3V4BA

Crystal structure of an enolase from the soil bacterium cellvibrio japonicus (target efi-502161) with bound mg and l-tartrate
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
402
structure length
384
Chain Sequence
MKIVDAKVIVTCPGRNFVTLKIVTDQGIYGIGDATLNGREKSVVSYLEDYLIPVLIGRDPQQIEDIWQFFYRGAYWRRGPVGMTALAAIDVALWDIKAKLANMPLYQLLGGKSRERILSYTHANGKDLDSTLEAVRKAKDKGYKAIRVQCGIPGIDLPSVEVWSTEKYLNYIPDVFAAVRKEFGPDIHLLHDVHHRLTPIEAARLGKALEPYHLFWMEDAVPAENQESFKLIRQHTTTPLAVGEVFNSIHDCRELIQNQWIDYIRTTIVHAGGISQMRRIADFASLFHVRTGFHGATDLSPVCMGAALHFDYWVPNFGIQEHMAHSEQMNAVFPHAYTFNDGYFTPGEKPGHGVDIDEKLAAQYPYKRACLPVNRLEDGTLWHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Starvation sensing protein rspA
publication title Crystal structure of an enolase from the soil bacterium Cellvibrio japonicus (TARGET EFI-502161) with bound MG and l-tartrate
rcsb
source organism Cellvibrio japonicus
molecule tags Lyase
total genus 142
structure length 384
sequence length 402
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02746 MR_MLE_N Mandelate racemase / muconate lactonizing enzyme, N-terminal domain
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3v4bA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3v4bA01
3QPEA 2CHRA 3QN3A 3V5FA 2PCEA 4GMEA 1TKKA 2DW6A 3B97A 3VCNA 3VA8A 2OLAA 3CT2A 2POZA 4E5TA 3DIPA 3FCPA 3ES7A 3CK5A 3ZLHA 4DYEA 2GGEA 3UJRA 3ZVIA 1KKRA 3QLDA 3Q45A 3OZYA 4GGHA 4A6GA 4MMWA 4J3ZA 5J04A 3UCDA 4H2HA 3MUCA 4IP4A 3FVDA 4K8GA 4G8TA 1W6TA 4J1OA 4JN7A 4F4RA 2PTXA 4GYPA 4DX3A 2AKZA 3D47A 2OQHA 2XH7A 3STPA 2GDQA 5EU9A 3ZLGA 2OPJA 3DDMA 2PGWA 4E4UA 2QQ6A 3DG7A 2OG9A 4ENLA 4KT2A 1XS2A 4DWDA 3MZNA 1JCTA 1PDYA 3EEZA 2RDXA 1EC9A 2QJJA 4HCLA 1E9IA 1MDRA 3H7VA 4FI4A 4ROPA 3H70A 3TTEA 1MRAA 2XH4A 3CYJA 1JPDX 3T6CA 3UJ2A 3UJEA 2OO6A 2GGIA 3BOXA 3DEQA 2ZADA 3R25A 4IHCA 2PSNA 1EC8A 3ZVHA 3JZUA 5BOEA 3VCCA 2QGYA 2HXUA 3RR1A 3IJIA 3SN1A 3FV9A 2PU0A 3OPSA 4HCHA 4X2PA 1KKOA 5FJRA 3MSYA 3SJNA 3KUMA 3PK7A 3DFHA 4DN1A 3Q4DA 4GGBA 2O56A 3DG3A 2QJNA 2PPGA 3VFCA 4MKSA 1KCZA 4ZA0A 3IJQA 3VC5A 3K1GA 3P93A 4GIRA 3DERA 2AKMA 1NELA 1WUFA 2NQLA 1EC7A 3GC2A 3VDGA 5BOFA 3JVAA 3TOYA 3U4FA 1R6WA 3N4EA 1WUEA 4HN8A 3UJSA 3N6HA 2OQYA 2P8BA 4E8GA 2OZ3A 2XH0A 4KEMA 3BJSA 4KWSA 2PTYA 1EBHA 2QJMA 2ONEA 4EWJA 1FHUA 1F9CA 1BQGA 4JHMA 3MKCA 2AL1A 3TCSA 1IYXA 1MUCA 3FXGA 3PWGA 4K2SA 1SJDA 3PFRA 2PU1A 3UCCA 3MQTA 2AL2A 3PWIA 2HNEA 3QTPA 3RO6A 3TQPA 3GY1A 3I4KA 4Z1YA 2GL5A 2QDDA 1P43A 3UXKA 4E6MA 3R10A 2MNRA 1R0MA 4DXKA 3SBFA 1JDFA 1ELSA 3NXLA 4ZCWA 2DW7A 3D46A 3CAWA 1SJAA 3P0WA 4G7FA 3EKGA 1FHVA 2HZGA 1PDZA 2OFJA 3RGTA 3DFYA 2HXTA 5FJOA 3RRAA 1MNSA 1NU5A 3N4FA 2GGGA 3IK4A 2OX4A 2PP1A 2XSXA 4IL0A 4A3RA 2XH2A 1TE6A 1MDLA 1ONEA 2PP0A 3UXLA 3DG6A 3V3WA 3FYYA 4DHGA 3NFUA 3TWAA 6ENLA 1ECQA 3T8QA 3FJ4A 3SN4A 3UJFA 4HNCA 3GO2A 2GGHA 2PODA 4FP1A 2QVHA 3N6JA 3I6EA 1EBGA 5FJTA 1DTNA 2XGZA 3ES8A 2MUCA 3S47A 2PGEA 4IT1A 3MWCA 4HCDA 3UGVA 5ENLA 2OVLA 5FJUA 3SQSA 2PTWA 3OW1A 3ZVHB 3OP2A 1YEYA 3THUA 4IZGA 4H1ZA 3TJ4A 4JN8A 1P48A 3R1ZA 3JW7A 5IDZA 4KPLA 3TWBA 4MGGA 1L8PA 4HYRA 2P88A 3QKEA 4Z17A 1JPMA 5FJPA 3MY9A 4M0XA 4HPNA 4IL2A 4YWSA 3RCYA 3R0KA 2GSHA 4GYPC 4GISA 2PA6A 2FKPA 1SJCA 3ENLA 1OEPA 3CB3A 3NO1A 3OTRA 3I6TA 4A35A 3SN0A 3H12A 2ZC8A 3T9PA 3V5CA 2PTZA 3T4WA 3BSMA 3TW9A 3R0UA 4HNLA 2P0IA 1BKHA 2GGJA 3H8AA 3P3BA 2FYMA 3VC6A 4IP5A 2OKTA 4E4FA 4H19A 3R11A 3V4BA 3GD6A 4GFIA 3ZLFA 2PS2A 2PMQA 1SJBA 4K1WA 2PP3A 1KD0A 3NZGA 1RVKA 2P8CA 3HPFA 3U9IA 2I5QA 2QDEA 3OZMA 2AL2B 3CXOA 4M6UA 2P3ZA 3DGBA 4H83A 7ENLA 3TJIA 1TZZA 3SSZA 2OZTA 3S5SA 1XPYA 3RITA 3IJLA 2OZ8A 3DESA
chains in the Genus database with same CATH superfamily
4D6FA 4WF7A 4B5WA 1K8XA 2PCEA 4GKTA 2FFCA 3RK8A 3TIMA 1KNWA 2E6YA 3W84A 1JF6A 4ATDA 1KBLA 1UIPA 1ME8A 3GDTA 4XAFA 2A7RA 1FFRA 2HPIA 2X1TA 2UY3A 4LPCA 4DXXA 3C61A 2DGAA 3C0LA 1VPYA 1K8CA 3AXMA 2VEGA 1VZWA 3OLIA 4Z2HA 3E49A 3HMCA 3SR6B 1HFBA 1KM2A 5D02A 4LU0A 4W87A 4UTUA 5TR3A 1Q6RA 1C92A 8CGTA 2BSLA 3LN3A 4MYXA 3TA6A 1XLJA 4JHOA 3EA3A 1J01A 6ALDA 3SRHA 3R89A 1GOXA 4WKFA 5BU6A 4WDXA 3IEBA 3HIJA 3A47A 7PTDA 4P8XA 1LM1A 4XBKA 3W1TA 4LXFA 2A7NA 4YTRA 5ABFB 2F61A 5CC6A 2Q6ZA 3H2CA 2ZOXA 3OLDA 5HDRA 2Y7EA 2CC0A 3O06A 1BG9A 3AJXA 4D8AA 2ZIDA 4M6QA 5HUPA 3CYJA 3T6CA 4CU8A 1QPKA 3UJEA 4JX4A 1AL7A 3BW4A 3SUWA 4YL2A 3HO8A 3LM7A 1RCOB 1GKQA 1SFLA 5BMXA 1E43A 3JZUA 3P5ZA 4UZSA 4NI3A 1K4HA 2BHYA 4Q4OA 1X1OA 4AHOA 1YDYA 4OZOA 3D3AA 3LMZA 2PDJA 4R34A 3TDFA 3TYDA 1FXPA 3LXCA 1A49A 4B9ZA 6CGTA 2WC7A 3EPNA 3NQ7A 3SGZA 3CHFA 4YWOA 2GQAA 3SB0A 2VFDA 1XYZA 8TIMA 5BRBA 3CLWA 3SQMA 1FWEC 1VBRA 4BHYA 4YMZA 4YVVA 4NX5A 5A6TC 1KWKA 3UG4A 1EGVA 3M07A 4BQ3A 1ZJAA 4LT9A 2WOWA 2ZX9A 3RN6A 3ARQA 3H23A 4TX9A 1TRIA 3QC3A 4ZO8A 3O1NA 2QZRA 3VIIA 2EPLX 1U83A 4PYSA 3EWXA 1X97A 3QF0A 2ISVA 1YPXA 4D6CA 2ZX5A 4K7VA 5EB8A 2R1NA 3DFSA 3UW6A 4UZUA 5U1OA 2F84A 1YE4A 2VVSA 3GXDA 2XH0A 4E2OA 3NQVA 3NPWA 3BJSA 1XRSA 4XSLA 3GNXA 1U2YA 2X0SA 4JX5A 1XIFA 5U4NA 3UZZA 3CL6A 3KDOA 4W5UA 1E4NA 1KGWA 3FHQA 1MW1A 3H2NA 1FWAC 3EWUA 4Z2JA 1H61A 3WK2A 4L6DA 2J3NA 2J62A 3GH4A 3LGDA 3T42A 3W7KA 1HKKA 4QE5A 3PWIA 3RO6A 4B90A 1NTHA 4I9TA 1PCWA 1Q6QA 5C7VA 3LTPA 1GSNA 1N82A 1AK5A 5F2LA 2YCLB 1PHQA 2HEJA 2NZLA 1LWHA 1M3UA 4QJ3B 4ZCWA 1A80A 2XFWA 4GQ0A 3GHUA 1B4EA 3DFYA 3EGJA 4AWUA 3GNNA 2VRQA 2Y88A 3M6YA 4FX9A 2ZWYA 4EAMA 3UG5A 3VNDA 2QAEA 3LPOA 4J3TA 4C6OA 4LF2A 3T7VA 8A3HA 3HGJA 4BI7A 3UPMA 3MV01 2PTDA 4A3RA 2PD5A 2GOKA 1M6IA 2WSKA 1OX4B 2DZPA 2NVDA 4PR4A 1O95A 1XC4A 1KW1A 4K8EA 5T9BG 5FESA 1UZ1A 2CLMA 1UH2A 1ZBCA 3TWAA 1Q3NA 1H60A 2R9RA 3OG3A 2PDMA 4BV6A 5GJNA 3MB9A 2W92A 1I2PA 4QDPA 3HMJG 2BGQA 2RUSA 5CSUA 2MUCA 3WJZA 4NNCA 2PGEA 4QGCA 4OE7A 1MQQA 4IT1A 1VF8A 5CJMA 4JFWA 1I1WA 1NM9A 3HG3A 5JVLA 5FJUA 2G50A 2PCQA 3PBVA 3ZVHB 1ZAIA 1UPMB 3W71A 1WZAA 4INFA 1R46A 1ZQ5A 3WBEA 1AQ0A 3MCMA 3F5LA 4R7WA 2NX3A 2ZRWA 3RDKA 1EOKA 4Y9AA 5AZ1A 1SFSA 1HKJA 4B3ZA 4OHQA 4PODA 2Z2BA 1XBZA 4R9OA 1UD5A 4IXHA 3EWYA 5HMDA 1O1HA 4H4ZA 4W4QA 1UWUA 3CZGA 4IP7A 1VDVA 3QBUA 1VLWA 1LT7A 2E5DA 4JKKA 4J56A 3L0GA 3SCVA 4L7ZA 4OECA 3F4NA 3CASA 4AW7A 4XTDA 3K30A 3GHTA 2FHFA 4HB7A 5E1QA 3W7JA 1FY6A 4JY9A 5F4SA 3JRKA 3Q58A 3CO8A 4H6RA 4L61A 3AWNA 4J5NA 2WKLA 2R24A 1RBAA 2WQDA 3ATZA 1H7NA 2FYMA 1OG0A 4JXCA 2EQ9A 1FCBA 3W7HA 3WQ8A 3SM0A 2YOCA 1LG1A 1W8SA 4J27A 2XGBA 2QNEA 1R5YA 1W5MA 4F48A 3THQA 2FH8A 2PMQA 4ADWA 2FTPA 1SJBA 2F2HA 3S5YA 3E0VA 2JKAA 4OKDA 2NQZA 2J9ZA 3CUHA 4MPKA 4TVCA 4AMAA 1JZ6A 4YN5A 1OFRA 1G01A 5EMLA 4QCFA 3U6WA 1WX0A 1TRDA 1IXOA 4NILA 5JH1A 3P8IA 3DGHA 4JTIA 5RUBA 1RCQA 2XN0A 2XG9A 3W7LA 2FLIA 4M6PA 3H4KA 1XLDA 4GH1A 1SSGA 2AAAA 2AGKA 4APNA 3GNOA 3QEZA 5CPQA 2ALRA 1LOQA 5I07A 4ML4A 3EDFA 3OQ8A 5D38A 3SCPA 1I2OA 1TKKA 4L4LA 3SDOA 3FA3A 1S2WA 2V38A 1A50A 4YNGA 3ZFHA 7TIMA 1UIOA 1IF2A 1XLFA 2POZA 2POTA 3WF4A 3DIPA 5KSWA 2WW5A 4XAPA 2Z26A 1QBBA 3AU2A 1XDMA 3BH4A 4C1KA 3EPMA 3IAQA 1AVAA 4I5UA 2GR3A 3ZT6A 1JPKA 2GGEA 5D30A 4LCRA 3UERA 3GBDA 3FNDA 3MUY1 3OZYA 4FLOA 4H2HA 3FW6A 2WHMA 1US2A 2VZVA 3EPOA 3G3MA 1US0A 3NG3A 4LNYA 1H7WA 1BVNP 3R13A 1EJTC 2PTXA 4B5VA 4NP7A 1ADSA 5I3GA 2YBVA 3VDAA 3KFTA 2FHBA 1MUWA 4WQ6A 3E2RA 5C9WA 2HROA 1H4PA 3S1XA 1KM4A 1FIQB 4EAYA 4UQBA 3VNMA 3MSDA 1JZ8A 4C1LA 4PA8A 2DFAA 1GXFA 4DWDA 3C2RA 3CL8A 4MY1A 4AEFA 3B9AA 5CQ1A 3PF3A 1WZKA 1W5NA 1G94A 5J8LA 5JCMA 3H70A 4CVUA 2F6XA 4B5NA 1GQKA 1OC7A 4XVEA 1CGXA 2ZADA 3NIYA 3GXPA 2A3CA 1J6PA 3KXQA 3XIMA 1DBTA 1B3ZA 4IQLA 2XSAA 3QLLA 2XJ7A 5C2XA 1GOIA 1NDZA 3B40A 4KWUA 2ESCA 3IJ6A 4FX6M 4GGBA 4H9XA 4F8XA 4L9ZA 1H6VA 1GVQA 4JTSA 1E1FA 1KM0A 1NARA 1H09A 4X2RA 3TR2A 2XFFA 2B81A 1DIEA 2INEA 3QW3A 2AKMA 4BA0A 2VRJA 2D0HA 1Z42A 4UTWA 2BP1A 1YX1A 4LVFA 4G9PA 1P0KA 1A5BA 4QCEA 1A5NC 2WPBA 3U48A 3R58A 3EOSA 3N4EA 4OJYA 1H41A 1PX3A 4R7OA 3AIUA 3GAKA 1NOFA 2F38A 4LCSA 3LHYA 1CNVA 2AQWA 1MEIA 3K13A 3ZR5A 4DWSB 4F9JA 1CIUA 1VRDA 3ALFA 1M65A 2D2GA 3CZLA 1IZJA 2V3GA 5D8ZA 5I03A 5D32A 4HNOA 1BQGA 3NTYA 1AQHA 3NSMA 4IFRA 4LY4A 1WKDA 2WKGA 2ZUNA 1PKNA 3TYEA 3GG7A 5LNWA 2QHAA 3WLPA 1DWJM 3AS0A 4X3ZA 1IT7A 1HVXA 1VAHA 3O6CA 1O66A 1S46A 3D5HA 2F9RA 3W22A 1QT1A 4KEUA 2ZICA 3PJWA 3OZOA 3GVGA 3N18A 4HNVA 3W7MA 1EHNA 1XIHA 4JTJA 3OBAA 1RPKA 1GETA 5HWMA 2Y5JA 3LHWA 1FWFC 4UFJA 1W3JA 2NV9A 2HXTA 3WF2A 1C90A 4B5SA 2ZZCA 4WDTA 1JYNA 2YFOA 4Z2LA 3CWHA 1QPRA 4YTTA 2WWCA 4HN4A 2D2HA 1VFOA 4LEQA 4G1KA 1VEOA 1GG0A 4MY9A 3F1QA 1M9HA 4GY1A 3O3RA 2DSWA 3B05A 2GK1A 3THCA 5DELA 1F8WA 3T8QA 3N25A 3RPMA 4NZ3A 3UJFA 2G97A 1QWGA 5D2VA 5HJXA 4FP1A 3LXAA 3W2MA 3D3FA 5HNUA 2TSYA 2C79A 3KHJA 3TZNA 3NM3A 4S3GA 5I3KA 4B3LA 4W8BA 2IKIA 1AMKA 1XUUA 3WD2A 1VENA 4F0KA 1GKPA 2ADAA 2DZVA 3THUA 3LCFA 4FOUA 3VIHA 3KM8A 1NSJA 1P6WA 2GQWA 2BOGX 2INFA 2PDYA 3U5YA 2OTDA 1RP9A 4CLMA 3W2NA 2C71A 4L6HA 1LVLA 1N5WC 3W2JA 3BV7A 1ZLPA 4D6GA 1RY0A 2UY4A 4N6EA 3GXIA 4YCPA 3GXTA 1O6IA 3C4UA 3LZ3A 2V3AA 4US5A 3BZJA 4JCLA 1KA9F 2ZDRA 2WNZA 4LVBA 4NXSA 4CNOA 1TWWA 3LOTA 1V6WA 4WZHA 3UR8A 1GZGA 1FKXA 3N6QA 1J0JA 3LU2A 3B8TA 4N02A 2RH9A 4RE3A 3LBCA 1TMQA 2CLPA 3SCWA 1WYIA 4DF2A 3UXIA 3GR4A 1HKVA 4EM3A 4UCFA 1F8MA 3L68A 3HTWA 1E0WA 2QAPA 2ZUUA 3HZ3A 2VKZG 4GNVA 4R85A 1VYPX 4OVXA 3FA5A 3WH6A 1HW6A 2PURA 3B03A 3PBYA 3D6NA 2V5LA 3MMTA 1XLEA 1VCGA 1V0MA 2ZA2A 1ONXA 4BWLA 1ZBVA 4RNJA 3VYLA 3DGBA 3GNDA 3DU0A 1VJIA 2XHYA 1AG1O 4PFMA 2PLMA 1B3VA 1QNVA 3UNDA 4CNNA 3MC5A 2E1DA 3RITA 1SSDA 4NYYA 1I2QA 2YZRA 3W72A 3PBWA 3W2UA 3A9BA 3BOFA 4Q8TA 4H2CA 1DJXA 2B7PA 1PWLA 3WLKX 3TLLA 4XKMA 1IV8A 1UBPC 3WMLA 3CT2A 4E5TA 4LX4A 4YU1A 3ONBA 3TC6A 4P7OA 3DX5A 4DYEA 1BTCA 2WNWA 4E0CA 4K37A 4IJBA 3ORWA 3GU2A 1GOQA 4JTEA 4PTDA 2C3ZA 4I9MA 3H55A 1XGZA 3TYAA 2AQOA 4KWOA 3SURA 4M56A 1UUMA 3MUCA 3M43A 3GD4A 1BVWA 1TYPA 1ME9A 1W9BM 1BWLA 4U2YA 4FS9A 4J1OA 4HSOA 3WNLA 3KBMA 5K3VA 2NLYA 2V2DA 4PRRA 3HFTA 3DH9A 3S6OA 1QRQA 4PTNA 1THFD 1J0HA 3M41A 3PJTA 1P6CA 3UZ5A 1FWTA 1OFEA 3CZ8A 4XZLX 1I6NA 1FVPA 1YXDA 4RLIA 4BY3A 3IANA 5HULA 3B04A 5CPMA 4KIRA 1I8JA 1IWBA 1O5KA 4ADTA 2NXHA 1IIHA 1KR0A 4XZIA 3IJ8A 2IQDA 2J75A 2CWNA 4FMVA 3E02A 4NJJA 2FTYA 4JTAA 1X2GA 4MFDA 5HJLA 1R7AA 3W9ZA 3LHVA 5CPLA 4CQAA 4WKAA 1W8GA 1GJWA 2D3LA 3TP4A 2CESA 2Q3RA 3WUFA 1PIGA 4V28A 3JS3A 1JCXA 2PC4A 2Q71A 3R12A 3NYDA 3W1AA 2ACUA 1S5WA 5G4EA 4O12A 3TKFA 3S2MA 4QG8A 3AIEA 1J93A 3B9NA 5FOOA 5AZ0A 1EH9A 1RZMA 4QG6A 1TYTA 4HMCA 4DN1A 1OF8A 3LXBA 4LRSA 2PPGA 3K5XA 3QW4B 4M1BA 4REQA 1JD7A 3G1RA 1JAKA 5AHEA 2CLOA 3SQPA 1FWWA 3BURA 4D6JA 2OGJA 1K8ZA 3CV6A 3AYSA 5BXTA 1TPUA 1QWKA 1BLIA 3O63A 3TU9A 1NDYA 4AD5A 4Q22A 3M0LA 4AZ6A 3FKKA 3SFWA 3DI0A 3L5AA 1TB3A 2FPTA 3ZT5A 1OT1A 2C15A 5AHLA 1DQWA 2JQXA 3VIFA 3NR0A 1UJQA 2VJXA 1M7JA 2IKHA 3QV6A 3KLLA 1PB0A 2PTYA 1I2NA 2ONEA 4D8ZA 4EWJA 1OCQA 4XBSA 4JHMA 4Q4KA 4ZMGA 3RILA 4LUYA 3TCSA 2IXVA 1H3GA 3VGBA 2BFGA 4C5ZA 3FG2P 3FXGA 4J3XA 1GESA 2OCZA 4EANA 6REQA 8RUCA 3CPRA 2GSEA 4GRSA 4XKYB 1W1ZA 4ZSTA 4QISA 3HGSA 4Q4PA 1MNZA 1L9WA 1EPVA 3R10A 1UHVA 3U7VA 3I10A 3B06A 4N42A 1TWIA 3NS1B 2XN2A 1VFHA 4AU0A 1T0OA 1UD6A 4CN4A 1DTUA 3WQ5A 1UR2A 1V02E 3WNOA 4NY2A 5LXEA 3IK4A 2OX4A 2PGRA 3NJ3A 2PF8A 1YE6A 4WXYA 2XH2A 3SY8A 1GRBA 2NSOA 4YYCA 4DBSA 4M82A 1C8XA 5BRQA 2XIIA 4DHGA 3M16A 1WXYA 4JTKA 4AC7C 3DYPA 1KFCA 1UD3A 4OBSA 2PODA 1ITXA 3FFSA 3GKFA 4F2BA 2QVHA 3PUEA 4N2YA 3WCZA 3B0PA 4GX9A 3VMNA 4AG0A 1ESWA 1PYFA 5TAOA 4TVDA 3QR3A 3VIMA 2Y2WA 3B4YA 3SQSA 1AOGA 1GZ1A 4FF7A 2H3DA 1TJRA 5GJMA 9XIMA 1RALA 5A6JA 4J2PA 4IIEA 4LB3A 3B8VA 3VDCA 3F4DA 5EFDA 5GJPA 1TV7A 3E0WA 1XIEA 4ERAA 1MW0A 2BC1A 1JPMA 3GNRA 3N4AA 4HPNA 3GFZA 3E3HA 4XZNX 4GISA 2OSWA 2VQTA 2PA6A 1ZCOA 1WAWA 2E5BA 1OGSA 3R8HA 3B0VC 2G3FA 1GVRA 5FACA 3MVTA 2Y1HA 1PS9A 3WBWA 3I6TA 1E3XA 1YRRA 4E8DA 5BCAA 5AC7A 1LQ0A 3UP8A 5KEZA 3CPUA 4S2CA 5DT7A 4UQCA 4I5XA 2EKCA 3CQKA 4IMGA 4PC8A 3URHA 3CV2A 1T8QA 2XGIA 2GYIA 4TXEA 4DZ5A 1BWKA 2DIEA 1AW1A 5KITA 1T3QC 5JH2A 1WDPA 3S4TA 3RUBL 4QBXA 1HN1A 2Y5EA 3EKLA 4KCWA 1DJQA 3LLFA 2YA2A 3ITGA 1S5VA 3DECA 4J2MA 1BRLB 3M7WA 3NZGA 2O92A 1RP8A 3RM8A 3SEPA 3P84A 3OIHA 4O1FA 1U5HA 3CXOA 4I6VA 4UOJA 4CEUC 3A21A 3C2FA 4HPJA 1N2VA 5CPTA 1Q6GA 3HOJA 1R9XA 3OGSA 3GTNA 3URAA 3CXBA 1JYXA 2PDGA 3N9KA 1LYXA 3WF0A 3HQPA 3BVJA 3PZIA 4PMQA 5EBUA 1NIUA 3TN4A 1JOAA 3QHOA 2DZBA 1UQYA 3AXKA 4HPHA 3WLIA 3VABA 1X39A 2V63A 3DFTA 2YVFA 1M53A 7ODCA 3M64A 1IIGA 1Z6KA 1DJWA 1XICA 3NUKA 1YIXA 3ES7A 3CGDA 1KBJA 1JPHA 3USBA 2PF0A 3OA5A 5E6YA 1JI2A 1XKYA 2OSYA 5AYBA 1KKRA 3WFLA 5D4YA 2ZE3A 5I02A 5D2YA 3BC9A 3HA1A 1RV8A 2VC9A 7XIMA 3WD1A 2I9EA 1PIIA 2XSBA 2CCRA 5FEZA 4ALDA 3PZOA 3VOHA 2IPJA 4BZYA 3ETRB 4TU1A 3BAWA 4AHQA 4RDWA 4B2DA 4UCGA 4FNUA 5EU9A 3ZLGA 2R1PA 3W29A 5I6SA 4CD5A 2WZTA 1JXKA 3GKAA 1US3A 1VEMA 1A3WA 1L0PA 3COTA 4W5ZA 3CHEA 2X0YA 3U8GA 3APYA 1U33A 3RLUA 3B0UX 1PZ1A 3F2CA 2PDQA 2BY1A 1GJUA 4MWAA 3NZRA 2WVTA 3JUGA 4XTIA 5G2IA 3T1GA 3WQDA 1BFNA 3OVGA 4GXMA 3NPUA 4RZ5A 1JPDX 4DRSA 1OFBA 2HBXA 5FCZA 4H9TA 1XWYA 4IFKA 5D9MA 2OKOA 1EC8A 2QULA 1JZ5A 5BW6A 1XXXA 3FA4A 4MAVA 5TQLA 3WQGA 3B8DA 3AS2A 1TSIA 3SN1A 2XPKA 1RK5A 1M03A 2BGSA 3DH7A 4PMXA 4HSNA 1GV4A 5BMWA 4RDZA 1XIIA 1Y0EA 3M0YA 3SCOA 4U3AA 4MPQA 3M6DA 3VUSA 4LB4A 3DG3A 3VDHA 2QYGA 2REQA 4RV8A 1ODZA 2BGNE 3MO7A 3VVGA 4O16A 3EA1A 4O0KA 1T7LA 4GC4A 1UOKA 4H04A 5BWFA 1LP6A 1C9DA 2QAFA 5KZDA 5C55A 4C6KA 3WDPP 2ZXBA 3PAOA 4G56A 1CZ1A 3L4XA 1IXNA 1UKQA 3K8KA 2OT0A 2W5FA 4W9TA 3IAPA 3ICJA 3LI1A 1X7IA 4CD4A 3HN3A 3VI2A 1EGZA 2WMIB 3T0BA 1G7VA 3G6LA 2VOTA 2E1WA 4KETA 1MRQA 2Z6JA 2PWUA 3R43A 1X98A 1CX9A 3GVVA 3UU0A 1UR9A 1R2RA 1OJTA 1P0EA 5BOOA 5CCZA 1PHWA 4LAZA 5HNRA 2VELA 1HJUA 4JQ3A 1XPGA 4B16A 4LBSA 2YDSA 3AYRA 3QMRA 3RLVA 2HS6A 5C9XA 4MNLA 4S38A 4EQSA 4JY8A 3TQPA 3L4ZA 3GY1A 2X50A 1DJZA 1KRBC 3LD5A 4LUSB 2X41A 5BWAA 1WBJA 2BODX 1LBMA 3UWVA 4E6MA 3PAJA 1EEPA 4JDYA 4UIOA 2DW7A 3WLLA 3D46A 1SW0A 2WHLA 4G7FA 3RCNA 4JDRA 3WQFA 2VGGA 1HIZA 5M3WA 1UOZA 1EJVC 3MW7A 3N3MA 1QATA 3T4CA 1ZP4A 1XYAA 3S83A 3UPWA 1EX5A 4LUJA 1TX0A 2XZ9A 1HF6A 3OHIA 1NFGA 3MMWA 3TJLA 5H8PA 1ISXA 3OHMB 1DEDA 2VX4A 3TC7A 4Z1DA 3SN4A 3VE9A 5CC7A 2NQ9A 4DBWA 4HNCA 4H4YA 2DSKA 3W82A 5BXPA 4Y6GA 3N6JA 3ANUA 4HBKA 3UZWA 2TYSA 2TODA 4Q7NA 3NQMA 3LENA 5B80A 3CUZA 3UGVA 5CKSA 2H9AA 3FN9A 4DLFA 3TYBA 1XBYA 1KRMA 3AS1A 1TZ7A 5L6UA 5E9XA 3UY8A 4UNIA 4ADSA 1PO9A 1GVEA 4WLCA 5KINA 5AY7A 2NW0A 4FNSA 1UP0A 1ZBKA 1BXNA 1FRBA 1JCJA 5I24A 5A6BA 1RY8A 2Z6IA 4PBEA 4DO7A 5GQBA 1UW9A 1H2JA 1FWJC 5ECVA 4ZQPA 3W6YA 4H7CA 1RSCA 2ZC8A 3I3DA 3LTYA 2J24A 3B4UA 1E1EA 1Q6EA 1UBSA 1CXKA 1G6CA 3MI3A 1IGSA 5C9RA 2WNQA 4ZENA 2GGJA 1GPWA 4C7DA 3BW2A 3INPA 2CDUA 2Z29A 2ZZ0A 1IEVA 3IIZA 1S39A 3VGHA 1HP5A 4LOCA 4O0QA 4ZB5A 3EMQA 3R11A 1DJIA 2E68A 4PBFA 1TV2A 4E4PA 1OYBA 2B7NA 2CZEA 2VENA 4GKLA 3AMCA 3S1VA 4LJ3A 1KD0A 4HKPA 1OJXA 2D0FA 2JEPA 4GE8A 2ATSA 1NVMA 1BVZA 3SECA 4C1NA 4XV0A 2E6DA 1M7OA 4B3KA 3FOKA 1XIJA 3D0CA 2CZFA 3AUOA 2E3ZA 4YCOA 4FLRA 3UR2A 4D1IA 4HOXA 1OSEA 4HTYA 4XZBA 4QTGA 1HVQA 1E1CA 3ECQA 1A5UA 3BAKA 2C18A 2X0HA 4ZOHB 3LCLA 2QCFA 1CWYA 1XLMA 3RM9A 1UKOA 3GU9A 4H4RA 3CQ0A 2R1MA 4CCCA 1O1ZA 4GMEA 2CETA 2XVLA 4PMDA 3APGA 1HT6A 3PB0A 2W62A 3BK0A 2NQHA 3EDEA 3S2LA 2NQJA 4JPGA 3F7JA 4AD4A 3VKDA 1VIWA 3TXZA 4A21A 5KVIA 2YL9A 2VC7A 3RJXA 1SYTA 1R30A 4PFHA 3A13A 3VNJA 3K4DA 1VFUA 1TTQA 4K8GA 4YIWA 1B0IA 1KFJA 1Q7QA 3GXFA 4GI6A 4WCJA 4JN7A 4LVGA 4BEUA 3N11A 5A95A 2IQ0A 3D47A 5D33A 3WX7A 4RV3A 3WSUA 3PTQA 5A3HA 2VUYA 4LS2A 4NYUA 2DU2A 5KZEA 3SGUA 4NZCA 4L4MA 3GXMA 5AN7A 3QY6A 2PDFA 2PRHA 3PM6A 3WQEA 5KZ6A 4TIMA 1SFJA 2PDBA 3T0CA 1GERA 3WELA 5AB3A 1EQCA 4HCLA 5EBKA 3S2NA 2HE8A 4CCEA 3ZR6A 4JQ4A 3I7RA 3NQ8A 3BQ6A 1YTDA 3SCTA 1GGOA 4F66A 3WLOA 3BZGA 3TFCA 2PSNA 4O18A 3W23A 3NZ1A 4HGXA 1Z41A 4C65A 1OB0A 2QMJA 2VDGA 1D3HA 3UEQA 1PYMA 3GUWA 3BTNA 4W7VA 3HBLA 4OGZA 1DIKA 3NDZA 1PX8A 3FV9A 1PSCA 3ARSA 2XIOA 4P7RA 3OPSA 2PI6A 3UWZA 1HL9A 2BVDA 3QTGA 1JUEA 3N17A 1K7XA 1CXEA 2Y5SA 4RNHA 5ER0A 1C29A 1H62A 2HVNA 2Q09A 1Z69A 2X8RA 4JYDA 1Q2RA 3B0YA 2QJNA 3S9ZA 3G1SA 3HJEA 2D2OA 3EWZA 3H2FA 4KWWA 1NHPA 4U33A 1CB2A 3FEMA 2GWNA 3E1F1 2QEZA 3VDGA 3W1NA 2VXNA 2KAUC 1NDWA 1TO3A 4WXZA 3PJXA 2CKSA 3P82A 1IXPA 1DWAM 2JGQA 4HN8A 3LRMA 3L2MA 1QUMA 4O11A 4NNBA 5DCDA 5I79A 3QGVA 2C7FA 4Y9PA 3WY1A 4Y7EA 3BG3A 6A3HA 3AIVA 3KP0A 3FVMA 1G5AA 3BL3A 4GI8A 1FEBA 4WDUA 1QNPA 1F9CA 1J0ZA 2WB5A 3HV9A 4P7NA 1HGWA 4BI6A 3LEPA 1KLZA 1UR8A 5JIPA 3ZS4A 1GW9A 2FGZA 4M24A 4WJXA 2VGBA 4AX7A 3UXKA 4AF0A 2MNRA 2EPKX 2VGIA 3UNTA 3MKKA 1SVDA 1C7TA 2WHJA 2VZUA 2EAWA 2F2KA 3SY1A 5FJOA 5D2XA 3TROA 3N04A 1Z32X 3UYCA 3M5YA 5BXSA 4HYWA 4JNYA 5FI8A 2PUZA 4ZGYA 3WLNA 1H49A 5AC6A 2E9MA 4KWVA 2PP0A 4XISA 3DG6A 1KC7A 4IM4A 3LLDA 3NFUA 3OZPA 1H7XA 2BOFX 3DAQA 3P60A 4HJWA 4Q33A 2BBFA 5AHFA 3UQNA 1LBFA 3EF6A 2Z7GA 4M7TA 3BLKA 1V93A 2JBMA 4FB7A 3V0SA 1CENA 3CHCA 3WMSA 1TELA 4XIAA 1H0GA 5TF0A 4AZ5A 4PEEA 4HCDA 5MHBA 1XI3A 4DJEC 4Z08A 1O94A 3BAIA 4WGXA 5FL0A 5EMJA 2G3IA 3ELFA 3I68A 4C6IA 2O7QA 3KVKA 4BJHA 3BSHA 3TWBA 4O8RA 1VEPA 3SUVA 4ECLA 3OYZA 3R07C 1V6VA 1Q65A 3CQIA 3HG2A 3PPHA 4FR1A 3V1PA 4BEQA 3BW3A 3PPCA 1W1A1 4TMCA 1VP5A 5FAJA 4PUDA 5HMEA 3GHSA 3EKZA 2W67A 4NG3A 1Q5MA 2BY2A 1EO7A 3UVIA 3URQA 1Z44A 4U3CA 3T4WA 3UCQA 1Z89A 1W3HA 3R0UA 4DWSD 4ML9A 1F4AA 1QASA 1GOOA 3H54A 4DAFA 3CC1A 2ZBTA 1FDJA 2D23A 4IPJA 4IP5A 2QCMA 4TMBA 1V6YA 4MLRA 2OELA 3VCRA 5I3IA 3K8MA 4LUIA 4I8DA 3M0XA 2W79A 2ZE0A 3ISIX 4U4MA 4ACZB 2DH3A 1OFQA 1D7KA 5H8UA 1UKPA 4DUWA 4LAUA 2G95A 3KZPA 1SB3B 4J9JA 2JK2A 1C8QA 2PDHA 2QUTA 4L80A 3CAKA 1HJVA 1AUSL 1OD0A 2HVMA 1XL9A 1GPFA 1AQFA 1QPNA 4FZIA 2ACQA 3QZAA 1MOKA 3GAYA 4FXFA 1AH0A 1R85A 4HU3A 3T08A 4FSAA 4HJFA 2VC6A 5A8NA 4FOKA 2C13A 2Z2AA 1SMAA 1EWEA 4LAMA 1XISA 4WSKA 5K9XA 1F74A 2DJLA 2RAGA 4WDWA 4RL3A 1W91A 1TWDA 1CGTA 1GRTA 2O9PA 3W1LA 3PTKA 2OEMA 4HHHA 3CIXA 3JU2A 4DUOA 4EXQA 7REQA 2J13A 3G1DA 4GYFA 5KTLA 3UWUA 2PEVA 2EGZA 2HDJA 2DJXA 2OR2A 4GUIA 2ZUVA 1TVNA 2XIMA 5CZKA 3W3OA 3G8EA 4ONVA 1DNCA 1R8LA 5M2FX 3QFWA 4CUCA 5K9DA 1ML1A 1EOMA 1PZ3A 3MP4A 3WK1A 5HPOA 2X1SA 1GWJA 4MLJA 3T0DA 5LYRA 4XO6A 3AYVA 5EMUA 1OBAA 5C6MA 5TBOA 1XR2A 1MFUA 4O54A 4DAIA 3GD3A 3URBA 1KRAC 4M6VA 1VCVA 2W27A 1W2VA 2G37A 3USZA 3AXXA 1B54A 1RR2A 3H2AA 1KXVA 5FD0A 3WJWA 1IEIA 2NUWA 8XIMA 1VYSX 4JKLA 1PX4A 5I3FA 2XM2A 2QUUA 1OGBA 3ZMRA 1GCYA 1A3XA 4FNRA 5T9CE 2GVLA 1EC9A 2QJJA 3CHDA 1EP1A 3CNYA 4JYFA 3E0LA 3CWOX 1FO4A 5LIXX 1GUVA 3PG6A 3H21A 3IVUA 4NAFA 3EXRA 3R25A 2FPYA 4B5TA 1QO5A 2ODOA 1A0EA 1HG3A 3STCA 1S2TA 4EK7A 3NVYB 5JMUA 3RR1A 2Y6ZA 3WDHA 5CG0A 1GOMA 2V3EA 2C8NA 4EQXA 3TOPA 2HK1A 3PK7A 4M81A 3DFHA 3KBNA 4L9XA 3VGFA 3AZSA 4JTUA 4IUGA 3M1ZA 3VFCA 1XSKA 3C5QA 2YL6A 3WLMA 4IIGA 2VEMA 3G1AA 1SO6A 4GIRA 2YA1A 4K39A 1K9DA 1Q85A 5A2BA 4Q8PA 2NQLA 3M47A 1E6SM 1JJKA 3HU7A 1A5MC 1F6YA 2C16A 2O9TA 5XIMA 1X1ZA 3CQHA 5LIKX 1ONWA 3LPPA 3CU2A 1RJRA 2WBKA 4LC8A 5BROA 3SRKA 1GVYA 3AMGA 1KRCC 4OV4A 4H4XA 4JNZA 3A23A 1TPDA 1EBHA 1SR0A 4K8DA 5G4HC 2XWDA 4AD1A 1TTIA 3WBXA 3PJUA 2C19A 4S3CA 2BVYA 3VMOA 3W00A 1G4SA 1J2WA 3DOPA 3PANA 1MXSA 4EE9A 3PTMA 3MQTA 6XIMA 1VHCA 2HNEA 2VUNA 4GOAA 4Y8EA 3S3GA 4R9XA 2O7SA 4KF1A 2OX1A 3G77A 4DJFD 2EXOA 5HMFA 1V02A 1PTGA 1XD0A 5JU6A 4P8UA 2YSWA 3ATYA 3G1VA 2J27A 3WUBA 4IISA 2FZBA 4ZQNA 2VCCA 1GKRA 1YNPA 4XB3A 1B5TA 4UFMA 4KESA 1MVYA 4JTHA 4IIFA 1XLHA 5DRIA 4FO4A 2VL4A 4LC6A 3ABOA 1F3XA 2PP1A 1H63A 3M44A 2YLAA 1JDCA 4UR7A 3ALGA 4Q8VA 5CH9A 2QCHA 2G96A 1PJ9A 2BB0A 3WNKA 2ZRXA 1QNOA 2WLZA 3FJ4A 5AHNA 1ZALA 4HHPA 2EPHA 1N63C 1ZENA 3JZEA 4LVDA 1XGDA 1G69A 2ZZ1A 4HA3A 3C52A 2CZDA 5JCIA 4GY7A 4AX6A 3BJFA 3UA4A 1AJZA 1T99A 4OFCA 2DSUA 3ZT7A 4JBRA 5HNNA 4QFUA 1B30A 3W38A 1GYMA 1F6KA 3CGTA 5E0KA 4Z1AA 3AFBA 2W55A 1KO0A 2GVJA 3W87A 5I0DA 1GORA 3JW7A 3FSUA 3NGFA 4NU7A 4MNMA 3TNOA 4FR6A 1DWFM 5LHFA 4V15A 8XIAA 5K4ZA 4ZSUA 3NO3A 4N9BA 5ABFA 2HRWA 2P88A 1YPFA 3QKEA 3WZ0E 4EMIA 1HP4A 3WNMA 1Q4NX 3CGBA 3QZEA 4F2TA 2GSHA 5FSDC 4GYPC 3G22A 1CT5A 1EL3A 3NO1A 4EQRA 4ZXLA 3BUVA 4B15A 3E5PA 1FXQA 3V5CA 1FKWA 3CPGA 3IPWA 5HQEA 5CJ5A 2DP3A 1QK2A 4ROQA 1YXCA 3GK0A 3W6MA 2VCAA 1BKHA 2JF6A 4PRWA 2G4FA 3ZJKA 1BWVA 3SCNA 3L5OA 1QMLA 3TTSA 4AYGA 1EXPA 1S2UA 1P0BA 2VEFA 3KVMA 1JDEA 1XRTA 1FWCC 1IQ8A 1E0TA 4W86A 3IWPA 1XANA 3N1AA 3DK4A 5IHSA 1JDDA 1H5YA 2ZRVA 4E3VA 2GH5A 1N60C 3FEQA 2Z00A 1ZX9A 4IUOA 2VEPA 1DXIA 2CLHA 2CIPA 4IGSA 1M6JA 3VFLA 1YYAA 3PG9A 4ZTYA 2V8ZA 3FIGA 1VPQA 5HWJA 1LL4A 4JFTA 2D22A 3KVJA 1XW8A 3AU6A 4M6UA 4B4HA 3VNKA 1LZOA 2P3ZA 4FDCB 3EOEA 5REQB 3QJAA 1ZJIA 2WCGA 3IUHA 1ODUA 3W4RA 1KFEA 3VGEA 4OIFA 3O7UA 1BHGA 3W6LA 3IJLA 1O5RA 5DO8A 1Z3NA 1E6PA 3WG6A 2J6VA 4X61A 3LTSA 3VIKA 4EACA 2FZDA 3ZWSA 4AVFA 3BLDA 4F0RA 2W3RA 1XLAA 1JQVA 2ZRYA 1V0LA 2CFFA 5C5YA 3R2GA 4URIA 3M0VA 2CBUA 2ZC1A 3BG9A 4DM2A 3MCOA 4H50A 4TX6A 3CGCA 3FJLA 4DEFA 2FFIA 4Y9OA 2JK6A 1W1B1 2TMDA 1GG1A 4A6GA 5F2IA 1ZY8A 3LB8A 4W7WA 2VP8A 2VT0A 3B9DA 3VPLA 3U2ZA 2YCLA 3RXZA 3WL1A 2IKGA 3KDNA 5C7HA 5U25A 1NH6A 5HWNA 3L5MA 1P4CA 4GC3A 4PTXA 4HMEA 1JZ2A 3RRXA 4KERA 5DY2A 4MB3A 2IPFA 1OIFA 3GR7A 3LYEA 3T2QA 1BF6A 2FHCA 1BXCA 2A4AA 1B90A 1E55A 4GFSA 1Q63A 3CMJA 1L6FA 2BDQA 2I56A 4H8NA 1F6PA 4QLKA 1OX4A 2QQ6A 4ZFCA 3IRSA 1T40A 4UBPC 1V6TA 3TFXA 5FMHA 3HQ1A 4HZ6A 4QRNA 5HMSA 4PUEA 5G1MA 5JCNA 1WZLA 1MRAA 2TRSA 2RKXA 5CSRA 3SCSA 3K4WA 3S1WA 1XG4A 4M8UA 4KH2A 3QY7A 1JPIA 1ZJBA 4IPNB 4O14A 3ZVHA 1W3LA 3Q37A 3QC0A 3TX9A 2WBGA 1W54A 4UXDA 3LCWA 1LRNA 3EWBX 3KLJA 3NM1A 1QW8A 3GH5A 4RE4A 1REQB 2J9XA 1EUAA 4M80A 5M1TA 1XF0A 1FQ0A 3ME3A 2WBAA 5FJRA 3HGOA 4UB9A 3O6DA 2P53A 5HOSA 4XZ9A 2VTFA 5M5DA 4BQ5A 2V81A 3K1GA 1AJ0A 1RHCA 4PUKA 4G2DA 3DERA 2GJXB 1E6QM 2ACSA 1V3IA 1R9ZA 1YTKA 1TPEA 4FALA 3TQKA 2RDUA 3LV6A 4AWEA 1EFZA 2XYLA 3OO2A 1ISWA 4AC1X 3U3HA 3EB2A 3VKJA 4DJDA 2P50A 4KFOA 3CMGA 2VGFA 3ANYA 2NWSA 1Q7MA 3PZUA 2W4XA 5HQLA 1TR9A 2NT0A 3O2LA 1A0CA 4HTBA 4A8IA 1FHUA 4A4AA 3V16A 1GJPA 5DLCA 2QKFA 4U28A 3ARUA 3MKCA 3C3UA 1RQEA 2ATMA 3GXNA 1CGVA 1NWTA 3EX1A 4ZO7A 1VQTA 5H1WA 3IACA 4JIIX 1MI3A 5KETA 3PBMA 5JCLA 3TAKA 3QTPA 2ZQ0A 4FXJA 3S6DA 2WSRA 4J57A 4RDVA 3R4IA 5CC5A 4CCDA 3B0XA 2RFGA 1I0DA 3II4A 4C6QA 2PFHA 2CBVA 3SIMA 5CZ0A 2O55A 1UZHA 3EAUA 3PUOA 2FZNA 3DGZA 2D1ZA 3WQOA 1GT8A 1JCYA 1PDZA 1QPOA 3VKBA 1CLVA 3H2MA 4L1GA 1RCXB 2Z27A 1M5WA 3E74A 2E28A 1KM1A 1NY1A 9XIAA 4AVNA 1ZSXA 1DHKA 3W85A 1A53A 5E0FA 1XIMA 3BE7A 3KRUA 2IPGA 4IG2B 1NPXA 2PDKA 1GVOA 1T96A 1VFSA 3E0FA 2EPOA 1ZB5A 4IMFA 2W6RA 5CLTA 1ECQA 1UD2A 2C1GA 4W8LA 4IPIA 3PC0A 4JKMA 4PUMA 5TD4A 3U57A 2AOSA 3I6EA 1UKTA 4HZ8A 3AICA 3UXAA 3UR7A 3G3DA 1UROA 3PP7A 4GZ7A 2EQ7A 3RO8A 5G2HA 3H4GA 4LANA 3VUPA 1AMYA 1XRVA 4MM1A 1CW2A 1XYBA 1YEYA 1YPIA 1IT8A 2JIEA 5K4XA 2BVWA 1LUCB 2VR4A 4ZE5A 5FS7A 4TR9A 3UG3A 3MP3A 4PZVA 4CQCA 1EF3A 3R79A 4MGGA 3BG5A 4QJ1A 4GZEA 3T55A 3AIQA 3VZZA 1IWAA 4KEZA 2FB2A 2FQIA 1GEUA 2IXUA 4DI8A 5DMYA 4YWSA 3STFA 2GLKA 3NEHA 2FKPA 1UB3A 2XISA 3VM5A 3ENLA 4B5XA 4GIEA 1B31A 1SW7A 3ITXA 3C0SA 1V97A 4A35A 2WK2A 4LUTB 3T9PA 1XSIA 3NZPA 4EMJA 3ZZ1A 1E9YB 1FDYA 1DE6A 4IIDA 2WOQA 3P3BA 2CLKA 4O15A 3HFYA 2CYGA 4Z2GA 1B2YA 5LIUX 2IS7A 1I45A 1GEQA 1ZUAX 1DQXA 4XD3A 3UPBA 1UR4A 3ZLFA 2DUAA 4DJDD 1ZHAA 3PWAA 4GPNA 4NI8A 3TVAA 4PE8A 5LGZA 2RDTA 1JAEA 5CXPA 4YTUA 4PMJA 1EJUC 3LLXA 4U5KA 3S9IA 2QDEA 1ICSA 4MWAE 3OZMA 1Q6CA 2AL2B 1TG7A 2F6UA 3WQWA 4LS1A 4P2VA 4QQUA 4PUWA 3MYOA 3U4AA 3W1UA 1BD0A 1WO2A 3LM3A 4D9PA 4UTFA 5MKGB 3TJIA 1HZYA 1QHZA 5HPCA 2DQXA 4ORMA 4UR8A 3SIZA 4AZCB 1J5TA 3STEA 4BK9A 3H24A 4O1DA 4GX8A 3FAXA 2OZ8A 3WIJA 2SFPA 1I60A 1KTNA 4AISA 3A4JA 1JZ7A 3VZXA 4KCTA 2ZZ5A 3B97A 4FEZA 3PNUA 4PMVA 4JQ1A 4WK9A 3VCNA 3II1A 1RVGA 4IQJA 1FECA 5D09A 1JGMA 1XDLA 1OFPA 4PSPA 2VZSA 2X40A 4O1EA 1ISVA 3OYXA 4D8LA 1CXHA 4QHRA 2DVXA 1DOSA 4GUFA 4J3ZA 3UCDA 3BLOA 3M5VA 3DFPA 4WD0A 3POCA 1VH7A 2YCEA 4AQLA 3AHTA 4X0NA 3LK6A 1K6AA 2QPSA 4RJEA 1O5XA 1ALDA 2NLIA 1XLIA 3NDOA 1EIBA 4NX0A 3ZJ8A 4IFOA 3TUUA 3THDA 1PXGA 4MJZA 3STPA 3NVWB 4AZBA 3A22A 3WDIA 4YTQA 4QAWA 2DZTA 3EBVA 3W1QA 4O1AA 3PZ9A 4GUHA 4JTFA 3AHVA 4GRTA 3IC9A 3C2YA 4MUZA 2R91A 2W3ZA 2LLEA 3L7RA 2VEIA 2TPRA 2G8ZA 4QS6A 1KCXA 3MZNA 1JCTA 4NEWA 1A4LA 3FJNA 1E0XA 4G7EB 1K9EA 1CXLA 1XYLA 3UWQA 3W7GA 5I09A 3L12A 3T2PA 3MDUA 3AMZA 4EPBC 1E9IA 3HB9A 1GTHA 3P8JA 2WJZA 5EGRA 3A7RA 1OHLA 4MB4A 4AVOA 3R8RA 3IRDA 2NV1A 2VFHA 2E5AA 2DVTA 2YPIA 1EP3A 3VK5A 4CGTA 3L5LA 2QGYA 3CH0A 2JALA 4W85A 2UBPC 3FHAA 1RK6A 4XAGA 2ISFA 2PU0A 3NEVA 4Y90A 1NF0A 4GUGA 2ZKMX 1E56A 4X2PA 5D9NA 3VMPA 3E6EA 1W9DM 2PWHA 3SJNA 4F0MA 3W70A 4DPPA 5C2GA 3MZ2A 1FEAA 2ZUWA 3LV5A 2GZXA 3N2CA 3H2EA 1Q6LA 4O19A 3CTLA 2CLLA 1E6ZA 1UD8A 3ZXWA 3WFZA 4R27A 1PPIA 2F7FA 4GK8A 1HL2A 4DVOA 4O17A 2V3BA 3EYPA 1B4KA 2Z1KA 3NCOA 2ZUTA 1C8VA 3EWCA 3NYZA 3U4FA 4EQWA 2EQDA 4RE0A 2ZA1A 1JEHA 3KLKA 1DPMA 1S5NA 2FZ8A 4ZEPA 3BCJA 2OQYA 2YJQA 2YB1A 4WKHA 3EA2A 3W74A 4O10A 5DMNA 1SFTA 3G2GA 3WUEA 2PZNA 1E51A 2CZ5A 1J0KA 2E67A 4ZOBA 2QJMA 2WM1A 1KM3A 1NWRA 2OODA 4YTSA 4Y96A 4JD4A 4MUPA 1K02A 5F2GA 4LVAA 1MUCA 4UMBA 1DYSA 4QNWA 1B3OA 2AMGA 1XJBA 3AQUA 2W63A 3ERPA 4DI9A 1RA0A 4TVYA 3W1PA 1TWSA 3R5EA 2W54A 2BLEA 4J35A 1N8FA 4GO9A 1M7PA 4P7LA 4AEEA 4NHVA 1OQFA 5CBJA 1NDVA 3F5KA 5D9PA 2W91A 3CH9A 2A8XA 3WLRA 4UTTC 3BCDA 3FYPA 2NT1A 1JDFA 3PZTA 3OVQA 1SJAA 3W27A 2DZWA 3O0FA 3IUIA 4UTKA 4F9DA 3OB8A 3BSGA 1XFCA 3DKLA 1IZKA 1DKWA 2JFEX 4JS3A 3S1UA 1MQRA 2PWDA 4AEOA 3H26A 1TTPA 1R3SA 2V82A 4UQDA 5BYWA 3ARVA 4Z2KA 2D0GA 3DC0A 3BMWA 4L4PA 4C6BA 4C91A 2NUYA 1KM5A 1OWQA 3B8SA 1Q1WA 2ACRA 1FUYA 3DJGX 1AZ1A 4LH8A 5D37A 3ES8A 2ZCGA 5C70A 3M9YA 5ABTA 2OXNA 5XIAA 3VINA 2UZ9A 2QCDB 4S2BA 3WEOA 2DIJA 2EHHA 1IR2A 3OW1A 1G0CA 3IIVA 4K7YA 1MYRA 5GNZA 3M5ZA 4DM1A 3PPFA 3H7UA 5CC3A 4WUIA 4DBDA 2PDUA 3A3HA 4C6EA 2NXIA 2V3DA 1E1CB 1K8YA 1SO4A 1UR3M 4IGMA 3GW0A 3C2OA 3SUTA 3T2OA 1FWDC 3RX3A 1BTMA 3UBPC 1L8PA 4ILSA 3ITOA 4HSHA 3SR7A 1E6NA 1EIXA 1UR1A 3QFEA 2CBJA 1RJQA 4LW7A 1XLGA 1EB3A 1EO5A 2WQPA 4IIHA 1JR1A 1H7RA 1GRHA 3W81A 1E70M 3AHYA 1V8EA 4NZ1A 1HGYA 4GG9A 4UQ9A 1RJPA 2EG8A 1E9ZB 4ZXOA 3PBUA 4G1NA 3TAOA 2J8TA 4H6EA 3WF1A 1ZPTA 2G3NA 5FEXA 3V4BA 4EF8A 3GD6A 4FHAA 3M7SA 4Z2IA 2IPWA 4NJIA 3BPWA 2OU4A 3SUUA 1GVSA 3WLSA 3BGJA 1FX6A 1YNYA 3NQFA 3B8WA 3Q65A 4HA1A 1EPXA 2VI0A 1W0MA 1GHRA 4XD5A 1QI0A 4NZ4A 2GVGA 4S3DA 3AYTA 1J18A 1ZJHA 4GNKB 3CV7A 4MJ2A 4H4UA 4BCEA 1SO3A 4KRTA 3M0HA 4QSHA 4H83A 1KGXA 4CN1A 2V30A 1W5QA 2Q3OA 3MBDA 3WK0A 4XVDA 4FAMA 4IIBA 5DRCA 4W89A 1WBHA 3S5SA 3AIWA 4Y9NA 5ECUA 3OLGA 5DN1A 2OEJA 1B9BA 1B3YA 4PMRA 2CZVA 4XG1A 4KS0A 5JCKA 4NASA 2OLAA 1LQAA 1TPWA 4DJEA 1K3UA 3IJDA 2NX1A 3RU6A 3PG8A 3CUIA 3AAMA 2A2IA 4XKYA 3J7HA 4AZIA 3P74A 4PB5A 1F3WA 3MI2A 3EB3A 2RGLA 3TQVA 1B3XA 1EYWA 2WC4A 3XINA 4V33A 4QX4A 1QTWA 3S2CA 3IS4A 4G8TA 1P6BA 5HNTA 4TOQA 4N6FA 2QW5A 3KOWA 5IRPA 1QFEA 1JCMP 4J28A 3UVAA 2EF9A 3DHUA 5H91A 2I14A 4UQAA 2V9DA 3P14A 1DJGA 4GCAA 4WY0B 5CZJA 3N19B 9CGTA 5CEWA 3RMEA 3UXDA 1V6XA 2ZX8A 3FDGA 5AVHA 2EO7A 3CAQA 4O1BA 3EEZA 3L4UA 4H9VA 3DJJA 4ZB0A 3N15A 5C9UA 1RD6A 2XH4A 2VR2A 4UFIA 1QDSA 3EX6A 2EJ1A 3AROA 5DEZA 4N7QA 2ZUMA 3OOQA 1S1RA 1VYRA 1DIDA 1TIMA 1CGYA 4H6QA 4RW3A 4KFPA 2ZTKA 2H3BA 4KW2A 3IGXA 1VC4A 1JULA 4MSSA 5EKYA 2E9BA 3GTXA 4DB7A 3WMCA 3UY7A 1GOKA 1W17A 1W2PA 3KUMA 3GDBA 4MY8A 3DBPA 3ZYZA 3PTDA 4UFHA 1VBUA 4MB1A 1R3YA 3IJQA 3VC5A 3B9JB 1BYBA 1V3MA 3SUSA 3GIYA 1GK8A 4DZHA 2WSPA 5HR6A 3CMFA 3LHZA 2EPMX 3GC2A 4P61A 3IGSA 2BX7A 3WFAA 4LALA 1ZTVA 1LBLA 3CAVA 1QR7A 3ZSTA 5I06A 4CQDA 1BF2A 3N2MA 5CPSA 1PKMA 4FNPA 1UWTA 1B57A 1LRTA 2ABBA 2C0HA 4QJ4B 1I9CB 2I5IA 2OYLA 2E6FA 3M0KA 3W2KA 4C6LA 1MXGA 1TR1A 1UR0A 2EG7A 1ECEA 2ZX6A 3AUJA 1JDAA 1HL8A 2D24A 3W7PA 4K68A 1QW7A 4D6HA 2OQLA 2ABAA 1Y5WA 2X1RA 5HAOA 4US6A 3TE9A 3OA3A 5DXYA 2E77A 5A8MA 1NWUA 5CPOA 2C1HA 3ITCA 2D20A 2CXGA 4JTDA 3CS2A 5EYWA 4ATWA 4S1FA 4PTWA 2V5KA 3OODA 4CD8A 4AAJA 3QV9A 1D2KA 1A5KC 3NXLA 4I7VA 4RW5A 2E7FA 2HZGA 5IOBA 3NOYA 1C93A 5FKYA 4DBEA 1XDJA 2ZZ7A 3RJYA 4HOWA 3IGUA 4LNCA 4PB3A 1XHGA 3N2OA 4NT0A 3ARWA 4PRTA 2Y7GA 2XSXA 4IL0A 2W0HA 5DBTA 4FF5A 4H9MA 1YBQB 4LYRA 2X2GA 1WV2A 2GQ8A 3TQ0A 1EHAA 2OLSA 3LGGA 2DORA 1N7KA 3A24A 5E0CA 3M0MA 1SO5A 2HVOA 2PRMA 4Q4SA 4UOZA 1ICQA 2J7CA 3DN5A 1GRFA 3PPGA 1MW3A 3V7PA 3A9IA 5A94A 2RHGA 5AOUA 3WEMA 1IHIA 2WVVB 4GBDA 1W1TA 5ENLA 1E0VA 4KRZA 2Z7KA 2Q8LA 4ZO6A 4MNJA 3WLTA 1A4MA 2CWXA 2I7GA 4FNQA 4Q8QA 4H1ZA 2CLFA 1WKFA 2HQMA 2EEXA 4JTTA 1KV8A 5IFPA 1AW2A 4AXNA 4D1JA 4QEEA 4QM1A 1XYCA 3NQEA 3H22A 1M01A 3L9CA 1SW3A 4Z17A 1JRPA 1V77A 3H7RA 5IBXC 1MZHA 4DZIA 2VWTA 4JFUA 1GOWA 3NQAA 1OFAA 5FF2A 3CV1A 3CB3A 4BF5A 1L2UA 3AWOA 1PE1A 2PWFA 1BYAA 1XKJA 2PTZA 5C9ZA 3UG8A 1WOAA 2Y85A 3H4WA 2P5NA 2E8ZA 1XQKA 4IICA 1V59A 3V75A 1E40A 2QXWA 1ITQA 3W88A 4O53A 1GRAA 2Z0IA 3RLHA 2YIHA 3VC6A 4C6PA 1KLYA 1SM9A 3N2TA 4GH3A 4E4FA 4PBGA 5A1AA 2ALDA 4ZQRA 2I5GA 1NJJA 5LSMA 1TMHA 1GTEA 3MA8A 2BS9A 3IGHX 1TREA 2PDIA 1Z8AA 1W9VA 2E6AA 3WQCA 3SRDA 3ITLA 1X8FA 5EA9A 2I5QA 3ZOAA 1QK0A 4K6AA 1LRQA 3FKRA 1V3LA 4GWEA 1TVPA 4D72A 1AQMA 5CLWA 1TUFA 3CYVA 4LV9A 1PKYA 5A6MA 4B9YA 4US5D 2PDXA 1XCFA 3WK3A 3N73A 1NHSA 1ZBWA 2WMIA 4XUYA 4S23A 1G7UA 3LGEA 5CAKA 4A3QA 3I7SA 5HANA 1DXEA 4J7RA 4ZBCA 4Y9MA 1D9EA 5PTDA 4IX0A 3LQGA 1XHCA 1V3KA 2BXVA 4O28A 4AHPA 3NGJA 3EANA 3ZQ9A 2QUMA 3AMKA 3AXIA 4EXBA 1S3TC 2OT1A 1BAGA 3DBNA 4J3VA 3N9SA 1YXYA 4C6NA 3G18A 4UTMA 1CEOA 2ZXQA 4NF7A 2WJFA 4U10A 5I3JA 2NUXA 4LUSA 5E6ZA 2ON3A 5CPNA 1XG3A 4MMWA 3WN6A 1DORA 3NWRA 1QO2A 4EKJA 1F2JA 1TA3B 1V0NA 2I1OA 2UY5A 1WB0A 1RAKA 2DY3A 3EUB3 2HE5A 4GYPA 3CLMA 1E72M 2VZOA 3KX6A 1BWCA 4X60A 1V79A 5G5HB 3C2EA 4M1RA 3S6TA 3XISA 4AY7A 5DFAA 2A6NA 1U5JA 2J8GA 6XIAA 2VMFA 2J8FA 2VQUA 3A3XA 1NOUA 2FMOA 4ZO9A 3S1GA 1QNRA 2A85A 5DMLA 2ISSA 3KOZA 1RQHA 3TTQA 1UWAA 2WVSA 1R3QA 5GVJA 5DT5A 4C6DA 5T26A 1UJPA 4U2ZA 4GCXA 4V2XA 3NQ6A 1XRFA 2QGHA 1TV4A 3EMCA 1MDRA 4UMCA 4NVTA 4FI4A 4WIWA 3W07A 4LA1A 3TTEA 1V3HA 4W7UA 4E38A 3UJ2A 2V67A 2FDMA 4NSBA 2YKKA 4WJ8A 2EKGA 3DEQA 4HU8A 4S3FA 3DFNA 2R14A 4L1WA 2DSVA 1BG4A 1WP6A 1GNXA 4EPEC 3GG1A 1O60A 3IJIA 4OUEA 1A3HA 1OFDA 2E9LA 2VFEA 3FAWA 2FMNA 3UWWA 3L4YA 1FBAA 1LF1A 4XZWA 4AIBA 5I5RA 3LBMA 5A5WA 3MHUA 1MMFA 4PUJA 1KWGA 2OYKA 3EOOA 1U1HA 4C6FA 1PTAA 3TNBA 3OJGA 2JKEA 1CPUA 3QPYA 4XZHA 1R3RA 5LKYA 4UC5A 3GIQA 2A1YA 3AZRA 5DX7A 3GS6A 4QIUA 3KBWA 2DSZA 1NELA 2WMKA 2A5HA 4B5UA 3LSCA 3VU2A 3QY8A 3L21A 4DXVA 4AFYA 1QCWA 3L23A 2BZNA 3VTRA 1Q6FA 5EMMA 4GYKA 4IJCA 4KQNA 1VD6A 2HBVA 3AS3A 4JDBA 2GQ9A 3C2VA 1ZKQA 2QV4A 4UTIA 1MW2A 4X9YA 4E8GA 1RLCL 1H2IA 2H8XA 4EM4A 3PHAA 3WD0A 2E25A 3NNTA 3PB2A 4QITA 4ICCX 4KWSA 1XIGA 1R2TA 2WV8A 3BLFA 1WDQA 3IVTA 3QXBA 3W86A 1H1NA 1NFBA 1VR6A 1K7FA 2AL1A 1IYXA 3TV8A 3QM3A 3LCIA 4DO4A 2D3NA 1OK6A 2ZX7A 3ABSA 2HWGA 3S42A 3WD3A 2WPCA 2QCCA 3G1FA 5DCEA 3PN8A 3A7AA 2CLEA 4I9AA 5CG7A 1WZMA 3I4KA 4H9YA 4XD4A 4NAEB 3TH6A 2WPEA 3BV4A 1YDNA 4JTGA 5A8GA 2VD9A 3EKGA 5CGQA 2Y24A 4MDPA 3U2OA 2QIIA 1KCLA 2EJAA 3MUIA 2VO5A 3RRAA 1WDRA 2OGYA 1Q66A 4HD5A 3DFOA 3MU7A 4S3AA 4WJEA 2PBOA 3SCRA 4AY8A 1YMYA 4MFEA 4LTSA 4UTJA 3O07A 4NJKA 3N29A 3KE0A 5FS8A 4AIEA 2PE4A 4HP5A 4QE1A 2BASA 4LGXA 5AHMA 2ZZBA 4NRSA 1V0KA 3VX1A 2P0OA 3K4AA 2DZSA 4L5ZA 3QSRA 4ZR8A 2PLJA 1G67A 1MWOA 1ZP3A 4RCXA 4HOZA 3BGGA 3GNPA 3S2JA 3VOCA 4Q4MA 3RFAA 1DVJA 4GR1A 3CHVA 4OV9A 1BZLA 4F0HA 3T09A 1P48A 1U5VA 4CNPA 1P1MA 2FGLA 1ZGDA 4Q4QA 2WNNA 4GBUA 2J9YA 1W3TA 1K7EA 2NV2A 3B9OA 3SY5A 1EZ2A 3VZYA 3WMBA 3CZKA 3VX0A 1K6WA 4RPQA 3MI6A 5FJPA 4AB4A 4X0VA 3UGRA 1ZXIC 2HJPA 1PCKA 5IM51 4QLJA 3M0JA 1J5SA 3M0ZA 4JQ2A 7A3HA 4HT3A 3VIPA 4CQBA 1EXBA 4DLMA 4UNKA 3OTRA 1XD1A 3REQA 2CLIA 1Q13A 6TIMA 1AJ2A 1W31A 3TW9A 1FH7A 4AD2A 3V0UA 2YCIX 4HNLA 3W02A 5DANA 4ERIA 4MZ8A 1GZJA 3W7DA 5K7JA 1PKLA 2X05A 1EKOA 1LWIA 2H6RA 1SPQA 3W7QA 4NL1A 1EGMA 4IWWA 4XO7A 4H3DA 1DXLA 2C3DA 3CGEA 2NXGA 5CAHA 3WNPA 1OCBA 2H90A 3WKZA 3PVFA 1YQZA 4H4IA 1V4YA 4ORIA 3AJ7A 2R8WA 2OWCA 5U7SA 1YHTA 2KX9A 1VGAA 5CSSA 2DUXA 1ENUA 1TYGA 2ZZ3A 4IX2A 1ONFA 3RX2A 4AH7A 1P7TB 1BYCA 2OYMA 7ENLA 2QDGA 1F8IA 1SZEA 4WGHA 1ADDA 4H6KA 2V5JA 5LHEA 3MDWA 4QROA 4MAZA 2BVTA 3KL5A 1JIBA 3V36A 1P5BA 2XIJA 1R38A 4HU4A 5CZSA 1GQJA 3BGAA 3CWNA 2Q8XA 2DW6A 4C90A 2YXGA 3T78A 1O4UA 1DWGM 4MB5A 3TJXA 5AC5A 1Y8BA 4RZ6A 1XIBA 2VEKA 2WANA 4HPXA 3SCQA 3KZSA 4WEVX 2UWFA 4Z0SA 2EQ6A 1DJHA 3HPSA 3ARZA 3RHGA 1OT2A 3WH8A 1E4LA 2FVLA 3UJRA 5BZAA 3PFMA 3TZFA 4GINA 2DZXA 2HV5A 4ICNA 4WRHA 2C14A 3VOFA 3STGA 3DENA 1X2HA 1YLVA 2E3TA 4DX3A 3A4AA 3I7QA 3KL3A 4TO8A 2HS8A 2GFTA 1PAMA 3KOFA 4GNJA 5AYIA 4PCNA 1D8CA 1YADA 4JIQA 3W26A 1I4NA 2X7WA 3FS2A 4JR5A 3PUDA 1ITUA 2VM8A 3F2DA 4YVPA 2A3BA 5A6KA 1R86A 3BLIA 2Y8UA 1SZGA 1I2RA 4RDYA 5ABEA 3ZIZA 3QQWA 2YXOA 4H00A 2CEQA 4K1GA 3RMJA 2NPXA 4ASTA 5HUOA 1AD1A 1R2SA 2OO6A 3K8LA 3HJZA 4H4WA 4M7SA 1BSIA 1J10A 2GVEA 3VKCA 3CIVA 3AM9A 5BOEA 3AOFA 3VCCA 2ANUA 2HXUA 4CEXC 2PGFA 3LY0A 3VIJA 1PVNA 4V1YA 3LERA 3DXIA 4MKNA 1GHSA 3TXVA 3NZQA 2CITA 1SZRA 4OOZA 1XCWA 3MSYA 4B2DD 1R3WA 3K46A 1M7XA 3S9YA 4DWSC 2QR6A 1NDAA 4JEQA 2GDVA 1DWIM 4XZMX 5DMMA 3SO7A 1Q6DA 2BWGA 3TCEA 4JL1A 1TWZA 1VIZA 2Z28A 1WXJA 2DPEA 2V69A 3A7UA 1EC7A 2VD8A 3AIRA 2A6LA 4Q4RA 4GIYA 4MWAD 3KRZA 2ZDSA 4I8YA 1YQ2A 5AKQA 1JROA 4ZODA 4PMNA 2UY2A 3FGCB 3WQ6A 4PCTA 1E5JA 3N6HA 4UMAA 4X63A 3MVIA 3WLQA 2P8BA 5BU9A 2X7VA 4FPSA 5G5GB 1LL7A 2R1KA 4O4WA 3DK8A 2I16A 2Z24A 2V3FA 3G1HA 5HINA 1J12A 3EXTA 4O57A 3TK7A 3OBKA 4G5DA 3VGGA 4LS0A 3S5OA 3V5OA 4ACZA 1N8IA 1MZRA 4JCMA 3QH2A 1IZCA 1C7SA 5D9OA 2FGBA 3ZSSA 1FWGC 2Z1BA 2VWSA 4OBTA 1FOBA 3PFRA 2QPUA 3T81A 4QAIA 1VFTA 3GDKA 1VJZA 1XGEA 4XIMA 2WJDA 2NVCA 3L2LA 2A3EA 2XIQA 3N2XA 3GDRA 4YHGA 2CNCA 5A6LA 3GDMA 1MSSA 4PMYA 1HKMA 3BARA 3TSMA 4DNHA 2YDRA 3CAWA 3MMDA 3GYCA 4WSJA 3UYIA 4AZHA 1FHVA 4I7WA 4HIBA 4MYAA 2A3AA 2VZTA 5ABGA 4JICA 3E2SA 4QSFA 4AZ7A 4N9EA 3LNMA 2GGGA 2GWGA 2OMAA 3RIKA 4TV6A 4NZJA 1XBXA 2XU2A 1ITCA 3GVQA 4ICMA 1ONEA 1M1BA 3OGVA 4DYJA 4L64A 1YNQA 4MOZA 4PUUA 4QP0A 4KRUA 1QI2A 1CB7B 3KW3A 3BOLA 3MSRA 3BCFA 1VB9A 1FHLA 1EBGA 3CUJA 1ZZMA 2XGZA 3MKVA 1L6GA 1QI3A 1LTDA 1XLLA 2VR5A 3NQ2A 1A5SA 3MWCA 5TIMA 2OVLA 4JIPA 4IQDA 3I6RA 3MUZ1 4JQAA 5FEPA 1G4PA 2C6QA 4IQEA 1TJ2A 4JN8A 5MF5A 1JUKA 1E73M 1DL3A 3DUGA 1QPQA 4AIUA 4HYRA 2R1LA 4F0SA 3Q94A 1VBJA 4CQ9A 3MY9A 3RX4A 4M0XA 5FL1A 3R0KA 4BR1A 2Z1SA 2PRLA 4QE4A 1OEPA 1F07A 4R7JA 4M51A 3NQGA 2Y8VA 3L67A 7CGTA 3ARYA 1FCUA 2Y62A 3QFAA 2BCPA 3ZO9A 3BAJA 4DUVA 2P0IA 1TCDA 4A8RA 5D03A 5LA0A 1UWSA 2W61A 3AMDA 3S5NA 4DF1A 1AH4A 4JEJA 2Z4GA 2DT1A 2QCGA 5JQ9A 2G3JA 3M46A 4GFIA 3GE7A 4O52A 4UTTA 4N9DA 4FK9A 2PS2A 1R87A 3TSDA 2PP3A 2XIBA 2P8CA 5FSEC 4GI4A 4H7VA 1V5XA 2DUZA 3DFQA 1QI4A 5C54A 5A6BD 3P80A 2J7BA 3RPDA 4MNKA 5GNYA 1QBAA 4JN6A 4PMOA 4N9CA 2PDLA 3U2CA 3BQ5A 4JQ9A 4HK7A 3CM4A 4C5YA 1NQKA 1JRBA 3N3TA 2MANA 1CTNA 4GUJA 1S5TA 1E4IA 4JFVA 4LV4A 4PCSA 5AYZA 2BHZA 4Y8FA 4DJFC 5DF0A 3OVPA 1WNOA 1I0BA 2QF7A 1UMLA 3U2EA 1B1YA 1X38A 2OLHA 1XSJA 2G41A 2PAJA 5AFDA 4HQVA 1AFSA 3MWAA 3GQYA 3AIBA 5FS6A 3LB0A 4LRTA 3MO4A 2X42A 3VILA 3DHFA 4DNAA 2WXDM 1FH8A 5IDIA 3UESA 3MJMA 3B8IA 3ZVIA 1KXQA 2Y61A 3CBWA 4WHBA 5DCBA 3ABQA 3WQ4A 3LZ5A 3MV11 4LEFA 1U30A 4IP4A 3W76A 4EF9A 3FVDA 4LQ1A 2AGTA 3W7IA 1XCXA 3TYCA 3GU1A 2RJHA 1W6TA 1V3JA 2W9MA 4EPDC 4A3YA 3PZMA 1NP0A 1XH1A 2OQHA 3GLCA 3O0KA 3SSJA 2WZIA 4UNLA 3KWXA 1RXOB 2DT3A 5AYYA 5LA2A 2QDHA 5I2UA 2D73A 1AL8A 4CVWA 1JZ4A 1TX2A 3VIOA 5EMYA 4E4UA 4DO6A 3VNLA 2ZA3A 2V5DA 3TR9A 1K77A 4YVXA 2WLYA 3G0UA 3C8NA 2B0MA 2OOFA 1M41A 5A8PA 1MEHA 3KOYA 1KQZA 3GDLA 5CBBA 4ROPA 1RQBA 4P5UA 3CL7A 2VX6A 2WKJA 1OC6A 1T5AA 3PNZA 4TVWA 1JXJA 3BDKA 3GC4A 1G4TA 3N13A 4WR3A 2BTMA 2JIWA 2YR1A 2P1FA 3E38A 1PTDA 3NVTA 3TN6A 2QLYA 3KTCA 1E71M 1W1IE 3T0TA 4POCA 2YX0A 3LBOA 3C86A 1UQZA 1VFFA 1HJQA 1Q6OA 3WL0A 4MKSA 3ABXA 4PUNA 3ZWTA 2W3SA 3TEVA 2A0NA 2Y70A 3AHXA 3RNDA 1WUFA 2YBTA 3DZ1A 3SRFA 5BOFA 1GEHA 1YDVA 4W84A 2GUUA 1L2QA 3CB8A 1JZ3A 1WUEA 3DKJA 3QVQA 5F4WA 4U5IA 1A47A 2X1IA 4PGLA 3O6YX 3LPFA 4G6CA 1VLIA 1XLKA 4RZ4A 2QJHA 1X6UA 3MHFA 1ZU8A 3GBEA 2QT3A 3NAVA 3FX4A 2O9RA 3DHDA 2IQTA 2Y4SA 4GQGA 4KEMA 5HQMA 4K8HA 2RGMA 1UKSA 5LGXA 2Y0FA 3O15A 3H2OA 4YLWA 4V27A 3E9AA 3LRKA 2OSXA 4GVGA 1XH2A 4CN6A 1BQCA 2ISDA 3TN3A 4WOZA 2YVGA 2YDAA 1MQPA 1AD4A 1XLBA 5D2WA 2B4GA 1E4MM 3GG0A 4YWIA 2GL5A 5REQA 3HPXA 1UUOA 4GIAA 3TYZA 3LS9A 1WAUA 3FSTA 4ZQOA 4UUIA 1LWJA 2X8HA 1WDWA 2FPVA 1BKSA 3DI1A 5E70A 1RM6B 3M4HA 4R53A 5FEWA 3SI9A 3T44A 4IXXA 3ZM8A 3BANA 3I3EA 1NU5A 4L9YA 3N4FA 1LCOA 4KIEA 1W5PA 1RPXA 1EZWA 1UA7A 4MKVA 3E2VA 5I3DA 3UETA 1FWIC 4IF2A 5LNRA 1LG2A 2IKJA 4JNMA 1XINA 4E2BA 1X1NA 3FYYA 3GFXA 4JTCA 2GUYA 3WDQA 4DF0A 4NJHA 1QHPA 1QVBA 4CCZA 1CLKA 2ZVIA 3GYEA 2J7FA 3E5BA 3EOLA 3LCGA 4GQQA 1SU5A 2YL8A 1E15A 5EMKA 3KCLA 1KBKA 2XZ7A 1K1DA 5H8MA 3C0JA 1JI1A 1TV5A 2ZYFA 5G5IA 4KKXA 1C91A 3W28A 4HNUA 4QXIA 3IV8A 5CZTA 1Q2SA 3R6IA 4H4QA 2ZWZA 1KXTA 1LQ2A 3PS7A 4UTHA 2QV5A 2GJRA 1IE7C 2EPNA 3O0HA 3N34A 3I65A 1EJXC 1J2BA 4ADUA 4ZQCA 2WP5A 4HHLA 1AZ2A 4TV5A 1LT8A 4Q32A 3POHA 4ZFMA 5DY3A 1RH9A 3EDKA 3PZQA 1C3FA 3RCMA 1ICPA 3H8AA 3MJYA 3VIGA 1NQ6A 1REQA 4XQ6A 2C0AA 2PB1A 1MFVA 3HGRA 1EYEA 1PEZA 3JR2A 1V6UA 1C8YA 4P8WA 3M0IA 1TTJA 1X7FA 3GSMA 4ATLA 3ARPA 3UF9A 4O50A 4RX0A 1RVKA 3MBFA 4QR6A 5K2ZA 2GJXA 1EF2A 5I23A 3U0HA 2YYUA 2WYSA 4MTVA 1IGWA 4A8LA 1WE5A 4BF7A 4NQ1A 1HKWA 3S8HA 5LNVA 3BAXA 1EWDA 1Z9AA 2ZUSA 2B7OA 5D8WA 4Z42C 3DK9A 3Q2DA 4WY0F 1TPC1 3G1YA 5HBFA 2WVUA 1Y7VA 4EP8C 3G1XA 3GIPA 2J74A 1XPYA 4FNTA 2V6OA 1OF6A 2WHKA 2VHLA 1DXFA 3CIWA 3KRBA 3F5JA 4A2RA 2PDNA 2FJUB 2QUVA 3P81A 5F7UA 3ONCA 3WNNA 3VNYA 4Q7IA 4GVHA 1CBGA 3FCPA 3NPVA 1EP2A 1PWMA 1FFVC 1OVDA 1Q8JA 2GK1B 5CGTA 3ZLHA 3Q67A 3OLEA 1VHNA 1H51A 3H6OA 2A21A 3HF3A 4JZ5A 4QDWA 4L56A 2I57A 4DBUA 3QMSA 1WQ5A 1QW9A 2YW3A 1WOBA 3G5EA 1E5NA 2E5CA 5IBXA 2DZUA 4LBRA 5CSYA 2AKZA 3R8GA 4JFSA 3F03K 4TUFA 3GC5A 5D2TA 1VQZA 2GDQA 2V6AA 1JRCA 1ZL1A 3DDMA 3QPZA 4Q6XA 3QGKC 2PGWA 3IIXA 4F2UA 4NXKA 4CNSA 1CECA 2VURA 3A12A 3MPGA 4HK5A 4IG2A 2QJIA 2OG9A 4KFNA 4FXRA 2V0TA 4DNMA 1R7OA 2GR1A 4ZOCA 3WBAA 1PDYA 3OG2A 4X9SA 2FVMA 4ZOEA 2HTMA 3MYPA 4YS1A 1FWHC 1XP3A 5GNXA 1WKEA 4JIEA 1FFUC 3GR8A 4NRRA 1D7YA 3RG6A 3APTA 4F79A 4OTKA 3H53A 1DJYA 1XUZA 3GVWA 4JAWA 2NVAA 2P3EA 2FZ9A 3NO5A 3FYOA 1TCMA 1LUCA 1ZNNA 1O68A 3W7NA 2WSQA 4HPGA 4IH3A 2EG6A 2INZA 1SUXA 4XWUA 2IMRA 1LLZA 1FH9A 2AAQA 5G4WA 1WA3A 3P67A 1FA2A 2B31A 4PL2A 3W24A 2O56A 3W01A 4QEHA 1HX0A 4J4KA 3UD6A 2X09A 2WMGA 3P93A 3L2IA 3PSWA 3QR0A 3GRSA 4LUTA 4A22A 4DJDC 3TOYA 4PL1A 4WOQA 2CHNA 3UJSA 4IMCA 4CU6A 2VFFA 1ZDLA 2A7PA 4B92A 5EFFA 1S7MA 3WLHA 2WZMA 3K2GA 3A6OA 3W75A 2PDCA 5C2CA 3WD4A 1H0IA 2YVJA 2DQWA 2ZVRA 2PBGA 3LUTA 1KTBA 3AMLA 2FJKA 1FP9A 2PLKA 4AZGA 1V7YA 1JG9A 5C71A 1PV8A 3UWEA 2QS8A 3TW6A 3PWGA 3RPTA 2QCEA 4K2SA 5IFTA 4EPKA 1P0DA 3WJSA 2JKPA 2PU1A 1X6LA 2Y7FA 2AL2A 2GR0A 4H4PA 3N14A 5G1YA 4UFKA 5I77A 2E40A 3L0KA 1KBIA 5CJNA 5MKGA 1KFLA 2G4JA 2WMFA 1JCNA 4DXKA 3A4XA 2WWDA 1XYFA 4AZCA 1OK4A 2ZXAA 4C6JA 1OD8A 2HMCA 1D8WA 4H4VA 1VS1A 3LNPA 1RD5A 4R3UA 1MNSA 3IIOA 1LOLA 4IMDA 3CT7A 1JNEA 2X8GA 2VX7A 1HNYA 1HTIA 2CW6A 3M5XA 2WCSA 2G3MA 3TTOA 5JBDA 4EWND 6ENLA 2F5ZA 2Y63A 1D7FA 1GYNA 3LSBA 2GGHA 3BMVA 1UA3A 5C0QA 1TQJA 1BXBA 1QI5A 3KCOA 4KGJA 1EX1A 2YYTA 4K3ZA 1OYAA 3AO0A 3VD7A 4L4OA 1VPXA 1DP0A 4PCPA 5A2AA 3OC4A 2Z25A 1XQLA 2B7QA 3OQEA 1P0NA 1CYGA 2JGYA 2R9ZA 4EIVA 3TJ4A 4PSRA 1CDGA 3CUXA 3R1ZA 5IDZA 2XVKA 4ZQMA 1W9PA 4KPLA 5K9CA 4CQ8A 4TQTA 1NAL1 3LDVA 3O16A 3BO9A 3PZVA 5LNSA 2VCBA 4BQ2A 1J96A 1QHOA 1KCKA 1UASA 4G7EA 4BI5A 3KS6A 2WP6A 3W73A 2QPXA 4NUWA 4REQB 1OG6A 1ZMDA 3KWSA 4BFAA 5A6AA 3NDYA 5I00A 3H12A 1KQYA 5FAGA 2GR2A 3F4WA 1A5OC 4F0LA 2ZFAA 4D6EA 1LLWA 1TJ0A 3OU8A 3BAYA 1ADOA 3G0SA 1UCWA 3THAA 1TPH1 4EOUA 5T8GA 2AMXA 3IVSA 1XX1A 3EDJA 3CEUA 1E6XM 1CGUA 2OKTA 3WJYA 2BC0A 1K70A 3BMXA 4H19A 1W1VA 4MJ4A 2R6OA 3W1RA 1LL6A 3BICA 3HQNA 1L6SA 5AECA 4D71A 1UH4A 3WQVA 4OUIA 1EJSC 3ITYA 3TLQA 4RE2A 3L8KA 1F3TA 4JTQA 6REQB 3ARXA 3LHTA 3KOXA 4IPLA 4XUGA 2A79A 3MANA 1MEWA 2J6XA 1S1PA 3QYQA 2GRTA 2GJLA 5BRPA 3W2LA 3NOEA 1OX5A 3C8FA 2OZTA 4GD0A 3NVZB 1FWRA 4YJ5A 2PZ0A 4QNEA 4MF4A 3U7BA 3L4VA 3VXGA 3W53A 1E9LA 3QN3A 5B7YA 4P7QA 3VOGA 4YPJA 2ZRZA 5H2ZA 4HNTA 1W37A 4EMWA 4EX4A 2WOIA 2E09A 4ZB2A 1PZ2A 1TUXA 3HRDC 4S3JA 3QYSA 2Z1WA 1T8XA 1EUNA 2VDIA 1V08A 3AHZA 1I1XA 4H01A 2YAUA 1NF7A 1Q8AA 3CTTA 3RU8X 4HZMA 1QOQA 3CK5A 1VBGA 1J6OA 4JL2A 2XINA 1N5XA 3KAOA 4A3HA 4W93A 4UR9A 1O5QA 2ZZ6A 3WH5A 3QLDA 3RM4A 3Q45A 4GGHA 5FF4A 5A69A 2NX9A 3WDJA 4J3UA 2VNCA 1O12A 1S2VA 4F4RA 1JD9A 1H7OA 4ES4A 2Y7DA 3LG3A 3PZGA 5TNVA 2X1UA 2JF7A 3W7RA 2XH7A 2J4GA 4A29A 1STZA 4XBJA 1NHRA 3R7MA 4N4PA 1T41A 4GA8A 4UWMA 4RXFA 3MUAA 1H7PA 3DG7A 1GONA 1JGIA 4O1CA 4ENLA 1XS2A 2HNHA 1VBHA 1N62C 1F3PA 3W7OA 1OY0A 3DYOA 4H8UA 4KCVA 2ICSA 2QUNA 3E96A 1LROA 1BPLB 3QOKA 2W66A 4L6OA 4YHEA 1OC5A 4IMAA 3VOJA 4FX7A 4C7GA 2TPSA 1UP3A 1JVNA 2CERA 4S3KA 2DEPA 1P1XA 4Q8NA 2OO0A 3BOXA 3CEPA 1K9TA 2OB3A 2QCDA 3EB4A 5JBEA 4DUXA 3QQ0A 4H41A 3KHDA 3CJPA 3T07A 1MO9A 1FCQA 1FP8A 2BOEX 3TW7A 5FF0A 5LIWX 3GM8A 4A2SA 1HJSA 3HURA 4HCHA 3A5FA 3V18A 2J78A 2J7DA 3HPZA 1WXZA 2HK0A 3DC8A 4WSHA 1UZDA 5CBIA 2RDWA 2I17A 4R33A 3DYMA 5KMYA 3AI0A 4MJMA 3KRSA 1U1JA 2DVUA 1KB3A 3VD4A 3HV8A 1IWPA 1MO0A 4IPPA 4XAZA 3GRIA 2PWVA 2C91A 4NIRA 3AISA 2F6KA 3G6MA 4HA4A 4LAKA 2WSYA 3CO4A 3HG4A 1KGUA 3MP5A 5G1TA 3MCNA 2X16A 2VX5A 1HO4A 4JHZA 3KCJA 3U5UA 1SZNA 1G9HA 3VAVA 3QMTA 4NEVA 1OFOA 4NJGA 4NZ5A 3IARA 3P62A 1UD4A 2CPUA 3ZR4A 1EQPA 3L65A 2X2YA 3EAOA 1R47A 2XWEA 1F73A 4DQWA 4AD0A 2X8CA 2YL5A 1UPPA 4Z0JA 3FDKA 2F8QA 3GH7A 3IIPA 1N61C 3FJ6A