2NV9A 2IKIA 2PLKA 2EGZA 3WLJA 3P81A 1TELA 4LX4A 1AD4A 1Q8AA 2Z28A 4EE9A 4LCQA 5BNKA 1HG3A 5L9FA 1S2VA 2J13A 2J8GA 2NXGA 1Q1WA 3IGXA 4B5VA 2SFPA 1HL9A 3IIVA 4JY9A 1FWHC 1H6VA 3O2LA 4F48A 3CZJA 5C71A 3KOZA 1KB3A 2EPLX 2EO7A 4L1GA 4Q4KA 5MHBA 2WMIB 1YE6A 1W37A 3GK0A 5LNUA 3IIZA 4Q33A 1XW8A 2CLPA 3GXPA 3CPUA 4GYFA 4JIHA 4K37A 4QP0A 1ZSXA 2VCAA 3TUUA 4QLKA 3LV6A 1OD8A 3SR6B 1NU5A 1EXPA 1QUMA 3BMWA 1GTEA 4ZQMA 1DV7A 4QCFA 2F8QA 1VEOA 2QIWA 1O5XA 3NCOA 3MANA 2I9UA 2VELA 1WCGA 1Q1RA 5LIWX 1VFOA 3HF3A 1LT7A 4A3UA 2GSEA 4O14A 1OF8A 3BURA 4PTMA 4FR1A 4A3QA 5JVLA 3GTXA 1M6IA 3CHEA 1EF3A 3B05A 1GRGA 1OT1A 6REQB 1JULA 4ZQRA 1S2WA 1R3QA 4M6VA 1R2RA 3MYPA 3PULA 5EMLA 4LANA 3BAIA 3BSHA 2VKZG 3CS2A 1UWAA 1G01A 1FECA 3S47A 2E40A 3B8VA 3N2OA 3DGZA 1X2HA 4AIEA 2ON3A 1M3UA 4NX0A 2ZX7A 4E0CA 5I03A 4FI4A 3ZJKA 3STFA 3PZIA 3MSYA 3V5FA 5T9CE 1UR3M 4XSMA 4P61A 2MNRA 3APTA 4Q4SA 2OO0A 1ZL1A 4W8AA 4GYKA 4J7RA 2HVOA 1CI1A 3I65A 1KGWA 1RHCA 3IIOA 3ARYA 1RD5A 2Q71A 4B5WA 4AWTA 5D2XA 2WV8A 3BAJA 1XBXA 3PSWA 4AB4A 1V3IA 5AVHA 1OB0A 3AS3A 4IJBA 4FXJA 1UR8A 2EPMX 2X8GA 4ECLA 2PZ0A 1YPFA 1PBGA 1XICA 3QOMA 3UBPC 2ZZ7A 1IEIA 3JR2A 2DH3A 4I7UA 1M1BA 3IAQA 3CGEA 2XFRA 2R14A 3EA1A 1W1A1 5AZ0A 2YPIA 1OEPA 4B2DD 1XIJA 2IKJA 4JGDA 1STZA 2C6QA 1TZ9A 2VUYA 3EDDA 2VRQA 2QS8A 1MZHA 3STGA 2PTYA 1E6RA 1QPRA 2YOCA 3PK7A 5EL1A 1H0GA 5G4WA 4GBUA 1XD0A 5CZ0A 2PTXA 2JK2A 2P8CA 4FIRA 5C2XA 3UF9A 5LGXA 3BARA 2WMIA 1GOKA 4DBSA 3UG3A 2OX4A 2F2HA 3NZ1A 3PZ9A 1TV4A 3CB3A 3O05A 5KETA 4OQVA 1WKEA 4N6FA 2E77A 4OV4A 1I8JA