3V4IB

Crystal structure of hiv-1 reverse transcriptase (rt) with dna and azttp
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
425
structure length
412
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 Reverse Transcriptase P66 subunit
publication title HIV-1 reverse transcriptase complex with DNA and nevirapine reveals non-nucleoside inhibition mechanism.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/dna
total genus 120
structure length 412
sequence length 425
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3v4iB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3v4iB03
4NLSA 4YR0A 4GC7A 3GQCA 5F8GA 2VG7A 3CJ4A 3OLAA 3UQSA 1XR6A 2GIRA 5HP1B 4LQ3A 1JLBA 4J9NA 4KFBA 4ECSA 2J6UA 1N5YA 4TYBA 2DPJA 2OPSA 1TVRA 3E01A 3I0SA 2F8EX 1T03A 4ZPAA 3QGGA 2AGPA 4RNMA 1N6QA 3DMJA 5KT2A 4U7CA 4ECYA 1IKVB 1RTHA 4RNHA 2V4QA 2OPQB 1S9GA 1S1TB 5KFLA 5F9NA 1S9FA 2IM3A 1WNEA 3CIZA 3LP2B 1RT3B 4IG3A 3FQKA 5KFQA 3FFIA 3MEGA 4DL5A 4Q8EA 4RW6B 2RDIA 2XGQA 2ATLA 3GYNA 1S1UB 2I5JB 1KLMB 3DYAA 1UWBB 3DRPA 5CYQA 3CVKA 5L1IA 4B3OB 3TAMA 3T5LA 3SI8A 4X2BA 3DOLB 4KSEB 2HNZA 3KLEA 3KJVA 4NCGA 4QWCA 2ZE2A 4IR9A 4EO8A 2AX1A 5D3GA 4PWDB 4I2QB 2YNFB 5C24A 5J2QA 1RT1A 1HYSB 4KBIA 5I42A 2JEGA 3T5HA 4M94A 1VRTB 3RBEA 2XI2A 3MR2A 4RW9B 1JLEB 3M8QB 1S97A 1T05B 3LAMA 3MF5A 5FDLB 4ZP9A 2WRMA 4O4GA 4PQUB 3G6VA 3DDKA 2IM0A 3IS9B 5EUHA 1LWEA 1XR5A 3BSNA 3C6TB 1RT5A 2AX0A 2W7PA 3KLGB 5KFHA 3QO9A 4PUOA 3NAHA 1ZTTA 4NZ0A 5KT6A 2DPIA 4KHMA 3ITHB 1TKTA 2HNDB 2ZKUA 5DG8A 4O3RA 1EP4B 1TKXB 4NYZA 2UVVA 2R8KA 3V4IA 2ASJA 2WOMA 2IM2A 3KK2A 4RUAA 3LP1A 3V6JA 4WZQA 3QIPB 4FBTA 4IFYA 4XPEA 1TV6B 3GIJA 3SFGA 4ZVFA 2W9CB 4F4WA 5C25A 4O3NA 4TQRA 1HNIA 4IG0B 4H4MA 1RA7A 5KFMA 1JX4A 2YKMA 3ISND 2R8GA 1VRUA 4EBCA 4ECZA 1HMVA 4EEYA 2R8JA 2E9ZA 3HVWA 4ZP8A 3DLGA 3V81B 3V6DA 4K4XA 1RTJA 4R8UB 1JIHA 3QLHA 1RYSA 4ECRA 1QE1A 2VG7B 4K4WA 1QAIA 3IN5A 1C1CA 4IRDA 4IKAA 5KFKA 1JLBB 4KFBB 1N5YB 4Y34A 3RB3A 2AU0A 4F4ZA 4ZHRA 2OPSB 2AQ4A 1TVRB 3E01B 3H2LA 3M9OB 1RT7A 2VG5A 1T03B 4ZP6A 4KHRA 1N6QB 4WYWA 3DMJB 1YVFA 2ILZA 3JYTA 3NBPA 1RTHB 3BQ0A 4IRKA 2R8HA 3BSCA 2FJWA 1HQUA 2R2RA 3OL8A 3BGRA 4URQU 2JEFA 5F8JA 3CJ0A 1RTDA 4IG3B 3MFHA 3FFIB 3MEGB 4KE5A 4JV1A 5J2NA 3CDWA 3CDEA 4HKQA 2V4RA 4J9KA 1RT6A 3DYAB 1REVA 5CYQB 3DRPB 5EWEA 2FVPA 4ZP7A 3KHGA 3KJVB 1EETA 2HNZB 3KLEB 4ZPCA 4NCGB 4ECUA 1D0EA 2BQ3A 4M95A 2YKNA 5D3GB 4NLTA 4QWAA 5J2QB 1RT1B 4ZPBA 2W8LA 5I42B 2WK4A 4IH7A 3OL6A 3UPFA 1N48A 4KKOB 5L1JA 3MEDA 3GILA 5DGBA 1SV5A 3OHBA 4O4GB 4J9RA 1BQNA 1S6PB 1D1UA 2FVRA 1LWEB 1S1WA 4NLUA 1JLFA 2R2UA 4ECXA 2IA6A 2ILYA 1RT5B 1DLOA 1J5OA 4MK9A 2HAIA 3RB6A 3H5XA 4PUOB 3JSMA 4GC6A 3TQ1A 3DM2A 4J9MA 2YNGA 4NLGA 2OPPA 2VA2A 1TKTB 4EBDA 2UVUA 1RDRA 4J9QA 5T14A 4DL7A 1SH0A 5KFXA 3V4IB 4WFXA 2WOMB 1BQMA 3I5AA 3NAIA 3H5YA 3NMAA 1S1XA 4IH6A 1QUVA 3LP1B 2O5DA 2FVSA 5JUMA 5KFGA 4IFYB 4QWDA 1MU2A 4Q8FA 1R0AB 3GIMA 5C25B 4KV8A 1HNIB 1HARA 1TKZA 1RA6A 5KG1A 4H4MB 3T1AA 3H5SA 2YKMB 2RDJA 3V6HA 1VRUB 1S1VA 1RT2A 2RKIA 5KG5A 4F50A 4ED1A 3DLGB 3PJWA 2R8IA 1LWCA 3HVAA 4DL2A 4NRUA 4MK7A 3V6DB 5EWFA 1RTJB 4YR3A 3RAXA 5KFJA 3NKYA 4LSLA 4J9LA 3DI6A 3H40A 3QLHB 1DTTA 4ICLA 4K4TA 1QE1B 2WCXA 3Q8SB 4O3OA 1C1CB 4WXOA 4G1QA 5KFVA 3GV8B 3NL0A 3IG1A 4O44A 3GV5B 1RT7B 4I7FA 2VG5B 2RF2A 3MECA 3CJ3A 3IGVA 3PHEA 5JXSA 3Q8RB 3MTKA 1MMLA 5DGAA 3JYTB 1OS5A 3DRRA 3NBPB 3GIKA 1S9EA 3SFUA 2C2RA 2W8KA 3PW5A 1S0OA 1HQUB 4NLYA 3KLVA 1TL3B 3BGRB 3FRZA 3ISNC 5L1KA 5HLFA 2B6AA 5KT5A 3BSOA 4Y3CA 5J2NB 2FVQA 1HNVA 1S4FA 2IAJA 1FK9A 4H4OA 2UUWA 4RNNA 5CYMB 4ED7A 1REVB 4RW7A 4XPCA 5DG7A 1S0NA 4LQ9A 4TY8B 5J2PA 1EETB 4IFVA 5F8HA 2CJQA 4TLRA 2YKNB 2W9BA 4MK8A 3PVXA 1JLCB 5KFYA 4NLPA 3FSIA 3MEDB 2HMIA 4ZVEA 3DLKA 5F8LA 1SV5B 1TL1A 3H98A 3N6MA 4WZMA 3KLFA 1K1SA 1BQNB 4FS1A 2WTFA 1S1WB 1JLFB 1SUQA 5HBMA 4ZVGA 4IR1A 1N56A 2IBKA 1J5OB 1DLOB 2OPRA 3OLBA 2VA3A 4WFZA 4Q0BA 4WYLA 5F8MA 4RZRA 2D3ZA 4XO0A 3JSMB 2FVCA 4KAIA 2UVWA 3FDSA 3C6UA 3DM2B 1GX5A 2YNGB 4ECTA 4WFYA 2OPPB 2QV6A 2BE2A 1NHVA 1S6QA 2VG6A 4NLXA 1S0MA 1JLAA 3G86A 1BQMB 4Y2AA 1RT4A 3CWJA 3HKWA 3IGNA 1S1XB 4Q45A 3M9MB 3H5UA 2E9TA 4K50A 3I0SB 1MU2B 1K1QA 5KFDA 1KHVA 2XCAA 3M9NB 1C0TA 4KV8B 4ED6A 1DTQA 5KT4A 3RAQA 1TKZB 2FLNA 4URGA 1JLQA 4F4YA 1S9GB 4QW8A 4OL8A 3OHAA 1LW0A 2JLEA 2RKIB 2WB4A 3H4BA 5KG7A 4TY9A 2UVRA 2YNIA 1LWCB 2C2DA 4EO6A 5KFNA 3KLHA 2QE5A 4ED2A 4DL3A 2IC3A 4LSLB 3DI6B 4RW8A 2D41A 1DTTB 4ICLB 5KG4A 5HROA 1T94A 3TAMB 4Q43A 3FQLA 3N6NA 4I2QA 1HYSA 4NRTA 1FKOA 4G1QB 2FJXA 2ZE2B 4NLOA 2UUTA 2E9RX 3HVTA 2ZD1A 5KFEA 5F8IA 4YQWA 1NNDA 2JC1A 5C24B 5KFTA 4J9PA 4R5PA 5L1LA 2B5JA 3IG1B 4O44B 4R0EA 2AWZA 1HPZA 4I7FB 3MECB 2RF2B 4Y2CA 1N4LA 3T5JA 3PZPA 3PW7A 4FBUA 3CJ5A 3MR6A 2FLPA 2J6SA 4IDKA 1S9EB 3RB0A 2AGOA 3I5BA 3KMSA 5KFWA 5KFAA 3Q8PB 2FLLA 3KLGA 3DLEA 4O3QA 5HLFB 2B6AB 5KFUA 1I6JA 2XWYA 2W9AA 2ASLA 4LSNA 2WONA 3QIDA 1HNVB 4H4OB 1FK9B 3QO9B 3LP0A 4RW7B 2GIQA 4TYAA 3DOKA 3T19A 2FJVA 1IM4A 1W25A 3EPGA 1IKWA 5J2PB 4IFVB 1FKPA 3KLIA 3I0RA 3E51A 5I3UA 4MH8A 3LALA 2W9BB 4RUCA 3BR9A 3KK2B 2CKWA 4ED0A 4DL6A 2V9WA 2YNHA 2BRLA 4KO0A 4RNFA 2V0NA 2HMIB 5KFZA 5DQIA 4TN2A 3DLKB 2JEJA 3LANA 3OL7A 1CSJA 2BRKA 3EPIA 4ID5A 3DRSA 3KLFB 3BSAA 3PW2A 4K4ZA 3V81A 3CDUA 5EWGA 1LWFA 1RAJA 1HMVB 1SUQB 5HBMB 2XGPA 5KFPA 4KB7A 1C1BA 4ECQA 1ZETA 2OPRB 2WHOA 1RTIA 4IOBA 3VQSA 3OSNA 4Q0BB 3MEEA 2JEIA 4O3PA 3BQ2A 3C6UB 4MKAA 4I2PA 4DG1A 3G6XA 1JKHA 2BE2B 1S6QB 2VG6B 3KHRA 1IKXA 1JLAB 1S49A 3I5CA 3H59A 5KFOA 4TXSA 5J1EA 1RT4B 4ZHRB 3QGIA 4MIBA 2BR0A 2I1RA 1C0UA 5KG0A 1JLGA 1C0TB 2BANA 3UDLA 1DTQB 4QWBA 1HQEA 4Q44A 3V6KA 1JLQB 2GC8A 3MFIA 2HNYA 3IRXA 3PJXA 3KK1A 1LW0B 5KG2A 3H4DA 4K4YA 3ICLA 5DLFA 3PW0A 3OSPA 1S48A 1RTDB 3KOAA 3RB4A 2YNIB 4O4RA 1NHUA 3KLHB 3M8PA 5C42A 2IJNA 2IC3B 4JV0A 4MFBA 5KT7A 1RT6B 4RW8B 4NLDA 3QZ7A 4ECWA 3MR3A 5HROB 4F4XA 3RBDA 1FKOB 5DG9A 5K14A 2W7OA 1IKYA 1LW2A 3HVTB 2ZD1B 3KNAA 3KHHA 4QWEA 4YMEA 5C5JA 4KKOA 4R5PB 5J2MA 2B5JB 2IMWP 4RW4A 4WE1A 1HPZB 1TQLA 3G6YA 4URSA 2C28A 1S6PA 1S10A 4IDKB 2HWHA 4J9SA 3KK3A 3BQ1A 5KG3A 4U6PA 4EYHB 2R2SA 2OH2A 3DLEB 4RU9A 4LSNB 2WONB 4ZPDA 3QGHA 3D28A 5EDWA 3LP0B 2C22A 5HP1A 3DOKB 3NGDA 1IKWB 1FKPB 3KLIB 2D3UA 4ZVHA 4IRCA 1QAJA 3I0RB 2ASDA 3GIIA 5I3UB 5KG6A 4IQXA 3KMQA 1R0AA 5KFIA 2YNHB 1IKVA 2B43A 4IH5A 4KO0B 3UR0A 2OPQA 1T3NA 2HWIA 1S1TA 5F8NA 4YP3A 4DL4A 4ID5B 3DRSB 3LP2A 1RT3A 2JC0A 1S1VB 1RT2B 1LWFB 2XC9A 1TP7A 3PW4A 4RW6A 3KHLA 3LAKA 1C1BB 1C2PA 1S1UA 2I5JA 1KLMA 3N6LA 4QW9A 4JV2A 1RTIB 1UWBA 4H54A 4B3OA 5KFBA 3Q8QB 4EBEA 3DOLA 3EZUA 2EC0A 3MEEB 5KFCA 2AGQA 3CO9A 3T5KA 5DLGA 4I2PB 4DG1B 1JKHB 1RYRA 4PWDA 2YNFA 1IKXB 4QPXA 1JXLA 3HHKA 1VRTA 3MR5A 5J1EB 4TQSA 3QYYA 4NLWA 3GV7B 4RW9A 1JLEA 3M8QA 4ED3A 4MIAA 1T05A 1U09A 4DEZA 4K4VA 2XI3A 1C0UB 5FDLA 1JLGB 4PQUA 2BANB 4O3SA 1XR7A 3QZ8A 3IS9A 3DRRB 4FS2A 1TL3A 2R2TA 4G3IA 1HQEB 5DQGA 4JUZA 3C6TA 2HNYB 3IRXB 5KT3A 3KK1B 1Z4UA 4NLQA 3TVKA 4HYKA 1GX6A 5KFSA 3PR4A 2J6TA 4WXWA 5CYMA 5DQHA 2C2EA 3CJ2A 3M8PB 5C42B 4TY8A 5F9LA 2IAJB 4MFBB 5KFFA 3ITHA 2HNDA 5L9XA 3BJYA 1EP4A 4RNOA 1TKXA 3D5MA 1SH3A 4K4UA 5K14B 1IKYB 1SH2A 2D7SA 1LW2B 4ED8A 1JLCA 4YR2A 3QIPA 1TV6A 4J9OA 5J2MB 4ECVA 2IJFA 4RW4B 1KHWA 4WE1B 2XCPA 2W9CA 2IM1A 4EYIB 2BQRA 2BQUA 3PR5B 4NLVA 4IG0A 4NLRA 3BREA 1ZTWA 1TL1B 2ALZA 3OL9A 3KK3B 4K4SA 4MKBA 5KFRA 4ZMMA 4R8UA
chains in the Genus database with same CATH superfamily
3ZNUA 3N4WA 5F8GA 4DV0F 4DFKA 1SIZA 3VAMA 2VONA 4N8OA 1MN9A 3THVA 4K5SA 4G65A 4DX7A 1RT3B 4DV5J 4DXLA 3IWXA 4C8KA 3FK4A 3CXCR 2HGLA 3AAWB 1F5AA 1VQMS 3RW7A 3MUTP 2HZVA 1ICEB 2XMVA 2WBMA 1EHWA 5FDLB 1FJEB 4DUYF 1XR5A 3W66A 2W7PA 2E1MC 3NAHA 4P7VA 4IUFA 3OT9A 3TOQA 3ITHB 2HNDB 4I4BA 1P1LA 4CO5A 1O8BA 2ZH5A 1F5BA 4LBPA 2HS0A 2R8JA 3MWBA 3CIMA 1PCAA 4DV7F 2QMUB 3MD3A 3MM9B 4NYOA 5L39A 1E6VB 1UW9A 1TVRB 3H2LA 1T03B 2Z56B 1EARA 2ADCA 4PRFA 4FPIA 3CJ0A 1RTDA 4IG3B 4JI3F 1YJTA 2FHKA 2Z30B 2HHPA 1HD0A 2HFZA 4S0MA 5D3GB 3PY8A 4DOZA 5I42B 4W98A 1OSDA 4AL6A 3OHBA 1NK7A 1U48A 3UN2A 1BQNA 4Z7YA 1S1WA 2YKQA 3D3CJ 1QY7A 3TX0A 1KQKA 3DLJA 3I32A 2KZMA 3TANA 5T14A 2WB1D 3V4IB 1IVZA 4TVAB 5B7WA 5EX3A 1BHNA 5KG5A 1U02A 3FEYB 3HVAA 3R5JB 3H40A 1DTTA 1SPBP 4F2RA 2YWKA 7AT1B 1HNXJ 2VASA 2E5LJ 1XMQF 1WEYA 2ACYA 4CDIA 4QR2A 3UD5A 2ASYA 4M5HA 3H7HB 3KLVA 3ISNC 3EUNA 3W9HA 1SVDA 2ZVIA 1Y4ZB 2ACMA 4LQ9A 2H54B 2BW2A 4P2SA 1A0OB 4X4SA 2I6WA 5G0RB 4MYTA 4DPYA 1JLCB 2JHEA 3NNHA 3NNCA 3JAMY 5DZ6A 4CLYA 2K3KA 4KC5A 2VHGA 3VR1A 2CWKA 1WWHA 2FVCA 4KAIA 2I2YA 2UUCJ 2BBEA 2ZJPQ 2OSQA 3US5A 2KH9A 3H5UA 1FJCA 5D0EA 2HRUA 4ZVOB 4AE5A 5M2RA 4JI0F 5HVGA 3AJ2A 1HYSA 4NRTA 2FJXA 1WJ9A 2D1CA 5G4DA 5KFTA 3W62A 5GMKa 3W63A 1R0CB 4BS2A 3U1NA 3MR6A 1GMUA 4JI5F 4I69A 2ZUGA 1VQ6S 1R8BA 3I5BA 2YH1A 3M30B 4HTJA 1HNVB 4H4OB 4LFBF 3M8WA 1B0VA 1JJHA 4DR5J 4M63A 5GAHU 2F7VA 3DRSA 2GQCA 2RQMA 4M5KA 3UD3P 1LEOA 4DG1A 3QRPA 1JLAB 2R7VA 2FY8A 2EG2A 4CM0A 3WQPA 5IOLA 2BANA 3IM9A 2JVRA 5CD4A 2MZJA 4U8VA 3H4DA 3OSPA 1VHFA 1RTDB 5DDPC 3KLHB 4RW8B 5J1NA 2ZHBA 1VMBA 3TJ8A 1CG2A 1FKOB 3LH2S 3ETOA 1KRPA 1VS3A 2KT3A 2A2DA 2FJAB 3RTVA 1Q0NA 2D3UA 3CPWR 2BUNA 1Y3JA 2DO0A 3FCWA 2K06A 3NGRA 4USMA 4HDGA 1M5HA 4USWA 3PG9A 4DV2F 2JC0A 3MM6A 1WI8A 2AEJA 2GX8A 2W24A 2UUBF 4EBEA 4CTAA 3K7RA 1R8PA 1RHQB 4FXVA 2CQ1A 3M8QA 4HHHA 3CEDA 2ZNYA 4E98A 2CPFA 4G3IA 4RBVA 3IRXB 4CO2A 3KK1B 1Z4UA 3TVKA 5IT4A 4NCBA 2YKOA 2BOAA 4DU8A 2DH7A 3Q83A 5AXKA 5K14B 2R7QA 3DLHA 4RW4B 3BH7B 2YKPA 2K1RA 3W1YC 1UW4A 4C9DA 3D6MB 4GC7A 3OLAA 4LQ3A 2MDAA 2R7UA 1YGYA 3BDEA 4I0WA 3W3SA 4RNMA 3DXBA 5A0YA 3HHLA 1WDTA 3TZZA 3HHNB 3JS9A 3PDNA 3KLEA 1H7XA 4EO8A 2H5EA 1HYSB 1QM9A 1WF1A 2XMUA 3LW5C 1HFEL 2VH7A 5HVHA 2J8SA 2B4UA 1CQMA 3DDKA 2QL9B 1NSAA 3C6TB 2M7SA 3HT3A 2HQDA 4L3NA 3BR8A 2VFTA 5LT5A 4LRCA 3CJTA 5DG8A 2HBQB 4OMFG 3M2UA 1TKXB 4OV1A 5C25A 1YTYA 1T8EA 4BCAA 3MI7X 3DLGA 3HO1A 4K4XA 1VQ7S 1WKKA 4P2FA 4Z7CA 2OPSB 3E01B 1RT7A 2YWEA 3AB4B 4ZP6A 4KHRA 1RTHB 4HR2A 2MZRA 3CMES 2YQ3A 2ZVSA 4DV6J 5F8JA 2YPZA 4F0HA 3MEGB 2OUGA 4C6AA 4J9KA 2FIUA 5D0RA 3KJVB 4XDDA 3M4XA 2MQMA 3FGVA 1YRXA 4B3SJ 1J5OA 5HO4A 1NDLA 3JSMA 2AKWB 2DGTA 2QLXA 3DLBA 4JI7F 4H4KC 5ETNA 4B3RF 4DL7A 2VBZA 3NAIA 2HFVA 4B3MJ 1RWVB 1K8AT 2ZZTA 2RMLA 3K89A 4CYUB 3AQPA 2VV5A 2RKIA 2SXLA 3DI6A 3QLHB 1R27B 2C3MA 3NY0A 2QA4S 4LF5J 1RZMA 4OLOA 3OFGA 1QTNB 4JI4J 4ELTA 3JYTB 1UEVA 2ATCB 4B9UA 1VIXA 1N36J 2B6AA 2HQCA 2HVZA 2KL8A 3ZO7A 4ED7A 4FF4A 4MT1A 5J2PA 4TU7A 2Z2ZA 3CT9A 4LF6F 2QN6B 3S6EA 1SL0A 1SV5B 1UZDA 3H98A 1PJ6A 1SUQA 4LMZA 3OLBA 2OPRA 1MSWD 4JI2F 2NYHA 4C7QA 2KI2A 1BQMB 2W4DA 2B3TB 2FLOA 3M8ZA 4DQQA 1JMTA 5A0YB 1H98A 2V2ZA 1RKIA 2C2DA 3HVRA 4DSEA 3MAQA 4ILRA 3GP9A 1U0HB 3MECB 2MQOA 2XNRA 1Q82T 4LSNA 2DKOB 5DRKA 1ZZFA 1PBUA 3M2UB 4PYDA 3I0RA 2QYCA 1XQIA 2CIMA 3VV2B 3V81A 1RAJA 3HX9A 3OVSA 2E1PA 3CNQP 5AXMA 3AOCA 3K5NA 3C6UB 5ADZA 1VK8A 1RWPB 4YB5A 4DSLA 1RJJA 1TELA 3R1LA 1WKJA 1DTQB 2C3OA 4Q44A 4PG5A 2R4FA 3UW1A 3KOAA 3MPYA 3DCAA 3C46A 1BGXT 4C8MA 3Q8YA 1SB6A 3JQJA 3IAM9 4LF7J 5F3ZA 3B82A 4EFAC 2ZD1B 1TL7A 4R5PB 3G6YA 3HSZA 1CJVA 2HWHA 4J9SA 5KG3A 3BYRA 2HURA 2CWXA 4TLQA 5HP1A 1XNRJ 1IKWB 1RLCL 4LSZB 1NSKL 2IVFB 1PG5B 3UCZP 4U7UD 2ASDA 3POTA 1DURA 2OMOA 3M8YA 2LA4A 3LP2A 3ZZUA 3PM9A 3EDRB 1LWFB 1U7LA 1N32J 4C8LA 1NU4A 5KFCA 2HG4A 4QR1A 4I2PB 1EQ0A 2ZJRQ 4TQSA 1JLEA 1C0UB 1Y5IB 1QVGR 4OZ3A 5CQGA 2DTJA 4HYKA 4WP8A 3KTQA 2EK6A 1HHSA 1D8ZA 4K4UA 4YR2A 2CRLA 1LFPA 3SV4A 3KWMA 1AA1B 2YXLA 3W5XA 3OL9A 4MKBA 5KFRA 2GAGC 4KGMA 3O44A 4NLSA 1BQXA 1HWUA 1E6YA 1PAEX 1L3KA 1KQFB 3QGGA 2C2NA 3THTA 1TTHB 2OPQB 4ZPWR 2YY3A 1QSSA 4UW2A 4UT4A 2I8EA 2X51A 3OFFA 2UZAA 2CPHA 1M5SA 4NCGA 2MKJA 1RT1A 1ZM3A 2E44A 1SJ4P 2NZCA 1KQGB 1HWKA 2CA9A 5ITHA 3RR7A 3PJ9A 4WWSA 1I1GA 2RDDA 4LF8J 3H25A 1IBKF 5FIIA 1N0UA 4PG8A 3MAAB 2JFKA 1DARA 2QJ3A 2GJFA 4IFYA 2VFVA 1K73T 2W9CB 4O3NA 2GNKA 4IG0B 1RA7A 3BS9A 2KXNB 3B4MA 3V81B 3HHEA 3SDEB 2DGSA 3PFOA 1XC9A 3VAKA 2BV3A 4K4WA 4LF2A 5A8WA 4QJVA 4J91A 2AU0A 2QMWA 3ZNJ1 1N6QB 4K59A 4OX7A 5EX0A 2RUSA 2LFVA 1KDNA 4URQU 1XMBA 2CPJA 3PACA 2V4RA 1RU1A 2BM0A 3R8YA 1CS4A 4YY3J 2YWGA 4FYYB 4DWIA 3EVWA 1TL7B 3UVJB 4QPTA 1WEXA 2NR0A 4M5IA 5L1JA 4M5DA 2UU9J 3MMCB 1J2VA 1HBUB 3MPUB 3S8SA 1PO6A 1I3OB 3R2DJ 5AE2A 5HMWA 3VALA 4FKXA 2WOMB 4PPZA 3I4HX 1W26A 1NH7A 4LIRA 5KG1A 3CCTA 2R7SA 4B08A 2Z8QA 2F4VJ 3OXFA 3R5BA 1UFLA 4O44A 4A8QA 2VG5B 3CW2C 3MTKA 1S9EA 1S0OA 1SCJB 3BGRB 1CBKA 4LJMA 1NJWA 1REVB 2J7KA 1U2CA 3HT0A 4A8KA 1OMSA 3MURP 4FF2A 1AUSL 3PVXA 2JRSA 5KFYA 2K7JA 2KDOA 1S79A 4WZMA 3KLFA 3VGUA 1UPPA 2MQLA 2Q3PA 5IWAJ 4X62F 5GADI 2MXYA 1W7WA 1FFWB 3DM2B 3A8JA 2ZNZA 4WP3A 2KM8C 1S0MA 1E6YB 2YWHA 3HKWA 1NDKA 4PAAA 1NK4A 1QAYA 4PABA 5B08A 4BWMA 2BZ2A 1JLQA 5ETPA 1FVQA 2OD4A 2QE5A 3FBBA 4NLOA 4ZIWA 4ES2A 4IYQA 2JC1A 1Q86T 5A2QY 5K8PA 2HZAA 2XM3A 2MKCA 2J6SA 3AOAA 2JLGA 1NK0A 4Q2MA 2QMXA 4DF4A 2FJVA 3TARA 4DFPA 3BR9A 3CULA 1KVIA 4NYPA 1U6FA 4ID5A 2H5JB 4QIVA 3FNNA 3O5TB 4ECQA 5D4NA 1RTIA 1NK9A 1JKHA 1IKXA 1KOOA 2PO4A 4OHVA 2PA8D 2HQ3A 1SI9A 3P96A 1NZ8A 4ZPVR 5LOQA 2DEIA 1HR0F 5LXRA 2GJ2A 2XQCA 2ZH4A 3ICLA 3HSDA 1O6XA 2GGPB 4QOTA 3RB4A 3PKYA 5C42A 2BVZA 4QIWD 4OZLA 5E7OB 4KR0B 1LQ9A 2CPZA 4NI2B 4OQJA 4DUZJ 1YG0A 2VPZB 4ZPDA 2VBXA 2HK2A 1VI7A 1FKPB 3OTEA 4DR3F 2BE9B 3MHYA 1IKVA 4KO0B 1G3OA 1T3NA 4I6AA 2CDQA 2VPYB 1U0SA 1S1UA 1P6TA 1VLYA 2MKYA 3MEEB 2MKSA 3IWNC 4FYWB 1RYRA 4PWDA 2YNFA 2DIVA 5F3TA 2DHSA 3QYYA 4QIEA 2UXBF 4EGLA 1JLGB 1TL3A 3R27A 3C3LA 3RBXA 1YZ6A 2VIHA 1VLOA 3BJYA 2LKZA 4PG6A 5MLCV 2XHCA 1IKYB 3D1QA 3BV8A 1KNZA 1N33F 1FDBA 2V8GA 3D0IE 4QR0A 3RRGA 4YDDB 2OEKA 4R8UA 1URRA 4YR0A 2CZ4A 4B3TF 2W1BA 2MHEA 5DO2A 4RUBA 2CJXB 5B0BA 3EE3A 4ZJLA 4GRSA 1FNMA 4DR6J 4Y2IA 2XGQA 4IR9A 1LKZA 2G2OA 5I3PA 3ZZ0A 2J7WA 4DSJA 3K58A 3G6VA 2VICA 4NE9C 1HWJA 3R5CA 2M5YA 3KG1A 5KT6A 2OIHA 3ZFVA 2FHJD 4NYZA 3K5PA 2VJVA 1JX4A 5KFMA 4HEA9 3CDBA 2MGZB 1H3DA 1TKDA 1FCAA 1QAIA 3IN5A 3UD4P 4ZHRA 2V4JA 3DMJB 2B9XA 1FTCA 3BSCA 2FJWA 1HQUA 1VDHA 2E1AA 3GJQB 4UQTA 4DN0A 2JH3A 2M88A 5ETRA 5CYQB 4PEOA 3PEHA 1CULA 1M1GA 3O8WA 4L73A 3ENAA 4J9RA 1O5JA 5D15A 2VFRA 2ZH2A 1IBLJ 2EBGA 1RT5B 1HNWJ 1ELOA 5CH7B 3LA0A 2J5AA 4DI6A 2VPWB 4EBDA 1TMMA 3I5AA 5HSPA 4HT5A 2CG4A 2O5DA 3BPDA 1U49A 1WC0A 1KVKA 1TKZA 2B9WA 3PJWA 4MAKA 4LRFA 5EWFA 3RAXA 2DNRA 2EFGA 2G2YA 2MZQA 4O3OA 1JJ2R 4CZCA 1TZ0A 1VQSA 3ZZOA 1TL3B 3RR8A 2CQIA 2ZDPA 1S0NA 4RW7A 2EXUA 3Q86A 1SL1A 1NCLA 1Q16B 3CJQA 2RS8A 4RWWA 4MK8A 2R7XA 1XMOJ 4NLPA 3GLJA 1UMJA 5F8LA 1TL1A 1VC0A 4DMZA 2LP4A 2AYGA 3EGNA 1DLOB 4ZLNA 3UNGC 3K0JA 4NLXA 5LM7E 5LMUF 3M9MB 4NMLA 4O0NA 4KV8B 4CCHA 4RBUA 1SKUB 3G8TA 3LGHA 4HH1A 5ETLA 2HS3A 1QAXA 2JZ5A 2UUAJ 4G1QB 1R6YA 5F8IA 3UCGA 4KPYA 2OD6A 1RWOB 1VK3A 4HL9A 2PFFB 4Y00A 2FQQB 3HULA 2W2MP 3MGJA 1IM4A 5H9FJ 3BDPA 3W2WA 1T7PA 2V9WA 2BACA 4TN2A 2JEJA 1R7IA 1NK5A 4K4ZA 4C11A 4IQMA 3C15A 3N0VA 2B51A 2VG6B 2RRAA 4FF1A 5GAEI 3OFEA 5HQ8A 4ZHRB 2BR0A 3QJLA 3BBCA 4DV5F 3QT7A 4ZOSA 4U7UK 3CJKB 1HQEA 4C4WA 1CC7A 3TR5A 3JSBA 3OR1A 4J9VA 3M6VA 1MROB 3MM5B 3C14B 2MZ1A 2Z58B 3AODA 3HVTB 5C5JA 4WK3A 1FNOA 1GMWD 2FHMA 2DBBA 3OTBA 4NCAA 2PE8A 2W2OP 4RU9A 2PEBA 5IM0B 2XSJA 3H0PA 3JTPA 2JWNA 4KQZA 2H51B 3MCSA 2A6OA 3FRYA 1G6BA 1UWAA 3DOMA 3GU0A 1UVLA 3GJSB 4OX9F 2XC9A 4DQPA 3KHLA 3ISZA 4CO4A 4X4TA 3ZZPA 1UZHA 5HANA 1RHKB 3BBBA 1I94F 3QZ8A 1QSYA 4NLQA 1GX6A 2J6TA 2BOPA 2VFSA 2QLFB 2HYIB 4J9OA 3NCPA 1KHWA 2BE7D 3NP5A 4V1Ak 2CADA 1TL1B 4K4SA 1S77D 3IMQJ 2FLPA 4YFUA 4Q5VA 4J9NA 4KFBA 2CDRB 2PI4A 2XB2D 2FJEB 4A48A 4UF4A 1S1TB 2GW8A 2LQ9A 2L3MA 2IVMA 1RP5A 1U4BA 1KLMB 2YTCA 1ITPA 1X9SA 4X4PA 1T9UA 2COLA 1VQ8S 2E9TA 3GE9A 2N7CA 1JK9B 3Q89A 1VRTB 2AF6A 3T3FA 3LAMA 4USVA 1X31C 3BSNA 2LEPA 5DDRC 2XG8A 3QO9A 1TKTA 1EP4B 2F8MA 2KJVA 2UVVA 1FRKA 3BN4A 3K5MA 3KK2A 3QIPB 2PSZA 8AT1B 3MM8A 4Z37A 2R8GA 2E9ZA 1Y0HA 5T41A 4ZS6A 3FMWA 2V2VA 3C15B 1N5YB 3RB3A 1PJ5A 1F1BB 3A8IA 2LQBA 4P10A 2A2CA 2NPFA 4N77A 2AJFE 4WPAA 5IQQA 3FFIB 4ZVSB 4DZ6A 2G9OA 2Y0SD 3OR1B 3CDEA 3MCNA 3DYAB 3HK2A 4DPXA 5A6PA 3BGOP 3T1HF 3G9CA 2BKNA 3FCVA 3Q8UA 3T9NA 2Y0BB 5AE1A 1H7WA 5T7LB 1FI4A 2PD1A 4M5MA 1TK5A 1NBEB 4OYZA 4UQGA 2VA2A 2DYAA 4NL5A 1TUWA 2DXFA 5KOWA 4QWDA 3PO5A 3EM1A 4RPFA 3DOMB 2HFUA 3FBCA 3H5SA 1WOSA 3AQOA 1FESA 3ZC4A 1LWCA 4LF4J 1RWMB 4USKA 2WCXA 1HNZF 4EU0A 1RWKB 2CNNB 3GV8B 3NL0A 4X4QA 5FJ4A 3QNWB 4I7FA 3K5OA 4OI1A 4K7QA 2Z2MA 5E3RA 4LF9J 2KHCA 4IFVA 3AHPA 1IUJA 2W9BA 2DCLA 2AIRB 2KB2A 3N6MA 2GQ2A 4RJVA 4DCOB 3A12A 1OQ3A 4Q0BA 3QFWA 2E7VA 2OPPB 2BE2A 1A7GE 4KGKA 1SXLA 3EX7B 2PT0A 4Q45A 2P9EA 4DR1F 3V5RA 3VHQA 3OHAA 2GMJA 4KT0C 4DL3A 2IC3A 2DNLA 3N6NA 1SC1B 1SJRA 4Y2CA 3EGVA 4NEYA 4C8ZA 4DCPB 4MJKA 2DNOA 2EW9A 1VYAA 4K2XA 3D0GE 3OD2A 4O3QA 2ASLA 3CD7A 1WTBA 3QO9B 1XN9A 2GIQA 3BM7A 5A76A 2A6MA 1IXKA 2LXFA 1S6UA 3AFGA 3KK2B 4DL6A 3G82B 3UN5A 3D66A 5ETTA 2R7OA 3DLKB 2DHAA 3OL7A 3EPIA 5HAOA 1Y9OA 5GAGI 4IOCQ 3SEOA 2CJAA 3CCZA 3GONA 3TWZA 3VQSA 3OSNA 2VKZG 5FLXY 2EKNA 2G0CA 2ZC4A 2V8DA 4ZITA 4R0JA 4CLPA 4DV4F 5JVHQ 3I87A 4P72A 2HNYA 1ZYQA 1S48A 1DJ0A 4JI1F 4O0IA 4WTOB 4F4XA 1B4SA 5DG9A 2B5JB 2BEFA 1HPZB 1TQLA 3EYZA 1M90T 3B6BA 3QSIA 4EI2A 1FKAF 1BXNA 1H0HB 4USJC 4OHXA 2KVQE 2Q43A 3UFCX 3UDVA 3KK3A 1LXJA 2Y8YA 2NSBA 3D9BA 1RWXB 4CLSA 2XO6A 3IR5B 4IQXA 1L3UA 4IH5A 4AYBD 3MOZA 2DH8A 4DL4A 3CJRA 1TP7A 4ES3A 1C2PA 1NJIT 1RAAB 3PYDA 2VDHA 3DOLA 2HHUA 1OPZA 3GZ7A 4C3LA 1T05A 3M2RA 2M70A 1QUPA 4PR6A 4DPOA 3GJTB 4O3SA 2HHHF 5A8KA 1U2FA 1X60A 3CJ2A 5L9XA 4ALZA 2LQJA 1LW2B 1FJGF 2HK3A 4OZ0A 1LV5A 2IM1A 4MKVA 1H2VZ 4WIQA 1HBMB 1IR2A 2MMYA 1W2IA 1TFWA 3CJ4A 1R8AA 9ATCB 4OYMA 4B3MF 4HACB 4XIUA 3I0SA 4A8MP 3QFHA 4L6V3 4ZKAA 2F4FA 2IM3A 1WNEA 3B4DA 4ATNA 2F1FA 3K8VA 2DRBA 3J80Y 1VQLS 3R1HA 4B3OB 4FP9A 5B0EA 1GTEA 4YDXA 4M94A 1NDPA 2QFIA 5EUHA 1LWEA 3VAHA 3AOBA 4NZ0A 1NJZA 1NKCA 2IM2A 1DQ9A 1G2EA 1HNIA 2W2PP 2YKMA 2WSCC 1U1KA 1VRUA 4ECZA 1QJHA 3EGWB 4MYUA 2C2MB 2UXCJ 2CQDA 4ECRA 1C1CA 1EQMA 5KFKA 1X4GA 4TU9A 4USTA 5HJYA 3TW0A 1U1NA 2IYIA 1BD6A 3D2WA 3OL8A 2QL7B 1EIYB 4RX6A 4U95A 5D4PA 1T9YA 2J9DA 4ZPCA 5E3PA 3W7BA 1FD8A 3M32A 3VGSA 2C3UA 3TVYA 1JXEA 3MEDA 3KYLA 2ALYB 3WBZA 4O4GB 2V2KA 2PDAA 2FVRA 4C97A 4ECXA 1BMQB 5A8RB 2FHJA 1VR6A 3RB6A 4PUOB 1NRKA 1S1XA 3LP1B 1RBLA 5KFGA 4XK8C 2XLIA 7FD1A 1HARA 4DSKA 4H4MB 3EZOA 2H5IB 3LO3A 5ETVA 4RWXA 4F3MA 2YPYA 1X9MA 2VZ9A 4N8NA 1X4EA 5KFVA 2AW0A 1UFWA 4A8WA 2WAQD 3DRXA 3DRRA 1KOHA 1YDLA 4OZ5A 2E1RA 2Y1LB 1FEHA 1UPMB 3TEGA 5L1KA 5KT5A 1PYOB 1ZPWX 2CQHA 1EETB 2VQEF 3VZIA 1B99A 2DNHA 2F63A 2HQIA 2BJ7A 4IR1A 3D68A 1XNRF 4Y0FA 3FDSA 2QV6A 1T9WA 5IT9U 2GHPA 1FX2A 1RAFB 1S7IA 3F0NA 1NJYA 4GVBB 3I0SB 5KFDA 3G4SS 4DQSA 1N32F 2KXHA 1OY9A 2VBWA 3W2VA 1LW0A 1FT8A 3CTRA 2E29A 1WHWA 3RBZA 5JVGQ 3CO0P 4OFZA 2VU5A 3CB4A 4YQWA 1NNDA 1X4AA 2CPYA 5L1LA 2OO4A 1TAQA 2GAHC 2RF2B 3O1LA 4A47A 5CCMA 5L9NA 3CCSS 4OHZA 2B7BB 3IAS9 2W9AA 1OYDA 1FK9B 3EPGA 5I3UA 3ULHA 1X0FA 2CKWA 2BRLA 3QAUA 3PNIA 3JSRA 4P9SA 5EWGA 1S12A 1S6OA 5KFPA 1C1BA 4ZK7M 3UR3C 4X65J 3CC2S 3EVMA 1UEUA 1S49A 4PWWA 5KFOA 2A18A 1RT4B 3QGIA 2MKKA 4B9NA 2B8QA 2DNQA 3IWLA 3QT5A 4B9VA 3PJXA 2FB0A 4ZJOA 1V3ZA 4DUYJ 2IJNA 3NEKA 3MR3A 5HROB 2HGNA 4EUVA 1NKBA 2W7OA 4CNZA 4YMEA 3ZZZA 3GFHA 1P1TA 3I6PA 3EDQB 2LXIA 2RNEA 3J81Y 2WONB 1LK5A 2W2QP 1IM6A 3QPIA 4IRCA 1SQEA 2DH9A 1RTZA 4B9MA 4N5SA 1PC4A 4WU2A 2EFVA 1X0PA 3WIVA 2P5VA 4C8NA 1Q53A 4M8LA 5MAOA 3K5LA 2RU9A 4JI3J 5B0FA 1UETA 3MR5A 2JDJA 3IA0A 3DRRB 3KNGA 4M5GA 2OKQA 3SZ2A 4OI0A 4ZN3A 1HHQA 4MFBB 3SYZA 5CD4H 4RNOA 4RUHA 2E7WA 1GMWA 4OYXA 2PC6A 4ED8A 1TV6A 1GAOA 1W2BR 2JSXA 1TK8A 3UDCA 2OP5A 5HN0A 2ALZA 4F67A 4R25A 1TK0A 3D7SB 3HI9A 1BWVA 3SSSA 5B0DA 4TYBA 2LDIA 4DV3F 1J5EJ 4CH1A 1XMQJ 1FDDA 2FYXA 5GADU 1XEZA 4QU6A 2DNMA 1UWBB 5L1IA 4USHA 3LWLA 1HLWA 3VVUA 3SXLA 2V68A 2E1CA 4FYDA 3OFHA 1KP6A 2EG1A 1V9OA 2E5JA 4DR7F 5KFHA 1VQ4S 2QGFB 4WKYA 2R8KA 2ASJA 2VQFF 5DDOC 1LXNA 2IDEA 4FBTA 1YLXA 1FRHA 3ISND 4EBCA 4EEYA 4L74A 4JI8F 2B4VA 2BXJA 3F44A 3MMAB 1RTJA 1WF0A 2M8HA 1RADB 1FXRA 1JLBB 4F0KA 4JI0J 2RQKA 2XEXA 1IBMF 2HHXA 2FGCA 1YHQS 4W4MA 1VBZA 5J2NA 2DHHA 1QDUB 4JI5J 3HKZD 1RUSA 2HNZB 3R3TA 1X8DA 3O2IA 2GVZB 1J27A 3AXKA 5CABA 1D1UA 4HTIA 4NLUA 4ZCLA 4K8RA 2VL1A 4MK9A 3PRBA 1ZA1B 3ELHA 2EVZA 2WSFC 2ZH8A 4U8YA 2CPDA 3TQEA 2B56A 4GKJJ 2XBPA 3NMAA 5DM6Q 4CLFA 1F3FA 3LPEA 4NOHA 4LF1A 3EZ5A 2ZITA 1CPZA 4K4TA 1QE1B 2MZSA 3S1TA 3GR0A 4FNIA 3PHEA 3M6UA 5HQMA 3KDOA 4HHUA 3KG0A 7FDRA 1P9YA 1Z1ZA 1KLNA 1PSDA 4RNNA 2IAJA 2UUWA 3CCVS 1ZH5A 3PKMA 2CJQA 4A8YA 3SSQA 2ZOMA 1MW7A 4DCJB 1VQNS 2QSWA 3HXMA 1ZAVA 2M3DA 2WSEC 4ZVEA 2NPIA 1JLFB 1VHIA 2DNGA 4NPOA 2VA3A 1TMJA 4OHYA 5F8MA 3LOUA 4DV2J 5H9FK 3G86A 4OYPA 2HWTA 1YRTA 2UUBJ 3M9NB 3G6ES 4URGA 1WG1A 3IR7B 5KTQA 5KG7A 4GKKF 2WVBA 4X4RA 2EWHA 2CNKB 2D69A 2D41A 1F0XA 4I2QA 1UJ4A 3IG1B 1WI6A 2W01A 2AJ0A 1T02A 2BX6A 3LP0A 3TUZC 3DOKA 3T19A 4J9UE 3OTDA 2FHOB 3KLIA 2IFXA 2MY7A 4TU8A 2HLTA 2AHOB 2XWXA 3CUNA 4OHWA 3PW2A 2FC9A 3CDUA 4BC9A 4RO0A 2XGPA 1N34F 4NZ6A 2XSFA 1WC4A 1YJWS 2L9WA 4PXEA 4FVCA 2Z0GA 4ELUA 5J1EA 3E8OA 2HLUA 3VZHA 5E33A 3QGPA 4DF8A 4DR6F 4QWBA 1KBRA 2VBYA 2YNIB 5LSLA 4ES1A 1JQGA 3NRBA 2KYZA 3OUYA 3MMBB 2D9OA 1IN0A 2DY1A 2BKPA 8RUCA 1B0PA 4KKOA 1YSJA 5J2MA 2EKYA 3T9ZA 5K5MA 1SC3B 4LREA 4IDKB 2LECA 1NUEA 1GT8A 2CPXA 1H2UX 4U6PA 3DC2A 2OH2A 2N3OA 2XY7A 1K47A 2P9GA 3PHTA 1RHJB 3M1VA 1K0VA 2MTLA 1RWNB 3J7Z5 1CJKB 4KYZA 3SMZA 1YBTA 1DQAA 1AFIA 3L95X 3OXLA 2I5JA 4WK1A 1FRMA 1QTMA 2RILA 2DGWA 3CO9A 3T5KA 1ZAWA 4AQYF 2KKHA 4JV5F 4NXNF 4K2JA 2K7KA 5E0OA 3OJSA 2R2TA 4FS2A 3MCMA 5IC4B 1S72S 2HRYA 3PR4A 3HFZB 2LLZA 3M8PB 2GMHA 2IAJB 3CCMS 3CMAS 4YN3B 2XLKA 4LR9A 4JI7J 4B3RJ 1IBLF 2E66A 2BQUA 5EGYA 3PR5B 4NLRA 1HW8A 3GFXA 3J81j 3I82A 3V4MA 1Z2LA 3C8YA 4ZMMA 3NCQA 2EEYA 4F4KA 2GIRA 3W5ZA 4HI1A 3MDFA 3SV3A 2AGPA 4ECYA 1A9NB 5ETSA 3OR2A 2ZUAA 1KVJA 4DL5A 4C3MA 4RW6B 3WZ0A 2ATLA 4PKDB 4E0DA 3DGPB 3DRPA 4LR7A 3CD0A 4I2QB 1LK7A 2PN6A 3MR2A 3MF5A 2RH3A 4PQUB 4LF6J 2F8HA 3NWRA 3RGIA 3FEZA 2V50A 1IWGA 1RBAA 2U2FA 1EKSA 4JI2J 4XPEA 3IC1A 1H74A 4QIGA 5LSRA 1YWXA 3DN9A 2HBZB 3HVWA 2EI5A 3V6DA 4CNYA 1AZSA 4DV1F 1F2GA 3JTNA 3H8YA 1QLNA 2G4BA 1CJTA 1EKRA 3OBIA 3NBPA 2L41A 3TX8A 4IRKA 4LFAF 1NJXA 3FZBA 3C2PA 1VQPS 5GAEU 2HZCA 4RU2A 2MB0B 4FYXB 4NLTA 2GHWA 3DHWC 5AXNA 3Q2TC 2HRTA 1APSA 4B9LA 4KKOB 1GXLA 4I56A 2C42A 2NYIA 4N56A 3NS7B 4C48A 4QCLA 4CLZA 1YBAA 3BGUA 3T1YF 4UTGA 1Q7YT 1UTAA 2YNGA 1OWXA 4EK2A 1SC4B 4N41A 1M5OC 1YRUA 1SJFA 2FC8A 4UY85 3Q2SC 3RUBL 3C16A 2CZ9A 3TO8A 4DLEA 4NA2A 1AB8A 4WXOA 1GK8A 4D3HA 2CVIA 2YX1A 3NS6A 3FRZA 2RHSB 5HLFA 3F56A 4M5JA 3CCUS 2FVQA 2PFDA 1URNA 2YKAA 3D6HB 2OSRA 4X66J 4KY3A 2BJ3A 3HD1A 2HMIA 4M5NA 2DRAA 2P6TA 1BQNB 1S1WB 4OX6A 5DZ7A 5HBMA 1OSCA 2QYGA 4FDFA 3U27A 4JYAF 2HVEA 1M5KC 2D3ZA 3P6YC 3GJRB 2QC3A 3D67A 4K0KF 3T6BA 2KVIA 3VAFA 1C0TA 3RAMA 3RAQA 1ZAXA 1P27B 5HQLA 5L46A 4TY9A 1OQ6A 1DTTB 5KG4A 2CQ2A 3NGTA 1D3WA 2ROEA 2WVEA 3O6QA 1CLFA 1FXLA 3W8GA 2XMWA 4CM2A 1RE1B 2FLLA 4HVZA 1S99A 2FTRA 1FX4A 1VJQA 2POKA 4TYAA 2O66A 3CCQS 1ZM9A 3W8PA 4NA3A 1QD1A 2MQPA 1FXDA 1S76D 2Q6CA 4OX8A 3LANA 4RKUC 1PGZA 3QAEA 1Y3KA 4EZ6A 3PX6A 3KHRA 3UDLA 4Y2KA 3V6KA 1REGX 2VOPA 1BLUA 2ZH7A 3NWGA 4IO9Q 4CO3A 5AJ3F 4F04B 2C3YA 1IBKJ 4FXDA 2VJUA 4MMOA 1FDNA 4URSA 2G1HA 1VIOA 4IO1A 5H9EJ 4OYAA 3QGHA 2MQ8A 4HT7A 4ZVHA 3X3UA 3M2VA 1U45A 3PIPQ 1FWKA 1UVNA 4AXIA 1RSCA 4YP3A 3DRSB 1V6HA 3G96A 4DG1B 2BDPA 2QO3A 4N76A 3I56S 4NLWA 3GV7B 4RW9A 2BANB 3IS9A 2FY1A 2OELA 5CYMA 2X3GA 1JB0C 2C2EA 2ZWOA 2HFNA 4E8UA 5HJXA 4G1IA 2IJFA 1F9HA 3D1OA 4KGXB 4ZIVA 2RS2A 4HH0A 3Q24A 2VG7A 1XR6A 1PIEA 2GO9A 2VKRA 4RNHA 2XYGB 2V8PA 5KFLA 1Q4RA 1S9FA 3CJSA 2LEBA 5KFQA 3FQKA 3MM6B 4F26A 1YJ9S 1TR0A 5AT1B 1PBAA 4CTAB 5J2QA 4KBIA 2GO8A 1KC8T 2F40A 3MAHA 3M8QB 2ZH9A 1S97A 2JNJA 2KFYA 4NA1A 1WG4A 1RU2A 2NXJA 1FHTA 1N52B 2M9KA 4KHMA 3CCJS 1VQOS 2AEFA 4X62J 5C2CA 2LYVA 1R89A 2AJ1A 8ATCB 2D3O1 2V67A 2K1RB 3I96A 2Q1LA 1HI8A 4X84A 2CXEA 3DLLQ 3QRQA 3CGIA 1FRXA 1WELA 2NUUG 2QL5B 2P8IA 2DGXA 2ZM6F 4Y34A 1X4BA 2C1EB 5GAGU 4P52A 3HHLB 4FVMA 2AZ1A 4KE5A 4U67Q 2M52A 3H90A 4CIOA 4G6VB 5EWEA 4B9SA 1WEZA 3KHGA 3KLEB 1M5PC 4M95A 2YKNA 1NHKL 4L3KA 3PYFA 4IH7A 2QRRA 3IBCB 5DGBA 2KM8B 2R2UA 1FFGB 1L3VA 4OZNA 1M5VC 2DEJA 1UJ6A 3H5XA 1NSQA 1CJUA 1KQSR 2FVSA 2HS4A 1MU2A 1SQGA 1OPIA 5C25B 3GIMA 2CJ9A 3V6HA 3KUEA 4ED1A 3DLGB 4YS2A 3EVOA 4LSLA 4ICLA 2ZOFA 1GFWB 3MM7A 1EZZB 2FZCB 4WFAQ 2DGVA 1RT7B 5AE3A 3IO1A 2DR5A 4FZVA 1RAIB 4FN5A 2W25A 2GMLA 3DNCA 5CYMB 1X4HA 4GVLA 2OLWA 4P7TA 4KHPF 2BJDA 1XNQF 2AZ3A 2R9LA 1ZA2B 1Q7LB 3MPWA 4I67A 4DR3J 1U8SA 5L8RC 1U24A 1BWEA 3AJ1A 4ZVGA 2W7AA 1U47A 1J5OB 1FNXH 3JSYA 4WYLA 3JSMB 4KJIA 2DXEA 1S6QA 2C2KB 1YJUA 2CJYB 3IGNA 4WCEQ 5KT4A 1YQHA 2HW3A 2JLEA 1SBRA 2RKIB 2UXBJ 4F0MA 5KFNA 3DI6B 2I9SA 1Y5LB 1VISA 3BPSP 4J9PA 2B9YA 1HBOA 3TZYA 2AJ4A 5IT0A 2Z4PA 2DR9A 2KO1A 4DR4F 1N33J 3DLEA 2B6AB 1WORA 4HDHA 5J2PB 3TEHB 1MMNA 4LRAA 2WBRA 4B3TJ 3SIPB 2WVCA 2YNHA 1Q8BA 2CQ0A 4RNFA 1JJ4A 2XY5A 5SZTA 2BRKA 3I4PA 2DGUA 1SUQB 4TNOA 2OPRB 2O67A 1GXTA 4MKAA 1UVMA 1Q8LA 3I5CA 1FVSA 3H59A 3MTJA 2HPUA 2E5GA 4HI2A 1K9MT 1RBOB 2Z57B 4WE1A 3ET6A 3KJFB 2RVJA 5LJ5Y 3OXGA 3OTOF 2FD2A 2HGMA 4LSNB 2XYHB 1D8YA 1D9FA 4ED4A 1CJUB 5IQ6A 3I0RB 3GIIA 2DB1A 5HMXA 3DU5A 3U7JA 1KTQA 2X1BA 2UXCF 1RT3A 2ZBIA 3QWUA 4DJBA 4X4UA 3N6LA 1HQ2A 1IJEB 3MR7A 5IFMA 1Q1KA 2A0FB 5U47A 2UV8G 3HHKA 4LFCJ 5FDLA 1T9XA 4DR2F 4PWUA 4UOFA 4F4AA 1U1QA 4TY8A 5KFFA 3ITHA 2HNDA 3FC9A 1SH2A 1WG5A 2V6AA 3NGSA 3JXOA 4EYIB 1CJVB 2KJWA 4HHJA 4LT6A 2Z2YB 2AJQA 2DHGA 4E2FB 4ZVPB 2E5HA 3MM9A 4ZA1A 5HP1B 1E6VA 4ECSA 2J6UA 1R8HA 2DPJA 3GG1A 1TVRA 3POTB 4LUBA 1T03A 5KT2A 1PAUB 5CYJA 3QT8A 2V4QA 3LP2B 4IG3A 4Q8EA 3KJNB 3QWPA 4ZCIA 3QATA 4UUWA 2DHXA 1H38A 5D3GA 4C3KA 1VBXA 5I42A 3RBEA 1KS2A 1JLEB 2XO7A 3NG8A 2DXDA 3V2UC 1Q95G 2CNOB 3NS5A 2DPIA 3HHLC 2E7XA 2OTLS 3GYGA 3V4IA 2HQGA 4LBHA 2D3OR 3SFGA 3ZTRA 4ZVFA 1NPRA 5LMUJ 5E41A 3DRYA 1X9WA 5EHHA 4V19X 4F4ZA 3ZZRA 2CFXA 1ROFA 4X64J 3HP6A 3OW2R 4LVOP 3KKFA 2H1YA 1RT6A 3DU6A 4LR8A 4WP9A 1XBWA 4NCGB 2BJ9A 1D0EA 1UCNA 1N5VA 5G0RA 1RT1B 4ZPBA 2WK4A 2J9CA 4OYOA 3OL6A 3P5BP 3ET6B 1TAUA 2FPHX 1FE4A 4JI6F 2AP6A 3HMJG 3TQ1A 4NLGA 2A3JA 2DNKA 1TL5A 2B9EA 5JUMA 4IFYB 3ZTPA 3TVZA 2HHWA 1NDCA 2VPXB 4X65F 3U1MA 2DNPA 4DX8H 4YHHF 1NMEB 2NUHA 5A8WB 2O01C 3TUPA 1PKUA 5JXSA 4Y6IA 3CC7S 1MWZA 3VF0B 2C2RA 3M30A 3Q8VA 1CQNA 1HNVA 4H4OA 4TY8B 5F8HA 1CS4B 2DT9A 2PMWA 1RCXB 2F5GA 3B54A 1FRIA 4M5DB 2KT5A 4FS1A 2IBKA 1UVJA 3CE8A 4RZRA 1MG7A 4OX9J 1JLAA 4I1TA 3CWJA 2V9KA 2XCAA 2W4PA 4ED6A 5HMZA 4ZVTB 3OPKA 2WB4A 3ONQA 2ZHAA 1RKJA 1I94J 3KLHA 1N88A 4RW8A 2Q66A 4DPTA 4Q43A 1FKOA 3BBFA 3G8SA 4O44B 1MMDA 2KYXA 2C2ZB 4UZBA 1S9EB 3RB0A 2RIJA 3W60A 5KFUA 4DPUA 2W2NP 4C2MA 2XMMA 1WD6A 2BW7A 3SCKE 1RGVA 4DS5A 1LFWA 5D77A 4YB6A 5DQIA 2DJWA 1CSJA 3KLFB 3BSAA 2EFPA 2YQ0A 1ZETA 1FWLA 4ANCA 5BR8F 1J5EF 1WHYA 4DX6A 4CLTA 4ED5A 2X3DA 3K17A 2ZOGA 1JLQB 3IRXA 3KK1A 4RL1A 1RXOB 1RT6B 4L76A 4ZLJA 4PG4A 1RWWB 4DHVA 4L72B 1IWAA 2NXCA 3GG0A 3JQMA 5K14A 3GTYX 3KNAA 3SQOP 4RW4A 4EWTA 4C8OA 1PC5A 1GEHA 2DGQA 2ZH3A 2HHSA 3BGFA 5DJBA 3TA1A 3F73A 2XLJA 3BKUA 2LXUA 3BO4A 3H20A 2VFUA 3D28A 5EDWA 4ZVUB 4NXMF 4ETXA 1NEEA 5KFIA 4C98A 3UR0A 2IYGA 1YK9A 4ID5B 1NZAA 3AD8C 1V5IB 3PW4A 1IR0A 1RTIB 3Q8QB 2DISA 1JKHB 5BYSA 1IKXB 1NH8A 4QYRA 1AXQA 3CMQA 4DEZA 2H48B 2CQ3A 3T1HJ 3P4UB 5HATA 4NEZA 1H6KX 1B7YB 1Y7PA 3C6TA 3FZ2A 2J7UA 1F9EB 2GCFA 5DQHA 5C42B 3CD6S 1TKXA 4PXDA 2D7SA 2XULA 5JMNA 1WUUA 4GKJF 3FJ2A 1RLDA 4F36A 2OPSA 2XYPB 1SIWB 3E01A 4RR5A 4U7CA 1HNZJ 1IKVB 1RTHA 2QLWA 1WSVA 2BJ8A 3MEGA 1S1UB 1B0TA 1DY3A 3KJVA 2ZE2A 1I5OB 4PWDB 2YNFB 5BXIA 2MLXA 2YX7A 2MKHA 1X7VA 2MHNA 2BJ1A 4ZLLA 3TA0A 2KRRA 4QQBA 6AT1B 1GQEA 2BA9A 3Q23A 1YX2A 3OJUA 4ETZA 2IPOB 1ZPVA 1K0TA 2ZKUA 3NOGA 4C0HA 2UXDJ 1RB0A 3I9V9 4DU7A 2V69A 4CYUA 3D6TB 2MQQA 4PZVA 4DR1J 3FBEA 5M2PA 4R8UB 1JIHA 2ABYA 3QLHA 4L75A 2W4CA 2AQ4A 4DX5A 3M9OB 2KN4A 4WYWA 2WZ1A 3JYTA 2XZWA 1B70B 4I6WA 5IV3A 2PEHA 3R5DA 5D6GA 4B02A 4QWAA 2W8LA 2IA0A 3LF0A 2X7IA 3MCOA 3AA8A 1N48A 3A13A 2FUG9 5HL7Q 1FJ7A 1SV5A 3I9ZA 3VAIA 3TP2A 3N01A 5CA5A 1JJCB 5K8MA 4GC6A 4XAKA 1OY6A 2UVUA 2DGOA 3GYXB 3H5YA 1BQMA 1WSRA 1AW0A 4IH6A 4Q8FA 1DRZA 1T9TA 4NWBA 1EJ7L 4XDCA 3JAMU 2Y1JA 4DV4J 4DL2A 3NKYA 1P9QC 2VB6A 2YX4A 4DN9A 4JI1J 2V4JB 1PJ7A 1U0HA 3MECA 3IGVA 4MKYA 1NO8A 2NZ4A 2J0QD 3PW5A 1HQUB 2K3IA 2WW8A 4FKYA 2Y1RI 2VF3A 3QSYB 1CULB 3AA9A 3EGZA 1LOUA 1B64A 4P73A 3FSIA 1U2RA 1TFYA 4RBTA 2AYEA 3C6UA 4ECTA 3DDNA 1IJFB 2OFGX 4OV6A 3G87A 1KHVA 1HHTP 4UOCA 1DTQA 1TKZB 1AFJA 5KAKA 5LJ3Y 2HHHJ 6FDRA 3ENWA 2O1PA 2ZE2B 2L9DA 2ZD1A 1P8GA 3A3NB 4RLEA 3RRHA 4FYVB 4R5PA 2AMCB 4OZ1A 1EB0A 1FJGJ 5KFWA 1FO1A 3QJJA 1U1RA 2V2QA 4RW7B 4ZCMA 1IKWA 2ZZMA 2LMIA 3R6GB 1HWLA 2VOOA 5K8NA 2V34A 5D78A 5M2UA 3I31A 4QBUA 1LWFA 1ZS6A 4NX9A 2KFZA 5H9EK 4KB7A 3MZIA 4I2PA 3R5AA 4P71A 4OI3A 3ENQA 2PI5A 2MJUA 4MIBA 4OJ3A 3H2VE 1RQ0A 1C0UA 5KG0A 1PILA 1RWUA 2WVFA 1HNXF 2E5LF 1XERA 1NPPA 4KH0B 4ECWA 1SKSA 4CLKA 1FA0A 1Y10A 1BY9A 2LDYA 1U8WA 1MLAA 1T9VA 3SQGA 1S10A 1GMVA 3NGUA 5CHCB 5DDQC 3HM9A 4KIAA 2DVIA 3ZTOA 4KGVB 1QSLA 2RE1A 3IRWP 3W2WB 2L9NA 2HFSA 2NLWA 2OPQA 6FD1A 5CXTA 4C11B 2NREA 2UUCF 3LAKA 4KTQA 4JV2A 3S01A 3EZUA 3LGNA 1UVIA 4AT1B 3VGTA 4F2SA 3ILOA 3D4JA 2HFOA 2JX2A 3HD2A 3R6LB 1HQEB 2RHQB 1UAWA 4LVNP 2XS2A 3JQKA 1UA0A 2DNYA 2E5IA 3MAAA 5D4OA 2W9CA 3LTOA 3D1HA 2CZVC 4KGZB 2J8AA 4IG0A 5ETOA 1ZTWA 3Q0AA 1ULRA 4UOHA 4DR5F 2OGUA 3BKFA 3SDEA 1VC5A 1HWIA 3HHDA 2XSJB 2N4CA 4I64A 2ZZNA 1U6BA 2F8EX 4CLUA 1N6QA 1FFSB 3P3DA 5F9NA 2DNNA 2RDIA 4ITSA 5HI7A 3D0HE 1Q5VA 2RQ4A 2RSQA 2ZDOA 5IS2A 4BHQA 3UVJA 2VQEJ 2J9DE 2MQNA 3MMCA 3KXDA 4C8YA 1YKWA 1HBUA 4X66F 3TAQA 1EX8A 2WOMA 5LMNJ 4RUAA 4WZQA 3GIJA 2ROGA 2ZKTA 1HL6A 4TQRA 2BKOA 4WIIA 4DL0C 1UFKA 1U1LA 3F41A 1L3TA 4KFBB 1NLKL 2IIHA 2VG5A 2ILZA 1YVFA 4PXCA 3BGRA 1TU0B 3GSIA 2JL9A 3CDWA 4HKQA 1REVA 2RJZA 3KUGA 2IRUA 3G71S 1O51A 4X4OA 5E2QA 2BQ3A 2I38A 2QX0A 2D9PA 2J0WA 2U1AA 3UPFA 1HI0P 2V63A 3LQVA 3M6WA 3SQGB 5F0WA 3PRDA 1A6LA 5H1SV 4Z2XA 2UP1A 3DM2A 1X5TA 3D3BJ 1TKTB 1RDRA 1DFDA 4GMKA 4LBIA 5ETKA 3GWCA 3IBWA 3K59A 3MM8B 2OAUA 3IR6B 3GMGA 3A8KA 2KT2A 2R8IA 1ZM2A 1NM2A 1YJRA 3PFEA 4MK7A 1B7FA 3N5FA 2IRXA 4PYAA 2LU1A 3Q8SB 2V94A 3JB9k 2PA3A 4DDFA 2HVDA 3CJ3A 3L3CA 1MMLA 1OS5A 1U26A 3GIKA 5IV4A 4NLYA 1KN6A 1WOPA 2V8HA 2PMHA 3HDSA 5DG7A 3T41A 3MUMP 4WF9Q 2R7RA 3GFZA 1N56A 3PYEA 5BJRA 2YWFA 4ZPTR 4PCQA 2QZ8A 4OI2A 2EFNA 4B17A 4Y65A 3A3PB 3ZZYA 2FLNA 2H4YB 2DNZA 2GGPA 1LWCB 1Q79A 1UP1A 2QT7A 2M2BA 2E9RX 2PGCA 4DV6F 2AWZA 4I7FB 3PZPA 1RHMB 1H2TZ 4YB7A 4NI2A 2IY5B 5KFAA 3W61A 1FDAA 1W25A 2OEMA 4IFVB 1FKPA 5IT9Y 1U1OA 2W9BB 4RUCA 4B3SF 2G2ZA 3M7VA 4KO0A 3PCOB 5ETMA 4DV3J 4UZCA 2IBOA 5GMEA 1CC8A 3HFVA 4Q0BB 3TYTA 3MEEA 3G6XA 2BE2B 3IXQA 4A46A 4TXSA 1JLGA 1JNZB 4A8XA 4OYBA 3VAGA 3GB0A 3E2EA 1WHVA 5KG2A 2RU3A 2FJDB 4LF5F 4O4RA 3EWGA 5DS7A 2IC3B 3SCIE 3SCJE 4JI4F 4DR7J 1IKYA 2FZKB 4QWEA 1VFJA 2MYFA 4I6YA 4ZVQB 1N36F 4YB1P 2VQFJ 2MZTA 2ZJQQ 4EYHB 1TL4A 2L48A 3BN7A 1OO0B 4JI8J 3EJMA 2Q6BA 1F9FA 1QAJA 2UV8A 1D09B 1R0AA 4WU3A 1IBMJ 5F8NA 1AROP 2FJBB 1YIJS 4H54A 3JTOA 3DKDA 1UA1A 5DLGA 3AD9C 1HW9A 3E3XA 2CUYA 4GO7X 1B3TA 1D9AA 1XR7A 4JUZA 2HNYB 2ZH1A 5KFSA 4WXWA 1Y5NB 4FXWA 1VQKS 3MOJB 3TZXA 2A1BA 2XCPA 2B0GA 2GS8A 4DZDA 2Y1IA 3ENVA 1U25A 1SJ1A 4MIWA 2MGZA 3KK3B 2ZEJA 2QA2A 3TJ9A 3L7UA 3UQSA 2DY9A 2KTQA 3J7ZT 3DMJA 2QIFA 1X4FA 3J7AN 1SKRA 3GYNA 5CYQA 3CVKA 3T5LA 4X2BA 3DOLB 4KSEB 3PYGA 3HFKA 2AX1A 3BB5A 1N5SA 2RT3A 3UN3A 3J7YI 1T05B 3M2RB 2WRMA 4LF7F 1RT5A 2AX0A 2OEJA 4PXBA 5A8KB 1XK8A 3PEJA 4CT8A 2X1AA 3VQTA 4DFMA 1RI7A 2KZZA 5JJBA 2V5HG 4DSIA 4WJBA 2ZBCA 4GKKJ 3LGMA 2QSFA 3VGVA 1VCTA 2XMKA 3EXCX 3QBCA 3CCRS 4LRDA 3B8HA 2B4OA 3DFEA 3MD1A 2OMLA 2YVSA 3ZZTA 3GIRA 3HF5A 1C4AA 2HEKA 4ZP7A 4ECUA 2LQ5A 3TJAA 2KXFA 2N4DA 4ER8A 1VRQC 1UEKA 2A10A 4ZN1A 2K8GA 3HJVA 3N79A 2JFDA 1LWEB 1RISA 2Y8WA 3VWSA 2ILYA 1DLOA 4DFJA 1VOMA 4DQIA 3SCLE 3O3LA 2NS1B 2B8PA 1KTVA 5J1PA 4J9QA 1T95A 1N34J 1VC6A 1SH0A 1QVFR 4DV0J 1R0AB 4KV8A 1HNIB 3W64A 2YH0A 3HJFA 2YKMB 1VRUB 1CVJA 1RT2A 1M0SA 5KFJA 5A6WA 1C4CA 1SL2A 1C1CB 4G1QA 5B0CA 1FE0A 3R5GA 3ZXWA 3Q8RB 1NPKA 1ZM4A 4D3GA 2HQFA 2ZFHA 3MPDA 1U6ZA 2C2OB 1WACA 4AD6A 2G0IA 3NCRA 1HD1A 3M32B 3I55S 2EK1A 3LWMA 2P2CB 3UE2A 5A2QU 3MEDB 2XZDB 2YWWA 4QZVB 4LF8F 2WTFA 3UWTA 4DUTA 2LQ8A 2OJ3A 1HKAA 2UVWA 2XS5A 1NHVA 4DV7J 2VG6A 1AYEA 2B7CB 1S1XB 4K50A 4QYZJ 2QG9B 1FD2A 3HSGA 4AQYJ 2XMTA 3CJKA 4JV5J 4UY8T 3P5TL 4F4YA 1S4EA 4QW8A 4NXNJ 4NZ7A 1FF2A 2H65B 2UVRA 2C3PA 4EO6A 1MROA 1WOOA 3MM5A 4KRWA 3C14A 4LFCF 4OYIA 3FQLA 1N0VC 3BYPA 2N82B 1FWPA 4DLGA 3HVTA 4A8FA 3NNAA 5LSOA 4FBUA 4ILLA 2VODA 5F41A 1UVKA 2WW4A 2QA1A 3KMSA 1RABB 4P2XA 3T6JA 1XWLA 1OIAA 2AD9A 4YY3F 4M1KA 2HIYA 3GCXP 5IM0A 4ERDA 1D9DA 4PPDA 3LALA 4ILMA 2UU9F 4AUKA 4AL5A 2L08A 2AEMA 4F8RA 1YZ7A 1UJ5A 2CYYA 2MPUA 3BZQA 2K2PA 4IOBA 5RUBA 5CZVA 1NKEA 3IM8A 2APOA 4YUDA 1FTRA 1N5QA 2GC8A 2XMJA 3W2VB 2GV1A 5DLFA 1LW0B 3PW0A 2F4VF 1N54B 1VJWA 1MNEA 1VQ5S 3TRGA 2EFOA 3UI3A 4CT9A 3BO2A 1S6PA 1GTHA 3FBFA 4ANDA 5CZXA 5CAAA 5IZHA 1S57A 2OFHX 5I3UB 3KMQA 4DV1J 3QJPA 5FD1A 5IWAF 1S1TA 1KFDA 1RAGB 3KG4A 1RT2B 3HCXA 4LFAJ 2AV5A 1C1BB 1KLMA 2CQBA 1TUVA 2LU2A 2AGQA 1G7CB 2JOQA 4J7CA 4CO1A 4FF3A 4USUA 4X64F 1VRTA 2VC1A 4MIAA 1U09A 4K4VA 2KG0A 1F5CA 4OZJA 5DETA 3HSJA 4IOAQ 1EP4A 3AH6A 3TZWA 4CQ1A 3T1YJ 4LFBJ 2JJ4D 2CQCA 2RRBA 3QIPA 4BC7A 1GXUA 3WIUA 4X4VA 2KG1A 4F3OA 3HZGA 1M1KT 2HKEA 3GQCA 4EMDA 3GCWP 4U9RA 4CWBA 1N5YA 1S59A 4DS4A 3PRVA 2XNQA 4OLPA 2Z2LA 3WX4A 3KJQB 1FERA 4W90B 2MSSA 3FFIA 2X1FA 1R43A 3P49B 3DYAA 4HLBA 3SI8A 2H4WB 3TA2A 2KFNA 2DR7A 1I51B 4CI0B 4JP8A 4BWJA 5BYQA 4OJHA 4KH1B 5GAHI 1F2HA 1OY8A 4LIWA 2IM0A 5T7LA 1ZTTA 1SQFA 5E3QA 3MXHP 4O3RA 4JYAJ 4DUZF 3V6JA 1TV6B 3CCWA 2MKIA 3WHIA 1U1PA 4K0KJ 4WFBQ 4N7TA 4Q7AA 2RRNA 1ZBTA 3M05A 3R97A 4P75A 3ZTQA 2ZH6A 2R2RA 2IRYA 1L3SA 3FSYA 3MFHA 2FVPA 1FEEA 2ROPA 3KFWX 1BUXA 3VCDA 3K8WA 2H3EB 2WVDA 2KHDA 4TKTA 4OIXA 1S6PB 3FCHA 3MMJA 3CC4S 2XHWA 3L4BC 2CJKA 2OPPA 1R3NA 3EXYA 3M8SA 1JNRB 5IC6B 3NMRA 1T11A 1S1VA 1V3RA 1RTJB 4YR3A 1FRLA 1V3SA 1RAEB 5B0AA 1ZZNA 4Q2LA 1XTZA 5AJ3J 5DGAA 5K20B 3OV7A 1NB7A 3LPYA 1Q81T 3BSOA 3ILJA 1WC1A 4J90A 3U02A 5J2NB 4ANEA 2OTJS 5E5NA 1M1HA 3X1LB 4ZVRB 2ZWPA 4TLRA 2RQCA 5C7PA 3PO4A 1NK6A 3G82A 2HSEB 1RHUB 3DLKA 5THWA 4WFZA 3BO3A 1Q78A 2M4MA 1GX5A 4JBCA 4WFYA 1GH8A 1JXVA 1K1QA 3RRKA 4C0OC 4ZCKA 2F65A 3TAPA 3A4TA 1WTFA 5D0GA 3ILIA 2HHQA 4ED2A 1X5OA 2B4PA 2IHR1 3R7NB 2YBVA 1NB2A 2DR6A 3CDAA 3N9UC 2B5JA 3KDNA 1HPZA 2AGOA 1MN7A 1VBYA 1H73A 3Q8PB 1PYTA 3KLGA 1R8CA 1I6JA 4AFFA 2RD5C 2QTWA 1UKUA 2XZTB 3RG6A 4ELVA 3J7A1 3R2CJ 5KFZA 1HNWF 1LWXA 3M8RA 1OYEA 5GVQA 2QA4G 3GR1A 4QIFA 2JEIA 3OQ2A 4PG7A 3TUJC 1GNKA 1HBNA 2AT1B 3FUYA 1DBDA 3BKTA 3FVYA 3QZ7A 4NLDA 2GJIA 4G1PA 1LW2A 1WC6A 2I0XA 2C28A 4OI6A 2R7TA 4J5OA 1HBMA 2R2SA 2G0JA 4ZLPA 3W5YA 3LP0B 3IBFB 2C22A 2UXDF 3DOKB 1XMOF 3NGDA 2VDIA 4USIA 3KLIB 4HACA 3W9IA 3ETMA 1R0BG 1RAHB 5KG6A 1YI2S 3MPVA 2ZM6J 1G1XA 4X4NA 3L09A 1S7HA 1S1VB 4B3OA 3UCUP 4JB8B 5E3CA 2G13A 2HBRB 5D4LA 2PMZD 3G8QA 4NASA 5J1EB 1RAOA 4O23A 5I3QA 2J0XA 5DQGA 2UUAF 1WF2A 1RK8A 2JVOA 1ZOTA 2HHVA 3OUYB 1SH3A 4GO5X 3M6XA 5D8HB 2CPIA 5J2MB 3BEGB 4NLVA 1BC6A 1JWWA 1ACMB 2MLZA 3B78A 4OJ1A 2CJBA 1H72C 1WC3A 2FDNA 3M1VB 2LCWA 1V5VA 4QU7A 2R42A 1S9GA 2GZOA 3OTCA 2N7YA 4BDPA 3WC0A 2I5JB 1YJNS 1NAQA 3TAMA 2J76E 4QWCA 2JEGA 5D0HA 3R7BB 4KHPJ 2KU7A 4O4GA 1F60B 2ZBPA 1XNQJ 5A8RA 3KLGB 4PUOA 3UDEA 2PIIA 4CLWA 5HMYA 2ZHOA 2IMOA 2MY8A 3LP1A 1R31A 5KOXA 4CP5A 5LXYA 4KPCA 4H4MA 2DD8S 1HMVA 3BF4A 4PQAA 1RYSA 4A8OA 5CCLA 4ZDNA 5K9FA 4A4JA 4IKAA 1Q8IA 4ENOA 1S0VA 1VGYA 2R8HA 3EICA 3OR2B 4ID8A 2JEFA 1HBNB 1VQ9S 4A8SA 4DR4J 3DRPB 5IXUA 1EETA 4UUXA 2NXNA 3CF5Q 2MEWA 3GILA 3A8EA 2GVDA 3NXZA 2HAIA 1Y00A 2JLFA 4WFXA 4GVBA 1F6TA 2GIFA 4WFNQ 3VAJA 1RA6A 3T1AA 2RDJA 4BLGA 3V6DB 3K57A 4J9LA 4BBYA 4K5RA 2IDLA 1AZSB 2CVEA 5DM7Q 1SJ3P 4YOEA 5C2GA 2DRDA 3BGLA 2HVIA 2RF2A 1DHMA 1CJTB 3RU0A 2HVHA 3NBPB 2DCUB 3SFUA 2CNLB 3C19A 2XY6A 3ILLA 4Y3CA 1S4FA 1FK9A 2Y9HA 3D54A 3FMBA 3P8BB 3OTOJ 1DZ5A 4V19J 1KD1T 3W9JA 2CQ4A 3U1LA 4CO0A 2EFQA 3FKBA 1N5TA 1KSPA 4C0BA 1XIQA 4XO0A 2YNGB 3AXMA 3SBMA 2OI2A 3QQCD 2HAFA 3P45B 3ZTSA 4Y2AA 1RT4A 2R3VA 1S9GB 3C16B 4DR2J 5FLXU 3TI0A 5HROA 1T94A 1T3OA 3TAMB 5E3AA 3N5BA 2UUTA 5KFEA 2LVWA 3T5JA 3CJ5A 3ADAC 4M5LA 3PX4A 1HA1A 1YJVA 2H9ZA 5HLFB 1IBCB 2XWYA 5ETQA 2WONA 3QIDA 4MTPA 5F0UA 1VQYA 3AT1B 3EMTA 4B9TA 3CCLS 3UNYA 1HI1A 2F9JA 2HHTA 2MSTA 2V0NA 2HMIB 3QT6A 1RHRB 1Y11A 2DIUA 1K44A 1HMVB 5HBMB 2VUGA 4FNHA 3C66A 2WHOA 1UL3A 4JOUA 3S7RA 4LRBA 1O0PA 2ERRA 4P2MA 2I1RA 2J0SD 1C0TB 4LF4F 3R7SB 4K4YA 4CLLA 4JV0A 4MFBA 3D6FB 5KT7A 1WHXA 2FZGB 3AD7C 4NMXA 3KHHA 2IMWP 2V8VA 2QLBB 3G2XA 4LF9F 4WKRA 2DITA 4Y28C 3NGKA 3BQ1A 2GVDB 3L7PA 5LMNF 1IR1A 3DXSX 2AYBA 2AYMA 4F02A 2R7WA 2OHDA 2F3JA 3FSXA 2EPIA 2CAJA 2RUGA 1X4DA 5L38A 4QW9A 3HHLD 3IFEA 1UWBA 5KFBA 2EC0A 4CH0S 5BYRA 1RCOB 1X4CA 2EC2A 1SC6A 3OVBA 3CJ8A 4DQRA 2BABA 1SJQA 3FEXB 3J80U 4CRJA 2VD3A 3DHXA 9RUBA 1OJ4A 4JI6J 1EAYC 4DBQA 1WDDA 3D5MA 1Q5YA 3N28A 1KKHA 2BQRA 4DSFA 3BREA 3R9LA 2QEXS 3LUYA 2NXEA 3MMAA 3WX8A 4F3QA 1L5UA 4EZ9A 3H2UB 2DR8A 2LA6A 4J37A 3THPA 3GSDA 1NSPA 2XTJP 3DDIA 2P9CA 1JLBA 3M2VB 4YHHJ 4F25A 3PXGa 4ZPAA 1N8RT 3DGVA 1KFSA 3CIZA 3UO0A 1HR0J 5SUHA 2HNZA 5AXLA 4W92B 5C24A 3T5HA 3QRRA 1LNQA 1YBUA 4I68A 2XI2A 5LL6d 2GVZA 4RW9B 4ZP9A 2M0GB 3IS9B 4N47A 3HLUA 1KEKA 3L9ZA 2KRBA 2O3DA 4DPWA 3PIOQ 2CQGA 4F4WA 1AUDA 2MJNA 3W65A 4ZP8A 3IP0A 2HIQA 1QE1A 2VG7B 3WC2A 4IRDA 3A1YG 2G1DA 1G4CA 2NQPA 5HVFA 2VC0A 2Q79A 1XJWB 3MUVP 3BQ0A 1MWYA 4U96A 3H42A 2M8DB 2RB7A 4JV1A 3AY0A 1S5ZA 4OZ2A 4OJGA 1KONA 4WBFA 2IVYA 3CD5A 3Q22A 5J2QB 5I4MA 3L7OA 1KWMA 3AB2B 2GA7A 1JLFA 4WTYA 2IA6A 2GHVC 4J9MA 1MWQA 2ADBA 5KFXA 5BR8J 1QUVA 1WKLA 2ZBRA 4F50A 4NRUA 2NSCA 3VTIA 1NK8A 3IG1A 3GV5B 2NCKL 1YITS 1F3VA 4FPRA 4Y2MA 4QYZK 2W8KA 4AXJA 4UOGA 3K2YA 4XPCA 1X5PA 4AL7A 2YKNB 2RAQA 4NXMJ 1IQTA 1TUGB 3NLCA 5HK4A 1K1SA 2Y3YA 2BYCA 3HZEA 5B0GA 2D74B 4CH7A 3TNVA 1U1MA 2CQPA 2QLJB 3RJMB 3TUIC 2CPEA 4YEAA 1MU2B 4P6QA 4OL8A 3H4BA 2GFFA 2YNIA 1X5SA 3QMQA 4LSLB 4ICLB 3MMBA 3MM7B 3A3OB 2DO4A 5C24B 4R0EA 5K8OA 3PW7A 1N4LA 2MLYA 1R6VA 2LEAA 1SKWA 4IDKA 3GFYA 2BJEA 3PV8A 2BM1A 1Z2ZA 2YQ1A 1FRJA 2EBEA 3J7YU 3MEKA 2ZC3A 3E51A 4MH8A 1RACB 2P6SA 4ED0A 1CJKA 4OI4A 2F9DA 1T0TV 3SSRA 1BE4A 1WC5A 3J81U 3AJDA 4O3PA 3BQ2A 3WDOA 1S6QB 2XS7A 2J9EA 1YJ7A 3BH6B 3CSKA 2IJRA 5B09A 3MFIA 4P74A 2BMBA 3HPOA 1NHUA 3M8PA 2NXUA 1DAXA 4F7VA 3RBDA 1CEZA 2XMAA 2X1GA 1DQ8A 1HBOB 3OVAA 4XTTA 2FGOA 3KUHA 1NXIA 3RZAA 3DLEB 2HBYB 3NOCA 1PYSB 3GPAA 1HIYA 4OYWA 2QFJA 2YNHB 2B43A 3PX0A 2HWIA 2ZBQA 3RW6A 1IQZA 4RW6A 3DGPA 4QPXA 1JXLA 4ZJQA 3CCES 4ED3A 2XI3A 4PQUA 2DK2A 4H4KA 2N3LA 1VBKA 5KT3A 1AT1B 2CG8A 5F9LA 3PTWA 5GMDA 3RYLA 3VVTA 2GQQA 1JLCA 4ECVA 5EN1A 4WE1B 1KR4A 1Q8KA 2AJ2A
chains in the Genus database with same CATH topology
3N4WA 4Q5VA 5F8GA 2VG7A 3UQSA 1XR6A 4J9NA 4DV0F 4KFBA 2KTQA 4DFKA 2ERRA 1SIZA 3VAMA 2PI4A 2VONA 2GO9A 2XB2D 2FJEB 4N8OA 2VKRA 3J7ZT 3DMJA 3THVA 4RNHA 4A48A 1S1TB 2QIFA 2GW8A 1Q4RA 2LQ9A 4K5SA 5KFLA 1S9FA 1X4FA 2LEBA 5KFQA 1RT3B 3FQKA 3MM6B 2L3MA 2IVMA 1RP5A 1U4BA 1SKRA 3GYNA 3IWXA 4F26A 1KLMB 4C8KA 1YJ9S 5CYQA 2YTCA 3CVKA 3T5LA 3CXCR 1X9SA 1TR0A 2HGLA 3AAWB 3DOLB 4KSEB 4X4PA 4X2BA 3HFKA 4CTAB 2AX1A 2COLA 1VQ8S 2E9TA 3BB5A 3GE9A 1F5AA 5J2QA 4KBIA 2N7CA 1JK9B 3RW7A 1VQMS 3MUTP 2GO8A 1N5SA 2RT3A 2XMVA 1VRTB 2AF6A 2F40A 3T3FA 1KC8T 2WBMA 3MAHA 3M8QB 3J7YI 2ZH9A 1S97A 1T05B 3M2RB 3LAMA 2KFYA 5FDLB 1FJEB 2WRMA 4NA1A 4DUYF 1XR5A 3BSNA 1WG4A 4LF7F 2LEPA 5DDRC 2XG8A 1RT5A 2AX0A 2W7PA 4PXBA 5A8KB 2E1MC 3QO9A 1XK8A 3NAHA 4P7VA 1FHTA 1N52B 2M9KA 4IUFA 3TOQA 4KHMA 3ITHB 1TKTA 2HNDB 3PEJA 4I4BA 3CCJS 1P1LA 4CO5A 1EP4B 2F8MA 1O8BA 2KJVA 1VQOS 2UVVA 4CT8A 1FRKA 2X1AA 2LYVA 1F5BA 1R89A 3KK2A 3BN4A 3K5MA 2ZH5A 2AJ1A 3QIPB 2PSZA 3VQTA 4DFMA 2K1RB 3I96A 1RI7A 3MM8A 4Z37A 2HS0A 2KZZA 2Q1LA 1HI8A 5JJBA 2R8GA 2V5HG 2R8JA 3MWBA 4X84A 4DSIA 2E9ZA 1Y0HA 4WJBA 3DLLQ 5T41A 3CIMA 3CGIA 4ZS6A 4DV7F 1FRXA 1WELA 2NUUG 2ZBCA 3MD3A 3MM9B 4NYOA 3FMWA 5L39A 1E6VB 2DGXA 1N5YB 4Y34A 2ZM6F 3RB3A 1X4BA 2QSFA 3LGMA 1TVRB 3H2LA 2XMKA 3EXCX 1T03B 3CCRS 2LQBA 2A2CA 5GAGU 3B8HA 2B4OA 3DFEA 2NPFA 3HHLB 4N77A 2ADCA 4PRFA 4FVMA 2AJFE 3CJ0A 1RTDA 4IG3B 3MD1A 5IQQA 3FFIB 2OMLA 4KE5A 4JI3F 1YJTA 2FHKA 2G9OA 2M52A 2Y0SD 4U67Q 3OR1B 3CDEA 4CIOA 2KFZA 2YVSA 3ZZTA 3HF5A 3DYAB 4G6VB 3HK2A 1C4AA 5EWEA 4B9SA 2HHPA 1WEZA 4ZP7A 5A6PA 3KHGA 4ECUA 1HD0A 3KLEB 2LQ5A 1M5PC 2HFZA 2KXFA 4M95A 2YKNA 5D3GB 3T1HF 3PY8A 2N4DA 4DOZA 5I42B 3G9CA 4IH7A 1OSDA 2A10A 2QRRA 4AL6A 5DGBA 2K8GA 3T9NA 3OHBA 1NK7A 3N79A 5AE1A 2JFDA 1U48A 1BQNA 1LWEB 1S1WA 1H7WA 2R2UA 1RISA 2KM8B 5T7LB 2PD1A 1L3VA 4OZNA 3VWSA